3I5DA

Crystal structure of the atp-gated p2x4 ion channel in the closed, apo state at 3.5 angstroms (r3)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
324
structure length
324
Chain Sequence
RFTQALVIAYVIGYVCVYNKGYQDTDTVLSSVTTKVKGIALTNTSELGERIWDVADYIIPPQEDGSFFVLTNMIITTNQTQSKCAENPTPASTCTSHRDCKRGFNDARGDGVRTGRCVSYSASVKTCEVLSWCPLEKIVDPPNPPLLADAENFTVLIKNNIRYPKFNFNKRNILPNINSSYLTHCVFSRKTDPDCPIFRLGDIVGEAEEDFQIMAVRGGVMGVQIRWDCDLDMPQSWCVPRYTFRRLDNKDPDNNVAPGYNFRFAKYYKNSDGTETRTLIKGYGIRFDVMVFGQAGKFNIIPTLLNIGAGLALLGLVNVICDWI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P2X purinoceptor
publication title Crystal structure of the ATP-gated P2X(4) ion channel in the closed state.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transport protein
total genus 60
structure length 324
sequence length 324
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.940 Mainly Alpha Orthogonal Bundle Helix Hairpins atp-gated p2x4 ion channel 3i5dA01
2.60.490.10 Mainly Beta Sandwich atp-gated p2x4 ion channel fold atp-gated p2x4 ion channel domain 3i5dA02
3H9VA 4DW0A 4DW1A 3I5DA
chains in the Genus database with same CATH superfamily
3HKBA 4WFHA 2IJJA 1RPRA 4O4JB 1R3JC 2AGAA 1ZWIC 1ZAUA 2ATKC 4JAAA 4TOIA 1D5AA 2QWPB 3X2QB 4X1YA 1H38A 1M9NA 1YXBA 4AILC 4DV0O 2EIMB 5LXTB 2P4VA 2ZQMA 1MSDA 2QDOA 1IXBA 1VQOV 4DW1A 2JS5A 4X89A 2B1IA 1TVKA 4DV7O 4JI0O 3K5OA 1L1FA 5CBFA 2F93B 1KYOF 3DXRA 4X1KA 1QVGU 5J2TA 4U7OA 3RFRA 3AK2A 1KBHA 3CCSV 2RN9A 4MVMA 1OCZB 2CDYA 4BIUA 1VF5B 2LP7A 1MOFA 4BW9A 2DYSC 3SPJA 2IU3A 3B4SA 1PKXA 4JI0B 2EINC 4WFEA 4KP4A 2R9IA 4L87A 4TUYA 2VQFO 4NTXA 4R6ZA 4UXNA 5L3GA 4JYAO 5L3FA 4Q20A 2GSMB 4FLVA 2A0LA 3GWOA 2N74A 5LYJA 4FLZA 1M90W 4R8CA 3G6BA 3RYIB 4K35A 5IY5C 3ZRWA 2D3OW 2P6JA 3UM7A 4LH6A 5JJJB 2FB5A 1N32O 3CCRV 5B5EZ 4O2BA 3ZX6A 2CTRA 2JK5C 2ETNA 4DV2O 1ZTEA 5FLXN 1AI7A 3FKSG 2VQFB 3CCVV 1AJQA 1VQ4V 1AI4A 1TUEB 4RWUA 3OEHG 3I56V 4JYAB 4I55B 1B06A 1K9MW 1Y66A 2YS8A 4CC5A 1Z5VA 2YI8A 5LHGA 5J2UA 3JD4A 2QSAA 4NXNO 4JI6O 3E8GA 3FAVB 3G67A 2PYJA 1NI8A 2ARHA 1P4RA 3R65A 1JFFB 2BTQB 1N32B 4CC6A 1I94O 3JD3A 4DV2B 1MA1A 4O4HA 3FFQA 1VARA 2JIZG 2Q7GA 2YIBA 4UCRA 2QKAA 3CRCA 3CCLV 4HBNA 2XUMA 3CCEV 4DK1A 4AQYB 2QA4V 3HKCB 2GTAA 2BOCC 3OTOO 3ZRVA 5B1AC 4OXSA 3JALB 1OZ0A 1IX9A 4NXNB 4JI6B 1ZUQA 5JWPA 1NVPB 4X64B 1XBLA 3CHXA 2B9ZA 3VBBA 1KECA 1HNXO 1CP9A 4FM0A 2IJKA 2H3OA 2VQEO 3THOA 3L9DA 1WNSA 2DJVA 4LF7O 2F43G 2ZXWC 4GUNA 3RVYA 4Z1MG 4XDKA 1XMQO 1Q81W 1DK1A 1NBMG 4QE9A 3UCSC 1S0VA 2OTLV 4B08A 4LFBO 4PA6A 5LOVB 3ASNC 1BT8A 1HNXB 1H8EG 3A0HZ 3QTCA 4J7KA 2VQEB 2IU0A 1XMOO 3JAKA 3F5WC 4LF7B 2ZE5A 2MW2B 1XMQB 3E35A 1AVMA 3J7AU 3WG7B 1GN3A 4MT8A 1GM7A 4LFBB 1KMIZ 3ZS8C 4KXRA 4H33A 1WLEA 1GO3F 4I4TA 4YJ2B 4IL6Z 2EZOA 4FLYA 2A9HA 1NR7A 1X59A 1XMOB 3E8FA 1AI5A 1FFXB 5BZBA 1EN4A 1S3JA 4MVZA 4LBEC 2EJRA 1R73A 4X66O 4FIPC 4LFCO 5BMVA 4JZGA 4NTYA 3Q4HB 2Q67A 4B3TO 3TXQA 4QIWF 3D3IA 3FD9A 1I08A 3HPLC 4MTGA 2A7WA 3N2GB 1ZL8B 4JI4O 4CH3A 5B1OA 4HNAA 3AG1B 1QVFU 2ZD9A 1R1BA 2MK3A 5KHKA 3JCZA 3IC9A 2A79B 3D36A 5GONB 4X1IB 4NVPA 1HW7A 4QE7A 3LNNA 4QPKA 3OR7C 3K06A 4X66B 4LFCB 4UVBA 4H37A 4I0XA 1XUQA 1BGYH 3D36C 1KC8W 1P7GA 3FYEB 4JI4B 2EIKB 3DSQA 1FYJA 4GKKO 2FTKA 3JCUZ 1VQKV 5JVDA 2WLLB 4EB6B 3ETEA 3L71H 2EULA 2UXDO 1M57C 5DN6G 1I7FA 4J9YB 3CMEV 2IBZH 4DR5O 3CRQA 1WA8A 3W7SA 3OTFA 3N2KB 1FXKA 3OGCC 5IE9A 2H94A 2YIAA 4JGSA 1G6UA 3OE7G 1YSCA 3MHSC 1BQ0A 4GKKB 1VQPV 4CH4A 1VIBA 1QLEC 3ZMTA 3ZN0A 2E3CA 4A5UB 1UJWB 1FXKC 1H2NA 5EIBC 2E75B 5CB4B 2UXDB 4O2AA 3H1IH 4UCUA 4O4LB 3CYOA 2PTMA 4PJ0Z 2EILB 1M93A 5F2VO 4DR5B 2WLNA 3BFRA 5IDJA 3BABA 2BSKA 2VWKA 5LP6A 3PJSK 1GKFA 1WB7A 2UU9B 1GH6A 4JV5O 1AR5A 2UUCO 5EC1C 2OYQA 4DRXB 2Q7EA 4JI1O 4DXWA 2NR5A 1HDJA 1N34O 5KAFZ 5IJ9A 3JASA 4GX1A 1Y74A 5KMGB 5GW7A 