3I5DA

Crystal structure of the atp-gated p2x4 ion channel in the closed, apo state at 3.5 angstroms (r3)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
324
structure length
324
Chain Sequence
RFTQALVIAYVIGYVCVYNKGYQDTDTVLSSVTTKVKGIALTNTSELGERIWDVADYIIPPQEDGSFFVLTNMIITTNQTQSKCAENPTPASTCTSHRDCKRGFNDARGDGVRTGRCVSYSASVKTCEVLSWCPLEKIVDPPNPPLLADAENFTVLIKNNIRYPKFNFNKRNILPNINSSYLTHCVFSRKTDPDCPIFRLGDIVGEAEEDFQIMAVRGGVMGVQIRWDCDLDMPQSWCVPRYTFRRLDNKDPDNNVAPGYNFRFAKYYKNSDGTETRTLIKGYGIRFDVMVFGQAGKFNIIPTLLNIGAGLALLGLVNVICDWI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ATP-gated P2X(4) ion channel in the closed state.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transport protein
molecule keywords P2X purinoceptor
total genus 60
structure length 324
sequence length 324
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.940 Mainly Alpha Orthogonal Bundle Helix Hairpins atp-gated p2x4 ion channel 3i5dA01
2.60.490.10 Mainly Beta Sandwich atp-gated p2x4 ion channel fold atp-gated p2x4 ion channel domain 3i5dA02
4DW0A 4DW1A 3I5DA 3H9VA
chains in the Genus database with same CATH superfamily
4AILC 1X4TA 4JTAB 1L0LH 1SQQH 2PF4E 4HBNA 4Q20A 2IU3A 1Y76B 1QHTA 4PJ0Z 1Z5VA 2F93B 4FM1A 2FYUH 4QGPA 3HKEB 4X62B 4I4TA 3IGAC 1IBLO 1JA8A 1QNMA 3G4SV 3ASNC 4JI5B 3G80A 4EFEA 3CCQV 5GONB 4DYLA 4QIWF 3J81N 3E35A 1VIBA 2YC0A 2XHBA 3ZMZA 3GB7C 3RFRA 3OMNB 3B09A 4UB8Z 3AEIA 3VBBA 4B7KA 1ROPA 1FXVA 1R3LC 4H37A 3D8CA 4ZHQA 5FNVB 3QO7A 2FKXA 3RN4A 2GTSA 4DV5B 3SPGA 5KHKA 2P6JA 3X2QB 5LGTA 4O2AB 4DR7B 4O4LA 5L3BA 4MVQA 3BA8A 3DTUB 1F4NA 3OTOB 1R6NA 4LF7B 4DR1B 2CGOA 4DO2A 1XMQB 4XBFA 1K9MW 1URFA 4GX0A 4BAYA 5H9CA 4TUYA 3CRQA 1WNSA 2ZQMA 1GH6A 4FLZA 2RQ6A 2ZE8A 3H1IH 2ZXWB 4ZBMA 4DV0O 3EXAA 4WFAV 1Y74A 5JQGB 1VQOV 1RPOA 3CYOA 4UFZA 1AP6A 3SYOA 2OCHA 2UUCB 4B3SB 2VS0A 3K59A 1I5XA 1NR1A 4DV7B 1N34B 3L9DA 1WP7A 1FXKB 1NR7A 1D2DA 1QBZA 4DRXB 2O57A 4BW9A 5EBWC 2ADPA 2ARHA 3LSSA 2ZM6O 4X89A 4U3JB 2JEXA 3ZMTA 2BCCH 5BR8O 1EN6A 3QVNA 4WCEV 3CRAA 5KA6A 1Q90D 1T5EA 3LUTB 5LA6B 2ITCC 3IC7A 1FJGO 3JARA 4IIJB 1KP2A 2D2CB 5KX5A 3SJCC 4BR6A 1OCZB 1G1XB 5LOVA 4JGSA 4TWKA 4P2ZA 2HVKC 5GTIZ 3LDEA 1YEWA 3K06A 4I50A 5IYZA 4MVRA 1Q86W 3JCZA 3BHPA 4X66B 2VWKA 4KHPB 3ZMUA 2CH7A 3E8FA 4EFBA 5B3SB 2EIKB 4F4LA 4DV6B 3FB7C 5B66Z 1AJQA 1NU1H 2YXHA 4CC5A 5JJNB 2F4VB 4B3SO 3ZCCA 1BT8A 1Q81W 3GWKC 2RMKB 2UUCO 2YXYA 3VQYA 1I08A 4YY3O 2G38A 4DV0B 3BEHA 1B3QA 4UV8A 3K5MA 1OV9A 2JDIG 4LC1A 3CRMA 1AI7A 2Q68A 1JJ2U 2BE3A 4Z2WA 3DC6A 4FZ1A 3K9AA 3FB5C 3CCVV 3SPJA 3R65A 1PP9H 3KKYA 1WA8A 1YI2V 3X2QC 1SS3A 1QVFU 2HHHO 3RGBA 3OTOO 1HWYA 1CEZA 3E89A 3ABMB 4CBCA 3PJSK 1YVWA 4AQYB 3H1KH 1TUEB 3DXRB 2WA4A 4JI0B 5KMGB 1Y6XA 1YF2A 3OEEG 4JYYA 3D3IA 3HKEA 3HPLC 2YIAA 5CA1A 1EBOA 1W0JG 4DV5O 2VRZA 3ZEDA 1SQBH 2ZIOA 4E4EA 3ETGA 5ITZB 3KCXA 4D7TA 1SETA 1TAEA 2Y4TA 1TUBA 2WLHA 1HW7A 1V9PA 1P49A 2K9PA 3SPIA 4GT1A 5IT9N 4FLWA 3RYFB 4ZI7B 5LOVB 4TOIA 1M56C 1SF9A 2WLIA 5LHGA 3CWBH 1AI4A 1RPRA 4JYAO 4FZ0A 5FL7G 1SQPH 2WLJA 4LF5O 1GO3F 5IDJA 1Q43A 4MTXA 4JI5O 3E8GA 2YDEA 5CA3A 4DV4B 2UXBB 1M5IA 3T4DA 3TXSA 4TQFA 3G71V 3AG3C 2QR4A 4ZHQB 1P7BA 2HJFC 1R3KC 2XAQA 1IXMA 4I5SA 3ABKC 5JH7B 3D3QA 3BPZA 1LUWA 2A0LA 1YJ9V 5GTHZ 1L1FA 4LH6A 2XTAA 4K3AA 1R6TA 3FB8C 3FX7A 5CA0A 3ASNB 4R8CA 4JPRA 1N33O 2QJ1A 4QNHB 4FLTA 4JTCB 2QWRB 1H2GA 4WFBV 1Z2GA 3BVOA 1H8EG 2F1MA 4PHZA 3P32A 1Q6IA 2PI4A 2YSUB 3FB6C 1K7DA 3AG7A 2UUBB 3W7UA 3J80N 3T1YB 1RFYA 4LWSA 2LGWA 2UXDO 1OCRC 5IWAB 2C2AA 1DF4A 4UV9A 4DV6O 3ZMVA 4MSWC 3G6BA 1BSMA 1M57C 1WLEA 4X66O 3WG7C 3S3WA 3T1CA 2OIEA 1WJZA 2VQFO 1M9NA 1XMQO 2QEXV 1S72V 2EILB 4YJ2B 1PPJH 2JJ1G 1K4DC 1OCOB 4LFCB 4JI8B 1Z5WA 4NB5A 3JD3A 4I50B 5IYZB 4YY3B 2JS5A 5B5EZ 5JJEB 2NR5A 2IJKA 4DR2O 5EYPB 4FFBA 3HB3B 1NH2D 2E5LB 1Y66A 5J2UB 