3I5DA

Crystal structure of the atp-gated p2x4 ion channel in the closed, apo state at 3.5 angstroms (r3)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
324
structure length
324
Chain Sequence
b'RFTQALVIAYVIGYVCVYNKGYQDTDTVLSSVTTKVKGIALTNTSELGERIWDVADYIIPPQEDGSFFVLTNMIITTNQTQSKCAENPTPASTCTSHRDCKRGFNDARGDGVRTGRCVSYSASVKTCEVLSWCPLEKIVDPPNPPLLADAENFTVLIKNNIRYPKFNFNKRNILPNINSSYLTHCVFSRKTDPDCPIFRLGDIVGEAEEDFQIMAVRGGVMGVQIRWDCDLDMPQSWCVPRYTFRRLDNKDPDNNVAPGYNFRFAKYYKNSDGTETRTLIKGYGIRFDVMVFGQAGKFNIIPTLLNIGAGLALLGLVNVICDWI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P2X purinoceptor
publication title Crystal structure of the ATP-gated P2X(4) ion channel in the closed state.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transport protein
total genus 60
structure length 324
sequence length 324
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.940 Mainly Alpha Orthogonal Bundle Helix Hairpins atp-gated p2x4 ion channel 3i5dA01
2.60.490.10 Mainly Beta Sandwich atp-gated p2x4 ion channel fold atp-gated p2x4 ion channel domain 3i5dA02
3I5DA 4DW0A 4DW1A 3H9VA
chains in the Genus database with same CATH superfamily
1AP5A 1QQCA 3AK1A 3BABA 4ASUG 5LMNB 4OGQB 1RSOB 4FIPC 2WSSG 2VQFO 2P7TC 2P6JA 1NTZH 5H5NA 4FM0A 1KECA 2AHZA 4LFAB 3CRCA 4DR7B 4JI7O 2VWKA 3T4ZA 2PYJA 1YEWA 1K34A 1R3IC 5KLVH 2RMKB 2DOSA 2JGDA 5LMUO 4X20A 3ZN1A 1OCZC 3JATA 4LWSA 3AG1C 5JJJB 4ZIBA 1AJPA 1Z2GA 2HVJC 3TCUA 1GO3F 1BT8A 3APOA 4J41A 3CCJV 4OPAA 4MTFA 2B5UA 2ODMA 2QM8A 1CPYA 4GX1A 1RP3B 1HNWB 5EBLC 3K79A 3ABKC 3PN1A 3K59A 4J7KA 1WA8B 4YY3B 4LF9B 2VRZA 3FB7C 1NI8A 4O2AA 1Y76A 5C8YB 1VMGA 2YS8A 4DR4O 5IY5C 3ABLB 4F6RB 1HR0B 2ILMA 3H1HH 4B3RO 3TXSA 4WFFA 3UCSC 1BMFG 2QKAA 2R9AA 2BTQA 2LGQA 3SJBC 2OCCB 2VQFB 2R72A 4F6EA 5C93A 2JS3A 3L71H 1IXMA 2QDOA 1Q81W 2OTLV 1Z5WA 2UUCO 1AP6A 3U11A 5JJNB 4HYOA 4YJ3B 1O9GA 2WLIA 5BR8O 3I55V 5LMUB 4DR5O 2M6YA 2N74A 4LF4O 1J5EO 1BS3A 5BZBA 3RYCB 4I4TB 3GVMA 1ROPA 1N8RW 4TQDA 5FPRA 5K1PA 3SYPA 2IBZH 4HAMA 1Y67A 5K1XA 4FLXA 3H9VA 3Q4HB 1M5IA 3E8GA 5BY1A 3A0BZ 3CCSV 1IBMO 1TGOA 1O9HA 4CS4A 2YC0A 2OTJV 4JI3O 4FLYA 2UU9B 5HFMA 1GM8A 1K9MW 4B3RB 1GH6A 5LHGA 2WA3A 2DYSB 1VQLV 4TT3G 2KG7B 3UT5B 5KA6A 1I94O 1FXHA 1GM7A 3OM3B 3ABMB 4NXMO 4DR2B 4JAAA 2P22C 1LR1A 2AZ0A 2QTOA 3ZIAG 4J9ZB 5BR8B 4DR5B 1XEQA 1KUQA 2VWJA 1AI5A 4X62B 2JGUA 2O57A 1N34O 3VQVA 2OCHA 1JJOA 3AG3C 5EK0A 4I9WA 4EB6A 2QR4A 4DV3B 1W0KG 3B2EE 2H3OA 4JI0O 3VBBA 3RVYA 5CN0A 1H8HG 3BY6A 5ITZA 2A06H 1K73W 3CCUV 1NT2B 4MVQA 1IBMB 2WLNA 5J2UB 3HKCB 1SQGA 2ARHA 1U97A 1FXKC 3W7WA 4UCTA 2UXBO 3G6BA 1R73A 3ZRVA 2XAGA 3SPCA 4IIJB 2QM7A 5EYPB 3ZN0A 1SQVH 2LQTA 1D5NA 2EILC 1HNZO 1I94B 3SPHA 1R3LC 4FFBB 4RWUA 1GN3A 4DV2O 4G27B 2MK3A 3CX5F 4CS3A 2WLJA 3CYOA 4GKJB 3L73H 1NBMG 5BMVB 5F2VO 4NVPA 4FM1A 4I9QA 5CB4B 1N34B 1AVMA 4YIPA 3QTCA 4FPPA 2V4DA 4B3MB 2IM9A 3L9DA 3K08A 4JZGA 5IWAO 3ZRSA 1K7DA 3JSLA 4BIOA 2Q73A 2YI8A 4JYYA 4JASA 1WJZA 5CA1B 2ADPA 2P90A 1F4NA 1IX9A 4X66O 2UXBB 1E1QG 4PA4A 3UKMA 2E75B 2X0LA 4BWAA 1VQPV 5KAFZ 1N0NA 2CDYA 3AG4B 1HW7A 4R7CA 4MSWC 4JGSA 1U96A 3BPZA 4PDRA 2Y48A 3FFQA 4X1IB 1F51A 4PDVA 2XAHA 1KKDA 2F23A 3WG7B 3CCVV 2AW9A 2YIBD 1QVFU 4JV5B 4X1YA 1J95A 4IGGA 2FKXA 5LOVB 3CS5A 2G38A 4R8CA 4ZI7B 1FXKA 4J10A 3P32A 4JI8B 4P9OA 3RFRA 3L70H 1FS0G 5LHHA 4K35A 4X8AA 4PA9A 1QR8A 1SKVA 3DXRA 3E22B 4UV8A 3CCEV 2JIZG 5L3DA 4I7ZB 4K8XA 4PV1B 3CC7V 1YTFB 1YVWA 1GTOA 5KX5A 3JYCA 3W7TA 1A32A 1NH2B 4K0KO 1EN4A 1OCCB 5IJ0A 4TV8B 3ETDA 2Q6AA 1WLEA 1R1BA 