3I5DA

Crystal structure of the atp-gated p2x4 ion channel in the closed, apo state at 3.5 angstroms (r3)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
324
structure length
324
Chain Sequence
RFTQALVIAYVIGYVCVYNKGYQDTDTVLSSVTTKVKGIALTNTSELGERIWDVADYIIPPQEDGSFFVLTNMIITTNQTQSKCAENPTPASTCTSHRDCKRGFNDARGDGVRTGRCVSYSASVKTCEVLSWCPLEKIVDPPNPPLLADAENFTVLIKNNIRYPKFNFNKRNILPNINSSYLTHCVFSRKTDPDCPIFRLGDIVGEAEEDFQIMAVRGGVMGVQIRWDCDLDMPQSWCVPRYTFRRLDNKDPDNNVAPGYNFRFAKYYKNSDGTETRTLIKGYGIRFDVMVFGQAGKFNIIPTLLNIGAGLALLGLVNVICDWI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ATP-gated P2X(4) ion channel in the closed state.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transport protein
molecule keywords P2X purinoceptor
total genus 60
structure length 324
sequence length 324
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.940 Mainly Alpha Orthogonal Bundle Helix Hairpins atp-gated p2x4 ion channel 3i5dA01
2.60.490.10 Mainly Beta Sandwich atp-gated p2x4 ion channel fold atp-gated p2x4 ion channel domain 3i5dA02
4DW1A 3H9VA 3I5DA 4DW0A
chains in the Genus database with same CATH superfamily
4NXNB 1VEWA 4B3MB 4DV1B 4D7SA 3CC7V 3K08A 3A0HZ 1R3JC 4GYCB 2A06H 5CA1B 1VQKV 1XL4A 4UCVA 2E75B 2UXCO 4YIOA 3H9VA 4LF9B 4UCUA 1N36O 2ZR2A 2JEXA 4AHCA 4PHZA 3F7VC 3T1YO 2OWOA 3DXRB 2HEPA 4GZRB 4YY3O 5KX5A 1NTMH 2F95B 3HKCB 2XOKG 4LF5B 1SKVA 3IC9A 1FPOA 4EFEA 4PA7A 2CTQA 3A0BZ 3UQ8A 1K9MW 1HNXB 4U3JA 4DO2A 1KBHA 1KYOF 1I94O 4ZOLA 2DYSC 4UV8A 2IJHA 1FD9A 3WG7B 2EZPA 5D5PA 3SYCA 1R1BA 3JAWA 2YEVA 1BSMA 4O4LB 5FNVB 4NB5A 3VOUA 2DYSB 3H1LH 4K8XA 4EKWA 1WAZA 2Y69C 5J9PC 3EFFK 2V7QG 3GWKC 3X2QB 5LBQA 1US6A 1QVGU 5J2UB 4NXNO 4OGQB 1UFIA 4NTYA 4FLVA 4F6RA 1VMGA 3AK1A 1NI8A 2DOSA 3RGBA 1J95A 3CHXA 3K0GA 2FB5A 4LF6O 2W6JG 3L75H 3CCEV 4ZOLB 3D8CA 4CZZA 1Q8IA 5EK0A 2LO1A 2LQTA 1IBMO 2EIJB 1VQNV 1ORQC 2UXXA 1WLEA 2G38A 2IH1C 2ZT9B 2WLKA 2CK3G 1XNQB 1EFRG 1TUBA 1RPOA 2WSSG 3ZHUA 3SDLA 4B08A 4JI2O 3ZRXA 4Z1VA 5IJ9A 3ASNB 2ZE5A 3OMIB 1VQPV 1KECA 1EN6A 3W7XA 3RYIB 4JAVA 4JI8B 1S76D 1S0VA 3WB1A 3KCXA 4JASA 3RYCB 3IGAC 1Y76A 2Y4TA 4R7CA 3CXHF 3K5LA 1K5QA 2QA4V 3G80A 1MMMA 4FLXA 4I55A 5EYPA 4GKKO 1M90W 4I9QA 1RSOB 1VQOV 2GBOA 2JDIG 5H2FZ 5IY5C 2AXTZ 3JCZA 1AR5A 1LNQA 2WA3A 2Q7EA 1RPRA 3RWRD 3WB2A 1DF4A 1SQVH 5JCOC 3M7MX 5D5QA 1H8EG 1ZWIC 1QLEC 2RDCA 2GUZA 5IYCO 2LFSA 3HKEB 3ZJZA 2KQXA 2WLLB 5F2VO 2QWRB 4UFZA 3T1CA 4WFEA 1BQZA 1AI6A 4DV0O 5IYBO 3GB7C 2PYLA 2QTSA 5BMVB 1HWYA 3LNMB 2PI5A 1FXHA 3D36C 4WFBV 2DW4A 1RP3B 3E35A 3TETA 1FFXB 5GTIZ 2B5UA 2FL4A 4UVCA 3LDDA 3CP1A 2WLIA 3RFRA 2ZM6O 4RQFA 3HB3B 1XNRO 1HNWB 3P32A 2Z3YA 2X6CA 3ZHSA 2IJJA 1R6NA 3OE7G 1UJWB 4LF9O 2H94A 1OJHA 3H1KH 3HKCA 4GKKB 2RCVA 4J42A 1W0JG 4X1KB 4PI2A 3I56V 4W4KA 2ILMA 3JD2A 4GX1A 3TGUH 5CMUA 1MA1A 5GONA 4TV9A 5H6RA 4DV6B 5LOVA 3CMAV 5ITZB 3TJTA 2KKWA 1DLBA 1MOFA 4RUEA 4LF6B 1Q90D 2DQ0A 2PI4A 1WPXA 3OGCC 2HKOA 4JI0O 3ZEDA 3RYHB 3SR2C 1S5LZ 3CCQV 4DR2B 4FJCC 1N33B 5FL7G 4MVSA 5K1PA 2F4VB 5BY1A 2NLJC 3L72H 1YJNV 2Q67A 2Y0PA 1PNLA 3KCYA 1AJNA 1XUQA 5IDJA 2YICA 3T4DA 1OHHG 2AHZA 4DRXA 1JR9A 3AG1B 4CS2A 2VRZA 3OMNB 4WBNA 4I7ZB 2CH7B 1HP8A 2CTRA 1AI7A 4DUZB 1KP2A 2JGDA 2E76B 2XHBA 1V54B 1URFA 1ZTEA 1JMKC 5KUKA 2Q0AA 3DC6A 4K3AA 4CC5A 1EZVH 4GUNA 3SYOA 1XILA 1NS1A 2DJVA 3WG7C 1OCZC 3MAQA 3E22A 2JIZG 1CP9A 4W4LA 2JJ1G 2CGOA 2P7TC 1M1KW 5L3CA 3BPZA 4GKJB 3OR6C 2N04A 4JV5O 4LF5O 2A9HA 4I55B 1OCZB 4QJFB 1Q7YW 1NKDA 2VWJA 1Y67A 2BSKB 3CRQA 4DUZO 3SPJA 3D3QA 2R9AA 2W6IG 1JPXA 3U11A 4DUYO 1BGYH 4B3SO 1SERA 2F43G 1IBKB 3PJSK 2CTPA 5B5EZ 1F23A 3CB2A 4J41A 1YITV 2AGAA 2Z5UA 4DR3O 2EIJC 3H1HH 4IIJB 2Y48A 4LFCB 4LF8O 3TXQA 4JI4B 1QBZA 3BCCH 2PGGA 4FMTA 1YI2V 4FLUA 3D36A 2PYJA 2QKAA 3JATB 3N2GA 1VF6A 5TISZ 2YIBA 1ZLZA 5L3DA 4MTFA 5KHHA 1BMFG 1HW7A 