1DLBA 4DYLA 3K5LA 2JRIA 3HKBB 4P9OA 1WAZA 1S5JA 4PDRA 1TA8A 2CUGA 1OCRC 1YJNV 1T5EA 1JCHA 1SESA 2Y4UA 5CA3A 1AP5A 3LSSA 4MW3A 2ZNIA 5HFMA 2FL4A 4CS2A 1SRYA 1JOYA 4JI8O 4JV5B 2UUCB 2Q9LA 3A2FA 2QTOA 3ABLC 4X1YB 5FL7G 2D2CB 4ICGA 2OCHA 1L0LH 3MDSA 2P06A 2IJHA 5CA1B 1TVKB 1S77D 1XNRO 1EZJA 3CC2V 1DF5A 5IYBO 1Z5WA 4PA3A 4EFEA 1FAFA 4F6RA 5IYZA 4JYBA 5HFLA 2R9AA 3DXRB 3SJCC 3LUTB 2DYSB 1P7BA 4X1KB 1NKDA 2DN9A 2NLJC 5J2TB 3FB6C 2EINB 2CGOA 1K8AW 5EBLC 1VQ9V 1E79G 3JATA 2M6YA 1ORQC 2HKOA 3CX5F 1XNRB 5DEDA 3H1JH 2KSDA 4Z2WA 1JJ2U 2DWEC 1QNMA 2LO1A 4QJFB 5IY5B 4OPAA 2YEVB 4TUYB 4X62O 3ZHSA 2XAFA 4ZHQA 3RW0A 2ZCEA 5J9PC 3HKDA 1VF6A 2AZ2A 4W4LA 4OGQB 4TV9A 1XOUA 2RMKB 4MTXA 1AP6A 3G4SV 3ZRWB 3AK3A 4GT1A 5K1XA 1GN4A 1VF6C 1J5EO 2E76B 2QE7G 3ZBHA 4D7TA 3SDLA 1Z2GA 5CBHA 2ADQB 3UKMA 2WLKA 3QG5A 1XHZA 5LA6A 2X6BA 4IIJA 1PPJH 2O57A 4WFGA 3ZCCA 2YXYA 4JI2O 4ZBMA 5J2UB 1AB3A 1EFRG 1URFA 2LW1A 5IT9N 1MZFA 1YIJV 1YDXA 4CS3A 1J5EB 2HFEC 4JTAB 1QHTA 3K79A 4PDMA 1VQMV 2YXLA 4TV8A 4O4HB 5B1AB 3UT5A 1L0NH 3ZMUA 3A0RA 4FLUA 4QPJA 3KCXA 4I9QA 2JGUA 3H1HH 2X7RB 4UB6Z 2ITDC 4FVMA 4Q6GA 3CXHF 4DR4O 4DR7O 4J41A 2ZKOA 2IM9A 4FZ1A 5B1BB 3RT3C 4JI2B 5K1PA 3K59A 4LNUA 1QR8A 2KQXA 2YIDA 1AJNA 3ZHVA 1YVWA 4LF4O 4MTOA 3ZHRA 1FPOA 3AG2C 1R3LC 1M1KW 1QCEA 4WCEV 4MSWC 1SQBH 1A32A 4PHZA 3FYIB 5DECA 3RBZA 3ZRSA 4DR7B 4DR4B 1BS3A 4P30A 1Y4MA 3SR2C 3GWKC 1U96A 4MTFA 1SQXH 3ASNB 1RFYA 1COWG 4B7EA 4LF4B 1L8DA 1IXMA 1K73W 3L70H 4FFKA 4DV0B 3OW2U 3CPWU 1VQ5V 4YIPA 1QR9A 2Q69A 3T1CA 1WP7A 1GK9A 3B77A 4DV7B 2DW4A 1BZKA 3S3WA 1VQ6V 3SPIA 1HR0O 2XAHA 3JAKB 1NTMH 4CZZA 1WB8A 4XDLA 2PGGA 2PI5A 3RVZA 3VQWA 4EFBA 1F4NA 2ZNJA 1F51A 3L73H 3K04A 4DUZO 5FNVA 2UUBO 1KUQA 3JAWB 5L3CA 4JYCA 2K1EA 2LFSA 3SYQA 2IH3C 1RP3B 3ZIAG 2WWWA 4I4TB 4JI5O 2YICA 2X6CA 3UO3A 1Q6UA 4RQEA 2K9PA 2FMLA 1HR0B 4IGGA 2KKWA 1E1RG 2YIBD 4E2LA 1SF9A 1Y6XA 5LGUA 2WSSG 1IVSA 4MW8A 3JSNA 5GTHZ 2EJ7A 2EIJC 3WB2A 2PI4A 4DUZB 1RM1B 2Y0PA 4F4LA 2UUBB 2JJ1G 2C2AA 5B1NA 2QKCA 3B2EE 4JI5B 4BWAA 4HZ3A 5KHIA 4HNAB 1H8HG 1YHQV 4O4IA 5LHIA 1OCCC 5FPOA 2JS3A 1NR1A 1ZX3A 1G1XB 1V54C 1XILA 1PNKA 4U7NA 3DC6A 2HLDG 3CE2A 5A9GA 3QO5A 4B7KA 1GAXA 5EBMC 4I0XB 4K0KO 4GKJO 2HEPA 3OFNG 4PDLA 3K9AA 2CTQA 4KUMA 3IAYA 1FJGO 1O9GA 4JYYA 3CCJV 5LGTA 2LFRA 4G28B 3K57A 5JVDB 1I94B 1I5YA 3E8BA 3P30A 1SKVA 4RUFA 4TQFA 3M7MX 4DR1O 3F7YC 5CA0A 5IJ0A 1I0HA 1XREA 1BMFG 1K3EA 3BEHA 1WA8B 1BL8A 5EYPB 2LQTA 3OTOB 3K03A 1QLEB 1FXKB 1AR1B 4GKJB 4K0KB 3DGEA 3MAQA 3ZHTA 3SPGA 4QGPA 3CD6V 5JH7A 3CMAV 2Q73A 3RWRD 1QBZA 1H2SB 2OIGA 2E5LO 4LWSA 4UV9A 1CEZA 4O2AB 2EIMC 4DR1B 5B3SC 1VQNV 1M56C 2Y69C 2ZR3A 3T2MA 2P5OA 2BSKB 1IBLO 1JJOA 5LP6B 3K0DA 1GM8A 1G8MA 4DK0A 3APQA 3CJHA 4KHPO 4RO2A 4UFZA 5KHJA 3EHBB 3AEIA 1I5XA 3R66A 1P49A 5LMNO 4NKGB 2E5LB 4DV3O 1P84F 1LR1A 1OCRB 1W0KG 5JQGA 1MG1A 3HKEA 3I5DA 2CTPA 2QWQB 4X88A 5KAIZ 4DO2A 1OHHG 1PM9A 5CN0A 5IJ9B 1S72V 3CEIA 3JASB 1QLNA 1Y74B 1UFIA 1S5LZ 3ABLB 5ITZA 2Q4PA 5LMUO 1CPYA 3RYIA 2RNBA 2NNUA 1XL4A 4KHPB 1ZSPA 5EC2C 3W7UA 4XBFA 3OMAB 3CCQV 5LMNB 1N0JA 2M7WA 3IFXA 4R50A 4I50A 1F7YA 4FFBA 4UCTA 2G38A 3KZIZ 3OMIB 3ABKB 3FB8C 1B04A 1X4TA 2PF4E 4I55A 1YJWV 2UXXA 2RQ6A 3W7WA 1FXVA 3LDDA 4WBNA 4RQFA 1JQ0A 1HNZO 1N36O 5LMUB 2AHZA 4GLXA 3LDCA 4PI2A 4X20A 2UXBO 4B3RO 5IYZB 3D8CA 1VQLV 2L6LA 2X0LA 4DV4O 4B3TB 1PV0A 3F7VC 3BPZA 1RPOA 5H9CA 5EIBD 2VRZA 2QTSA 3TETA 2QWOB 3K5MA 1G4YB 4LC1A 2WPDG 1SETA 4IHJA 4LFAO 4DV1O 2YC0A 4LF5O 4FPPA 3SPHA 4GX5A 3JATB 4GCZA 3JARA 4I5SA 3U0ZA 3RYFB 1HNZB 5H6QA 4QNHB 1N36B 3P3NA 4W4KA 3JALA 3P3PA 4ZHQB 3C90A 2PZSA 3HKDB 2FKXA 4C7UA 3IC7A 4DV4B 3JD0A 1TUBA 2H8PC 3ICXA 1WJZA 2UXNA 4KL1A 4FLWA 4TT3G 2OTJV 2GUZA 3E22A 3A0BZ 1NJIW 4DV1B 1YI2V 3WB1A 1F4MA 3KCYA 2A06H 2EBOA 3FB7C 1RSOA 4NR1A 4U3FH 1EN6A 3W7XA 4P9PA 1DTOA 3ZMVA 5D5PA 1SC5B 