2QWRB 3O9OA 4MVMA 1JCHA 3E83A 1CXZB 1Y6XA 4X64B 4ZOLB 1I0HA 4JAVA 3E8FA 3OD4A 5JH7B 4DV5B 4IYIA 4NTXA 3SPJA 2OT5A 1URFA 4X1KB 4HNAB 2Q4PA 2Z5UA 2ZIOA 2YIAA 3EHBB 1F23A 2LP7A 2DWEC 3I56V 4RUEA 5LP6C 1HNXO 2N05A 4WBNB 3IAYA 1NVPD 2CTPA 2EULA 1GK9A 1FJGO 2JVDA 5CA0B 4RO2A 3L74H 4DO2A 4FM2A 1FFXB 2YIBA 4Z1VA 4PDMA 4UB8Z 1XMOB 3JAKA 3C3TA 4JI5B 1R6NA 4B3TB 1K4DC 4GZRB 2QA4V 2P5OA 4LF7O 3FYIB 3TK1A 2NLJC 2EINB 2PZSA 4MS2A 4DR6O 2CH7B 4R50A 1NKDA 4LF5B 5IYDO 2XASA 2DYRB 3M7MX 3QVNA 4BW5A 3T1CA 3UM7A 1H2GA 1G4YB 2FL4A 4NXNB 2YEVA 3T2MA 5JJEB 5B1OA 4GKKO 1QU7A 2DN9A 4BIZA 1V55C 2W6IG 4LF8B 2OYQA 1WB8A 5L3BA 3SGIA 3ASNC 4JI6O 4I0XB 3ZS8C 4OX9O 4FZ0A 4LCUC 2X6BA 1HNXB 2EIKB 3L72H 3D3IA 4X20B 4HZ3A 2JEUA 1FJGB 3N2KA 4D7TA 4LWSB 3JATB 1WPBA 4QGPA 2B1IA 5IYCO 2RJZA 1XUQA 4IHJA 4KUMA 2QEXV 4FZ1A 4J9YB 5TISZ 3LDDA 4BIUA 1L1FA 1YJNV 1US6A 3BAAA 3E8BA 2ZIMA 1SQXH 3CRAA 4AI8A 4DR6B 5LP6A 5JQGB 1SESA 3CRQA 1W2BU 1ZUQA 2EIJC 4YHHO 1SQQH 1ORQC 4J42A 3B09A 4O2AB 1Y76B 1M56C 3ZHTA 1E79G 4CH6A 4GT1A 5IT9N 2H94A 4W4LA 2BSKA 1V54B 2GHYA 5KUKA 3C90A 2BTQB 1NTKH 5GTIZ 3LDCA 3FX7A 2GUZA 1MOFA 1RPOA 2P4KA 4H37A 4JI4B 4DK1A 4LFAO 3DGEA 5B3SB 1SZTA 3RWRD 4MVUA 2BTOA 4LF6B 1M57B 3CXHF 3VQYA 4OPHA 1R3JC 3FD9A 1MSWD 1WB7A 5LYJA 4AQYB 1GRJA 4Q20A 5GW7A 2EJ7A 3A0HZ 5KHIA 2YSUB 1THZA 1FKAO 4HBNA 1XBLA 1AJQA 2L6LA 3K06A 5JVDA 3JAWB 3WB1A 5DM6V 2XTAA 4YHHB 1QLNA 1YITV 4YY3O 1OCZB 3AG1B 1HR0O 2P67A 4L87A 3ZRWA 1S5LZ 4JTAB 1ZX3A 5LHIA 1NS1A 5E79Z 4TUYA 5HFLA 1AILA 3QG5A 2HP8A 1YJ9V 4LFCO 2Q7EA 4QPJA 3OT7A 4QJFB 2R70A 5IY5B 3HKDB 1H38A 4F4LA 4LC1A 4AHCA 3JALA 4YJ2A 2CUGA 2B9ZA 4WFGA 3X2QC 3CSXA 3I5DA 1Q86W 3RYFA 3ICXA 5EC1C 3DSQA 5EBWC 1G1XB 1XOUA 3CMEV 4GYCB 1M90W 2DW4A 4UFZA 1Q5OA 5ITZB 4DRXA 2LFSA 5FLXN 3SPIA 4FLZA 2QKSA 1I5YA 2YUAA 1RM1C 3OAAG 2QSAA 1N36O 1GN6A 1PP9H 1KMIZ 4D7SA 4QE7A 3RN4A 2UU9O 3AG2C 1MZEA 1CP9A 2JDIG 2RCVA 3T1HB 1KU9A 3KCXA 4O4IB 5L3GA 3CEIA 4DV0B 1B06A 1WAZA 1IVSA 1QLEC 3WB2A 3OMNB 3ZMZA 2CGNA 4LFCB 5J2TA 3RYHA 4JTDB 3CRMA 4PJ0Z 4DR2O 1G8MA 2K9PA 2AGAA 3WU2Z 2F43G 3JASA 1XNQB 2F4VB 4CC6A 4CZZA 3BHPA 4X62O 1GN2A 3JCZA 5B1BB 4I50A 2CAZC 4FLVA 2NR5A 4UB6Z 4YIOA 4DV3O 3OUSA 2PI5A 3AK2A 4TWKA 5KHKA 2QWNB 1XNRB 4DK0A 3LNMB 3EXAA 2Q0OC 2UXDB 2F66C 2GBOA 4GX0A 3KKYA 1NU1H 3OEHG 4PHZA 3R66A 1H2LA 1NQTA 4WF9V 1N36B 2D3OW 1VEWA 1TVKA 3QNEA 5KHHA 1VQKV 1WN7A 1NZ6A 1VQ9V 1DF5A 4EKWA 1DGSA 1R6KA 3AG3B 3GWOA 3S3WA 3CC4V 5IYZB 1OCRB 5GONA 2YXHA 1T5EA 1JVMA 3IJ4A 1H2MA 1IBLB 2Y4TA 4DR3O 3JARA 2QJ1A 4GUNA 5FNVA 4JF3A 4UUJC 4X1YB 2AHYA 4MW3A 4GKJO 2HJFC 3EFFK 2ADQB 1IZ3A 4IL6Z 2V7QG 3E89A 4YXWG 1TAEA 5JWPA 1OCOC 1YHQV 4QNHB 1L0LH 2EILB 3H1JH 4L8JA 4O2BA 4B3MO 1GAXA 4MTGA 5E1AC 2RDCA 4FK5C 1S76D 1HP8A 3CCMV 3ETGA 3OMIB 1AB3A 2Z0AA 1AROP 2ZM6O 4CH5A 3T4DA 4FFKA 3HKEA 3VQXA 3ETEA 3K58A 1XILA 2FTKA 1WNSA 4LFBB 1JPXA 1S3JA 1SS3A 2UXNA 2DYSC 3JD1A 2ATKC 5KAIZ 3JSNA 2EIMB 5DN6G 1MSDA 1KP2A 2BE3A 4J7JA 5DEDA 4U3JB 4DR3B 1BZKA 3OW2U 4JV5O 5CMUA 1HWYA 3MD0A 3K5MA 4MT8A 2ZR3A 1PL4A 3JAKB 2AXTZ 2CGOA 1M4UA 3K04A 2Y0IA 4JI8O 2XNDG 4MVSA 2EZPA 3BRCA 3CC2V 1XL6A 1SA0A 1HDJA 1D5AA 2IH1C 5CBHA 5LXTB 2BCCH 1JFFA 3RGBA 4C7UA 2EJRA 3DC5A 1GMGA 2W0XA 4XBFA 4LNUB 1EZVH 3FAVA 3B8MA 1FAFA 2GV9A 1H8EG 2ZM6B 1TUBA 2EZOA 1ZWIC 2ZT9B 3O65A 1YCIA 2E5LB 4O4LA 4DW0A 1KC8W 4I4TA 4X64O 1XI1A 4DV5O 3CJHB 2MW2B 1AI7A 2ZXWC 4JYCA 1VQ4V 4X65O 4KHPO 1R3KC 2HLDG 5D5PA 2WLLA 3T1YO 2OIEA 4X9QA 1M1KW 1MA1A 2XUMA 1K97A 1I5XA 3N27A 2LJ2A 5D5QA 3F5WC 1NVPB 3KZIZ 3VOUA 3TXQA 1XMOO 3KCYA 