2R9IA 5CA0B 1XNQO 4X1YB 1GAXA 2DYRC 2AZ2A 3AG3C 3Q4HB 2BCCH 1JOYA 2E74B 1IBKO 1H2MA 3CCLV 1VF5B 4O2AA 1OCOC 2C2AA 3BVOA 3A8TA 1DK1A 2PY5A 4IYIA 1PL0A 2N74A 4A5UB 4PA6A 3O65A 2ZE6A 3G4SV 2Z0AA 4X65O 4JZ2A 3JAMN 4YY3B 2QWPB 3AG1C 1PNMA 2MK3A 4JYYA 2OTJV 3CSXA 4GCZA 3ETDA 3OM3B 3J7AU 1SQXH 4Q6GA 1NT2B 2JS5A 2ODMA 3LSSA 4DV1O 2HJDA 3AK3A 3K3WA 3SJQC 4BW5A 3X2QC 3LDCA 4O4IB 4JI7O 4FLTA 5AG2A 2WPDG 1A32A 5L3BA 5EZYB 4J7JA 1I5YA 5EIBC 3G67A 4WFHA 3STLC 2WLJA 2UUBB 4LWSA 1K92A 5LHIA 2EIMB 3SPIA 1E1RG 1YCIA 3ZHQA 1EZJA 4LF8B 2EIMC 4K8ZA 4LR3A 2Q69A 3ZHVA 4RUFA 2V4DA 3APQA 3H01A 4DR2O 2Q8VA 2ZQMA 4EEQA 1QR8A 5B1AB 5KX5B 2ZE7A 4YJ3A 4K0KO 3IJ4A 3B4SA 5KUMA 4LWSB 3KZIZ 4RAIA 4H13B 4JTDB 2KG7B 1Q81W 2F23A 3CRCA 5J2TB 2AZ0A 4U3JB 3RVZA 4L8JA 1ZUQA 1VQLV 2GDSA 4DXWA 1ZAUA 4TUYB 1M93A 1FJGB 4IHJB 4MSWC 3FB5C 3JALB 5LGTA 2YXYA 1SQGA 1YXBA 3CCSV 1N34O 2H8PC 1H2LA 2LGQA 4CC6A 4XDLA 4YJ2A 1SQBH 1MSWD 1OCCB 1IBMB 2WLHA 3OUFA 3QO8A 2XNDG 5DN6G 1R3IC 4ABMA 4HNAB 3LSQA 2UU9O 5LXTA 2ZDIA 1SETA 5J2UA 1VQ6V 4PELA 3CCVV 3F5TA 3LNNA 1TAEA 4X62B 1Q86W 5IY5B 4DK1A 1GM7A 4JYAB 4DR7O 5IYZB 2P6JA 2ZE8A 2GV9A 2GHYA 1OCOB 5KAIZ 1ZL8B 2EZOA 3NXSA 3FB7C 3THOA 1AB3A 3LSUA 1M57C 3U10A 5IJ0A 5FPOA 4OPHA 3CRAA 4NKGB 2F1MA 2CH7A 4X20B 4TV8A 2ETNA 3RYCA 1L0LH 2UU9B 4QGPA 2ADQB 1KQSU 5LHGA 1BE3H 4XDJA 4YIPA 4XBFA 1SESA 5KMGB 3HKBA 4DK0A 3L71H 5LA6B 4N21A 1AI5A 4MW8A 2JRIA 3RBZA 1I7FA 3DTUB 2PF4E 4MS2A 3A0RA 3L74H 2E5LB 2QSAA 3C90A 2UUAB 1N0NA 1J5EB 3CYOA 3JARA 4JI3B 2ZINA 1R73A 4CS3A 5CB4B 1L8DA 1YF2A 2A79B 4J11A 4R8CA 2BSKA 1QHTA 1YJWV 2HG5C 5B3SB 4BIZA 3ABLB 5A9GA 2XT9A 1M56C 5LMNB 3K5MA 3K5OA 2WA4A 3N27A 4XDKA 1YEWA 1GK9A 3RVYA 3B8NA 4NR1A 4JI0B 3ZMTA 4O4IA 4JI8O 2Y4UA 3UCSC 1BZKA 2AHYA 3K9SA 3OAAG 1BHAA 1KUQA 5EZYA 3BEHA 3DXRA 5CB4A 3R65A 3CEIA 1U97A 4K35A 2B9ZA 1IDSA 3QF7A 2ZM6B 1XNRB 3B77A 1OCRC 1M4UA 4NTXA 4NTWA 3ICXA 2IU3A 4X66B 3SGIA 2BE3A 4J10A 1PKXA 3NR7A 3JYCA 2YXLA 3KKYA 4G2KA 1HNZB 1VIBA 3WB0A 1P7BA 4PA3A 4BW9A 1EM1A 3CC2V 5CBHA 1AR4A 3F5WC 2EX3A 5CA0A 1VF6C 4DR1O 4JPRA 1PNKA 1W59A 4LFBB 2YEVB 3Q4HA 2L35A 3VBBA 3B09A 2W0XA 1F4NA 5IE9A 5LOVB 2Q68A 4P9PA 1B3QA 1FXKC 3UO2A 1E1QG 4X89A 2YDEA 3EVKA 4HBNA 1NH2D 1VP7A 4JAUA 5E79Z 1MZFA 3CCMV 3SYPA 4JV5B 3RYHA 1OZ0A 3N2KA 4RO2A 4JI5B 5KA6A 1R6TA 4G28B 4ZHQA 4JYAO 4BIOA 5LGNA 1OV9A 4I4TA 4E4EA 4MTXA 4FLWA 3OMAB 1K7DA 2K9PA 3EXAA 5HFMA 1XMQB 5JQGB 5L3GA 5JWPA 1Q6HA 1HNZO 3VQVA 1SQFA 1WP8A 5JJJB 5CA1A 4FPPA 3DC5A 3B2EE 1S5JA 1FJGO 1IXBA 2P67A 2XAGA 2ZNJA 1Z5VA 3DSQA 5JVDB 1NVPB 4JTAB 4UUJC 2YS8A 4O4JA 2ZCEA 5IJ0B 3CXCU 4B3MO 5FLXN 2W0FC 4MTGA 4JI6B 1GRJA 2IJIA 3C3SA 2Q4PA 2ZXWC 3VQYA 1DGSA 3E22B 3SPCA 4B3TB 1FAFA 2DWDC 2XAQA 3CRMA 5EBLC 1KB9F 4PA4A 5LL6Y 1N0JA 4R6ZA 4CH3A 2OTLV 3RN4A 3O9OA 3ZN0A 4ZI7A 4EB6B 1XMOO 2VQFB 1M56B 2X0LA 1I0HA 3JARB 3G6BA 4BWAA 3T1HO 3CD6V 1MABG 1S77D 1K4DC 1YJ9V 4X88A 2HP8A 2EINB 1JCHA 3JALA 1LR1A 1FFXA 1COWG 1FKAO 4LF4B 1WJZA 4LF7O 4N23A 2P22C 5JH7A 3R66A 2CTWA 1N36B 2GTSA 3N2GB 4DV3O 4JAAA 2HLDG 3IFXA 4RWUA 2P4VA 3ASOC 4FM0A 1SRYA 2L6LA 2D3OW 4DR6B 2QWNB 4PV1B 4L87A 1HNXO 4J7ZA 1XMOB 2Q9LA 3SYAA 2UXCB 1QR9A 1XL6A 1G8MA 3CC4V 5IYZA 2XASA 4DV7B 1Y66A 4B3TO 4I9WA 4BR6A 1YIJV 1IURA 2M6YA 3VQXA 3OTOO 4X20A 4DV5O 1T5EA 3JAKB 1H8HG 2R9RB 3ZS8C 2QR4A 4LC1A 1JFFB 2QM8A 5CN0A 1HR0O 1RM1C 2Q0OC 1YTFD 4JYCA 1CXZB 5JJNB 5GW7A 2LW1A 2YIAA 3B40A 1HNWO 1JJ2U 2Q7HA 4B3SB 1GKFA 1VARA 3J80N 1Y74B 2AW9A 4JI3O 4UCOA 4CH5A 1DF5A 2EULA 4D6TH 4MVRA 3ASNC 4F6EA 2BOBC 1O9GA 1OCRB 2JVDA 3MHHC 1G1XB 2KB1A 4O2BB 3ZRWA 1Q6IA 4AI8A 2UUBO 2UXBO 2A7WA 4DV2O 3K06A 5KHGA 3K58A 1IBLO 2ATKC 3P30A 1K4CC 2QJ1A 4P30A 4AQYO 1BHBA 2JS3A 1QLNA 2QWOB 3E86A 4J80A 2O57A 1SZTA 1S72V 3DGEA 2YIDA 2OIGA 2DMXA 3ML0A 4KXRA 2PZSA 5LMUO 2ZIOA 4DV3B 5KLVH 1TUEB 1BS3A 2HHHO 2P4KA 