5LA6B 1Q82W 4E4EA 5H6RA 1WPXA 3AG3C 4IIJB 2ODMA 3O65A 4PA7A 1R6NA 2WAMA 4AHCA 1Q6IA 3PN1A 2QEXV 4DV5O 4LF9O 3GB7C 4X9QA 5IWAO 4TV8B 1QQCA 1ROPA 1HNWO 1V55C 2XAJA 1W2BU 1KP2A 2HJDA 1SQFA 4K8ZA 3AG2B 2OIEA 4LR3A 4YIOA 4IT5A 2X6AA 1YEWA 3H01A 4LNUB 5C93A 2CH7A 4G2KA 4JI1B 3RGBA 1OCOC 4ABMA 2HVKC 4DV5B 4LF9B 2JGDA 5IWAB 1N34B 4NXMO 3ZN1A 1HNWB 5KHHA 4J7JA 1Q90D 3OEEG 4ZKIA 1KD1W 3OUFA 2ZE8A 1GTOA 1JR9A 2VWJA 1HWYA 3QVNA 4L8JA 2PUSA 2JJ2G 3NR7A 2Z5UA 3U11A 3ETDA 1BE3H 3N2GA 1GMGA 4JI8B 2Q5ZA 5D5QA 1K92A 3TK1A 1XNQO 3OAAG 2AZ0A 2YDEA 1B3QA 4K3AA 4NYKA 1KP3A 1PL0A 1FS0G 1IZ3A 2AHYA 4BR6A 5C8YA 3STLC 1VEWA 2Q0AA 3ZJZA 1N33O 2R70A 2JEXA 1PD3A 4N21A 5KX5A 3E83A 4KFMA 4TWKA 3QO8A 5E1AC 3O9OA 1THZA 4LF6O 4CBCA 1MNGA 3OMNB 5KUMA 2WLLA 1XNQB 4BW5A 2Y4TA 2GHYA 5LYJB 5FNVB 1J95A 1PNLA 2ZE6A 2VS0A 4YJ3A 4UCVA 1YTFD 3G80A 4J11A 5E79Z 3TJTA 2WA3A 4O2BB 1N33B 1SQVH 3APOA 2EIJB 3FB5C 3LDEA 2FYUH 2YI9A 3TCUA 2CGNA 3T4ZA 4X62B 3BCCH 4ZOLA 4LF6B 2Q6AA 1OJHA 3SGIA 3OT7A 3CCMV 1TGOA 4JI7O 4WFFA 4FLXA 5CB4A 4UB8Z 3C3TA 1QU7A 1V54B 3IGAC 2ADPA 4PDVA 4DR3O 1XHXA 4YY3O 2PY5A 1FXHA 2ZE7A 4TQDA 3ETGA 4O4IB 1SA0A 3L75H 1VQ8V 4UCOA 5JCOA 2UXCO 3ZMSA 3E86A 5JJEB 3JD2A 2QJ1A 1BHAA 4PD4F 1AROP 5H2FZ 4NTWA 1YF2A 2RCVA 1NS1A 3BRCA 3G71V 3BA9A 3ZRXA 1WPBA 5JCOC 4DR3B 2LGQA 1XL6A 3T1YO 3L74H 3RYHA 1Y76A 2ILMA 5LL6Y 4PV1B 2DE0X 2GDSA 2ZXWB 5LHHA 4GYCB 5CA0B 5IJ0B 2UXCB 5EZYA 2DWDC 4IYIA 1Q5OA 1KU9A 2LGWA 3BAAA 3CC7V 2WA4A 2BCCH 3QF7A 4RAIA 4D7SA 4FMTA 1YITV 1HP8A 4H13B 1SQGA 1VQ7V 2HP8A 3B40A 2ZT9B 1GM9A 5B3SB 1XDCA 3ETQA 4RUEA 5JH7B 3K9SA 5CA1A 3VQVA 2WLJA 3T1YB 1M56B 1Q86W 2Y69B 5IYDO 4LWSB 1SQQH 3RYCA 3E2EA 5KA5A 3UQ8A 5AG2A 1H2LA 2HVJC 5IYCO 2XTAA 2PYLA 2W6JG 1EN5A 4JF3A 2F1MA 3CJHB 2F95B 3H1KH 4EKWA 1H2GA 2RJZA 3P32A 4B3SO 2ZINA 2E74B 1MSWD 5JQGB 3HKEB 1JA8A 1V9PA 2WLIA 2Q8VA 2YEVA 3JAMN 3A8TA 2KG7A 1EZVH 3ASOC 4EEQA 2IW5A 4P2ZA 3T1HO 5ITZB 1US6A 5CMUA 3OR6C 2HHHO 2F4VO 1D5NA 3H1LH 4MVRA 5BMVB 4OX9O 2BE3A 3AG4C 4B3SB 1K4DC 4AI8A 2OT5A 3UO2A 3EXAA 4I50B 4UUJC 4LF8O 3H9VA 2L35A 4MS2A 3DTUB 4FFBB 2CTWA 3LSUA 1Y67A 4AQYO 4WBNB 3T1HB 5GTIZ 1K34A 3ZHQA 3W7TA 1AILA 3VQXA 4ZI7A 3CCUV 2F4VB 4X20B 2HHHB 4U3JA 3CSXA 4UV8A 3J80N 2Q7HA 1PL4A 4NB5A 4MVOA 2JDIG 4OX9B 4X64O 2QR4A 1M57B 5EBWC 4DR2O 1XI1A 2V1DA 2DYRC 4LF8B 3ABMC 2XAGA 2YUAA 4IHJB 4D6TH 3HB3B 4WFAV 2EX3A 2Z0AA 3JARB 4DR6O 3JYCA 1NH2B 2QWNB 5KUKA 1YJ9V 2W0XA 3NXSA 4O4JA 4DW0A 3CP1A 3QNEA 2OCCC 1R3IC 1O9HA 4I7ZB 1K4CC 4I9WA 5LBQA 1SS3A 3TGUH 4HYOA 1GN6A 1AI6A 1TUBB 1TAEA 3IJ4A 3K58A 1JVMA 5LXTA 1KB9F 4X8AA 4DR2B 1KKDA 2F23A 5B1BC 1H2KA 3D3QA 2GUZB 3ZHUA 1FJGB 3E22B 2RDCA 3L72H 3KKYA 3X2QC 4DR6B 3AG3B 1RSOB 4R7CA 1Q43A 2HR3A 2P4KA 3K3WA 2ITCC 3MD0A 3MHHC 1S5HC 2DOSA 4MVQA 1D2DA 2CE4A 3JSLA 4JTDB 1DF4A 3QO7A 3CXCU 2P22C 3WFVA 3BY6A 2XT9A 1M5IA 1BSMA 3N27A 3SYCA 2A3QA 2QM4A 1NT2B 5KHGA 1V55B 2R9RB 1NU1H 3FX7A 1XEQA 1PNMA 3M99B 1AR4A 2IJIA 3CRMA 3F5TA 3VQYA 4TSFG 3LSQA 1JPXA 1OCZC 2BTOA 5LGNA 3CRRA 5DM6V 4Z1VA 3SJBC 5FPRA 3VOUA 1OCOB 1IBLB 1LUWA 2DMXA 3JAWA 1ENVA 3ML0A 4K8XA 5B66Z 4JAVA 2CH7B 4DV6O 4DV3B 3BHPA 1EBOA 1FKAO 3C3SA 4F6EA 1SZTA 2JGDB 3U10A 1UPGA 1BCCH 1ZLZA 1SERA 2P7TC 4CH5A 2YSUB 4LP8A 1KKCA 3RN4A 4ASUG 1K33A 3SYPA 1NH2D 3WU2Z 2P90A 2QWRB 2LJ2A 1R3KC 4F6RB 3ABTA 2B1GA 4PA4A 3BVOA 1K5SA 3FAVA 3HR0A 1JFFA 2BTQA 3CC4V 4X65O 1K5QA 1N4CA 1W0JG 3T4DA 4JPRA 2QGNA 1NVPD 4HAMA 1GRJA 2WLHA 1LNQA 4DV6B 1RM1C 2WLMA 3SYOA 2DQ3A 2ZIMA 2R72A 2ZIOA 4LH7A 5C8YB 3HKCA 1BQZA 3OD4A 2P67A 2V4DA 4JZ2A 5KX5B 1WP8A 4BAYA 2UXBB 4B3RB 3ZMZA 4J9ZB 4X65B 1K97A 2BOBC 3DC5A 2NN4A 1WN7A 4WF9V 4TV9B 5L3BA 1SQPH 2F66C 1LUVA 4YJ3B 2XOKG 2ZDIA 4H44B 5L3EA 4LFAB 2W0FC 4MVSA 4LF5B 1IBKO 3SYAA 2N05A 5BY1A 5EYPA 3CWBH 2ZR2A 4CS4A 4PELA 3SPCA 5L3DA 4GX0A 1W59A 3B8MA 3STZC 2ZDIC 4J7ZA 4UVAA 