1Y74B 2YIDA 3OTOB 4JI5O 3TJTA 4B3TO 1OHHG 2Q69A 3ASOB 4NTYA 1P49A 3JD4A 5EZYA 4DW1A 5LP6B 1S5HC 3STLC 1KKCA 3W7UA 4NYKA 4LF5O 1IBKB 1YF2A 4UVCA 4PDLA 1ENVA 3JCUZ 1PKXA 4UCVA 3NXSA 2BOCC 3SJQC 4NTWA 5KMGA 1UJWB 1XDCA 4FLUA 2UUAO 2V1DA 1YZBA 4NXNO 1Z5VA 4LP8A 3BVOA 1RPRA 5EIBD 1AR5A 3AG4C 4LF8O 2WAMA 4X65B 3WG7C 4KHPB 1S5JA 1Y66A 3ETQA 5B1NA 3T1YB 2K1EA 2Q0AA 3CD6V 1P4RA 2KSDA 2QE7G 3GB7C 2QWPB 5LYJB 3H1IH 3A2FA 4Z2WA 3ZMUA 3BFRA 4IIJA 1V55B 5EYPA 1PNKA 3OTFA 3ASNB 4B7KA 1CEZA 3E8HA 5EBMC 3SYAA 3SYOA 4ICGA 2B1GA 2PUSA 1YJWV 3WB0A 1SC5B 2ZDIC 3QF7A 4O4HA 3K0DA 1M93A 2ZNIA 2JEXA 5BMVA 5BXZA 4PA7A 1K4CC 4EFBA 2UUAB 5CB4A 3DTUB 1YI2V 5KHJA 4IYHA 1VQOV 1YTFD 3OEEG 4TUYB 1WP8A 2C2AA 3C3SA 1NH2D 4LH7A 5CBGA 2CTWA 5DECA 4GCZA 4JI4O 2ZE6A 3TETA 2EIJB 3N2GA 1B3QA 3TGUH 4LF6O 2XAFA 4JYAB 1K92A 2XAQA 1BHBA 2JGDB 2PF4E 1OV9A 4U3FH 3K5OA 5KUMA 1AJNA 1SQFA 2PTMA 1VQNV 5KHGA 2IH3C 4FJCC 2F93B 4AQYO 3RT3C 2XOKG 3LSSA 1BGYH 1R6TA 4U7NA 2NN4A 2D2CB 1WP7A 4PI0A 1JX9A 1SETA 4FLWA 2LFRA 3OFNG 4DYLA 2N04A 3RVZA 4KL1A 3R65A 4ZI7A 4DV7B 3J7AU 1Y4MA 1XQ8A 1Q6HA 3J81N 1SF9A 4A5UB 1F4MA 4BW9A 3JD3A 3E22A 3LSUA 4K3AA 2Y69C 3BA8A 1JR9A 1YXBA 4O4JA 2UXCB 1LUWA 4B3SB 1D2DA 3ZMSA 3G80A 5J2TB 1SRYA 2HHHO 1EZJA 1KP3A 3CE2A 4TV8A 2Q7HA 5H6QA 2ZR2A 3D36C 2ZDIA 4D6TH 2UUBB 3K5LA 3CWBH 3JASB 3QO8A 2WLIB 1ZL8A 4J11A 3CMAV 5IE9A 5B1AC 2A79B 4Z1MG 3H1KH 3UQ8A 2VQEO 2WWWA 4ZHQA 4UCUA 1P84F 1XMQB 2FYUH 1K5QA 4DUYB 2DE0X 3ZHVA 2A9HA 4MTOA 1XHZA 1DTOA 2HEPA 2HR3A 2PYLA 4DV6B 2P4VA 1XL4A 2ITDC 3UO2A 3WFVA 1ZLZA 4K8ZA 2FB5A 5CA0A 5A9GA 4QPKA 2KQXA 2JS5A 3X2QB 1W59A 1BQZA 4R6ZA 3IGAC 2A0LA 1V54C 1X4TA 1UPGA 5LGNA 3T1HO 3W7SA 1SERA 1XHXA 5GONB 4RQFA 1B6QA 2Q67A 3CXCU 4ABMA 4B08A 3K57A 1MZFA 4DV0O 3M99B 3ZJZA 2P06A 2PGGA 4WFAV 3ABKB 3JARB 5FNVB 3CCLV 4JI2B 1RM1B 3SYCA 1M57C 1JJ2U 2HHHB 5FL7G 3F7VC 3D3QA 4UVBA 4QIWF 3AG2B 3ZHQA 4X88A 1QCEA 1XNQO 2CE4A 2F4VO 4FVMA 3E2EA 2LW1A 4TV9A 5B5EZ 2VQEB 4LR3A 2WA4A 4O2BB 2YXYA 2QTSA 4EB6B 2A3QA 1MABG 1VQ6V 1QLEB 4I0XA 4WCEV 1VF7A 1XNRO 5IYBO 4H33A 3D36A 2UXDO 3HKEB 2IU0A 1AR4A 3OGIB 3G6EV 3OUFA 1I7FA 4MW8A 4FLTA 4EEQA 4PI2A 4XDKA 2M7WA 1DLBA 1E1RG 1JMKC 5JQGA 2ITCC 3K3WA 1SQPH 4JI1O 3LDEA 3AEIA 1IBLO 1VARA 4NKGB 1N32B 4DR1O 1H2NA 5FPOA 3OGCC 3OMAB 2GTSA 3RYIA 4CBCA 3CCQV 1TA8A 1VQ7V 1TUEB 3F5TA 2ZINA 1VF6C 3VQWA 3ZCCA 1JQ0A 3CRRA 1PNLA 1FFTB 4TQFA 3HKBA 1QHTA 1GM9A 2YI9A 1IURA 2L35A 1SA0B 1LNQA 5A2QN 2JK5C 3E35A 3ZHRA 1JFFB 1VF5B 4UVAA 4JI7B 4DV4O 3FAVB 3IC7A 2JJ2G 1MMMA 4CH4A 4I55A 4DV1O 1TUBB 1COWG 3OE7G 4XDJA 2Q7GA 2R9RB 3ABLC 5IJ9A 4O4LB 4LFBO 4WFHA 2F1MA 3CCRV 2GTAA 1KD1W 1FPOA 1OCOB 4MVRA 5LA6A 1EFRG 5H6RA 4J80A 2OCCC 2VS0A 1YSCA 2GSMB 2ZE8A 2Z3YA 1SZXA 1BQ0A 2ZNJA 2A7WA 1G6UA 3JAWA 3B40A 4JI1B 2WLLB 2PY5A 1ZTEA 3U10A 1S72V 4DR1B 1QBZA 4DR4B 3ZHSA 4TOIA 1MG1A 2E74B 2QWQB 5IDJA 1FXKB 2ZE7A 1L0NH 1VIBA 4TSFG 5B1BC 1VQ5V 1RSOA 1P7BA 3IFXA 3JD0A 1BCCH 3FB6C 5EZYB 2Q68A 3DXRB 1FD9A 3QO7A 1OZ0A 2QM4A 1Q7YW 2EX3A 4DV4B 2UUCB 3A8TA 5CA3A 3LNNA 5KX5B 3AK3A 3HKDA 2ZQMA 3ZMVA 5IJ0B 1Q90D 4PD4F 4DV1B 4LF4B 2PI4A 3BA9A 5KMGB 5LGUA 1NJIW 1VF6A 1J5EB 2Q8VA 2E5LO 4WFBV 3RBZA 2IW5A 2YDEA 2H8PC 2QKCA 3ABTA 4H13B 1OCRC 4BAYA 3MAQA 1W0JG 3HB3B 4NR1A 1JOYA 1PD3A 3THOA 4H44B 3K9SA 3B77A 1XREA 3ABMC 1WA8A 3ZHUA 3IC9A 5KA5A 1EN5A 4JI3B 5C8YA 4KFMA 2X7RB 4F6RA 1KYOF 1N4CA 3E86A 4NB5A 1JA8A 1L8DA 4JZ2A 4MVZA 4O4IA 2RN9A 3OTOO 2ZXWB 1SQBH 4J7ZA 1KQSU 1Q43A 3BEHA 4LH6A 3DC6A 4G28B 2QGNA 3SJCC 4NXMB 1IBKO 4IT5A 4UCRA 5H2FZ 2LW7A 2WLHA 