4NXMB 3AG4B 4UCTA 2F66C 5LP6C 3U0ZA 1AI4A 4B3RB 1H2GA 2RMKB 1MZEA 2E3CA 2Q7GA 4DR1B 1MG1A 3ABKC 1X59A 3AG7A 1X4TA 4FZ1A 5CBFA 3C3TA 5LHHA 1AR1B 5EIBD 4FIPC 2HJFC 4FM2A 2Y69B 1N34B 4IHJA 3M8AA 1VQ7V 3K03A 3IC7A 2NNUA 4UCRA 1M57B 4LF4O 1SQQH 4DV4O 3HKDA 1SZXA 1N8RW 4I0XA 2EIKB 2LW7A 2UXBB 1KMIZ 2Y0IA 1TVKA 5H5NA 4J9ZB 4PJ0Z 4ZKIA 2KSDA 2XAHA 1FXKA 4MT8A 4DV2B 2RQ6A 1TA8A 3CCJV 1H38A 3JD1A 5L3FA 4LFAB 2M7WA 4WBNB 3CCUV 4LFAO 4J7KA 5FNVA 1Q3EA 3ZIAG 3CMEV 4TT3G 2YXHA 4DR4O 1V9PA 2LGWA 1BL8A 1GN4A 2OT5A 1W0KG 4K0KB 1K73W 3H1JH 4TWKA 3BA8A 4MW3A 3BA9A 1HDJA 4CS4A 2IU0A 2QM4A 3KG2A 4OPAA 2ZIMA 2NR5A 3W7UA 4FLZA 1BT8A 4LNUB 4ZIBA 5B1NA 3ABLC 4JI5O 3AEIA 1QQCA 4I5SA 3QVNA 3MHSC 2ZXWB 4DYLA 1TUBB 4LFCO 4QPJA 3ZMUA 3RYFA 4MVOA 5IJ9B 1R3LC 5LA6A 1B04A 1SC5B 4JZGA 1WB8A 1S3JA 4X1IB 1P84F 1WNSA 4LNUA 3CPWU 4MVMA 3ZMZA 4Z2WA 4LCUC 1YTFB 2YUAA 1N32B 1WA8A 2PUSA 4MVZA 1S5HC 3OD4A 3ZRSA 4J9YB 3BHPA 5EBMC 1XEQA 1N4CA 2HVJC 1K3EA 3WFVA 1RSOA 4G27B 5IWAO 2QWQB 4GX5A 4IL6Z 3FAVA 3ZMVA 5H6QA 2RJZA 1SA0A 1GM9A 2UXNA 3UT5A 1NTKH 4PI0A 3T1YB 2X7RB 1K97A 2OYQA 4X8AA 1N32O 3P3PA 5JJEB 3ZRVA 5H9CA 4ZBMA 2FYUH 1GTOA 5JCOA 3HKEA 4KL1A 4AILC 1I5XA 4X64B 1GMGA 3E8HA 2VQEB 4RQEA 4PDVA 3OEEG 3FYIB 4YJ3B 3E8GA 1W2BU 3AG4C 5LP6B 4CH4A 4O2AB 4H44B 3CJHB 3K79A 1YSCA 3OUSA 2CDYA 1D5AA 4FK5C 4YXWG 4TUYA 1FXVA 5B1AC 3ZN1A 3SJBC 1AP5A 3GVMA 4LH7A 2EBOA 1R3KC 1L1FA 1EN4A 3JASA 3T4ZA 3FKSG 2QKCA 2OCHA 3ZHTA 3ETEA 1IVSA 4JI4O 4Z1MG 1YHQV 3K59A 5DEDA 4BIUA 4FFBA 4DR3B 1F51A 2QEXV 1FS0G 1HR0B 2UUCO 1K5SA 2JK5C 2LJ2A 1NH2B 1VQ9V 1Q6UA 3L9DA 4I4TB 2ITDC 3ZMSA 4GX0A 1FYJA 1TVKB 3ZHRA 1I08A 3L70H 3RT3C 4F4LA 1VQMV 2IM9A 5JQGA 4QPKA 2EJ7A 3AK2A 1AJQA 3ABUA 1EBOA 1ENVA 3ETGA 5KHKA 3JD0A 3JSLA 3MD0A 3MDSA 3UO3A 3E8BA 5K1XA 4AQYB 5B1OA 4O2BA 3FD9A 4WFFA 4I50B 4LFBO 3UKMA 3ZCCA 2B1IA 1FFTB 1CEZA 5JVDA 2WAMA 1UPGA 1SF9A 3UM7A 2UUCB 3CCRV 2LFRA 3OR7C 4LBEC 3SJCC 1N33O 5CA3A 3QO7A 1Q5OA 5LGUA 1H2SB 2D2CB 3PN1A 2XTAA 4LH6A 1AVMA 2Q5ZA 4QE7A 5J2TA 4DR7B 5DM6V 4DR5B 5CBGA 4TOIA 3FYEB 1NZ6A 3W7WA 5B3SC 4EFBA 1SQPH 1CPYA 3P3NA 4P2ZA 1MSDA 1E79G 1M5IA 2IJKA 3CE2A 1H2NA 1Y4MA 1B6QA 3E83A 4JYBA 2IBZH 5KA5A 1P7GA 1TGOA 1JVMA 3HR0A 1P49A 1NR7A 3A2FA 5BR8B 4JI1B 5JH7B 3OTFA 4O4LA 3BABA 4NYKA 4BAYA 3BAAA 2DYRB 4H37A 3N2KB 1U96A 4U3FH 4GX2A 5B1BB 1KP3A 1V55B 5KAFZ 4ZHQB 2E5LO 2XUMA 2A0LA 2QDOA 5ITZA 3QTCA 4F6RB 3K57A 1J5EO 1XBLA 1L0NH 4B7KA 3S3WA 3FX7A 1ZL8A 3SPGA 4JI7B 2ARHA 3IAYA 2UUAO 4MTOA 4IIJA 5IYDO 1QVFU 1ZX3A 5E1AC 1PV0A 1G4YB 2HHHB 1QU7A 1AP6A 3L73H 2JJ2G 3BFRA 1KKDA 1NQTA 4MVUA 4GKJO 1B06A 5IWAB 1JJOA 1XHXA 4X1YA 3J81N 4X1KA 3RYIA 4O4JB 1PM9A 2QTOA 1I94B 5KHIA 1LUVA 3AG2C 1DTOA 3QNEA 3JAKA 2BTQB 4WFAV 3K04A 1ZSPA 1LUWA 1O9HA 4DV0B 1AJPA 3K5NA 3CRRA 5FPRA 1D5NA 3CS5A 4ICGA 3FB8C 3JSNA 4LF7B 3JCUZ 2EILC 3F7YC 5HFLA 2WLMA 4B3RO 1F7YA 1YVWA 1NR1A 2DE0X 2HVKC 5EC2C 1K34A 1H2KA 5EYPB 3HPLC 1XHZA 1Y74A 3G6EV 2BTQA 3APOA 4KUMA 3ZRWB 4PDRA 5DECA 4P9OA 4CH6A 1Q43A 1Z2GA 2YSUB 3JD3A 4EB6A 4DR4B 2ZD9A 2GUZB 4X65B 4OX9B 4PD4F 4IGGA 1KKCA 1AILA 1D2DA 5LYJA 5IT9N 2JGDB 5BXZA 2X6BA 4JI2B 4B7EA 4GLXA 2YI9A 3UT5B 4YHHB 4FVMA 2ZR3A 2UXDB 4LP8A 1RFYA 4FFKA 4UXNA 1KD1W 3S3XA 3E2EA 3LDEA 1AROP 1OCCC 4DV5B 1JA8A 3W7SA 1QLEB 3E89A 2QKSA 5C8YB 4H33A 2WLIB 4HYOA 1NVPD 3G71V 3ZX6A 2CUGA 5LP6A 3W7TA 4QE9A 4X9QA 3CJHA 2WWWA 4OX9O 3E8FA 4UCSA 1M9NA 1Y6XA 3FFQA 2UXDO 2DWEC 4X64O 3ABTA 1R6KA 1XDCA 4I0XB 3LUTB 4WF9V 2XAJA 3JAWB 5C8YA 3HKDB 4PA9A 2DN9A 1PP9H 2ZNIA 4D7TA 1IXMA 2JGUA 5GONB 2GSMB 3I5DA 3ABMB 5B1BC 4TV9B 2WLNA 5A2QN 4FFBB 4IT5A 3ASOB 2VS0A 3ABMC 4C7UA 4E2LA 2P5OA 3GWOA 2PTMA 4X62O 3STZC 1NU1H 1THZA 4YJ2B 4R50A 1Q82W 1F4MA 2ZDIC 4TQFA 3SJAC 3OW2U 4MVQA 3QO5A 2GTAA 2Q6AA 4DW1A 4NXMO 4HNAA 3SYQA 2V1DA 3T1HB 2VWKA 1WN7A 4IYHA 2HFEC 2A3QA 4NVPA 3K9AA 