5EIBC 3OMAB 3WB0A 1XL6A 3E8BA 5J2TB 1ZL8A 3E83A 2V7QG 3RT3C 4JI6O 3QF7A 5E79Z 5LGUA 5KHIA 4EEQA 3OT7A 3UO3A 2V1DA 3FFQA 2EIJB 4JAAA 5LP6B 1FFXB 1BCCH 2HR3A 3GVMA 4JI7B 3ABMC 4X1IB 1VQ8V 3TXQA 4MW3A 4EB6A 1RSOB 1EFRG 1X59A 5B3SC 2EJRA 4AI8A 1DK1A 4NVPA 1FFTB 1VF7A 3H9VA 3AK3A 3W7XA 1JOYA 3SJAC 2ITDC 2JEUA 3C3SA 4TV9A 5GW7A 4NR1A 3SJBC 2UXBO 5JVDB 4LFBO 4D7SA 1TA8A 1E1RG 3TETA 3JALB 3BFRA 1YZBA 1HR0B 2P67A 1MNGA 5DECA 1QLNA 1XQ8A 4JI3O 1IX9A 5C93A 5H2FZ 1AJNA 4OXSA 4GKKO 2Q0OC 2QWQB 2HLDG 3SPHA 2YIBD 4WFFA 1XUQA 2RJZA 4GX1A 3A8TA 4JTDB 1NI8A 2IH3C 1D5NA 1QVGU 3LDCA 4H13B 3E86A 3SR2C 2YI9A 3ZX6A 2HP8A 2GSMB 2WSSG 1MOFA 2OT5A 1ZL8B 2HKOA 2WLNA 4I0XA 4DR3O 2LFSA 1FAFA 2KB1A 4FPPA 3C90A 1GAXA 3P3NA 4UCTA 1BQ0A 4RQFA 4F6EA 3TK1A 1FD9A 2P4VA 5LP6A 4X65B 1OCRB 2Q6AA 2GUZA 2ZIMA 2W0FC 1WP8A 5IYBO 1WPXA 3FAVA 2VQEO 1Y74B 2R9IA 3H01A 2ZKOA 2DYRC 3N27A 3ZN1A 3HKCA 5JCOC 1R73A 5CB4A 1BE3H 4HNAB 4JZ2A 4K0KO 5L3FA 3H1LH 4DUZB 2Z5UA 4O4HB 3OR6C 2L6LA 4DV3O 5EZYB 3RYCB 3O65A 3I5DA 3OM3B 1SA0B 4O4JA 2PI5A 1JR9A 4MS2A 1IZ3A 2ATKC 4AHCA 3NR7A 3RYIA 3S3XA 3BCCH 2A79B 2JVDA 1HNXO 2B1IA 4ABMA 2UXCO 5C8YA 1AJPA 1SQGA 3SYCA 2DOSA 4JZGA 2KG7B 3CCLV 1QLEB 2CUGA 1PL4A 2OYQA 3T1HB 4K0KB 1HP8A 1XNRB 2UU9O 1LNQA 3FD9A 1NVPD 2DWDC 3ETEA 5IY5C 3LNMB 4MVOA 2BTOA 3BRCA 3SGIA 4UCSA 4I9QA 3JAWA 1H2KA 1OCOC 2VQFB 2LGQA 1G4YB 3LDDA 1XI1A 4J7ZA 3JD2A 4MVZA 3OMIB 4PDLA 3STZC 1GN2A 1PL0A 1N34O 4LF4O 2ZT9B 3SDLA 5H5NA 3JD4A 1IVSA 4GKJB 2QWNB 4P9OA 1ZLZA 5B1NA 2EIMC 1FXKC 2Q73A 1THZA 3O9OA 4R7CA 1HNXB 1MSWD 2YEVA 3H1HH 5FPOA 4CS3A 1NT2B 4NXMB 2H94A 1JFFA 1AR5A 4GKKB 4N21A 4YIPA 3CRCA 1N36B 4JV5B 4WFHA 2F95B 5LMNO 4F6RA 2GHYA 1Y67A 2WLLB 4DUZO 4DK0A 4GYCB 1S5LZ 1ZTEA 1EM1A 5EZYA 3VQWA 4JI2B 4Z1MG 2Y0IA 4IIJA 3MHHC 5JQGA 2Y4UA 1VF6C 4LFBB 2CK3G 2W0XA 4X20A 4U3JA 4MTFA 4QE7A 3JALA 4L87A 3RBZA 4DV4O 1DTOA 1IBKB 3ZHTA 3K5LA 1EZJA 1FXKA 2AHYA 4PI0A 4LH7A 3ZRSA 3ZIAG 1SC5B 4B3MO 4G28B 3N2GB 3P30A 2BSKB 3CCJV 2F66C 2PTMA 3OR7C 2E74B 2Q9LA 4BIUA 4JI1O 2ODMA 4FLVA 4LF6O 1ENVA 2ZDIC 3AG2C 1QR9A 2ZXWC 1UFIA 2XAJA 3ZRXA 2E75B 3OEHG 4QPJA 4J41A 1IXBA 4YHHO 3RW0A 1IDSA 1ZSPA 4OPAA 4LF8B 2ZNJA 1MZEA 5KHGA 5EBMC 1K97A 4U7OA 4ZOLA 1M90W 2L35A 4X8AA 1VF6A 1W2BU 2UUAO 1XBLA 5B1AB 2DW4A 4BIOA 4DR6O 1K33A 2YEVB 1JX9A 5KAIZ 1J5EO 4B3RB 4IL6Z 2JGDB 5KHJA 2HHHB 4J9YB 2ILMA 4XDJA 1SZXA 1PKXA 2EULA 4PV1B 3DGEA 1VF5B 2IBZH 4CS2A 1MMMA 4PA7A 2RNBA 1VQ5V 3MHSC 2PGGA 3CJHA 3IFXA 2FMLA 3CHXA 5IWAO 1KYOF 4OGQB 1M1KW 1GN6A 1OCCC 2XNDG 2LJ2A 2EILC 4UXNA 1IBMO 3HKCB 3RVYA 4CH4A 2EINB 3HKBA 2Y69B 3BAAA 2RCVA 3RYIB 5EK0A 4KFMA 3FKSG 4U7NA 3ASOB 4OX9O 3RYCA 4O2BA 2DYSC 2MW2B 2R9RB 2H8PC 5TISZ 4BW5A 2KG7A 1PNKA 3L74H 4PA6A 2EJ7A 1YSCA 2EIKC 1WAZA 4DXWA 5DM6V 2BSKA 2LP7A 2CAZC 3QO5A 1F51A 2HFEC 5C8YB 4RO2A 2FL4A 4JI4O 3OD4A 4CS4A 4LBEC 4LF9B 1W0KG 2XT9A 2PY5A 4G27B 1S5HC 1V54C 1NJIW 5K1PA 2QDOA 3ZHQA 3SYAA 4CH5A 5CBHA 4UVCA 3B2EE 4PELA 1U97A 2W6JG 5IJ0B 3UO2A 4C7UA 4E2LA 4DV7O 1S0VA 5H6QA 5JCOA 4DUYO 3B77A 1K5QA 4LR3A 4NTWA 4UCRA 5L3DA 1AI6A 3BA9A 5DN6G 1BHBA 4R50A 1SERA 4CH3A 1O9HA 3L73H 3ML0A 4GUNA 1S3JA 2WAMA 1VQ7V 4I55A 3IJ4A 4PD4F 2P5OA 1NZ6A 1HNZB 2KQXA 4ZIBA 1N32O 3H1JH 4IGGA 1Q3EA 2QKAA 5IJ9A 4GLXA 3WG7B 1TVKA 2B1GA 3K57A 4F6RB 4B3RO 4DR7O 2WLLA 4IYIA 5CMUA 5CBFA 1KMIZ 3ZRWB 4DW1A 1SQXH 4J7KA 3W7SA 2JS3A 5BMVB 5K1XA 2CTPA 2JGUA 1VQKV 2DWEC 1JCHA 3F7VC 2R9AA 2N74A 1J95A 3ZRVA 1HDJA 4O2AA 1VQMV 5J2UA 3R66A 3ZBHA 1FKAO 5J2TA 2X7RB 3AG3B 4J11A 3P3PA 1OJHA 5IYCO 3Q4HB 1GTOA 3QTCA 4FIPC 2CTWA 2PZSA 1AB3A 3VOUA 4JI2O 4MTOA 1Q8IA 2X6CA 4JF3A 3JAKA 3WB2A 4FLXA 3D36C 3L75H 3N2GA 5KAFZ 1IBLB 1DF5A 1KUQA 4GX2A 4DR5B 4JV5O 3W7TA 1Q5OA 1Y4MA 2P4KA 2ZNIA 2LQTA 5EYPA 1Q7YW 4UVAA 4B08A 3AG4B 4OX9B 2JGDA 5LHHA 3E2EA 3ZN0A 4FK5C 3CC4V 2OIGA 1VQ9V 2RDCA 3THOA 