3QO5A 4O4HB 2HJDA 3P30A 4JPRA 5L3FA 4UCOA 2X6CA 4YJ3A 2QWOB 2ZD9A 4N21A 1K3EA 4RQEA 1LUVA 4KXRA 1Q8IA 2WLMA 2YEVB 3RYCA 5LGTA 1P7GA 2EIMC 3CHXA 1H2KA 2JJ1G 4XDLA 4JI0B 3N2GB 3G67A 3Q4HA 3ZRXA 4DUZO 1KB9F 2WLKA 2Y4UA 1MNGA 3N2KB 1IXBA 4H0LB 2HG5C 2X6AA 1UFIA 2NNUA 4IHJB 3FKSG 5IYZA 2XHBA 1M9NA 2KG7A 3UT5A 2YXLA 3KG2A 2UXXA 1HNZB 3K5NA 3CPWU 4UV9A 5EIBC 4DV2B 3SPGA 2KKWA 2EBOA 3W7XA 1Q6IA 2WPDG 2BSKB 1VP7A 2DQ0A 1K5SA 2LO1A 1RFYA 1GN4A 5EC2C 1BHAA 2DMXA 2GUZB 4GX5A 4O4JB 2RNBA 3FYEB 3JD2A 5IWAB 1NTMH 1VQ8V 4U7OA 4DUZB 2CK3G 1S0VA 2E3CA 1ZAUA 4MVOA 4JYAO 5J2UA 1ZL8B 3HKCA 3U0ZA 3J80N 2HKOA 5L3EA 5LL6Y 2CTRA 3G71V 4X66B 4ZHQB 2IJJA 4GLXA 4WFEA 4EFEA 1ZSPA 3UO3A 3ASOC 1AI6A 2Q9LA 3PJSK 1BE3H 1NR7A 3HPLC 3SJAC 1PNMA 4P30A 4U3JA 4PA6A 3FB5C 2R9IA 4FFBA 4ZKIA 4P2ZA 5JVDB 2DJVA 4JTCB 1OCCC 2OWOA 3ML0A 4CS2A 1YDXA 3ABUA 4DV7O 1FYJA 3ZRWB 3M8AA 4I5SA 2IJHA 5JCOC 3CB2A 1IDSA 4E2LA 5LXTA 1Q6UA 3K03A 3JAMN 3ZX6A 5J9PC 2UXCO 4LNUA 1I08A 3MDSA 4B3SO 1S77D 3NR7A 2ZKOA 4K0KB 2XAJA 1DF4A 3B8NA 2LGWA 1PV0A 1VQMV 1M56B 1K8AW 3EVKA 3A0RA 3GWKC 2UUBO 2IJKA 4YJ2B 3JALB 5CA1A 3K9AA 2KB1A 4CC5A 4AILC 3OR6C 4TV9B 3LSQA 3RYFB 3CJHA 2Y69B 3F7YC 5GTHZ 1XMQO 2HVKC 4DUYO 2Y0PA 1N0JA 1BL8A 4DV6O 4LBEC 2EINC 5B66Z 2F95B 4ZBMA 4QE9A 4X1IA 4JAUA 5H9CA 1K33A 4RUFA 2Q5ZA 4DRXB 2DYRC 3CP1A 1EM1A 5LBQA 5LOVA 3B4SA 3FB8C 1PPJH 1OJHA 2ETNA 2HFEC 5B1AB 1KBHA 4FMTA 1Y74A 2AZ2A 3SR2C 3G4SV 2OIGA 5L3CA 3H1LH 4GX2A 4LF7B 1BSMA 2ZCEA 3BCCH 3AG7A 4MTXA 4W4KA 4CH3A 1PM9A 4Q6GA 2JRIA 3D8CA 1Q82W 4RAIA 4JI2O 1N33O 2EIKC 3P3NA 3RYIB 3RYHB 1PL0A 1NR1A 1F7YA 3H01A 2XT9A 4G2KA 3ZBHA 4UXNA 4KP4A 3APQA 5LMNO 2W0FC 1X59A 5JCOA 2DWDC 1DK1A 3P3PA 3HKBB 3SDLA 3LUTB 4ZOLA 4GKKB 1EBOA 3OR7C 4UCSA 4JYBA 4I50B 5JH7A 4N23A 3L75H 4PELA 4X1KA 4HNAA 1EN6A 4DR7O 4JI6B 1H2SB 1QR9A 3RW0A 1WPXA 1B04A 5CBFA 4OX9B 4OXSA 4E4EA 1Q3EA 4WBNA 4I55B 2CTQA 3SYQA 4P9PA 1YIJV 5IJ9B 3K0GA 4X89A 1FFXA 2DQ3A 2YICA 1TVKB 2ZE5A 4PA3A 5LA6B 3STZC 1QVGU 1FXVA 3MHSC 1HNWO 2FMLA 1AR1B 1V9PA 1QNMA 3ZEDA 1GKFA 4B7EA 4BR6A 1AI4A 2CH7A 2BOBC 2GDSA 3S3XA 4DXWA 2IJIA 5B3SC 4LF9O 3HR0A 2E76B 3MHHC 2W6JG 1N32O 2IU3A 5AG2A 1N33B 3ZMTA 2RQ6A
chains in the Genus database with same CATH topology
3I5DA 4DW0A 4DW1A 3H9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5D A;  4DW0 A;  4DW1 A;  3H9V A; 
#chains in the Genus database with same CATH topology
 1AP5 A;  1QQC A;  3AK1 A;  3BAB A;  4ASU G;  5LMN B;  4OGQ B;  1RSO B;  4FIP C;  2WSS G;  2VQF O;  2P7T C;  2P6J A;  1NTZ H;  5H5N A;  4FM0 A;  1KEC A;  2AHZ A;  4LFA B;  3CRC A;  4DR7 B;  4JI7 O;  2VWK A;  3T4Z A;  2PYJ A;  1YEW A;  1K34 A;  1R3I C;  5KLV H;  2RMK B;  2DOS A;  2JGD A;  5LMU O;  4X20 A;  3ZN1 A;  1OCZ C;  3JAT A;  4LWS A;  3AG1 C;  5JJJ B;  4ZIB A;  1AJP A;  1Z2G A;  2HVJ C;  3TCU A;  1GO3 F;  1BT8 A;  3APO A;  4J41 A;  3CCJ V;  4OPA A;  4MTF A;  2B5U A;  2ODM A;  2QM8 A;  1CPY A;  4GX1 A;  1RP3 B;  1HNW B;  5EBL C;  3K79 A;  3ABK C;  3PN1 A;  3K59 A;  4J7K A;  1WA8 B;  4YY3 B;  4LF9 B;  2VRZ A;  3FB7 C;  1NI8 A;  4O2A A;  1Y76 A;  5C8Y B;  1VMG A;  2YS8 A;  4DR4 O;  5IY5 C;  3ABL B;  4F6R B;  1HR0 B;  2ILM A;  3H1H H;  4B3R O;  3TXS A;  4WFF A;  3UCS C;  1BMF G;  2QKA A;  2R9A A;  2BTQ A;  2LGQ A;  3SJB C;  2OCC B;  2VQF B;  2R72 A;  4F6E A;  5C93 A;  2JS3 A;  3L71 H;  1IXM A;  2QDO A;  1Q81 W;  2OTL V;  1Z5W A;  2UUC O;  1AP6 A;  3U11 A;  5JJN B;  4HYO A;  4YJ3 B;  1O9G A;  2WLI A;  5BR8 O;  3I55 V;  5LMU B;  4DR5 O;  2M6Y A;  2N74 A;  4LF4 