5L3EA 3QG5A 4O4HB 4PDMA 1IZ3A 3T2MA 2CAZC 4UVAA 3RYFB 4X66O 5C93A 2FKXA 3CX5F 1YDXA 2B1GA 1WP7A 4GT1A 1GM8A 2EILB 3D3IA 1GN6A 4O4HA 4ZI7B 1IX9A 1WA8B 1RM1B 4HAMA 4QIWF 3OFNG 1K8AW 1PPJH 4UVBA 1GH6A 1P4RA 2LP7A 1V55C 3B8MA 1V54C 1XMQO 5KMGA 3HKBB 3WU2Z 4KP4A 3RW0A 2MW2B 2FTKA 3ZBHA 3VQWA 1KU9A 4WFGA 1Z5WA 3FAVB 3K0DA 4FLYA 4YHHO 2R72A 3OT7A 3CWBH 4FZ0A 4QNHB 1PD3A 1XREA 4DUYB 4Q20A 4DR5O 1KC8W 1YZBA 5BMVA 2VQEO 4FM1A 2YI8A 3I55V 1FXKB 1WB7A 1BCCH 5LYJB 2YIBD 4HZ3A 2FMLA 4KHPO 3TXSA 3JD4A 1GO3F 2BOCC 4KHPB 2QGNA 3BRCA 3AG2B 5LMUB 3OGIB 2BTOA 2NN4A 3FB6C 4TSFG 4DV4B 2ITCC 1NJIW 3JATA 4DR6O 3H1IH 3TCUA 3OEHG 3SPHA 1XOUA 1VF7A 2CE4A 3ABKB 2YC0A 1JQ0A 1K33A 3JASB 2N05A 4ASUG 4KFMA 2OIEA 4JGSA 2VQFO 5EC1C 2KG7A 1GN2A 2EINC 2HR3A 1VQ8V 1Y76B 4UB6Z 1VQ5V 2IH3C 1XI1A 1JFFA 2JEUA 1VQ4V 1NBMG 2F93B 2XAFA 4U7OA 2EJRA 5EBWC 1WPBA 1MNGA 2K1EA 2RNBA 5B66Z 2EIKC 1QCEA 1SS3A 2P90A 4JTCB 3BY6A 4DW0A 5BZBA 1IBLB 2CGNA 5LMNO 2P06A 4JF3A 4X1IA 3AG3B 4JI1O 2QM7A 4TV8B 4U7NA 3ETQA 5LXTB 4WCEV 1QNMA 5GTHZ 2DQ3A 2R70A 4PDLA 5KHJA 4DRXB 1G6UA 2OCCC 1BQ0A 1NTZH 1EN5A 2ZKOA 4H0LB 1JX9A 4UB8Z 2F4VO 2QE7G 2H3OA 2Q73A 1XQ8A 3EHBB 2RN9A 1PL4A 2WLLA 4DV7O 5BR8O 2OCCB 4I50A 2X6AA 1SA0B 1GN3A 4CBCA 3TK1A 2ADPA 2IW5A 1ROPA 4UV9A 3M99B 3OTOB 4OXSA 4TQDA 4DV6O 4JI6O
chains in the Genus database with same CATH topology
4DW1A 3H9VA 3I5DA 4DW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DW1 A;  3H9V A;  3I5D A;  4DW0 A; 
#chains in the Genus database with same CATH topology
 4NXN B;  1VEW A;  4B3M B;  4DV1 B;  4D7S A;  3CC7 V;  3K08 A;  3A0H Z;  1R3J C;  4GYC B;  2A06 H;  5CA1 B;  1VQK V;  1XL4 A;  4UCV A;  2E75 B;  2UXC O;  4YIO A;  3H9V A;  4LF9 B;  4UCU A;  1N36 O;  2ZR2 A;  2JEX A;  4AHC A;  4PHZ A;  3F7V C;  3T1Y O;  2OWO A;  3DXR B;  2HEP A;  4GZR B;  4YY3 O;  5KX5 A;  1NTM H;  2F95 B;  3HKC B;  2XOK G;  4LF5 B;  1SKV A;  3IC9 A;  1FPO A;  4EFE A;  4PA7 A;  2CTQ A;  3A0B Z;  3UQ8 A;  1K9M W;  1HNX B;  4U3J A;  4DO2 A;  1KBH A;  1KYO F;  1I94 O;  4ZOL A;  2DYS C;  4UV8 A;  2IJH A;  1FD9 A;  3WG7 B;  2EZP A;  5D5P A;  3SYC A;  1R1B A;  3JAW A;  2YEV A;  1BSM A;  4O4L B;  5FNV B;  4NB5 A;  3VOU A;  2DYS B;  3H1L H;  4K8X A;  4EKW A;  1WAZ A;  2Y69 C;  5J9P C;  3EFF K;  2V7Q G;  3GWK C;  3X2Q B;  5LBQ A;  1US6 A;  1QVG U;  5J2U B;  4NXN O;  4OGQ B;  1UFI A;  4NTY A;  4FLV A;  4F6R A;  1VMG A;  3AK1 A;  1NI8 A;  2DOS A;  3RGB A;  1J95 A;  3CHX A;  3K0G A;  2FB5 A;  4LF6 O;  2W6J G;  3L75 H;  3CCE V;  4ZOL B;  3D8C A;  4CZZ A;  1Q8I A;  5EK0 A;  2LO1 A;  2LQT A;  1IBM O;  2EIJ B;  1VQN V;  1ORQ C;  2UXX A;  1WLE A;  2G38 A;  2IH1 C;  2ZT9 B;  2WLK A;  2CK3 G;  1XNQ B;  1EFR G;  1TUB A;  1RPO A;  2WSS G;  3ZHU A;  3SDL A;  4B08 A;  4JI2 O;  3ZRX A;  4Z1V A;  5IJ9 A;  3ASN B;  2ZE5 A;  3OMI B;  1VQP V;  1KEC A;  1EN6 A;  3W7X A;  3RYI B;  4JAV A;  4JI8 B;  1S76 D;  1S0V A;  3WB1 A;  3KCX A;  4JAS A;  3RYC B;  3IGA C;  1Y76 A;  2Y4T A;  4R7C A;  3CXH F;  3K5L A;  1K5Q A;  2QA4 V;  3G80 A;  1MMM A;  4FLX A;  4I55 A;  5EYP A;  4GKK O;  1M90 W;  4I9Q A;  1RSO B;  1VQO V;  2GBO A;  2JDI G;  5H2F Z;  5IY5 C;  2AXT Z;  3JCZ A;  1AR5 A;  1LNQ A;  2WA3 A;  2Q7E A;  1RPR A;  3RWR D;  3WB2 A;  1DF4 A;  1SQV H;  5JCO C;  3M7M X;  5D5Q A;  1H8E G;  1ZWI C;  1QLE C;  2RDC A;  2GUZ A;  5IYC O;  2LFS A;  3HKE B;  3ZJZ A;  2KQX A;  2WLL B;  5F2V O;  2QWR B;  4UFZ A;  3T1C A;  4WFE A;  1BQZ A;  1AI6 A;  4DV0 O;  5IYB O;  3GB7 C;  2PYL A;  2QTS A;  5BMV B;  1HWY A;  3LNM B;  2PI5 A;  1FXH A;  3D36 C;  4WFB V;  2DW4 A;  1RP3 B;  3E35 A;  3TET A;  1FFX B;  5GTI Z;  2B5U A;  2FL4 A;  4UVC A;  3LDD A;  3CP1 A;  2WLI A;  3RFR A;  2ZM6 O;  4RQF A;  3HB3 B;  1XNR O;  1HNW B;  3P32 A;  2Z3Y A;  2X6C A;  3ZHS A;  2IJJ A;  