3STLC 4BIZA 2LO1A 2Q0AA 2QM8A 3AG1B 4JAVA 1IBMB 1RSOA 1N8RW 2PYLA 5EBLC 3CPWU 1GM7A 3CJHB 3JD1A 2X0LA 3OE7G 1XMOO 4O4JB 1TVKB 4X1IA 4WFGA 5BY1A 4P9PA 2ZR2A 1H2MA 5H6RA 4NXMO 2LFRA 4ZKIA 1HNZO 2ZD9A 1CP9A 2JIZG 2NN4A 3F5TA 2BTQA 4FM2A 3ETDA 3JYCA 4J10A 1SQFA 5BMVA 3PN1A 2P90A 5IE9A 1R1BA 4MVSA 2WWWA 5KUMA 4UCUA 2UUBO 2UUAB 1B06A 1GN4A 4H44B 2F23A 5LMUB 2LW7A 3MDSA 2EBOA 2DQ3A 2XAHA 3AG4C 4U3FH 3Q4HA 3LNNA 2ZINA 3SYPA 3IC9A 2YI8A 5IY5B 2IH1C 4IT5A 1YCIA 4FVMA 4HZ3A 4DR1O 4X64O 2DYSB 2DE0X 1MSDA 3J7AU 2D3OW 1FS0G 3QNEA 5AG2A 1NTZH 2ZE5A 5L3GA 2N05A 1XILA 1FJGB 3A0RA 1JPXA 2YS8A 4X1YB 1H2SB 5BR8B 2GBOA 3OAAG 4KL1A 1KBHA 3TCUA 2Q7HA 2WLKA 4YJ3B 1Q6UA 3ZHUA 3JATA 3HKDB 2B9ZA 4DV2B 1NS1A 3EVKA 5IJ0A 4UB6Z 1N0JA 2Y0PA 2BOBC 4LFAB 4DR5O 5LYJA 1H2LA 5A9GA 3M7MX 2GV9A 1BQZA 5B1OA 2CTRA 1SRYA 3TJTA 3UCSC 2Q8VA 2E3CA 4TSFG 2EIJC 3E8HA 4NXNO 3RYHA 5HFLA 1QLEC 5B1AC 5EIBD 3B8NA 4O4IB 4MTGA 5CB4B 1NTKH 5LHIA 2YUAA 3WB1A 5LL6Y 4CZZA 1DLBA 1M57B 1TGOA 1YDXA 2IW5A 4FJCC 4FM0A 1AVMA 5J9PC 4DV2O 1HNWO 1KKCA 3DXRA 4LF7O 3UT5B 2P22C 1MZFA 3JSNA 3OUSA 2EIMB 1KKDA 5L3EA 4I9WA 1XEQA 1QCEA 1XNQB 1KECA 1ZAUA 4YIOA 4PA4A 1NTMH 5LXTA 4DV1O 5ITZA 3K5NA 2A3QA 1S77D 2YXLA 4AQYO 4IHJB 1S76D 1B04A 1O9GA 3L72H 3OUFA 3CRRA 1N32B 3RYFA 4ZI7A 1HNWB 4BWAA 2E76B 2A06H 2P06A 1D5AA 5LP6C 2WLIB 3CCSV 4MVUA 4JASA 2XASA 3CMEV 2WLMA 1N0NA 4H33A 4QPKA 4JI3B 5FLXN 1PNLA 4OPHA 4JI1B 4DK1A 2Y69C 4J7JA 3A0HZ 1Q82W 1HR0O 1LUVA 1ORQC 2QKSA 2ZE7A 1CXZB 3OTFA 3HKDA 4J42A 3T2MA 1WB8A 4TV8A 1YTFD 3A0BZ 4X62O 3SJQC 4NTXA 5JH7A 2K1EA 2Q7GA 4RUFA 1KD1W 4K8XA 1Q6HA 3DC5A 3DSQA 3K08A 2OWOA 1KP3A 2IJHA 2DQ0A 1QU7A 2DMXA 4W4KA 4DR2B 4UCVA 2MK3A 1AR4A 4MW8A 3LSUA 3KG2A 1I7FA 2IJJA 3CXCU 4RQEA 1EZVH 1AR1B 1JVMA 4LF9O 4NKGB 2AHZA 2UXNA 5GONA 5KA5A 2KSDA 3W7WA 2VQEB 3UQ8A 2YICA 4JI6B 4X88A 1S5JA 4I4TB 1KU9A 4L8JA 1U96A 3JD0A 4G2KA 2DJVA 3T4ZA 2R72A 3AG1C 3K03A 2F43G 2OCCB 3C3TA 2JK5C 1PM9A 1I94B 3E22A 1XL4A 1ZUQA 3B40A 1FXHA 3U0ZA 3K58A 4WBNB 3L70H 1M93A 5KUKA 4PDVA 4X64B 1MA1A 1FFXA 1BZKA 3ICXA 2PYJA 4J9ZB 1KB9F 5FNVA 1SQVH 1RM1B 2Q4PA 1I0HA 2YIBA 4H0LB 3ZHSA 1OCCB 4A5UB 4EB6B 3ABKB 2GTAA 2UXDB 4ZOLB 4R6ZA 1BGYH 3A2FA 4FFBB 3K79A 3T1YO 4UUJC 4YXWG 1UJWB 1XNRO 1V54B 3ZHRA 3CX5F 4DV1B 3OGCC 2QKCA 1R3IC 4KXRA 1K92A 5EC1C 2ETNA 1EN4A 3HKBB 3AG2B 4PDMA 3VQVA 1PD3A 4IYHA 2Q5ZA 4GX5A 2M6YA 3CCMV 4QE9A 1K8AW 3U10A 3ABUA 5BZBA 4DRXA 3I55V 2QWPB 1XMOB 2Y48A 3CE2A 3RYHB 4MVMA 4PA9A 1XHXA 1E1QG 1CPYA 1N4CA 4Q6GA 5LYJB 2PUSA 4NXNB 1P84F 3IAYA 1L0NH 2IM9A 3K0GA 4XDLA 2EZOA 2RN9A 4Z1VA 4JI7O 2DN9A 3CCEV 1OZ0A 1G6UA 1L8DA 4X65O 5JJJB 4UCOA 1VQ4V 3CMAV 1COWG 4CH6A 4QJFB 3M99B 2ADQB 2Z3YA 1FPOA 3UT5A 4DR4O 1XHZA 3ABLC 2CGNA 4WBNA 1F7YA 3KCYA 1M4UA 5B1BC 3LSQA 1GM9A 1SZTA 3JARB 2W6IG 4XDKA 2WPDG 4X1KB 5KX5B 1JMKC 1YHQV 3K04A 3JAKB 3CXHF 4GZRB 3K5OA 4JI4B 3WU2Z 5F2VO 4FMTA 4O4LB 4DW0A 4K8ZA 5LMNB 1AILA 2CTQA 2QSAA 1B6QA 3F7YC 3RVZA 2ZDIA 2AGAA 2NLJC 2XOKG 4FFKA 3APOA 3B8MA 3U11A 3OGIB 2OTLV 1H38A 5A2QN 3CD6V 1YITV 4JYCA 4TV8B 1P7GA 2E5LO 1F4MA 2X6AA 2HJDA 1I5YA 3CC2V 1RP3B 3D36A 2UXXA 3UM7A 4I55B 1VEWA 2GUZB 3ZRWA 4PA3A 5KMGA 4GKJO 3CS5A 2F4VO 4JI8O 4LFCO 1K5SA 5JWPA 1F23A 3ASOC 2B5UA 1JJOA 4LP8A 3N2KB 4B7EA 1TUBB 3EFFK 3JASB 2XUMA 3GWOA 1W59A 2QA4V 2KKWA 5LMUO 3JCUZ 1R3JC 3AK2A 1YXBA 1GMGA 1G8MA 3T1HO 4B3TB 1K73W 3WFVA 3UKMA 2HEPA 3OW2U 1NKDA 1ZWIC 4JYBA 2UXCB 1US6A 5D5PA 1YTFB 1KQSU 3K0DA 3NXSA 1VMGA 3FYEB 1NH2B 3TGUH 1PNMA 1XREA 1YJWV 1NVPB 1DGSA 2A9HA 1LR1A 4WF9V 1N33B 4DV3B 3JAWB 1SKVA 2QGNA 3L71H 4X1YA 4NYKA 3E22B 3EHBB 5DEDA 3JSLA 1WB7A 1BL8A 5CA0B 2QTOA 4ICGA 1H8HG 1AROP 5D5QA 4DR4B 3ZJZA 3JATB 3K3WA 1Y76A 2QM4A 4W4LA 3I56V 3G67A 4PI2A 1GKFA 2AW9A 4DR3B 1BMFG 2BTQB 4KP4A 1GN3A 4LWSB 4X9QA 1BHAA 4TQDA 2QE7G 1J5EB 1V55C 1ZX3A 3ABTA 1VQLV 2GDSA 