2UU9O 3CB2A 1EM1A 2GBOA 2EZPA 3LNMB 4ZOLB 4N23A 3OM3B 3ZEDA 4J10A 4PI0A 4CH6A 4JAUA 1YTFB 1SZXA 1YZBA 5LOVA 4BIZA 1Q6HA 4JTCB 4YHHO 3EVKA 1IBKB 1Q3EA 3I55V 2HG5C 1PP9H 1SA0B 3UT5B 1CXZB 3AG7A 1MMMA 4JI3O 4LCUC 1NQTA 3OUSA 2OWOA 1OV9A 1AJPA 2AXTZ 5KLVH 3KG2A 2XHBA 4JASA 1N8RW 3S3XA 4WFBV 2GV9A 5LP6C 4YJ2A 2DQ0A 3E8HA 1VMGA 4FJCC 5JJNB 4G27B 4YHHB 3GVMA 1E1QG 3WG7C 3RYHB 2ZM6O 2UUAO 1Y76B 1IURA 2LW7A 3M8AA 1FFXA 2HJFC 2JVDA 5CBGA 4JI3B 4J42A 5EZYB 2Z3YA 2V7QG 3Q4HA 2CAZC 1R6KA 2Y0IA 4FM2A 1FD9A 1ZL8A 3EFFK 5TISZ 3WB0A 4FK5C 3CRAA 1IDSA 2ZM6B 2UUAB 3E89A 5GONA 4NXMB 4X1IA 3RYCB 3SJQC 4UCSA 5KA6A 1VF7A 2QM7A 1NTKH 3AG1C 3ABKC 5A2QN 1IBMO 2AW9A 4XDJA 3B09A 1F23A 2CK3G 2XNDG 1S76D 1MZEA 2GTSA 1DGSA 1Q8IA 2KB1A 4ZIBA 1NTZH 1VP7A 3AK1A 3ASOB 5BR8O 4EB6A 1GN2A 3RYFA 2XASA 4DUYO 2QKSA 3OGIB 1N0NA 2WLIB 1JMKC 2EIKC 3CS5A 2KG7B 4FZ0A 4J80A 3N2KA 3AG4B 1KQSU 1IBMB 2IH1C 5H5NA 1U97A 4IYHA 1XQ8A 4FM1A 2W6IG 3K5NA 2B5UA 2JEUA 1H2MA 3JD1A 1M4UA 4UVCA 5BR8B 2QM8A 1OCCB 4B3MO 3G6EV 1NZ6A 2XAQA 1YCIA 3BA8A 4DUYB 5BXZA 4GX2A 4O4LA 1Q7YW 1MABG 1BHBA 1B6QA 1K7DA 4BIOA 1JX9A 3K0GA 2N04A 2Y48A 3ABUA 4ZI7B 2DYRB 5EK0A 3ABMB 2EILC 4U3JB 1R6TA 4OPHA 4YXWG 2Q0OC 4MVUA 4JI7B 4DRXA 4B3MB 1FFTB 4PA9A 3SJAC 3J81N 3B8NA 4FLTA 2Q68A 2OCCB 2YXHA 5KMGA 4YY3B 4H0LB 3K08A 3TXSA 4GZRB
chains in the Genus database with same CATH topology
3H9VA 4DW0A 4DW1A 3I5DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H9V A;  4DW0 A;  4DW1 A;  3I5D A; 
#chains in the Genus database with same CATH topology
 3HKB A;  4WFH A;  2IJJ A;  1RPR A;  4O4J B;  1R3J C;  2AGA A;  1ZWI C;  1ZAU A;  2ATK C;  4JAA A;  4TOI A;  1D5A A;  2QWP B;  3X2Q B;  4X1Y A;  1H38 A;  1M9N A;  1YXB A;  4AIL C;  4DV0 O;  2EIM B;  5LXT B;  2P4V A;  2ZQM A;  1MSD A;  2QDO A;  1IXB A;  1VQO V;  4DW1 A;  2JS5 A;  4X89 A;  2B1I A;  1TVK A;  4DV7 O;  4JI0 O;  3K5O A;  1L1F A;  5CBF A;  2F93 B;  1KYO F;  3DXR A;  4X1K A;  1QVG U;  5J2T A;  4U7O A;  3RFR A;  3AK2 A;  1KBH A;  3CCS V;  2RN9 A;  4MVM A;  1OCZ B;  2CDY A;  4BIU A;  1VF5 B;  2LP7 A;  1MOF A;  4BW9 A;  2DYS C;  3SPJ A;  2IU3 A;  3B4S A;  1PKX A;  4JI0 B;  2EIN C;  4WFE A;  4KP4 A;  2R9I A;  4L87 A;  4TUY A;  2VQF O;  4NTX A;  4R6Z A;  4UXN A;  5L3G A;  4JYA O;  5L3F A;  4Q20 A;  2GSM B;  4FLV A;  2A0L A;  3GWO A;  2N74 A;  5LYJ A;  4FLZ A;  1M90 W;  4R8C A;  3G6B A;  3RYI B;  4K35 A;  5IY5 C;  3ZRW A;  2D3O W;  2P6J A;  3UM7 A;  4LH6 A;  5JJJ B;  2FB5 A;  1N32 O;  3CCR V;  5B5E Z;  4O2B A;  3ZX6 A;  2CTR A;  2JK5 C;  2ETN A;  4DV2 O;  1ZTE A;  5FLX N;  1AI7 A;  3FKS G;  2VQF B;  3CCV V;  1AJQ A;  1VQ4 V;  1AI4 A;  1TUE B;  4RWU A;  3OEH G;  3I56 V;  4JYA B;  4I55 B;  1B06 A;  1K9M W;  1Y66 A;  2YS8 A;  4CC5 A;  1Z5V A;  2YI8 A;  5LHG A;  5J2U A;  3JD4 A;  2QSA A;  4NXN O;  4JI6 O;  3E8G A;  3FAV B;  3G67 A;  2PYJ A;  1NI8 A;  2ARH A;  1P4R A;  3R65 A;  1JFF B;  2BTQ B;  1N32 B;  4CC6 A;  1I94 O;  3JD3 A;  4DV2 B;  1MA1 A;  4O4H A;  3FFQ A;  1VAR A;  2JIZ G;  2Q7G A;  2YIB A;  4UCR A;  2QKA A;  3CRC A;  3CCL V;  4HBN A;  2XUM A;  3CCE V;  4DK1 A;  4AQY B;  2QA4 V;  3HKC B;  2GTA A;  2BOC C;  3OTO O;  3ZRV A;  5B1A C;  4OXS A;  3JAL B;  1OZ0 A;  1IX9 A;  4NXN B;  4JI6 B;  1ZUQ A;  5JWP A;  1NVP B;  4X64 B;  1XBL A;  3CHX A;  2B9Z A;  3VBB A;  1KEC A;  1HNX O;  1CP9 A;  4FM0 A;  2IJK A;  2H3O A;  2VQE O;  3THO A;  3L9D A;  1WNS A;  2DJV A;  4LF7 O;  2F43 G;  2ZXW C;  4GUN A;  3RVY A;  4Z1M G;  4XDK A;  1XMQ O;  1Q81 W;  1DK1 A;  1NBM G;  4QE9 A;  3UCS C;  1S0V A;  2OTL V;  4B08 A;  4LFB O;  4PA6 A;  5LOV B;  3ASN C;  1BT8 A;  1HNX B;  1H8E G;  3A0H Z;  3QTC A;  4J7K A;  2VQE B;  2IU0 A;  1XMO O;  3JAK A;  3F5W C;  4LF7 B;  2ZE5 A;  2MW2 B;  1XMQ B;  3E35 A;  1AVM A;  3J7A U;  3WG7 B;  1GN3 A;  