O;  1J5E O;  1BS3 A;  5BZB A;  3RYC B;  4I4T B;  3GVM A;  1ROP A;  1N8R W;  4TQD A;  5FPR A;  5K1P A;  3SYP A;  2IBZ H;  4HAM A;  1Y67 A;  5K1X A;  4FLX A;  3H9V A;  3Q4H B;  1M5I A;  3E8G A;  5BY1 A;  3A0B Z;  3CCS V;  1IBM O;  1TGO A;  1O9H A;  4CS4 A;  2YC0 A;  2OTJ V;  4JI3 O;  4FLY A;  2UU9 B;  5HFM A;  1GM8 A;  1K9M W;  4B3R B;  1GH6 A;  5LHG A;  2WA3 A;  2DYS B;  1VQL V;  4TT3 G;  2KG7 B;  3UT5 B;  5KA6 A;  1I94 O;  1FXH A;  1GM7 A;  3OM3 B;  3ABM B;  4NXM O;  4DR2 B;  4JAA A;  2P22 C;  1LR1 A;  2AZ0 A;  2QTO A;  3ZIA G;  4J9Z B;  5BR8 B;  4DR5 B;  1XEQ A;  1KUQ A;  2VWJ A;  1AI5 A;  4X62 B;  2JGU A;  2O57 A;  1N34 O;  3VQV A;  2OCH A;  1JJO A;  3AG3 C;  5EK0 A;  4I9W A;  4EB6 A;  2QR4 A;  4DV3 B;  1W0K G;  3B2E E;  2H3O A;  4JI0 O;  3VBB A;  3RVY A;  5CN0 A;  1H8H G;  3BY6 A;  5ITZ A;  2A06 H;  1K73 W;  3CCU V;  1NT2 B;  4MVQ A;  1IBM B;  2WLN A;  5J2U B;  3HKC B;  1SQG A;  2ARH A;  1U97 A;  1FXK C;  3W7W A;  4UCT A;  2UXB O;  3G6B A;  1R73 A;  3ZRV A;  2XAG A;  3SPC A;  4IIJ B;  2QM7 A;  5EYP B;  3ZN0 A;  1SQV H;  2LQT A;  1D5N A;  2EIL C;  1HNZ O;  1I94 B;  3SPH A;  1R3L C;  4FFB B;  4RWU A;  1GN3 A;  4DV2 O;  4G27 B;  2MK3 A;  3CX5 F;  4CS3 A;  2WLJ A;  3CYO A;  4GKJ B;  3L73 H;  1NBM G;  5BMV B;  5F2V O;  4NVP A;  4FM1 A;  4I9Q A;  5CB4 B;  1N34 B;  1AVM A;  4YIP A;  3QTC A;  4FPP A;  2V4D A;  4B3M B;  2IM9 A;  3L9D A;  3K08 A;  4JZG A;  5IWA O;  3ZRS A;  1K7D A;  3JSL A;  4BIO A;  2Q73 A;  2YI8 A;  4JYY A;  4JAS A;  1WJZ A;  5CA1 B;  2ADP A;  2P90 A;  1F4N A;  1IX9 A;  4X66 O;  2UXB B;  1E1Q G;  4PA4 A;  3UKM A;  2E75 B;  2X0L A;  4BWA A;  1VQP V;  5KAF Z;  1N0N A;  2CDY A;  3AG4 B;  1HW7 A;  4R7C A;  4MSW C;  4JGS A;  1U96 A;  3BPZ A;  4PDR A;  2Y48 A;  3FFQ A;  4X1I B;  1F51 A;  4PDV A;  2XAH A;  1KKD A;  2F23 A;  3WG7 B;  3CCV V;  2AW9 A;  2YIB D;  1QVF U;  4JV5 B;  4X1Y A;  1J95 A;  4IGG A;  2FKX A;  5LOV B;  3CS5 A;  2G38 A;  4R8C A;  4ZI7 B;  1FXK A;  4J10 A;  3P32 A;  4JI8 B;  4P9O A;  3RFR A;  3L70 H;  1FS0 G;  5LHH A;  4K35 A;  4X8A A;  4PA9 A;  1QR8 A;  1SKV A;  3DXR A;  3E22 B;  4UV8 A;  3CCE V;  2JIZ G;  5L3D A;  4I7Z B;  4K8X A;  4PV1 B;  3CC7 V;  1YTF B;  1YVW A;  1GTO A;  5KX5 A;  3JYC A;  3W7T A;  1A32 A;  1NH2 B;  4K0K O;  1EN4 A;  1OCC B;  5IJ0 A;  4TV8 B;  3ETD A;  2Q6A A;  1WLE A;  1R1B A;  2QWR B;  3O9O A;  4MVM A;  1JCH A;  3E83 A;  1CXZ B;  1Y6X A;  4X64 B;  4ZOL B;  1I0H A;  4JAV A;  3E8F A;  3OD4 A;  5JH7 B;  4DV5 B;  4IYI A;  4NTX A;  3SPJ A;  2OT5 A;  1URF A;  4X1K B;  4HNA B;  2Q4P A;  2Z5U A;  2ZIO A;  2YIA A;  3EHB B;  1F23 A;  2LP7 A;  2DWE C;  3I56 V;  4RUE A;  5LP6 C;  1HNX O;  2N05 A;  4WBN B;  3IAY A;  1NVP D;  2CTP A;  2EUL A;  1GK9 A;  1FJG O;  2JVD A;  5CA0 B;  4RO2 A;  3L74 H;  4DO2 A;  4FM2 A;  1FFX B;  2YIB A;  4Z1V A;  4PDM A;  4UB8 Z;  1XMO B;  3JAK A;  3C3T A;  4JI5 B;  1R6N A;  4B3T B;  1K4D C;  4GZR B;  2QA4 V;  2P5O A;  4LF7 O;  3FYI B;  3TK1 A;  2NLJ C;  2EIN B;  2PZS A;  4MS2 A;  4DR6 O;  2CH7 B;  4R50 A;  1NKD A;  4LF5 B;  5IYD O;  2XAS A;  2DYR B;  3M7M X;  3QVN A;  4BW5 A;  3T1C A;  3UM7 A;  1H2G A;  1G4Y B;  2FL4 A;  4NXN B;  2YEV A;  3T2M A;  5JJE B;  5B1O A;  4GKK O;  1QU7 A;  2DN9 A;  4BIZ A;  1V55 C;  2W6I G;  4LF8 B;  2OYQ A;  1WB8 A;  5L3B A;  3SGI A;  3ASN C;  4JI6 O;  4I0X B;  3ZS8 C;  4OX9 O;  4FZ0 A;  4LCU C;  2X6B A;  1HNX B;  2EIK B;  3L72 H;  3D3I A;  4X20 B;  4HZ3 A;  2JEU A;  1FJG B;  3N2K A;  4D7T A;  4LWS B;  3JAT B;  