1R6N A;  3OE7 G;  1UJW B;  4LF9 O;  2H94 A;  1OJH A;  3H1K H;  3HKC A;  4GKK B;  2RCV A;  4J42 A;  1W0J G;  4X1K B;  4PI2 A;  3I56 V;  4W4K A;  2ILM A;  3JD2 A;  4GX1 A;  3TGU H;  5CMU A;  1MA1 A;  5GON A;  4TV9 A;  5H6R A;  4DV6 B;  5LOV A;  3CMA V;  5ITZ B;  3TJT A;  2KKW A;  1DLB A;  1MOF A;  4RUE A;  4LF6 B;  1Q90 D;  2DQ0 A;  2PI4 A;  1WPX A;  3OGC C;  2HKO A;  4JI0 O;  3ZED A;  3RYH B;  3SR2 C;  1S5L Z;  3CCQ V;  4DR2 B;  4FJC C;  1N33 B;  5FL7 G;  4MVS A;  5K1P A;  2F4V B;  5BY1 A;  2NLJ C;  3L72 H;  1YJN V;  2Q67 A;  2Y0P A;  1PNL A;  3KCY A;  1AJN A;  1XUQ A;  5IDJ A;  2YIC A;  3T4D A;  1OHH G;  2AHZ A;  4DRX A;  1JR9 A;  3AG1 B;  4CS2 A;  2VRZ A;  3OMN B;  4WBN A;  4I7Z B;  2CH7 B;  1HP8 A;  2CTR A;  1AI7 A;  4DUZ B;  1KP2 A;  2JGD A;  2E76 B;  2XHB A;  1V54 B;  1URF A;  1ZTE A;  1JMK C;  5KUK A;  2Q0A A;  3DC6 A;  4K3A A;  4CC5 A;  1EZV H;  4GUN A;  3SYO A;  1XIL A;  1NS1 A;  2DJV A;  3WG7 C;  1OCZ C;  3MAQ A;  3E22 A;  2JIZ G;  1CP9 A;  4W4L A;  2JJ1 G;  2CGO A;  2P7T C;  1M1K W;  5L3C A;  3BPZ A;  4GKJ B;  3OR6 C;  2N04 A;  4JV5 O;  4LF5 O;  2A9H A;  4I55 B;  1OCZ B;  4QJF B;  1Q7Y W;  1NKD A;  2VWJ A;  1Y67 A;  2BSK B;  3CRQ A;  4DUZ O;  3SPJ A;  3D3Q A;  2R9A A;  2W6I G;  1JPX A;  3U11 A;  4DUY O;  1BGY H;  4B3S O;  1SER A;  2F43 G;  1IBK B;  3PJS K;  2CTP A;  5B5E Z;  1F23 A;  3CB2 A;  4J41 A;  1YIT V;  2AGA A;  2Z5U A;  4DR3 O;  2EIJ C;  3H1H H;  4IIJ B;  2Y48 A;  4LFC B;  4LF8 O;  3TXQ A;  4JI4 B;  1QBZ A;  3BCC H;  2PGG A;  4FMT A;  1YI2 V;  4FLU A;  3D36 A;  2PYJ A;  2QKA A;  3JAT B;  3N2G A;  1VF6 A;  5TIS Z;  2YIB A;  1ZLZ A;  5L3D A;  4MTF A;  5KHH A;  1BMF G;  1HW7 A;  2R9I A;  5CA0 B;  1XNQ O;  4X1Y B;  1GAX A;  2DYR C;  2AZ2 A;  3AG3 C;  3Q4H B;  2BCC H;  1JOY A;  2E74 B;  1IBK O;  1H2M A;  3CCL V;  1VF5 B;  4O2A A;  1OCO C;  2C2A A;  3BVO A;  3A8T A;  1DK1 A;  2PY5 A;  4IYI A;  1PL0 A;  2N74 A;  4A5U B;  4PA6 A;  3O65 A;  2ZE6 A;  3G4S V;  2Z0A A;  4X65 O;  4JZ2 A;  3JAM N;  4YY3 B;  2QWP B;  3AG1 C;  1PNM A;  2MK3 A;  4JYY A;  2OTJ V;  3CSX A;  4GCZ A;  3ETD A;  3OM3 B;  3J7A U;  1SQX H;  4Q6G A;  1NT2 B;  2JS5 A;  2ODM A;  3LSS A;  4DV1 O;  2HJD A;  3AK3 A;  3K3W A;  3SJQ C;  4BW5 A;  3X2Q C;  3LDC A;  4O4I B;  4JI7 O;  4FLT A;  5AG2 A;  2WPD G;  1A32 A;  5L3B A;  5EZY B;  4J7J A;  1I5Y A;  5EIB C;  3G67 A;  4WFH A;  3STL C;  2WLJ A;  2UUB B;  4LWS A;  1K92 A;  5LHI A;  2EIM B;  3SPI A;  1E1R G;  1YCI A;  3ZHQ A;  1EZJ A;  4LF8 B;  2EIM C;  4K8Z A;  4LR3 A;  2Q69 A;  3ZHV A;  4RUF A;  2V4D A;  3APQ A;  3H01 A;  4DR2 O;  2Q8V A;  2ZQM A;  4EEQ A;  1QR8 A;  5B1A B;  5KX5 B;  2ZE7 A;  4YJ3 A;  4K0K O;  3IJ4 A;  3B4S A;  5KUM A;  4LWS B;  3KZI Z;  4RAI A;  4H13 B;  4JTD B;  2KG7 B;  1Q81 W;  2F23 A;  3CRC A;  5J2T B;  2AZ0 A;  4U3J B;  3RVZ A;  4L8J A;  1ZUQ A;  1VQL V;  2GDS A;  4DXW A;  1ZAU A;  4TUY B;  1M93 A;  1FJG B;  4IHJ B;  4MSW C;  3FB5 C;  3JAL B;  5LGT A;  2YXY A;  1SQG A;  1YXB A;  3CCS V;  1N34 O;  2H8P C;  1H2L A;  2LGQ A;  4CC6 A;  4XDL A;  4YJ2 A;  1SQB H;  1MSW D;  1OCC B;  1IBM B;  2WLH A;  3OUF A;  3QO8 A;  2XND G;  5DN6 G;  1R3I C;  4ABM A;  4HNA B;  3LSQ A;  2UU9 O;  5LXT A;  2ZDI A;  1SET A;  5J2U A;  1VQ6 V;  4PEL A;  3CCV V;  3F5T A;  3LNN A;  1TAE A;  4X62 B;  1Q86 W;  5IY5 B;  4DK1 A;  1GM7 A;  4JYA B;  4DR7 O;  5IYZ B;  2P6J A;  2ZE8 A;  2GV9 A;  2GHY A;  1OCO B;  5KAI Z;  1ZL8 B;  2EZO A;  3NXS A;  3FB7 C;  3THO A;  1AB3 A;  3LSU A;  1M57 C;  3U10 A;  5IJ0 A;  5FPO A;  4OPH A;  3CRA A;  4NKG B;  2F1M A;  2CH7 A;  4X20 B;  4TV8 A;  2ETN A;  3RYC A;  1L0L H;  2UU9 B;  4QGP A;  2ADQ B;  1KQS U;  5LHG A;  1BE3 H;  4XDJ A;  4YIP A;  4XBF A;  1SES A;  5KMG B;  3HKB A;  4DK0 A;  3L71 H;  5LA6 B;  4N21 A;  1AI5 A;  4MW8 