4MT8 A;  1GM7 A;  4LFB B;  1KMI Z;  3ZS8 C;  4KXR A;  4H33 A;  1WLE A;  1GO3 F;  4I4T A;  4YJ2 B;  4IL6 Z;  2EZO A;  4FLY A;  2A9H A;  1NR7 A;  1X59 A;  1XMO B;  3E8F A;  1AI5 A;  1FFX B;  5BZB A;  1EN4 A;  1S3J A;  4MVZ A;  4LBE C;  2EJR A;  1R73 A;  4X66 O;  4FIP C;  4LFC O;  5BMV A;  4JZG A;  4NTY A;  3Q4H B;  2Q67 A;  4B3T O;  3TXQ A;  4QIW F;  3D3I A;  3FD9 A;  1I08 A;  3HPL C;  4MTG A;  2A7W A;  3N2G B;  1ZL8 B;  4JI4 O;  4CH3 A;  5B1O A;  4HNA A;  3AG1 B;  1QVF U;  2ZD9 A;  1R1B A;  2MK3 A;  5KHK A;  3JCZ A;  3IC9 A;  2A79 B;  3D36 A;  5GON B;  4X1I B;  4NVP A;  1HW7 A;  4QE7 A;  3LNN A;  4QPK A;  3OR7 C;  3K06 A;  4X66 B;  4LFC B;  4UVB A;  4H37 A;  4I0X A;  1XUQ A;  1BGY H;  3D36 C;  1KC8 W;  1P7G A;  3FYE B;  4JI4 B;  2EIK B;  3DSQ A;  1FYJ A;  4GKK O;  2FTK A;  3JCU Z;  1VQK V;  5JVD A;  2WLL B;  4EB6 B;  3ETE A;  3L71 H;  2EUL A;  2UXD O;  1M57 C;  5DN6 G;  1I7F A;  4J9Y B;  3CME V;  2IBZ H;  4DR5 O;  3CRQ A;  1WA8 A;  3W7S A;  3OTF A;  3N2K B;  1FXK A;  3OGC C;  5IE9 A;  2H94 A;  2YIA A;  4JGS A;  1G6U A;  3OE7 G;  1YSC A;  3MHS C;  1BQ0 A;  4GKK B;  1VQP V;  4CH4 A;  1VIB A;  1QLE C;  3ZMT A;  3ZN0 A;  2E3C A;  4A5U B;  1UJW B;  1FXK C;  1H2N A;  5EIB C;  2E75 B;  5CB4 B;  2UXD B;  4O2A A;  3H1I H;  4UCU A;  4O4L B;  3CYO A;  2PTM A;  4PJ0 Z;  2EIL B;  1M93 A;  5F2V O;  4DR5 B;  2WLN A;  3BFR A;  5IDJ A;  3BAB A;  2BSK A;  2VWK A;  5LP6 A;  3PJS K;  1GKF A;  1WB7 A;  2UU9 B;  1GH6 A;  4JV5 O;  1AR5 A;  2UUC O;  5EC1 C;  2OYQ A;  4DRX B;  2Q7E A;  4JI1 O;  4DXW A;  2NR5 A;  1HDJ A;  1N34 O;  5KAF Z;  5IJ9 A;  3JAS A;  4GX1 A;  1Y74 A;  5KMG B;  5GW7 A;  1DLB A;  4DYL A;  3K5L A;  2JRI A;  3HKB B;  4P9O A;  1WAZ A;  1S5J A;  4PDR A;  1TA8 A;  2CUG A;  1OCR C;  1YJN V;  1T5E A;  1JCH A;  1SES A;  2Y4U A;  5CA3 A;  1AP5 A;  3LSS A;  4MW3 A;  2ZNI A;  5HFM A;  2FL4 A;  4CS2 A;  1SRY A;  1JOY A;  4JI8 O;  4JV5 B;  2UUC B;  2Q9L A;  3A2F A;  2QTO A;  3ABL C;  4X1Y B;  5FL7 G;  2D2C B;  4ICG A;  2OCH A;  1L0L H;  3MDS A;  2P06 A;  2IJH A;  5CA1 B;  1TVK B;  1S77 D;  1XNR O;  1EZJ A;  3CC2 V;  1DF5 A;  5IYB O;  1Z5W A;  4PA3 A;  4EFE A;  1FAF A;  4F6R A;  5IYZ A;  4JYB A;  5HFL A;  2R9A A;  3DXR B;  3SJC C;  3LUT B;  2DYS B;  1P7B A;  4X1K B;  1NKD A;  2DN9 A;  2NLJ C;  5J2T B;  3FB6 C;  2EIN B;  2CGO A;  1K8A W;  5EBL C;  1VQ9 V;  1E79 G;  3JAT A;  2M6Y A;  1ORQ C;  2HKO A;  3CX5 F;  1XNR B;  5DED A;  3H1J H;  2KSD A;  4Z2W A;  1JJ2 U;  2DWE C;  1QNM A;  2LO1 A;  4QJF B;  5IY5 B;  4OPA A;  2YEV B;  4TUY B;  4X62 O;  3ZHS A;  2XAF A;  4ZHQ A;  3RW0 A;  2ZCE A;  5J9P C;  3HKD A;  1VF6 A;  2AZ2 A;  4W4L A;  4OGQ B;  4TV9 A;  1XOU A;  2RMK B;  4MTX A;  1AP6 A;  3G4S V;  3ZRW B;  3AK3 A;  4GT1 A;  5K1X A;  1GN4 A;  1VF6 C;  1J5E O;  2E76 B;  2QE7 G;  3ZBH A;  4D7T A;  3SDL A;  1Z2G A;  5CBH A;  2ADQ B;  3UKM A;  2WLK A;  3QG5 A;  1XHZ A;  5LA6 A;  2X6B A;  4IIJ A;  1PPJ H;  2O57 A;  4WFG A;  3ZCC A;  2YXY A;  4JI2 O;  4ZBM A;  5J2U B;  1AB3 A;  1EFR G;  1URF A;  2LW1 A;  5IT9 N;  1MZF A;  1YIJ V;  1YDX A;  4CS3 A;  1J5E B;  2HFE C;  4JTA B;  1QHT A;  3K79 A;  4PDM A;  1VQM V;  2YXL A;  4TV8 A;  4O4H B;  5B1A B;  3UT5 A;  1L0N H;  3ZMU A;  3A0R A;  4FLU A;  4QPJ A;  3KCX A;  4I9Q A;  2JGU A;  3H1H H;  2X7R B;  4UB6 Z;  2ITD C;  4FVM A;  4Q6G A;  3CXH F;  4DR4 O;  4DR7 O;  4J41 A;  2ZKO A;  2IM9 A;  4FZ1 A;  5B1B B;  3RT3 C;  4JI2 B;  5K1P A;  3K59 A;  4LNU A;  1QR8 A;  2KQX A;  2YID A;  1AJN A;  3ZHV A;  1YVW A;  4LF4 O;  4MTO A;  3ZHR A;  1FPO A;  3AG2 C;  1R3L C;  1M1K W;  1QCE A;  4WCE V;  4MSW C;  1SQB H;  1A32 A;  4PHZ A;  3FYI B;  5DEC A;  3RBZ A;  3ZRS A;  4DR7 B;  4DR4 B;  1BS3 A;  4P30 A;  1Y4M A;  3SR2 C;  3GWK C;  1U96 A;  4MTF A;  1SQX H;  3ASN B;  1RFY