1WPB A;  4QGP A;  2B1I A;  5IYC O;  2RJZ A;  1XUQ A;  4IHJ A;  4KUM A;  2QEX V;  4FZ1 A;  4J9Y B;  5TIS Z;  3LDD A;  4BIU A;  1L1F A;  1YJN V;  1US6 A;  3BAA A;  3E8B A;  2ZIM A;  1SQX H;  3CRA A;  4AI8 A;  4DR6 B;  5LP6 A;  5JQG B;  1SES A;  3CRQ A;  1W2B U;  1ZUQ A;  2EIJ C;  4YHH O;  1SQQ H;  1ORQ C;  4J42 A;  3B09 A;  4O2A B;  1Y76 B;  1M56 C;  3ZHT A;  1E79 G;  4CH6 A;  4GT1 A;  5IT9 N;  2H94 A;  4W4L A;  2BSK A;  1V54 B;  2GHY A;  5KUK A;  3C90 A;  2BTQ B;  1NTK H;  5GTI Z;  3LDC A;  3FX7 A;  2GUZ A;  1MOF A;  1RPO A;  2P4K A;  4H37 A;  4JI4 B;  4DK1 A;  4LFA O;  3DGE A;  5B3S B;  1SZT A;  3RWR D;  4MVU A;  2BTO A;  4LF6 B;  1M57 B;  3CXH F;  3VQY A;  4OPH A;  1R3J C;  3FD9 A;  1MSW D;  1WB7 A;  5LYJ A;  4AQY B;  1GRJ A;  4Q20 A;  5GW7 A;  2EJ7 A;  3A0H Z;  5KHI A;  2YSU B;  1THZ A;  1FKA O;  4HBN A;  1XBL A;  1AJQ A;  2L6L A;  3K06 A;  5JVD A;  3JAW B;  3WB1 A;  5DM6 V;  2XTA A;  4YHH B;  1QLN A;  1YIT V;  4YY3 O;  1OCZ B;  3AG1 B;  1HR0 O;  2P67 A;  4L87 A;  3ZRW A;  1S5L Z;  4JTA B;  1ZX3 A;  5LHI A;  1NS1 A;  5E79 Z;  4TUY A;  5HFL A;  1AIL A;  3QG5 A;  2HP8 A;  1YJ9 V;  4LFC O;  2Q7E A;  4QPJ A;  3OT7 A;  4QJF B;  2R70 A;  5IY5 B;  3HKD B;  1H38 A;  4F4L A;  4LC1 A;  4AHC A;  3JAL A;  4YJ2 A;  2CUG A;  2B9Z A;  4WFG A;  3X2Q C;  3CSX A;  3I5D A;  1Q86 W;  3RYF A;  3ICX A;  5EC1 C;  3DSQ A;  5EBW C;  1G1X B;  1XOU A;  3CME V;  4GYC B;  1M90 W;  2DW4 A;  4UFZ A;  1Q5O A;  5ITZ B;  4DRX A;  2LFS A;  5FLX N;  3SPI A;  4FLZ A;  2QKS A;  1I5Y A;  2YUA A;  1RM1 C;  3OAA G;  2QSA A;  1N36 O;  1GN6 A;  1PP9 H;  1KMI Z;  4D7S A;  4QE7 A;  3RN4 A;  2UU9 O;  3AG2 C;  1MZE A;  1CP9 A;  2JDI G;  2RCV A;  3T1H B;  1KU9 A;  3KCX A;  4O4I B;  5L3G A;  3CEI A;  4DV0 B;  1B06 A;  1WAZ A;  1IVS A;  1QLE C;  3WB2 A;  3OMN B;  3ZMZ A;  2CGN A;  4LFC B;  5J2T A;  3RYH A;  4JTD B;  3CRM A;  4PJ0 Z;  4DR2 O;  1G8M A;  2K9P A;  2AGA A;  3WU2 Z;  2F43 G;  3JAS A;  1XNQ B;  2F4V B;  4CC6 A;  4CZZ A;  3BHP A;  4X62 O;  1GN2 A;  3JCZ A;  5B1B B;  4I50 A;  2CAZ C;  4FLV A;  2NR5 A;  4UB6 Z;  4YIO A;  4DV3 O;  3OUS A;  2PI5 A;  3AK2 A;  4TWK A;  5KHK A;  2QWN B;  1XNR B;  4DK0 A;  3LNM B;  3EXA A;  2Q0O C;  2UXD B;  2F66 C;  2GBO A;  4GX0 A;  3KKY A;  1NU1 H;  3OEH G;  4PHZ A;  3R66 A;  1H2L A;  1NQT A;  4WF9 V;  1N36 B;  2D3O W;  1VEW A;  1TVK A;  3QNE A;  5KHH A;  1VQK V;  1WN7 A;  1NZ6 A;  1VQ9 V;  1DF5 A;  4EKW A;  1DGS A;  1R6K A;  3AG3 B;  3GWO A;  3S3W A;  3CC4 V;  5IYZ B;  1OCR B;  5GON A;  2YXH A;  1T5E A;  1JVM A;  3IJ4 A;  1H2M A;  1IBL B;  2Y4T A;  4DR3 O;  3JAR A;  2QJ1 A;  4GUN A;  5FNV A;  4JF3 A;  4UUJ C;  4X1Y B;  2AHY A;  4MW3 A;  4GKJ O;  2HJF C;  3EFF K;  2ADQ B;  1IZ3 A;  4IL6 Z;  2V7Q G;  3E89 A;  4YXW G;  1TAE A;  5JWP A;  1OCO C;  1YHQ V;  4QNH B;  1L0L H;  2EIL B;  3H1J H;  4L8J A;  4O2B A;  4B3M O;  1GAX A;  4MTG A;  5E1A C;  2RDC A;  4FK5 C;  1S76 D;  1HP8 A;  3CCM V;  3ETG A;  3OMI B;  1AB3 A;  2Z0A A;  1ARO P;  2ZM6 O;  4CH5 A;  3T4D A;  4FFK A;  3HKE A;  3VQX A;  3ETE A;  3K58 A;  1XIL A;  2FTK A;  1WNS A;  4LFB B;  1JPX A;  1S3J A;  1SS3 A;  2UXN A;  2DYS C;  3JD1 A;  2ATK C;  5KAI Z;  3JSN A;  2EIM B;  5DN6 G;  1MSD A;  1KP2 A;  2BE3 A;  4J7J A;  5DED A;  4U3J B;  4DR3 B;  1BZK A;  3OW2 U;  4JV5 O;  5CMU A;  1HWY A;  3MD0 A;  3K5M A;  4MT8 A;  2ZR3 A;  1PL4 A;  3JAK B;  2AXT Z;  2CGO A;  1M4U A;  3K04 A;  2Y0I A;  4JI8 O;  2XND G;  4MVS A;  2EZP A;  3BRC A;  3CC2 V;  1XL6 A;  1SA0 A;  1HDJ A;  