A;  2JRI A;  3RBZ A;  1I7F A;  3DTU B;  2PF4 E;  4MS2 A;  3A0R A;  3L74 H;  2E5L B;  2QSA A;  3C90 A;  2UUA B;  1N0N A;  1J5E B;  3CYO A;  3JAR A;  4JI3 B;  2ZIN A;  1R73 A;  4CS3 A;  5CB4 B;  1L8D A;  1YF2 A;  2A79 B;  4J11 A;  4R8C A;  2BSK A;  1QHT A;  1YJW V;  2HG5 C;  5B3S B;  4BIZ A;  3ABL B;  5A9G A;  2XT9 A;  1M56 C;  5LMN B;  3K5M A;  3K5O A;  2WA4 A;  3N27 A;  4XDK A;  1YEW A;  1GK9 A;  3RVY A;  3B8N A;  4NR1 A;  4JI0 B;  3ZMT A;  4O4I A;  4JI8 O;  2Y4U A;  3UCS C;  1BZK A;  2AHY A;  3K9S A;  3OAA G;  1BHA A;  1KUQ A;  5EZY A;  3BEH A;  3DXR A;  5CB4 A;  3R65 A;  3CEI A;  1U97 A;  4K35 A;  2B9Z A;  1IDS A;  3QF7 A;  2ZM6 B;  1XNR B;  3B77 A;  1OCR C;  1M4U A;  4NTX A;  4NTW A;  3ICX A;  2IU3 A;  4X66 B;  3SGI A;  2BE3 A;  4J10 A;  1PKX A;  3NR7 A;  3JYC A;  2YXL A;  3KKY A;  4G2K A;  1HNZ B;  1VIB A;  3WB0 A;  1P7B A;  4PA3 A;  4BW9 A;  1EM1 A;  3CC2 V;  5CBH A;  1AR4 A;  3F5W C;  2EX3 A;  5CA0 A;  1VF6 C;  4DR1 O;  4JPR A;  1PNK A;  1W59 A;  4LFB B;  2YEV B;  3Q4H A;  2L35 A;  3VBB A;  3B09 A;  2W0X A;  1F4N A;  5IE9 A;  5LOV B;  2Q68 A;  4P9P A;  1B3Q A;  1FXK C;  3UO2 A;  1E1Q G;  4X89 A;  2YDE A;  3EVK A;  4HBN A;  1NH2 D;  1VP7 A;  4JAU A;  5E79 Z;  1MZF A;  3CCM V;  3SYP A;  4JV5 B;  3RYH A;  1OZ0 A;  3N2K A;  4RO2 A;  4JI5 B;  5KA6 A;  1R6T A;  4G28 B;  4ZHQ A;  4JYA O;  4BIO A;  5LGN A;  1OV9 A;  4I4T A;  4E4E A;  4MTX A;  4FLW A;  3OMA B;  1K7D A;  2K9P A;  3EXA A;  5HFM A;  1XMQ B;  5JQG B;  5L3G A;  5JWP A;  1Q6H A;  1HNZ O;  3VQV A;  1SQF A;  1WP8 A;  5JJJ B;  5CA1 A;  4FPP A;  3DC5 A;  3B2E E;  1S5J A;  1FJG O;  1IXB A;  2P67 A;  2XAG A;  2ZNJ A;  1Z5V A;  3DSQ A;  5JVD B;  1NVP B;  4JTA B;  4UUJ C;  2YS8 A;  4O4J A;  2ZCE A;  5IJ0 B;  3CXC U;  4B3M O;  5FLX N;  2W0F C;  4MTG A;  4JI6 B;  1GRJ A;  2IJI A;  3C3S A;  2Q4P A;  2ZXW C;  3VQY A;  1DGS A;  3E22 B;  3SPC A;  4B3T B;  1FAF A;  2DWD C;  2XAQ A;  3CRM A;  5EBL C;  1KB9 F;  4PA4 A;  5LL6 Y;  1N0J A;  4R6Z A;  4CH3 A;  2OTL V;  3RN4 A;  3O9O A;  3ZN0 A;  4ZI7 A;  4EB6 B;  1XMO O;  2VQF B;  1M56 B;  2X0L A;  1I0H A;  3JAR B;  3G6B A;  4BWA A;  3T1H O;  3CD6 V;  1MAB G;  1S77 D;  1K4D C;  1YJ9 V;  4X88 A;  2HP8 A;  2EIN B;  1JCH A;  3JAL A;  1LR1 A;  1FFX A;  1COW G;  1FKA O;  4LF4 B;  1WJZ A;  4LF7 O;  4N23 A;  2P22 C;  5JH7 A;  3R66 A;  2CTW A;  1N36 B;  2GTS A;  3N2G B;  4DV3 O;  4JAA A;  2HLD G;  3IFX A;  4RWU A;  2P4V A;  3ASO C;  4FM0 A;  1SRY A;  2L6L A;  2D3O W;  4DR6 B;  2QWN B;  4PV1 B;  4L87 A;  1HNX O;  4J7Z A;  1XMO B;  2Q9L A;  3SYA A;  2UXC B;  1QR9 A;  1XL6 A;  1G8M A;  3CC4 V;  5IYZ A;  2XAS A;  4DV7 B;  1Y66 A;  4B3T O;  4I9W A;  4BR6 A;  1YIJ V;  1IUR A;  2M6Y A;  3VQX A;  3OTO O;  4X20 A;  4DV5 O;  1T5E A;  3JAK B;  1H8H G;  2R9R B;  3ZS8 C;  2QR4 A;  4LC1 A;  1JFF B;  2QM8 A;  5CN0 A;  1HR0 O;  1RM1 C;  2Q0O C;  1YTF D;  4JYC A;  1CXZ B;  5JJN B;  5GW7 A;  2LW1 A;  2YIA A;  3B40 A;  1HNW O;  1JJ2 U;  2Q7H A;  4B3S B;  1GKF A;  1VAR A;  3J80 N;  1Y74 B;  2AW9 A;  4JI3 O;  4UCO A;  4CH5 A;  1DF5 A;  2EUL A;  4D6T H;  4MVR A;  3ASN C;  4F6E A;  2BOB C;  1O9G A;  1OCR B;  2JVD A;  3MHH C;  1G1X B;  2KB1 A;  4O2B B;  3ZRW A;  1Q6I A;  4AI8 A;  2UUB O;  2UXB O;  2A7W A;  4DV2 O;  3K06 A;  5KHG A;  3K58 A;  1IBL O;  2ATK C;  3P30 A;  1K4C C;  2QJ1 A;  4P30 A;  4AQY O;  1BHB A;  2JS3 A;  1QLN A;  2QWO B;  3E86 A;  4J80 A;  2O57 A;  1SZT A;  1S72 V;  3DGE A;  2YID A;  2OIG A;  2DMX A;  3ML0 A;  4KXR A;  2PZS A;  5LMU O;  2ZIO A;  4DV3 B;  5KLV H;  1TUE B;  1BS3 A;  2HHH O;  2P4K A;  4NXM B;  3AG4 B;  4UCT A;  2F66 C;  5LP6 C;  3U0Z A;  1AI4 A;  4B3R B;  1H2G A;  2RMK B;  1MZE A;  2E3C A;  2Q7G A;  4DR1 B;  1MG1 A;  3ABK C;  1X59 A;  3AG7 A;  1X4T A;  4FZ1 A;  5CBF A;  3C3T A;  