A;  1COW G;  4B7E A;  4LF4 B;  1L8D A;  1IXM A;  1K73 W;  3L70 H;  4FFK A;  4DV0 B;  3OW2 U;  3CPW U;  1VQ5 V;  4YIP A;  1QR9 A;  2Q69 A;  3T1C A;  1WP7 A;  1GK9 A;  3B77 A;  4DV7 B;  2DW4 A;  1BZK A;  3S3W A;  1VQ6 V;  3SPI A;  1HR0 O;  2XAH A;  3JAK B;  1NTM H;  4CZZ A;  1WB8 A;  4XDL A;  2PGG A;  2PI5 A;  3RVZ A;  3VQW A;  4EFB A;  1F4N A;  2ZNJ A;  1F51 A;  3L73 H;  3K04 A;  4DUZ O;  5FNV A;  2UUB O;  1KUQ A;  3JAW B;  5L3C A;  4JYC A;  2K1E A;  2LFS A;  3SYQ A;  2IH3 C;  1RP3 B;  3ZIA G;  2WWW A;  4I4T B;  4JI5 O;  2YIC A;  2X6C A;  3UO3 A;  1Q6U A;  4RQE A;  2K9P A;  2FML A;  1HR0 B;  4IGG A;  2KKW A;  1E1R G;  2YIB D;  4E2L A;  1SF9 A;  1Y6X A;  5LGU A;  2WSS G;  1IVS A;  4MW8 A;  3JSN A;  5GTH Z;  2EJ7 A;  2EIJ C;  3WB2 A;  2PI4 A;  4DUZ B;  1RM1 B;  2Y0P A;  4F4L A;  2UUB B;  2JJ1 G;  2C2A A;  5B1N A;  2QKC A;  3B2E E;  4JI5 B;  4BWA A;  4HZ3 A;  5KHI A;  4HNA B;  1H8H G;  1YHQ V;  4O4I A;  5LHI A;  1OCC C;  5FPO A;  2JS3 A;  1NR1 A;  1ZX3 A;  1G1X B;  1V54 C;  1XIL A;  1PNK A;  4U7N A;  3DC6 A;  2HLD G;  3CE2 A;  5A9G A;  3QO5 A;  4B7K A;  1GAX A;  5EBM C;  4I0X B;  4K0K O;  4GKJ O;  2HEP A;  3OFN G;  4PDL A;  3K9A A;  2CTQ A;  4KUM A;  3IAY A;  1FJG O;  1O9G A;  4JYY A;  3CCJ V;  5LGT A;  2LFR A;  4G28 B;  3K57 A;  5JVD B;  1I94 B;  1I5Y A;  3E8B A;  3P30 A;  1SKV A;  4RUF A;  4TQF A;  3M7M X;  4DR1 O;  3F7Y C;  5CA0 A;  5IJ0 A;  1I0H A;  1XRE A;  1BMF G;  1K3E A;  3BEH A;  1WA8 B;  1BL8 A;  5EYP B;  2LQT A;  3OTO B;  3K03 A;  1QLE B;  1FXK B;  1AR1 B;  4GKJ B;  4K0K B;  3DGE A;  3MAQ A;  3ZHT A;  3SPG A;  4QGP A;  3CD6 V;  5JH7 A;  3CMA V;  2Q73 A;  3RWR D;  1QBZ A;  1H2S B;  2OIG A;  2E5L O;  4LWS A;  4UV9 A;  1CEZ A;  4O2A B;  2EIM C;  4DR1 B;  5B3S C;  1VQN V;  1M56 C;  2Y69 C;  2ZR3 A;  3T2M A;  2P5O A;  2BSK B;  1IBL O;  1JJO A;  5LP6 B;  3K0D A;  1GM8 A;  1G8M A;  4DK0 A;  3APQ A;  3CJH A;  4KHP O;  4RO2 A;  4UFZ A;  5KHJ A;  3EHB B;  3AEI A;  1I5X A;  3R66 A;  1P49 A;  5LMN O;  4NKG B;  2E5L B;  4DV3 O;  1P84 F;  1LR1 A;  1OCR B;  1W0K G;  5JQG A;  1MG1 A;  3HKE A;  3I5D A;  2CTP A;  2QWQ B;  4X88 A;  5KAI Z;  4DO2 A;  1OHH G;  1PM9 A;  5CN0 A;  5IJ9 B;  1S72 V;  3CEI A;  3JAS B;  1QLN A;  1Y74 B;  1UFI A;  1S5L Z;  3ABL B;  5ITZ A;  2Q4P A;  5LMU O;  1CPY A;  3RYI A;  2RNB A;  2NNU A;  1XL4 A;  4KHP B;  1ZSP A;  5EC2 C;  3W7U A;  4XBF A;  3OMA B;  3CCQ V;  5LMN B;  1N0J A;  2M7W A;  3IFX A;  4R50 A;  4I50 A;  1F7Y A;  4FFB A;  4UCT A;  2G38 A;  3KZI Z;  3OMI B;  3ABK B;  3FB8 C;  1B04 A;  1X4T A;  2PF4 E;  4I55 A;  1YJW V;  2UXX A;  2RQ6 A;  3W7W A;  1FXV A;  3LDD A;  4WBN A;  4RQF A;  1JQ0 A;  1HNZ O;  1N36 O;  5LMU B;  2AHZ A;  4GLX A;  3LDC A;  4PI2 A;  4X20 A;  2UXB O;  4B3R O;  5IYZ B;  3D8C A;  1VQL V;  2L6L A;  2X0L A;  4DV4 O;  4B3T B;  1PV0 A;  3F7V C;  3BPZ A;  1RPO A;  5H9C A;  5EIB D;  2VRZ A;  2QTS A;  3TET A;  2QWO B;  3K5M A;  1G4Y B;  4LC1 A;  2WPD G;  1SET A;  4IHJ A;  4LFA O;  4DV1 O;  2YC0 A;  4LF5 O;  4FPP A;  3SPH A;  4GX5 A;  3JAT B;  4GCZ A;  3JAR A;  4I5S A;  3U0Z A;  3RYF B;  1HNZ B;  5H6Q A;  4QNH B;  1N36 B;  3P3N A;  4W4K A;  3JAL A;  3P3P A;  4ZHQ B;  3C90 A;  2PZS A;  3HKD B;  2FKX A;  4C7U A;  3IC7 A;  4DV4 B;  3JD0 A;  1TUB A;  2H8P C;  3ICX A;  1WJZ A;  2UXN A;  4KL1 A;  4FLW A;  4TT3 G;  2OTJ V;  2GUZ A;  3E22 A;  3A0B Z;  1NJI W;  4DV1 B;  1YI2 V;  3WB1 A;  1F4M A;  3KCY A;  2A06 H;  2EBO A;  3FB7 C;  1RSO A;  4NR1 A;  4U3F H;  1EN6 A;  3W7X A;  4P9P A;  1DTO A;  3ZMV A;  5D5P A;  1SC5 B;  5LA6 B;  1Q82 W;  4E4E A;  5H6R A;  1WPX A;  3AG3 C;  4IIJ B;  2ODM A;  3O65 A;  4PA7 A;  1R6N A;  2WAM A;  4AHC A;  1Q6I A;  3PN1 A;  2QEX V;  4DV5 O;  4LF9 O;  3GB7 C;  4X9Q A;  5IWA O;  4TV8 B;  1QQC A;  1ROP A;  1HNW O;  1V55 