3QO8A 1UPGA 2WA3A 1K34A 4JYAB 2Z0AA 1JFFB 2EINC 4NTYA 4YHHB 5CA1B 5LBQA 4YJ2A 2V4DA 3JASA 3RWRD 1YJNV 2AZ2A 2N04A 1WPBA 3ZS8C 5HFMA 1BS3A 5L3CA 1OHHG 2X6BA 5FPRA 1GK9A 4PDRA 2OTJV 1OCZC 4X20B 3ETQA 4EKWA 1XNQO 1QQCA 4LNUA 5B1BB 2ZCEA 3ABLB 1VP7A 3F5WC 2IU0A 4TUYB 1VARA 1AP5A 4KHPO 4GCZA 2Q69A 3ZHVA 1WN7A 1PV0A 3FYIB 3KZIZ 2IJIA 3MD0A 4K35A 4LF5B 2A7WA 2FB5A 3SPCA 1AI5A 3OFNG 3AK1A 4X1KA 2QWOB 2LW1A 3SYQA 4LFAO 2Q67A 5EC2C 2ZR3A 4YJ3A 1YIJV 1MG1A 4FLUA 1IBKO 2JJ2G 2CE4A 4WFEA 5CBGA 2ZM6B 4ASUG 5JVDA 2VWJA 2Q7EA 4DUYB 5KHHA 2BOCC 3B4SA 5CN0A 2OCCC 4P30A 2JRIA 1GRJA 4TV9B 5LGNA 1XDCA 5LA6A 4JI0O 1K4CC 4B3TO 3G6EV 4O4IA 2QM7A 2HG5C 3CSXA 4RAIA 1XOUA 3VQXA 1R6KA 4HYOA 2EX3A 1H2NA 1E79G 3K9SA 4CC6A 1SESA 2QTSA 1N36O 1KC8W 2XAGA 2AZ0A 1NQTA 3MAQA 1VQNV 1IURA 2H3OA 4RWUA 2FTKA 3CP1A 5KLVH 3QG5A 4I0XB 3N2KA 1QR8A 5LXTB 4LNUB 4RUEA 5E1AC 2NNUA 4LCUC 3M8AA 2CH7B 3CEIA 1I94O 1VQ6V 4N23A 1M56B 4O2BB 2DYRB 4MT8A 3JAMN 1FYJA 2AXTZ 2R70A 3BY6A 4LF4B 2YIDA 4TT3G 2XAFA 1JQ0A 4LF8O 4KUMA 2M7WA 3APQA 1GM8A 4HAMA 4IHJA 1WA8B 3BABA 4HNAA 1K3EA 3HR0A 2P7TC 1RM1C 3CCRV 1EN5A 3CCUV 4LF6B 5IYDO 4I7ZB 1NBMG 3FAVB 1MABG 3ZMSA 2UU9B 4UVBA 2ZE6A 2HVJC 3CB2A 4J80A 1V55B 2CDYA 5IJ9B 3CC7V 1SA0A 2EZPA 4B3MB 4DR6B 4JAUA 1A32A 1VQPV 1P4RA 4FLYA 4D6TH 5BXZA 4O4HA
chains in the Genus database with same CATH topology
4DW0A 4DW1A 3I5DA 3H9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DW0 A;  4DW1 A;  3I5D A;  3H9V A; 
#chains in the Genus database with same CATH topology
 4AIL C;  1X4T A;  4JTA B;  1L0L H;  1SQQ H;  2PF4 E;  4HBN A;  4Q20 A;  2IU3 A;  1Y76 B;  1QHT A;  4PJ0 Z;  1Z5V A;  2F93 B;  4FM1 A;  2FYU H;  4QGP A;  3HKE B;  4X62 B;  4I4T A;  3IGA C;  1IBL O;  1JA8 A;  1QNM A;  3G4S V;  3ASN C;  4JI5 B;  3G80 A;  4EFE A;  3CCQ V;  5GON B;  4DYL A;  4QIW F;  3J81 N;  3E35 A;  1VIB A;  2YC0 A;  2XHB A;  3ZMZ A;  3GB7 C;  3RFR A;  3OMN B;  3B09 A;  4UB8 Z;  3AEI A;  3VBB A;  4B7K A;  1ROP A;  1FXV A;  1R3L C;  4H37 A;  3D8C A;  4ZHQ A;  5FNV B;  3QO7 A;  2FKX A;  3RN4 A;  2GTS A;  4DV5 B;  3SPG A;  5KHK A;  2P6J A;  3X2Q B;  5LGT A;  4O2A B;  4DR7 B;  4O4L A;  5L3B A;  4MVQ A;  3BA8 A;  3DTU B;  1F4N A;  3OTO B;  1R6N A;  4LF7 B;  4DR1 B;  2CGO A;  4DO2 A;  1XMQ B;  4XBF A;  1K9M W;  1URF A;  4GX0 A;  4BAY A;  5H9C A;  4TUY A;  3CRQ A;  1WNS A;  2ZQM A;  1GH6 A;  4FLZ A;  2RQ6 A;  2ZE8 A;  3H1I H;  2ZXW B;  4ZBM A;  4DV0 O;  3EXA A;  4WFA V;  1Y74 A;  5JQG B;  1VQO V;  1RPO A;  3CYO A;  4UFZ A;  1AP6 A;  3SYO A;  2OCH A;  2UUC B;  4B3S B;  2VS0 A;  3K59 A;  1I5X A;  1NR1 A;  4DV7 B;  1N34 B;  3L9D A;  1WP7 A;  1FXK B;  1NR7 A;  1D2D A;  1QBZ A;  4DRX B;  2O57 A;  4BW9 A;  5EBW C;  2ADP A;  2ARH A;  3LSS A;  2ZM6 O;  4X89 A;  4U3J B;  2JEX A;  3ZMT A;  2BCC H;  5BR8 O;  1EN6 A;  3QVN A;  4WCE V;  3CRA A;  5KA6 A;  1Q90 D;  1T5E A;  3LUT B;  5LA6 B;  2ITC C;  3IC7 A;  1FJG O;  3JAR A;  4IIJ B;  1KP2 A;  2D2C B;  5KX5 A;  3SJC C;  4BR6 A;  1OCZ B;  1G1X B;  5LOV A;  4JGS A;  4TWK A;  4P2Z A;  2HVK C;  5GTI Z;  3LDE A;  1YEW A;  3K06 A;  4I50 A;  5IYZ A;  4MVR A;  1Q86 W;  3JCZ A;  3BHP A;  4X66 B;  2VWK A;  4KHP B;  3ZMU A;  2CH7 A;  3E8F A;  4EFB A;  5B3S B;  2EIK B;  4F4L A;  4DV6 B;  3FB7 C;  5B66 Z;  1AJQ A;  1NU1 H;  2YXH A;  4CC5 A;  5JJN B;  2F4V B;  4B3S O;  3ZCC A;  1BT8 A;  1Q81 W;  3GWK C;  2RMK B;  2UUC O;  2YXY A;  3VQY A;  1I08 A;  4YY3 O;  2G38 A;  4DV0 B;  3BEH A;  1B3Q A;  4UV8 A;  3K5M A;  1OV9 A;  2JDI G;  4LC1 A;  3CRM A;  1AI7 A;  2Q68 A;  1JJ2 U;  2BE3 A;  4Z2W A;  3DC6 A;  4FZ1 A;  3K9A A;  3FB5 C;  3CCV V;  3SPJ A;  3R65 A;  1PP9 H;  3KKY A;  1WA8 A;  1YI2 V;  3X2Q C;  1SS3 A;  1QVF U;  2HHH O;  3RGB A;  3OTO O;  1HWY A;  1CEZ A;  3E89 A;  3ABM B;  4CBC A;  3PJS K;  