1D5A A;  2IH1 C;  5CBH A;  5LXT B;  2BCC H;  1JFF A;  3RGB A;  4C7U A;  2EJR A;  3DC5 A;  1GMG A;  2W0X A;  4XBF A;  4LNU B;  1EZV H;  3FAV A;  3B8M A;  1FAF A;  2GV9 A;  1H8E G;  2ZM6 B;  1TUB A;  2EZO A;  1ZWI C;  2ZT9 B;  3O65 A;  1YCI A;  2E5L B;  4O4L A;  4DW0 A;  1KC8 W;  4I4T A;  4X64 O;  1XI1 A;  4DV5 O;  3CJH B;  2MW2 B;  1AI7 A;  2ZXW C;  4JYC A;  1VQ4 V;  4X65 O;  4KHP O;  1R3K C;  2HLD G;  5D5P A;  2WLL A;  3T1Y O;  2OIE A;  4X9Q A;  1M1K W;  1MA1 A;  2XUM A;  1K97 A;  1I5X A;  3N27 A;  2LJ2 A;  5D5Q A;  3F5W C;  1NVP B;  3KZI Z;  3VOU A;  3TXQ A;  1XMO O;  3KCY A;  1Y74 B;  2YID A;  3OTO B;  4JI5 O;  3TJT A;  4B3T O;  1OHH G;  2Q69 A;  3ASO B;  4NTY A;  1P49 A;  3JD4 A;  5EZY A;  4DW1 A;  5LP6 B;  1S5H C;  3STL C;  1KKC A;  3W7U A;  4NYK A;  4LF5 O;  1IBK B;  1YF2 A;  4UVC A;  4PDL A;  1ENV A;  3JCU Z;  1PKX A;  4UCV A;  3NXS A;  2BOC C;  3SJQ C;  4NTW A;  5KMG A;  1UJW B;  1XDC A;  4FLU A;  2UUA O;  2V1D A;  1YZB A;  4NXN O;  1Z5V A;  4LP8 A;  3BVO A;  1RPR A;  5EIB D;  1AR5 A;  3AG4 C;  4LF8 O;  2WAM A;  4X65 B;  3WG7 C;  4KHP B;  1S5J A;  1Y66 A;  3ETQ A;  5B1N A;  3T1Y B;  2K1E A;  2Q0A A;  3CD6 V;  1P4R A;  2KSD A;  2QE7 G;  3GB7 C;  2QWP B;  5LYJ B;  3H1I H;  3A2F A;  4Z2W A;  3ZMU A;  3BFR A;  4IIJ A;  1V55 B;  5EYP A;  1PNK A;  3OTF A;  3ASN B;  4B7K A;  1CEZ A;  3E8H A;  5EBM C;  3SYA A;  3SYO A;  4ICG A;  2B1G A;  2PUS A;  1YJW V;  3WB0 A;  1SC5 B;  2ZDI C;  3QF7 A;  4O4H A;  3K0D A;  1M93 A;  2ZNI A;  2JEX A;  5BMV A;  5BXZ A;  4PA7 A;  1K4C C;  4EFB A;  2UUA B;  5CB4 A;  3DTU B;  1YI2 V;  5KHJ A;  4IYH A;  1VQO V;  1YTF D;  3OEE G;  4TUY B;  1WP8 A;  2C2A A;  3C3S A;  1NH2 D;  4LH7 A;  5CBG A;  2CTW A;  5DEC A;  4GCZ A;  4JI4 O;  2ZE6 A;  3TET A;  2EIJ B;  3N2G A;  1B3Q A;  3TGU H;  4LF6 O;  2XAF A;  4JYA B;  1K92 A;  2XAQ A;  1BHB A;  2JGD B;  2PF4 E;  1OV9 A;  4U3F H;  3K5O A;  5KUM A;  1AJN A;  1SQF A;  2PTM A;  1VQN V;  5KHG A;  2IH3 C;  4FJC C;  2F93 B;  4AQY O;  3RT3 C;  2XOK G;  3LSS A;  1BGY H;  1R6T A;  4U7N A;  2NN4 A;  2D2C B;  1WP7 A;  4PI0 A;  1JX9 A;  1SET A;  4FLW A;  2LFR A;  3OFN G;  4DYL A;  2N04 A;  3RVZ A;  4KL1 A;  3R65 A;  4ZI7 A;  4DV7 B;  3J7A U;  1Y4M A;  1XQ8 A;  1Q6H A;  3J81 N;  1SF9 A;  4A5U B;  1F4M A;  4BW9 A;  3JD3 A;  3E22 A;  3LSU A;  4K3A A;  2Y69 C;  3BA8 A;  1JR9 A;  1YXB A;  4O4J A;  2UXC B;  1LUW A;  4B3S B;  1D2D A;  3ZMS A;  3G80 A;  5J2T B;  1SRY A;  2HHH O;  1EZJ A;  1KP3 A;  3CE2 A;  4TV8 A;  2Q7H A;  5H6Q A;  2ZR2 A;  3D36 C;  2ZDI A;  4D6T H;  2UUB B;  3K5L A;  3CWB H;  3JAS B;  3QO8 A;  2WLI B;  1ZL8 A;  4J11 A;  3CMA V;  5IE9 A;  5B1A C;  2A79 B;  4Z1M G;  3H1K H;  3UQ8 A;  2VQE O;  2WWW A;  4ZHQ A;  4UCU A;  1P84 F;  1XMQ B;  2FYU H;  1K5Q A;  4DUY B;  2DE0 X;  3ZHV A;  2A9H A;  4MTO A;  1XHZ A;  1DTO A;  2HEP A;  2HR3 A;  2PYL A;  4DV6 B;  2P4V A;  1XL4 A;  2ITD C;  3UO2 A;  3WFV A;  1ZLZ A;  4K8Z A;  2FB5 A;  5CA0 A;  5A9G A;  4QPK A;  2KQX A;  2JS5 A;  3X2Q B;  1W59 A;  1BQZ A;  4R6Z A;  3IGA C;  2A0L A;  1V54 C;  1X4T A;  1UPG A;  5LGN A;  3T1H O;  3W7S A;  1SER A;  1XHX A;  5GON B;  4RQF A;  1B6Q A;  2Q67 A;  3CXC U;  4ABM A;  4B08 A;  3K57 A;  1MZF A;  4DV0 O;  3M99 B;  3ZJZ A;  2P06 A;  2PGG A;  4WFA V;  3ABK B;  3JAR B;  5FNV B;  3CCL V;  4JI2 B;  1RM1 B;  3SYC A;  1M57 C;  1JJ2 U;  2HHH B;  5FL7 G;  3F7V C;  3D3Q A;  4UVB A;  4QIW F;  3AG2 B;  3ZHQ A;  4X88 A;  1QCE A;  1XNQ O;  2CE4 A;  2F4V O;  4FVM A;  3E2E A;  2LW1 A;  