C;  2XAJ A;  1W2B U;  1KP2 A;  2HJD A;  1SQF A;  4K8Z A;  3AG2 B;  2OIE A;  4LR3 A;  4YIO A;  4IT5 A;  2X6A A;  1YEW A;  3H01 A;  4LNU B;  5C93 A;  2CH7 A;  4G2K A;  4JI1 B;  3RGB A;  1OCO C;  4ABM A;  2HVK C;  4DV5 B;  4LF9 B;  2JGD A;  5IWA B;  1N34 B;  4NXM O;  3ZN1 A;  1HNW B;  5KHH A;  4J7J A;  1Q90 D;  3OEE G;  4ZKI A;  1KD1 W;  3OUF A;  2ZE8 A;  1GTO A;  1JR9 A;  2VWJ A;  1HWY A;  3QVN A;  4L8J A;  2PUS A;  2JJ2 G;  3NR7 A;  2Z5U A;  3U11 A;  3ETD A;  1BE3 H;  3N2G A;  1GMG A;  4JI8 B;  2Q5Z A;  5D5Q A;  1K92 A;  3TK1 A;  1XNQ O;  3OAA G;  2AZ0 A;  2YDE A;  1B3Q A;  4K3A A;  4NYK A;  1KP3 A;  1PL0 A;  1FS0 G;  1IZ3 A;  2AHY A;  4BR6 A;  5C8Y A;  3STL C;  1VEW A;  2Q0A A;  3ZJZ A;  1N33 O;  2R70 A;  2JEX A;  1PD3 A;  4N21 A;  5KX5 A;  3E83 A;  4KFM A;  4TWK A;  3QO8 A;  5E1A C;  3O9O A;  1THZ A;  4LF6 O;  4CBC A;  1MNG A;  3OMN B;  5KUM A;  2WLL A;  1XNQ B;  4BW5 A;  2Y4T A;  2GHY A;  5LYJ B;  5FNV B;  1J95 A;  1PNL A;  2ZE6 A;  2VS0 A;  4YJ3 A;  4UCV A;  1YTF D;  3G80 A;  4J11 A;  5E79 Z;  3TJT A;  2WA3 A;  4O2B B;  1N33 B;  1SQV H;  3APO A;  2EIJ B;  3FB5 C;  3LDE A;  2FYU H;  2YI9 A;  3TCU A;  2CGN A;  3T4Z A;  4X62 B;  3BCC H;  4ZOL A;  4LF6 B;  2Q6A A;  1OJH A;  3SGI A;  3OT7 A;  3CCM V;  1TGO A;  4JI7 O;  4WFF A;  4FLX A;  5CB4 A;  4UB8 Z;  3C3T A;  1QU7 A;  1V54 B;  3IGA C;  2ADP A;  4PDV A;  4DR3 O;  1XHX A;  4YY3 O;  2PY5 A;  1FXH A;  2ZE7 A;  4TQD A;  3ETG A;  4O4I B;  1SA0 A;  3L75 H;  1VQ8 V;  4UCO A;  5JCO A;  2UXC O;  3ZMS A;  3E86 A;  5JJE B;  3JD2 A;  2QJ1 A;  1BHA A;  4PD4 F;  1ARO P;  5H2F Z;  4NTW A;  1YF2 A;  2RCV A;  1NS1 A;  3BRC A;  3G71 V;  3BA9 A;  3ZRX A;  1WPB A;  5JCO C;  4DR3 B;  2LGQ A;  1XL6 A;  3T1Y O;  3L74 H;  3RYH A;  1Y76 A;  2ILM A;  5LL6 Y;  4PV1 B;  2DE0 X;  2GDS A;  2ZXW B;  5LHH A;  4GYC B;  5CA0 B;  5IJ0 B;  2UXC B;  5EZY A;  2DWD C;  4IYI A;  1Q5O A;  1KU9 A;  2LGW A;  3BAA A;  3CC7 V;  2WA4 A;  2BCC H;  3QF7 A;  4RAI A;  4D7S A;  4FMT A;  1YIT V;  1HP8 A;  4H13 B;  1SQG A;  1VQ7 V;  2HP8 A;  3B40 A;  2ZT9 B;  1GM9 A;  5B3S B;  1XDC A;  3ETQ A;  4RUE A;  5JH7 B;  3K9S A;  5CA1 A;  3VQV A;  2WLJ A;  3T1Y B;  1M56 B;  1Q86 W;  2Y69 B;  5IYD O;  4LWS B;  1SQQ H;  3RYC A;  3E2E A;  5KA5 A;  3UQ8 A;  5AG2 A;  1H2L A;  2HVJ C;  5IYC O;  2XTA A;  2PYL A;  2W6J G;  1EN5 A;  4JF3 A;  2F1M A;  3CJH B;  2F95 B;  3H1K H;  4EKW A;  1H2G A;  2RJZ A;  3P32 A;  4B3S O;  2ZIN A;  2E74 B;  1MSW D;  5JQG B;  3HKE B;  1JA8 A;  1V9P A;  2WLI A;  2Q8V A;  2YEV A;  3JAM N;  3A8T A;  2KG7 A;  1EZV H;  3ASO C;  4EEQ A;  2IW5 A;  4P2Z A;  3T1H O;  5ITZ B;  1US6 A;  5CMU A;  3OR6 C;  2HHH O;  2F4V O;  1D5N A;  3H1L H;  4MVR A;  5BMV B;  4OX9 O;  2BE3 A;  3AG4 C;  4B3S B;  1K4D C;  4AI8 A;  2OT5 A;  3UO2 A;  3EXA A;  4I50 B;  4UUJ C;  4LF8 O;  3H9V A;  2L35 A;  4MS2 A;  3DTU B;  4FFB B;  2CTW A;  3LSU A;  1Y67 A;  4AQY O;  4WBN B;  3T1H B;  5GTI Z;  1K34 A;  3ZHQ A;  3W7T A;  1AIL A;  3VQX A;  4ZI7 A;  3CCU V;  2F4V B;  4X20 B;  2HHH B;  4U3J A;  3CSX A;  4UV8 A;  3J80 N;  2Q7H A;  1PL4 A;  4NB5 A;  4MVO A;  2JDI G;  4OX9 B;  4X64 O;  2QR4 A;  1M57 B;  5EBW C;  4DR2 O;  1XI1 A;  2V1D A;  2DYR C;  4LF8 B;  3ABM C;  2XAG A;  2YUA A;  4IHJ B;  4D6T H;  3HB3 B;  4WFA V;  2EX3 A;  2Z0A A;  3JAR B;  4DR6 O;  3JYC A;  1NH2 B;  2QWN B;  5KUK A;  1YJ9 V;  2W0X A;  3NXS A;  4O4J A;  4DW0 A;  3CP1 A;  3QNE A;  2OCC C;  1R3I C;  1O9H A;  4I7Z B;  1K4C C;  4I9W A;  5LBQ A;  1SS3 A;  3TGU H;  4HYO A;  1GN6 A;  1AI6 A;  1TUB B;  1TAE A;  3IJ4 A;  3K58 A;  1JVM A;  5LXT A;  1KB9 F;  4X8A A;  4DR2 B;  1KKD A;  2F23 A;  5B1B C;  1H2K A;  3D3Q A;  2GUZ B;  3ZHU A;  1FJG B;  3E22 B;  2RDC A;  3L72 H;  3KKY A;  3X2Q C;  4DR6 B;  3AG3 B;  1RSO B;  4R7C A;  1Q43 A;  