1YVW A;  4AQY B;  3H1K H;  1TUE B;  3DXR B;  2WA4 A;  4JI0 B;  5KMG B;  1Y6X A;  1YF2 A;  3OEE G;  4JYY A;  3D3I A;  3HKE A;  3HPL C;  2YIA A;  5CA1 A;  1EBO A;  1W0J G;  4DV5 O;  2VRZ A;  3ZED A;  1SQB H;  2ZIO A;  4E4E A;  3ETG A;  5ITZ B;  3KCX A;  4D7T A;  1SET A;  1TAE A;  2Y4T A;  1TUB A;  2WLH A;  1HW7 A;  1V9P A;  1P49 A;  2K9P A;  3SPI A;  4GT1 A;  5IT9 N;  4FLW A;  3RYF B;  4ZI7 B;  5LOV B;  4TOI A;  1M56 C;  1SF9 A;  2WLI A;  5LHG A;  3CWB H;  1AI4 A;  1RPR A;  4JYA O;  4FZ0 A;  5FL7 G;  1SQP H;  2WLJ A;  4LF5 O;  1GO3 F;  5IDJ A;  1Q43 A;  4MTX A;  4JI5 O;  3E8G A;  2YDE A;  5CA3 A;  4DV4 B;  2UXB B;  1M5I A;  3T4D A;  3TXS A;  4TQF A;  3G71 V;  3AG3 C;  2QR4 A;  4ZHQ B;  1P7B A;  2HJF C;  1R3K C;  2XAQ A;  1IXM A;  4I5S A;  3ABK C;  5JH7 B;  3D3Q A;  3BPZ A;  1LUW A;  2A0L A;  1YJ9 V;  5GTH Z;  1L1F A;  4LH6 A;  2XTA A;  4K3A A;  1R6T A;  3FB8 C;  3FX7 A;  5CA0 A;  3ASN B;  4R8C A;  4JPR A;  1N33 O;  2QJ1 A;  4QNH B;  4FLT A;  4JTC B;  2QWR B;  1H2G A;  4WFB V;  1Z2G A;  3BVO A;  1H8E G;  2F1M A;  4PHZ A;  3P32 A;  1Q6I A;  2PI4 A;  2YSU B;  3FB6 C;  1K7D A;  3AG7 A;  2UUB B;  3W7U A;  3J80 N;  3T1Y B;  1RFY A;  4LWS A;  2LGW A;  2UXD O;  1OCR C;  5IWA B;  2C2A A;  1DF4 A;  4UV9 A;  4DV6 O;  3ZMV A;  4MSW C;  3G6B A;  1BSM A;  1M57 C;  1WLE A;  4X66 O;  3WG7 C;  3S3W A;  3T1C A;  2OIE A;  1WJZ A;  2VQF O;  1M9N A;  1XMQ O;  2QEX V;  1S72 V;  2EIL B;  4YJ2 B;  1PPJ H;  2JJ1 G;  1K4D C;  1OCO B;  4LFC B;  4JI8 B;  1Z5W A;  4NB5 A;  3JD3 A;  4I50 B;  5IYZ B;  4YY3 B;  2JS5 A;  5B5E Z;  5JJE B;  2NR5 A;  2IJK A;  4DR2 O;  5EYP B;  4FFB A;  3HB3 B;  1NH2 D;  2E5L B;  1Y66 A;  5J2U B;  5EIB C;  3OMA B;  3WB0 A;  1XL6 A;  3E8B A;  5J2T B;  1ZL8 A;  3E83 A;  2V7Q G;  3RT3 C;  4JI6 O;  3QF7 A;  5E79 Z;  5LGU A;  5KHI A;  4EEQ A;  3OT7 A;  3UO3 A;  2V1D A;  3FFQ A;  2EIJ B;  4JAA A;  5LP6 B;  1FFX B;  1BCC H;  2HR3 A;  3GVM A;  4JI7 B;  3ABM C;  4X1I B;  1VQ8 V;  3TXQ A;  4MW3 A;  4EB6 A;  1RSO B;  1EFR G;  1X59 A;  5B3S C;  2EJR A;  4AI8 A;  1DK1 A;  4NVP A;  1FFT B;  1VF7 A;  3H9V A;  3AK3 A;  3W7X A;  1JOY A;  3SJA C;  2ITD C;  2JEU A;  3C3S A;  4TV9 A;  5GW7 A;  4NR1 A;  3SJB C;  2UXB O;  5JVD B;  4LFB O;  4D7S A;  1TA8 A;  1E1R G;  3TET A;  3JAL B;  3BFR A;  1YZB A;  1HR0 B;  2P67 A;  1MNG A;  5DEC A;  1QLN A;  1XQ8 A;  4JI3 O;  1IX9 A;  5C93 A;  5H2F Z;  1AJN A;  4OXS A;  4GKK O;  2Q0O C;  2QWQ B;  2HLD G;  3SPH A;  2YIB D;  4WFF A;  1XUQ A;  2RJZ A;  4GX1 A;  3A8T A;  4JTD B;  1NI8 A;  2IH3 C;  1D5N A;  1QVG U;  3LDC A;  4H13 B;  3E86 A;  3SR2 C;  2YI9 A;  3ZX6 A;  2HP8 A;  2GSM B;  2WSS G;  1MOF A;  2OT5 A;  1ZL8 B;  2HKO A;  2WLN A;  4I0X A;  4DR3 O;  2LFS A;  1FAF A;  2KB1 A;  4FPP A;  3C90 A;  1GAX A;  3P3N A;  4UCT A;  1BQ0 A;  4RQF A;  4F6E A;  3TK1 A;  1FD9 A;  2P4V A;  5LP6 A;  4X65 B;  1OCR B;  2Q6A A;  2GUZ A;  2ZIM A;  2W0F C;  1WP8 A;  5IYB O;  1WPX A;  3FAV A;  2VQE O;  1Y74 B;  2R9I A;  3H01 A;  2ZKO A;  2DYR C;  3N27 A;  3ZN1 A;  3HKC A;  5JCO C;  1R73 A;  5CB4 A;  1BE3 H;  4HNA B;  4JZ2 A;  4K0K O;  5L3F A;  3H1L H;  4DUZ B;  2Z5U A;  4O4H B;  3OR6 C;  2L6L A;  4DV3 O;  5EZY B;  3RYC B;  3O65 A;  3I5D A;  3OM3 B;  1SA0 B;  4O4J A;  2PI5 A;  1JR9 A;  4MS2 A;  1IZ3 A;  2ATK C;  4AHC A;  3NR7 A;  3RYI A;  3S3X A;  3BCC H;  2A79 B;  2JVD A;  1HNX O;  2B1I A;  4ABM A;  2UXC O;  5C8Y A;  1AJP A;  1SQG A;  3SYC A;  2DOS A;  4JZG A;  2KG7 B;  3CCL V;  1QLE B;  2CUG A;  1PL4 A;  2OYQ A;  3T1H B;  4K0K B;  1HP8 A;  1XNR B;  2UU9 O;  1LNQ A;  3FD9 A;  1NVP D;  2DWD C;  3ETE A;  5IY5 C;  3LNM B;  4MVO A;  2BTO A;  3BRC A;  3SGI A;  4UCS A;  4I9Q A;  3JAW A;  1H2K A;  1OCO C;  2VQF B;  2LGQ A;  1G4Y B;  3LDD A;  1XI1 A;  4J7Z A;  3JD2 A;  4MVZ A;  3OMI