5LHH A;  1AR1 B;  5EIB D;  4FIP C;  2HJF C;  4FM2 A;  2Y69 B;  1N34 B;  4IHJ A;  3M8A A;  1VQ7 V;  3K03 A;  3IC7 A;  2NNU A;  4UCR A;  1M57 B;  4LF4 O;  1SQQ H;  4DV4 O;  3HKD A;  1SZX A;  1N8R W;  4I0X A;  2EIK B;  2LW7 A;  2UXB B;  1KMI Z;  2Y0I A;  1TVK A;  5H5N A;  4J9Z B;  4PJ0 Z;  4ZKI A;  2KSD A;  2XAH A;  1FXK A;  4MT8 A;  4DV2 B;  2RQ6 A;  1TA8 A;  3CCJ V;  1H38 A;  3JD1 A;  5L3F A;  4LFA B;  2M7W A;  4WBN B;  3CCU V;  4LFA O;  4J7K A;  5FNV A;  1Q3E A;  3ZIA G;  3CME V;  4TT3 G;  2YXH A;  4DR4 O;  1V9P A;  2LGW A;  1BL8 A;  1GN4 A;  2OT5 A;  1W0K G;  4K0K B;  1K73 W;  3H1J H;  4TWK A;  3BA8 A;  4MW3 A;  3BA9 A;  1HDJ A;  4CS4 A;  2IU0 A;  2QM4 A;  3KG2 A;  4OPA A;  2ZIM A;  2NR5 A;  3W7U A;  4FLZ A;  1BT8 A;  4LNU B;  4ZIB A;  5B1N A;  3ABL C;  4JI5 O;  3AEI A;  1QQC A;  4I5S A;  3QVN A;  3MHS C;  2ZXW B;  4DYL A;  1TUB B;  4LFC O;  4QPJ A;  3ZMU A;  3RYF A;  4MVO A;  5IJ9 B;  1R3L C;  5LA6 A;  1B04 A;  1SC5 B;  4JZG A;  1WB8 A;  1S3J A;  4X1I B;  1P84 F;  1WNS A;  4LNU A;  3CPW U;  4MVM A;  3ZMZ A;  4Z2W A;  4LCU C;  1YTF B;  2YUA A;  1N32 B;  1WA8 A;  2PUS A;  4MVZ A;  1S5H C;  3OD4 A;  3ZRS A;  4J9Y B;  3BHP A;  5EBM C;  1XEQ A;  1N4C A;  2HVJ C;  1K3E A;  3WFV A;  1RSO A;  4G27 B;  5IWA O;  2QWQ B;  4GX5 A;  4IL6 Z;  3FAV A;  3ZMV A;  5H6Q A;  2RJZ A;  1SA0 A;  1GM9 A;  2UXN A;  3UT5 A;  1NTK H;  4PI0 A;  3T1Y B;  2X7R B;  1K97 A;  2OYQ A;  4X8A A;  1N32 O;  3P3P A;  5JJE B;  3ZRV A;  5H9C A;  4ZBM A;  2FYU H;  1GTO A;  5JCO A;  3HKE A;  4KL1 A;  4AIL C;  1I5X A;  4X64 B;  1GMG A;  3E8H A;  2VQE B;  4RQE A;  4PDV A;  3OEE G;  3FYI B;  4YJ3 B;  3E8G A;  1W2B U;  3AG4 C;  5LP6 B;  4CH4 A;  4O2A B;  4H44 B;  3CJH B;  3K79 A;  1YSC A;  3OUS A;  2CDY A;  1D5A A;  4FK5 C;  4YXW G;  4TUY A;  1FXV A;  5B1A C;  3ZN1 A;  3SJB C;  1AP5 A;  3GVM A;  4LH7 A;  2EBO A;  1R3K C;  1L1F A;  1EN4 A;  3JAS A;  3T4Z A;  3FKS G;  2QKC A;  2OCH A;  3ZHT A;  3ETE A;  1IVS A;  4JI4 O;  4Z1M G;  1YHQ V;  3K59 A;  5DED A;  4BIU A;  4FFB A;  4DR3 B;  1F51 A;  2QEX V;  1FS0 G;  1HR0 B;  2UUC O;  1K5S A;  2JK5 C;  2LJ2 A;  1NH2 B;  1VQ9 V;  1Q6U A;  3L9D A;  4I4T B;  2ITD C;  3ZMS A;  4GX0 A;  1FYJ A;  1TVK B;  3ZHR A;  1I08 A;  3L70 H;  3RT3 C;  4F4L A;  1VQM V;  2IM9 A;  5JQG A;  4QPK A;  2EJ7 A;  3AK2 A;  1AJQ A;  3ABU A;  1EBO A;  1ENV A;  3ETG A;  5KHK A;  3JD0 A;  3JSL A;  3MD0 A;  3MDS A;  3UO3 A;  3E8B A;  5K1X A;  4AQY B;  5B1O A;  4O2B A;  3FD9 A;  4WFF A;  4I50 B;  4LFB O;  3UKM A;  3ZCC A;  2B1I A;  1FFT B;  1CEZ A;  5JVD A;  2WAM A;  1UPG A;  1SF9 A;  3UM7 A;  2UUC B;  3CCR V;  2LFR A;  3OR7 C;  4LBE C;  3SJC C;  1N33 O;  5CA3 A;  3QO7 A;  1Q5O A;  5LGU A;  1H2S B;  2D2C B;  3PN1 A;  2XTA A;  4LH6 A;  1AVM A;  2Q5Z A;  4QE7 A;  5J2T A;  4DR7 B;  5DM6 V;  4DR5 B;  5CBG A;  4TOI A;  3FYE B;  1NZ6 A;  3W7W A;  5B3S C;  4EFB A;  1SQP H;  1CPY A;  3P3N A;  4P2Z A;  1MSD A;  1E79 G;  1M5I A;  2IJK A;  3CE2 A;  1H2N A;  1Y4M A;  1B6Q A;  3E83 A;  4JYB A;  2IBZ H;  5KA5 A;  1P7G A;  1TGO A;  1JVM A;  3HR0 A;  1P49 A;  1NR7 A;  3A2F A;  5BR8 B;  4JI1 B;  5JH7 B;  3OTF A;  4O4L A;  3BAB A;  4NYK A;  4BAY A;  3BAA A;  2DYR B;  4H37 A;  3N2K B;  1U96 A;  4U3F H;  4GX2 A;  5B1B B;  1KP3 A;  1V55 B;  5KAF Z;  4ZHQ B;  2E5L O;  2XUM A;  2A0L A;  2QDO A;  5ITZ A;  3QTC A;  4F6R B;  3K57 A;  1J5E O;  1XBL A;  1L0N H;  4B7K A;  3S3W A;  3FX7 A;  1ZL8 A;  3SPG A;  4JI7 B;  2ARH A;  3IAY A;  2UUA O;  4MTO A;  4IIJ A;  5IYD O;  1QVF U;  1ZX3 A;  5E1A C;  1PV0 A;  1G4Y B;  2HHH B;  1QU7 A;  1AP6 A;  3L73 H;  2JJ2 G;  3BFR A;  1KKD A;  1NQT A;  4MVU A;  4GKJ O;  1B06 A;  5IWA B;  1JJO A;  1XHX A;  4X1Y A;  3J81 N;  4X1K A;  3RYI A;  4O4J B;  1PM9 A;  2QTO A;  1I94 B;  5KHI A;  1LUV A;  3AG2 