2HR3 A;  2P4K A;  3K3W A;  2ITC C;  3MD0 A;  3MHH C;  1S5H C;  2DOS A;  4MVQ A;  1D2D A;  2CE4 A;  3JSL A;  4JTD B;  1DF4 A;  3QO7 A;  3CXC U;  2P22 C;  3WFV A;  3BY6 A;  2XT9 A;  1M5I A;  1BSM A;  3N27 A;  3SYC A;  2A3Q A;  2QM4 A;  1NT2 B;  5KHG A;  1V55 B;  2R9R B;  1NU1 H;  3FX7 A;  1XEQ A;  1PNM A;  3M99 B;  1AR4 A;  2IJI A;  3CRM A;  3F5T A;  3VQY A;  4TSF G;  3LSQ A;  1JPX A;  1OCZ C;  2BTO A;  5LGN A;  3CRR A;  5DM6 V;  4Z1V A;  3SJB C;  5FPR A;  3VOU A;  1OCO B;  1IBL B;  1LUW A;  2DMX A;  3JAW A;  1ENV A;  3ML0 A;  4K8X A;  5B66 Z;  4JAV A;  2CH7 B;  4DV6 O;  4DV3 B;  3BHP A;  1EBO A;  1FKA O;  3C3S A;  4F6E A;  1SZT A;  2JGD B;  3U10 A;  1UPG A;  1BCC H;  1ZLZ A;  1SER A;  2P7T C;  4CH5 A;  2YSU B;  4LP8 A;  1KKC A;  3RN4 A;  4ASU G;  1K33 A;  3SYP A;  1NH2 D;  3WU2 Z;  2P90 A;  2QWR B;  2LJ2 A;  1R3K C;  4F6R B;  3ABT A;  2B1G A;  4PA4 A;  3BVO A;  1K5S A;  3FAV A;  3HR0 A;  1JFF A;  2BTQ A;  3CC4 V;  4X65 O;  1K5Q A;  1N4C A;  1W0J G;  3T4D A;  4JPR A;  2QGN A;  1NVP D;  4HAM A;  1GRJ A;  2WLH A;  1LNQ A;  4DV6 B;  1RM1 C;  2WLM A;  3SYO A;  2DQ3 A;  2ZIM A;  2R72 A;  2ZIO A;  4LH7 A;  5C8Y B;  3HKC A;  1BQZ A;  3OD4 A;  2P67 A;  2V4D A;  4JZ2 A;  5KX5 B;  1WP8 A;  4BAY A;  2UXB B;  4B3R B;  3ZMZ A;  4J9Z B;  4X65 B;  1K97 A;  2BOB C;  3DC5 A;  2NN4 A;  1WN7 A;  4WF9 V;  4TV9 B;  5L3B A;  1SQP H;  2F66 C;  1LUV A;  4YJ3 B;  2XOK G;  2ZDI A;  4H44 B;  5L3E A;  4LFA B;  2W0F C;  4MVS A;  4LF5 B;  1IBK O;  3SYA A;  2N05 A;  5BY1 A;  5EYP A;  3CWB H;  2ZR2 A;  4CS4 A;  4PEL A;  3SPC A;  5L3D A;  4GX0 A;  1W59 A;  3B8M A;  3STZ C;  2ZDI C;  4J7Z A;  4UVA A;  2UU9 O;  3CB2 A;  1EM1 A;  2GBO A;  2EZP A;  3LNM B;  4ZOL B;  4N23 A;  3OM3 B;  3ZED A;  4J10 A;  4PI0 A;  4CH6 A;  4JAU A;  1YTF B;  1SZX A;  1YZB A;  5LOV A;  4BIZ A;  1Q6H A;  4JTC B;  4YHH O;  3EVK A;  1IBK B;  1Q3E A;  3I55 V;  2HG5 C;  1PP9 H;  1SA0 B;  3UT5 B;  1CXZ B;  3AG7 A;  1MMM A;  4JI3 O;  4LCU C;  1NQT A;  3OUS A;  2OWO A;  1OV9 A;  1AJP A;  2AXT Z;  5KLV H;  3KG2 A;  2XHB A;  4JAS A;  1N8R W;  3S3X A;  4WFB V;  2GV9 A;  5LP6 C;  4YJ2 A;  2DQ0 A;  3E8H A;  1VMG A;  4FJC C;  5JJN B;  4G27 B;  4YHH B;  3GVM A;  1E1Q G;  3WG7 C;  3RYH B;  2ZM6 O;  2UUA O;  1Y76 B;  1IUR A;  2LW7 A;  3M8A A;  1FFX A;  2HJF C;  2JVD A;  5CBG A;  4JI3 B;  4J42 A;  5EZY B;  2Z3Y A;  2V7Q G;  3Q4H A;  2CAZ C;  1R6K A;  2Y0I A;  4FM2 A;  1FD9 A;  1ZL8 A;  3EFF K;  5TIS Z;  3WB0 A;  4FK5 C;  3CRA A;  1IDS A;  2ZM6 B;  2UUA B;  3E89 A;  5GON A;  4NXM B;  4X1I A;  3RYC B;  3SJQ C;  4UCS A;  5KA6 A;  1VF7 A;  2QM7 A;  1NTK H;  3AG1 C;  3ABK C;  5A2Q N;  1IBM O;  2AW9 A;  4XDJ A;  3B09 A;  1F23 A;  2CK3 G;  2XND G;  1S76 D;  1MZE A;  2GTS A;  1DGS A;  1Q8I A;  2KB1 A;  4ZIB A;  1NTZ H;  1VP7 A;  3AK1 A;  3ASO B;  5BR8 O;  4EB6 A;  1GN2 A;  3RYF A;  2XAS A;  4DUY O;  2QKS A;  3OGI B;  1N0N A;  2WLI B;  1JMK C;  2EIK C;  3CS5 A;  2KG7 B;  4FZ0 A;  4J80 A;  3N2K A;  3AG4 B;  1KQS U;  1IBM B;  2IH1 C;  5H5N A;  1U97 A;  4IYH A;  1XQ8 A;  4FM1 A;  2W6I G;  3K5N A;  2B5U A;  2JEU A;  1H2M A;  3JD1 A;  1M4U A;  4UVC A;  5BR8 B;  2QM8 A;  1OCC B;  4B3M O;  3G6E V;  1NZ6 A;  2XAQ A;  1YCI A;  3BA8 A;  4DUY B;  5BXZ A;  4GX2 A;  4O4L A;  1Q7Y W;  1MAB G;  1BHB A;  1B6Q A;  1K7D A;  4BIO A;  1JX9 A;  3K0G A;  2N04 A;  2Y48 A;  3ABU A;  4ZI7 B;  2DYR B;  5EK0 A;  3ABM B;  2EIL C;  4U3J B;  1R6T A;  4OPH A;  4YXW G;  2Q0O C;  4MVU A;  4JI7 B;  4DRX A;  4B3M B;  1FFT B;  4PA9 A;  3SJA C;  3J81 N;  3B8N A;  4FLT A;  2Q68 A;  2OCC B;  2YXH A;  5KMG A;  4YY3 B;  4H0L B;  3K08 A;  3TXS A;  4GZR B; 
#chains in the Genus database with same CATH homology
 3H9V A;  4DW0 A;  4DW1 A;  3I5D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...