B;  4PDL A;  3STZ C;  1GN2 A;  1PL0 A;  1N34 O;  4LF4 O;  2ZT9 B;  3SDL A;  5H5N A;  3JD4 A;  1IVS A;  4GKJ B;  2QWN B;  4P9O A;  1ZLZ A;  5B1N A;  2EIM C;  1FXK C;  2Q73 A;  1THZ A;  3O9O A;  4R7C A;  1HNX B;  1MSW D;  2YEV A;  3H1H H;  5FPO A;  4CS3 A;  1NT2 B;  4NXM B;  2H94 A;  1JFF A;  1AR5 A;  4GKK B;  4N21 A;  4YIP A;  3CRC A;  1N36 B;  4JV5 B;  4WFH A;  2F95 B;  5LMN O;  4F6R A;  2GHY A;  1Y67 A;  2WLL B;  4DUZ O;  4DK0 A;  4GYC B;  1S5L Z;  1ZTE A;  1EM1 A;  5EZY A;  3VQW A;  4JI2 B;  4Z1M G;  2Y0I A;  4IIJ A;  3MHH C;  5JQG A;  2Y4U A;  1VF6 C;  4LFB B;  2CK3 G;  2W0X A;  4X20 A;  4U3J A;  4MTF A;  4QE7 A;  3JAL A;  4L87 A;  3RBZ A;  4DV4 O;  1DTO A;  1IBK B;  3ZHT A;  3K5L A;  1EZJ A;  1FXK A;  2AHY A;  4PI0 A;  4LH7 A;  3ZRS A;  3ZIA G;  1SC5 B;  4B3M O;  4G28 B;  3N2G B;  3P30 A;  2BSK B;  3CCJ V;  2F66 C;  2PTM A;  3OR7 C;  2E74 B;  2Q9L A;  4BIU A;  4JI1 O;  2ODM A;  4FLV A;  4LF6 O;  1ENV A;  2ZDI C;  3AG2 C;  1QR9 A;  2ZXW C;  1UFI A;  2XAJ A;  3ZRX A;  2E75 B;  3OEH G;  4QPJ A;  4J41 A;  1IXB A;  4YHH O;  3RW0 A;  1IDS A;  1ZSP A;  4OPA A;  4LF8 B;  2ZNJ A;  1MZE A;  5KHG A;  5EBM C;  1K97 A;  4U7O A;  4ZOL A;  1M90 W;  2L35 A;  4X8A A;  1VF6 A;  1W2B U;  2UUA O;  1XBL A;  5B1A B;  2DW4 A;  4BIO A;  4DR6 O;  1K33 A;  2YEV B;  1JX9 A;  5KAI Z;  1J5E O;  4B3R B;  4IL6 Z;  2JGD B;  5KHJ A;  2HHH B;  4J9Y B;  2ILM A;  4XDJ A;  1SZX A;  1PKX A;  2EUL A;  4PV1 B;  3DGE A;  1VF5 B;  2IBZ H;  4CS2 A;  1MMM A;  4PA7 A;  2RNB A;  1VQ5 V;  3MHS C;  2PGG A;  3CJH A;  3IFX A;  2FML A;  3CHX A;  5IWA O;  1KYO F;  4OGQ B;  1M1K W;  1GN6 A;  1OCC C;  2XND G;  2LJ2 A;  2EIL C;  4UXN A;  1IBM O;  3HKC B;  3RVY A;  4CH4 A;  2EIN B;  3HKB A;  2Y69 B;  3BAA A;  2RCV A;  3RYI B;  5EK0 A;  4KFM A;  3FKS G;  4U7N A;  3ASO B;  4OX9 O;  3RYC A;  4O2B A;  2DYS C;  2MW2 B;  2R9R B;  2H8P C;  5TIS Z;  4BW5 A;  2KG7 A;  1PNK A;  3L74 H;  4PA6 A;  2EJ7 A;  1YSC A;  2EIK C;  1WAZ A;  4DXW A;  5DM6 V;  2BSK A;  2LP7 A;  2CAZ C;  3QO5 A;  1F51 A;  2HFE C;  5C8Y B;  4RO2 A;  2FL4 A;  4JI4 O;  3OD4 A;  4CS4 A;  4LBE C;  4LF9 B;  1W0K G;  2XT9 A;  2PY5 A;  4G27 B;  1S5H C;  1V54 C;  1NJI W;  5K1P A;  2QDO A;  3ZHQ A;  3SYA A;  4CH5 A;  5CBH A;  4UVC A;  3B2E E;  4PEL A;  1U97 A;  2W6J G;  5IJ0 B;  3UO2 A;  4C7U A;  4E2L A;  4DV7 O;  1S0V A;  5H6Q A;  5JCO A;  4DUY O;  3B77 A;  1K5Q A;  4LR3 A;  4NTW A;  4UCR A;  5L3D A;  1AI6 A;  3BA9 A;  5DN6 G;  1BHB A;  4R50 A;  1SER A;  4CH3 A;  1O9H A;  3L73 H;  3ML0 A;  4GUN A;  1S3J A;  2WAM A;  1VQ7 V;  4I55 A;  3IJ4 A;  4PD4 F;  2P5O A;  1NZ6 A;  1HNZ B;  2KQX A;  4ZIB A;  1N32 O;  3H1J H;  4IGG A;  1Q3E A;  2QKA A;  5IJ9 A;  4GLX A;  3WG7 B;  1TVK A;  2B1G A;  3K57 A;  4F6R B;  4B3R O;  4DR7 O;  2WLL A;  4IYI A;  5CMU A;  5CBF A;  1KMI Z;  3ZRW B;  4DW1 A;  1SQX H;  4J7K A;  3W7S A;  2JS3 A;  5BMV B;  5K1X A;  2CTP A;  2JGU A;  1VQK V;  2DWE C;  1JCH A;  3F7V C;  2R9A A;  2N74 A;  1J95 A;  3ZRV A;  1HDJ A;  4O2A A;  1VQM V;  5J2U A;  3R66 A;  3ZBH A;  1FKA O;  5J2T A;  2X7R B;  3AG3 B;  4J11 A;  3P3P A;  1OJH A;  5IYC O;  3Q4H B;  1GTO A;  3QTC A;  4FIP C;  2CTW A;  2PZS A;  1AB3 A;  3VOU A;  4JI2 O;  4MTO A;  1Q8I A;  2X6C A;  4JF3 A;  3JAK A;  3WB2 A;  4FLX A;  3D36 C;  3L75 H;  3N2G A;  5KAF Z;  1IBL B;  1DF5 A;  1KUQ A;  4GX2 A;  4DR5 B;  4JV5 O;  3W7T A;  1Q5O A;  1Y4M A;  2P4K A;  2ZNI A;  2LQT A;  5EYP A;  1Q7Y W;  4UVA A;  4B08 A;  3AG4 B;  4OX9 B;  2JGD A;  5LHH A;  3E2E A;  3ZN0 A;  4FK5 C;  3CC4 V;  2OIG A;  1VQ9 V;  2RDC A;  3THO A;  3STL C;  4BIZ A;  2LO1 A;  2Q0A A;  2QM8 A;  3AG1 B;  4JAV A;  1IBM B;  1RSO A;  1N8R W;  2PYL A;  5EBL C;  3CPW U;  1GM7 A;  3CJH B;  3JD1 A;  2X0L A;  3OE7 G;  1XMO O;  4O4J B;  1TVK B;  4X1I A;  