C;  1DTO A;  3QNE A;  3JAK A;  2BTQ B;  4WFA V;  3K04 A;  1ZSP A;  1LUW A;  1O9H A;  4DV0 B;  1AJP A;  3K5N A;  3CRR A;  5FPR A;  1D5N A;  3CS5 A;  4ICG A;  3FB8 C;  3JSN A;  4LF7 B;  3JCU Z;  2EIL C;  3F7Y C;  5HFL A;  2WLM A;  4B3R O;  1F7Y A;  1YVW A;  1NR1 A;  2DE0 X;  2HVK C;  5EC2 C;  1K34 A;  1H2K A;  5EYP B;  3HPL C;  1XHZ A;  1Y74 A;  3G6E V;  2BTQ A;  3APO A;  4KUM A;  3ZRW B;  4PDR A;  5DEC A;  4P9O A;  4CH6 A;  1Q43 A;  1Z2G A;  2YSU B;  3JD3 A;  4EB6 A;  4DR4 B;  2ZD9 A;  2GUZ B;  4X65 B;  4OX9 B;  4PD4 F;  4IGG A;  1KKC A;  1AIL A;  1D2D A;  5LYJ A;  5IT9 N;  2JGD B;  5BXZ A;  2X6B A;  4JI2 B;  4B7E A;  4GLX A;  2YI9 A;  3UT5 B;  4YHH B;  4FVM A;  2ZR3 A;  2UXD B;  4LP8 A;  1RFY A;  4FFK A;  4UXN A;  1KD1 W;  3S3X A;  3E2E A;  3LDE A;  1ARO P;  1OCC C;  4DV5 B;  1JA8 A;  3W7S A;  1QLE B;  3E89 A;  2QKS A;  5C8Y B;  4H33 A;  2WLI B;  4HYO A;  1NVP D;  3G71 V;  3ZX6 A;  2CUG A;  5LP6 A;  3W7T A;  4QE9 A;  4X9Q A;  3CJH A;  2WWW A;  4OX9 O;  3E8F A;  4UCS A;  1M9N A;  1Y6X A;  3FFQ A;  2UXD O;  2DWE C;  4X64 O;  3ABT A;  1R6K A;  1XDC A;  4I0X B;  3LUT B;  4WF9 V;  2XAJ A;  3JAW B;  5C8Y A;  3HKD B;  4PA9 A;  2DN9 A;  1PP9 H;  2ZNI A;  4D7T A;  1IXM A;  2JGU A;  5GON B;  2GSM B;  3I5D A;  3ABM B;  5B1B C;  4TV9 B;  2WLN A;  5A2Q N;  4FFB B;  4IT5 A;  3ASO B;  2VS0 A;  3ABM C;  4C7U A;  4E2L A;  2P5O A;  3GWO A;  2PTM A;  4X62 O;  3STZ C;  1NU1 H;  1THZ A;  4YJ2 B;  4R50 A;  1Q82 W;  1F4M A;  2ZDI C;  4TQF A;  3SJA C;  3OW2 U;  4MVQ A;  3QO5 A;  2GTA A;  2Q6A A;  4DW1 A;  4NXM O;  4HNA A;  3SYQ A;  2V1D A;  3T1H B;  2VWK A;  1WN7 A;  4IYH A;  2HFE C;  2A3Q A;  4NVP A;  3K9A A;  5L3E A;  3QG5 A;  4O4H B;  4PDM A;  1IZ3 A;  3T2M A;  2CAZ C;  4UVA A;  3RYF B;  4X66 O;  5C93 A;  2FKX A;  3CX5 F;  1YDX A;  2B1G A;  1WP7 A;  4GT1 A;  1GM8 A;  2EIL B;  3D3I A;  1GN6 A;  4O4H A;  4ZI7 B;  1IX9 A;  1WA8 B;  1RM1 B;  4HAM A;  4QIW F;  3OFN G;  1K8A W;  1PPJ H;  4UVB A;  1GH6 A;  1P4R A;  2LP7 A;  1V55 C;  3B8M A;  1V54 C;  1XMQ O;  5KMG A;  3HKB B;  3WU2 Z;  4KP4 A;  3RW0 A;  2MW2 B;  2FTK A;  3ZBH A;  3VQW A;  1KU9 A;  4WFG A;  1Z5W A;  3FAV B;  3K0D A;  4FLY A;  4YHH O;  2R72 A;  3OT7 A;  3CWB H;  4FZ0 A;  4QNH B;  1PD3 A;  1XRE A;  4DUY B;  4Q20 A;  4DR5 O;  1KC8 W;  1YZB A;  5BMV A;  2VQE O;  4FM1 A;  2YI8 A;  3I55 V;  1FXK B;  1WB7 A;  1BCC H;  5LYJ B;  2YIB D;  4HZ3 A;  2FML A;  4KHP O;  3TXS A;  3JD4 A;  1GO3 F;  2BOC C;  4KHP B;  2QGN A;  3BRC A;  3AG2 B;  5LMU B;  3OGI B;  2BTO A;  2NN4 A;  3FB6 C;  4TSF G;  4DV4 B;  2ITC C;  1NJI W;  3JAT A;  4DR6 O;  3H1I H;  3TCU A;  3OEH G;  3SPH A;  1XOU A;  1VF7 A;  2CE4 A;  3ABK B;  2YC0 A;  1JQ0 A;  1K33 A;  3JAS B;  2N05 A;  4ASU G;  4KFM A;  2OIE A;  4JGS A;  2VQF O;  5EC1 C;  2KG7 A;  1GN2 A;  2EIN C;  2HR3 A;  1VQ8 V;  1Y76 B;  4UB6 Z;  1VQ5 V;  2IH3 C;  1XI1 A;  1JFF A;  2JEU A;  1VQ4 V;  1NBM G;  2F93 B;  2XAF A;  4U7O A;  2EJR A;  5EBW C;  1WPB A;  1MNG A;  2K1E A;  2RNB A;  5B66 Z;  2EIK C;  1QCE A;  1SS3 A;  2P90 A;  4JTC B;  3BY6 A;  4DW0 A;  5BZB A;  1IBL B;  2CGN A;  5LMN O;  2P06 A;  4JF3 A;  4X1I A;  3AG3 B;  4JI1 O;  2QM7 A;  4TV8 B;  4U7N A;  3ETQ A;  5LXT B;  4WCE V;  1QNM A;  5GTH Z;  2DQ3 A;  2R70 A;  4PDL A;  5KHJ A;  4DRX B;  1G6U A;  2OCC C;  1BQ0 A;  1NTZ H;  1EN5 A;  2ZKO A;  4H0L B;  1JX9 A;  4UB8 Z;  2F4V O;  2QE7 G;  2H3O A;  2Q73 A;  1XQ8 A;  3EHB B;  2RN9 A;  1PL4 A;  2WLL A;  4DV7 O;  5BR8 O;  2OCC B;  4I50 A;  2X6A A;  1SA0 B;  1GN3 A;  4CBC A;  3TK1 A;  2ADP A;  2IW5 A;  1ROP A;  4UV9 A;  3M99 B;  3OTO B;  4OXS A;  4TQD A;  4DV6 O;  4JI6 O; 
#chains in the Genus database with same CATH homology
 4DW1 A;  3H9V A;  3I5D A;  4DW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...