4WFG A;  5BY1 A;  4P9P A;  2ZR2 A;  1H2M A;  5H6R A;  4NXM O;  2LFR A;  4ZKI A;  1HNZ O;  2ZD9 A;  1CP9 A;  2JIZ G;  2NN4 A;  3F5T A;  2BTQ A;  4FM2 A;  3ETD A;  3JYC A;  4J10 A;  1SQF A;  5BMV A;  3PN1 A;  2P90 A;  5IE9 A;  1R1B A;  4MVS A;  2WWW A;  5KUM A;  4UCU A;  2UUB O;  2UUA B;  1B06 A;  1GN4 A;  4H44 B;  2F23 A;  5LMU B;  2LW7 A;  3MDS A;  2EBO A;  2DQ3 A;  2XAH A;  3AG4 C;  4U3F H;  3Q4H A;  3LNN A;  2ZIN A;  3SYP A;  3IC9 A;  2YI8 A;  5IY5 B;  2IH1 C;  4IT5 A;  1YCI A;  4FVM A;  4HZ3 A;  4DR1 O;  4X64 O;  2DYS B;  2DE0 X;  1MSD A;  3J7A U;  2D3O W;  1FS0 G;  3QNE A;  5AG2 A;  1NTZ H;  2ZE5 A;  5L3G A;  2N05 A;  1XIL A;  1FJG B;  3A0R A;  1JPX A;  2YS8 A;  4X1Y B;  1H2S B;  5BR8 B;  2GBO A;  3OAA G;  4KL1 A;  1KBH A;  3TCU A;  2Q7H A;  2WLK A;  4YJ3 B;  1Q6U A;  3ZHU A;  3JAT A;  3HKD B;  2B9Z A;  4DV2 B;  1NS1 A;  3EVK A;  5IJ0 A;  4UB6 Z;  1N0J A;  2Y0P A;  2BOB C;  4LFA B;  4DR5 O;  5LYJ A;  1H2L A;  5A9G A;  3M7M X;  2GV9 A;  1BQZ A;  5B1O A;  2CTR A;  1SRY A;  3TJT A;  3UCS C;  2Q8V A;  2E3C A;  4TSF G;  2EIJ C;  3E8H A;  4NXN O;  3RYH A;  5HFL A;  1QLE C;  5B1A C;  5EIB D;  3B8N A;  4O4I B;  4MTG A;  5CB4 B;  1NTK H;  5LHI A;  2YUA A;  3WB1 A;  5LL6 Y;  4CZZ A;  1DLB A;  1M57 B;  1TGO A;  1YDX A;  2IW5 A;  4FJC C;  4FM0 A;  1AVM A;  5J9P C;  4DV2 O;  1HNW O;  1KKC A;  3DXR A;  4LF7 O;  3UT5 B;  2P22 C;  1MZF A;  3JSN A;  3OUS A;  2EIM B;  1KKD A;  5L3E A;  4I9W A;  1XEQ A;  1QCE A;  1XNQ B;  1KEC A;  1ZAU A;  4YIO A;  4PA4 A;  1NTM H;  5LXT A;  4DV1 O;  5ITZ A;  3K5N A;  2A3Q A;  1S77 D;  2YXL A;  4AQY O;  4IHJ B;  1S76 D;  1B04 A;  1O9G A;  3L72 H;  3OUF A;  3CRR A;  1N32 B;  3RYF A;  4ZI7 A;  1HNW B;  4BWA A;  2E76 B;  2A06 H;  2P06 A;  1D5A A;  5LP6 C;  2WLI B;  3CCS V;  4MVU A;  4JAS A;  2XAS A;  3CME V;  2WLM A;  1N0N A;  4H33 A;  4QPK A;  4JI3 B;  5FLX N;  1PNL A;  4OPH A;  4JI1 B;  4DK1 A;  2Y69 C;  4J7J A;  3A0H Z;  1Q82 W;  1HR0 O;  1LUV A;  1ORQ C;  2QKS A;  2ZE7 A;  1CXZ B;  3OTF A;  3HKD A;  4J42 A;  3T2M A;  1WB8 A;  4TV8 A;  1YTF D;  3A0B Z;  4X62 O;  3SJQ C;  4NTX A;  5JH7 A;  2K1E A;  2Q7G A;  4RUF A;  1KD1 W;  4K8X A;  1Q6H A;  3DC5 A;  3DSQ A;  3K08 A;  2OWO A;  1KP3 A;  2IJH A;  2DQ0 A;  1QU7 A;  2DMX A;  4W4K A;  4DR2 B;  4UCV A;  2MK3 A;  1AR4 A;  4MW8 A;  3LSU A;  3KG2 A;  1I7F A;  2IJJ A;  3CXC U;  4RQE A;  1EZV H;  1AR1 B;  1JVM A;  4LF9 O;  4NKG B;  2AHZ A;  2UXN A;  5GON A;  5KA5 A;  2KSD A;  3W7W A;  2VQE B;  3UQ8 A;  2YIC A;  4JI6 B;  4X88 A;  1S5J A;  4I4T B;  1KU9 A;  4L8J A;  1U96 A;  3JD0 A;  4G2K A;  2DJV A;  3T4Z A;  2R72 A;  3AG1 C;  3K03 A;  2F43 G;  2OCC B;  3C3T A;  2JK5 C;  1PM9 A;  1I94 B;  3E22 A;  1XL4 A;  1ZUQ A;  3B40 A;  1FXH A;  3U0Z A;  3K58 A;  4WBN B;  3L70 H;  1M93 A;  5KUK A;  4PDV A;  4X64 B;  1MA1 A;  1FFX A;  1BZK A;  3ICX A;  2PYJ A;  4J9Z B;  1KB9 F;  5FNV A;  1SQV H;  1RM1 B;  2Q4P A;  1I0H A;  2YIB A;  4H0L B;  3ZHS A;  1OCC B;  4A5U B;  4EB6 B;  3ABK B;  2GTA A;  2UXD B;  4ZOL B;  4R6Z A;  1BGY H;  3A2F A;  4FFB B;  3K79 A;  3T1Y O;  4UUJ C;  4YXW G;  1UJW B;  1XNR O;  1V54 B;  3ZHR A;  3CX5 F;  4DV1 B;  3OGC C;  2QKC A;  1R3I C;  4KXR A;  1K92 A;  5EC1 C;  2ETN A;  1EN4 A;  3HKB B;  3AG2 B;  4PDM A;  3VQV A;  1PD3 A;  4IYH A;  2Q5Z A;  4GX5 A;  2M6Y A;  3CCM V;  4QE9 A;  1K8A W;  3U10 A;  3ABU A;  5BZB A;  4DRX A;  3I55 V;  2QWP B;  1XMO B;  2Y48 A;  3CE2 A;  3RYH B;  4MVM A;  4PA9 A;  1XHX A;  1E1Q G;  1CPY A;  1N4C A;  4Q6G A;  5LYJ B;  2PUS A;  4NXN B;  1P84 F;  3IAY A;  1L0N H;  2IM9 A;  3K0G A;  4XDL A;  2EZO A;  2RN9 A;  4Z1V A;  4JI7 O;  2DN9 A;  3CCE V;  1OZ0 A;  1G6U A;  1L8D A;  4X65 O;  5JJJ B;  4UCO A;  1VQ4 V;  3CMA V;  1COW G;  4CH6 A;  4QJF B;  3M99 B;  2ADQ B;  2Z3Y A;  1FPO A;  3UT5 A;  4DR4 O;  1XHZ A;  3ABL C;  2CGN A;  4WBN A;  1F7Y A;  3KCY A;  1M4U A;  5B1B C;  3LSQ A;  1GM9 A;  1SZT A;  3JAR B;  2W6I G;  4XDK A;  2WPD G;  4X1K B;  5KX5 B;  1JMK C;  1YHQ V;  3K04 A;  3JAK B;  3CXH F;  4GZR B;  3K5O A;  4JI4 B;  3WU2 Z;  5F2V O;  4FMT A;  4O4L B;  4DW0 A;  4K8Z A;  5LMN B;  1AIL A;  2CTQ A;  2QSA A;  1B6Q A;  3F7Y C;  3RVZ A;  2ZDI A;  2AGA A;  2NLJ C;  2XOK G;  4FFK A;  3APO A;  3B8M A;  3U11 A;  3OGI B;  2OTL V;  1H38 A;  5A2Q N;  3CD6 V;  1YIT V;  4JYC A;  4TV8 B;  1P7G A;  2E5L O;  1F4M A;  2X6A A;  2HJD A;  1I5Y A;  3CC2 V;  1RP3 B;  3D36 A;  2UXX A;  3UM7 A;  4I55 B;  1VEW A;  2GUZ B;  3ZRW A;  4PA3 A;  5KMG A;  4GKJ O;  3CS5 A;  2F4V O;  4JI8 O;  4LFC O;  1K5S A;  5JWP A;  1F23 A;  3ASO C;  2B5U A;  1JJO A;  4LP8 A;  3N2K B;  4B7E A;  1TUB B;  3EFF K;  3JAS B;  2XUM A;  3GWO A;  1W59 A;  2QA4 V;  2KKW A;  5LMU O;  3JCU Z;  1R3J C;  3AK2 A;  1YXB A;  1GMG A;  1G8M A;  3T1H O;  4B3T B;  1K73 W;  3WFV A;  3UKM A;  2HEP A;  3OW2 U;  1NKD A;  1ZWI C;  4JYB A;  2UXC B;  1US6 A;  5D5P A;  1YTF B;  1KQS U;  3K0D A;  3NXS A;  1VMG A;  3FYE B;  1NH2 B;  3TGU H;  1PNM A;  1XRE A;  1YJW V;  1NVP B;  1DGS A;  2A9H A;  1LR1 A;  4WF9 V;  1N33 B;  4DV3 B;  3JAW B;  1SKV A;  2QGN A;  3L71 H;  4X1Y A;  4NYK A;  3E22 B;  3EHB B;  5DED A;  3JSL A;  1WB7 A;  1BL8 A;  5CA0 B;  2QTO A;  4ICG A;  1H8H G;  1ARO P;  5D5Q A;  4DR4 B;  3ZJZ A;  3JAT B;  3K3W A;  1Y76 A;  2QM4 A;  4W4L A;  3I56 V;  3G67 A;  4PI2 A;  1GKF A;  2AW9 A;  4DR3 B;  1BMF G;  2BTQ B;  4KP4 A;  1GN3 A;  4LWS B;  4X9Q A;  1BHA A;  4TQD A;  2QE7 G;  1J5E B;  1V55 C;  1ZX3 A;  3ABT A;  1VQL V;  2GDS A;  3QO8 A;  1UPG A;  2WA3 A;  1K34 A;  4JYA B;  2Z0A A;  1JFF B;  2EIN C;  4NTY A;  4YHH B;  5CA1 B;  5LBQ A;  4YJ2 A;  2V4D A;  3JAS A;  3RWR D;  1YJN V;  2AZ2 A;  2N04 A;  1WPB A;  3ZS8 C;  5HFM A;  1BS3 A;  5L3C A;  1OHH G;  2X6B A;  5FPR A;  1GK9 A;  4PDR A;  2OTJ V;  1OCZ C;  4X20 B;  3ETQ A;  4EKW A;  1XNQ O;  1QQC A;  4LNU A;  5B1B B;  2ZCE A;  3ABL B;  1VP7 A;  3F5W C;  2IU0 A;  4TUY B;  1VAR A;  1AP5 A;  4KHP O;  4GCZ A;  2Q69 A;  3ZHV A;  1WN7 A;  1PV0 A;  3FYI B;  3KZI Z;  2IJI A;  3MD0 A;  4K35 A;  4LF5 B;  2A7W A;  2FB5 A;  3SPC A;  1AI5 A;  3OFN G;  3AK1 A;  4X1K A;  2QWO B;  2LW1 A;  3SYQ A;  4LFA O;  2Q67 A;  5EC2 C;  2ZR3 A;  4YJ3 A;  1YIJ V;  1MG1 A;  4FLU A;  1IBK O;  2JJ2 G;  2CE4 A;  4WFE A;  5CBG A;  2ZM6 B;  4ASU G;  5JVD A;  2VWJ A;  2Q7E A;  4DUY B;  5KHH A;  2BOC C;  3B4S A;  5CN0 A;  2OCC C;  4P30 A;  2JRI A;  1GRJ A;  4TV9 B;  5LGN A;  1XDC A;  5LA6 A;  4JI0 O;  1K4C C;  4B3T O;  3G6E V;  4O4I A;  2QM7 A;  2HG5 C;  3CSX A;  4RAI A;  1XOU A;  3VQX A;  1R6K A;  4HYO A;  2EX3 A;  1H2N A;  1E79 G;  3K9S A;  4CC6 A;  1SES A;  2QTS A;  1N36 O;  1KC8 W;  2XAG A;  2AZ0 A;  1NQT A;  3MAQ A;  1VQN V;  1IUR A;  2H3O A;  4RWU A;  2FTK A;  3CP1 A;  5KLV H;  3QG5 A;  4I0X B;  3N2K A;  1QR8 A;  5LXT B;  4LNU B;  4RUE A;  5E1A C;  2NNU A;  4LCU C;  3M8A A;  2CH7 B;  3CEI A;  1I94 O;  1VQ6 V;  4N23 A;  1M56 B;  4O2B B;  2DYR B;  4MT8 A;  3JAM N;  1FYJ A;  2AXT Z;  2R70 A;  3BY6 A;  4LF4 B;  2YID A;  4TT3 G;  2XAF A;  1JQ0 A;  4LF8 O;  4KUM A;  2M7W A;  3APQ A;  1GM8 A;  4HAM A;  4IHJ A;  1WA8 B;  3BAB A;  4HNA A;  1K3E A;  3HR0 A;  2P7T C;  1RM1 C;  3CCR V;  1EN5 A;  3CCU V;  4LF6 B;  5IYD O;  4I7Z B;  1NBM G;  3FAV B;  1MAB G;  3ZMS A;  2UU9 B;  4UVB A;  2ZE6 A;  2HVJ C;  3CB2 A;  4J80 A;  1V55 B;  2CDY A;  5IJ9 B;  3CC7 V;  1SA0 A;  2EZP A;  4B3M B;  4DR6 B;  4JAU A;  1A32 A;  1VQP V;  1P4R A;  4FLY A;  4D6T H;  5BXZ A;  4O4H A; 
#chains in the Genus database with same CATH homology
 4DW0 A;  4DW1 A;  3I5D A;  3H9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...