4TV9 A;  5B5E Z;  2VQE B;  4LR3 A;  2WA4 A;  4O2B B;  2YXY A;  2QTS A;  4EB6 B;  2A3Q A;  1MAB G;  1VQ6 V;  1QLE B;  4I0X A;  4WCE V;  1VF7 A;  1XNR O;  5IYB O;  4H33 A;  3D36 A;  2UXD O;  3HKE B;  2IU0 A;  1AR4 A;  3OGI B;  3G6E V;  3OUF A;  1I7F A;  4MW8 A;  4FLT A;  4EEQ A;  4PI2 A;  4XDK A;  2M7W A;  1DLB A;  1E1R G;  1JMK C;  5JQG A;  2ITC C;  3K3W A;  1SQP H;  4JI1 O;  3LDE A;  3AEI A;  1IBL O;  1VAR A;  4NKG B;  1N32 B;  4DR1 O;  1H2N A;  5FPO A;  3OGC C;  3OMA B;  2GTS A;  3RYI A;  4CBC A;  3CCQ V;  1TA8 A;  1VQ7 V;  1TUE B;  3F5T A;  2ZIN A;  1VF6 C;  3VQW A;  3ZCC A;  1JQ0 A;  3CRR A;  1PNL A;  1FFT B;  4TQF A;  3HKB A;  1QHT A;  1GM9 A;  2YI9 A;  1IUR A;  2L35 A;  1SA0 B;  1LNQ A;  5A2Q N;  2JK5 C;  3E35 A;  3ZHR A;  1JFF B;  1VF5 B;  4UVA A;  4JI7 B;  4DV4 O;  3FAV B;  3IC7 A;  2JJ2 G;  1MMM A;  4CH4 A;  4I55 A;  4DV1 O;  1TUB B;  1COW G;  3OE7 G;  4XDJ A;  2Q7G A;  2R9R B;  3ABL C;  5IJ9 A;  4O4L B;  4LFB O;  4WFH A;  2F1M A;  3CCR V;  2GTA A;  1KD1 W;  1FPO A;  1OCO B;  4MVR A;  5LA6 A;  1EFR G;  5H6R A;  4J80 A;  2OCC C;  2VS0 A;  1YSC A;  2GSM B;  2ZE8 A;  2Z3Y A;  1SZX A;  1BQ0 A;  2ZNJ A;  2A7W A;  1G6U A;  3JAW A;  3B40 A;  4JI1 B;  2WLL B;  2PY5 A;  1ZTE A;  3U10 A;  1S72 V;  4DR1 B;  1QBZ A;  4DR4 B;  3ZHS A;  4TOI A;  1MG1 A;  2E74 B;  2QWQ B;  5IDJ A;  1FXK B;  2ZE7 A;  1L0N H;  1VIB A;  4TSF G;  5B1B C;  1VQ5 V;  1RSO A;  1P7B A;  3IFX A;  3JD0 A;  1BCC H;  3FB6 C;  5EZY B;  2Q68 A;  3DXR B;  1FD9 A;  3QO7 A;  1OZ0 A;  2QM4 A;  1Q7Y W;  2EX3 A;  4DV4 B;  2UUC B;  3A8T A;  5CA3 A;  3LNN A;  5KX5 B;  3AK3 A;  3HKD A;  2ZQM A;  3ZMV A;  5IJ0 B;  1Q90 D;  4PD4 F;  4DV1 B;  4LF4 B;  2PI4 A;  3BA9 A;  5KMG B;  5LGU A;  1NJI W;  1VF6 A;  1J5E B;  2Q8V A;  2E5L O;  4WFB V;  3RBZ A;  2IW5 A;  2YDE A;  2H8P C;  2QKC A;  3ABT A;  4H13 B;  1OCR C;  4BAY A;  3MAQ A;  1W0J G;  3HB3 B;  4NR1 A;  1JOY A;  1PD3 A;  3THO A;  4H44 B;  3K9S A;  3B77 A;  1XRE A;  3ABM C;  1WA8 A;  3ZHU A;  3IC9 A;  5KA5 A;  1EN5 A;  4JI3 B;  5C8Y A;  4KFM A;  2X7R B;  4F6R A;  1KYO F;  1N4C A;  3E86 A;  4NB5 A;  1JA8 A;  1L8D A;  4JZ2 A;  4MVZ A;  4O4I A;  2RN9 A;  3OTO O;  2ZXW B;  1SQB H;  4J7Z A;  1KQS U;  1Q43 A;  3BEH A;  4LH6 A;  3DC6 A;  4G28 B;  2QGN A;  3SJC C;  4NXM B;  1IBK O;  4IT5 A;  4UCR A;  5H2F Z;  2LW7 A;  2WLH A;  3QO5 A;  4O4H B;  2HJD A;  3P30 A;  4JPR A;  5L3F A;  4UCO A;  2X6C A;  4YJ3 A;  2QWO B;  2ZD9 A;  4N21 A;  1K3E A;  4RQE A;  1LUV A;  4KXR A;  1Q8I A;  2WLM A;  2YEV B;  3RYC A;  5LGT A;  1P7G A;  2EIM C;  3CHX A;  1H2K A;  2JJ1 G;  4XDL A;  4JI0 B;  3N2G B;  3G67 A;  3Q4H A;  3ZRX A;  4DUZ O;  1KB9 F;  2WLK A;  2Y4U A;  1MNG A;  3N2K B;  1IXB A;  4H0L B;  2HG5 C;  2X6A A;  1UFI A;  2NNU A;  4IHJ B;  3FKS G;  5IYZ A;  2XHB A;  1M9N A;  2KG7 A;  3UT5 A;  2YXL A;  3KG2 A;  2UXX A;  1HNZ B;  3K5N A;  3CPW U;  4UV9 A;  5EIB C;  4DV2 B;  3SPG A;  2KKW A;  2EBO A;  3W7X A;  1Q6I A;  2WPD G;  2BSK B;  1VP7 A;  2DQ0 A;  1K5S A;  2LO1 A;  1RFY A;  1GN4 A;  5EC2 C;  1BHA A;  2DMX A;  2GUZ B;  4GX5 A;  4O4J B;  2RNB A;  3FYE B;  3JD2 A;  5IWA B;  1NTM H;  1VQ8 V;  4U7O A;  4DUZ B;  2CK3 G;  1S0V A;  2E3C A;  1ZAU A;  4MVO A;  4JYA O;  5J2U A;  1ZL8 B;  3HKC A;  3U0Z A;  3J80 N;  2HKO A;  5L3E A;  5LL6 Y;  2CTR A;  3G71 V;  4X66 B;  4ZHQ B;  2IJJ A;  4GLX A;  4WFE A;  4EFE A;  1ZSP A;  3UO3 A;  3ASO C;  1AI6 A;  2Q9L A;  3PJS K;  1BE3 H;  1NR7 A;  3HPL C;  3SJA C;  1PNM A;  4P30 A;  4U3J A;  4PA6 A;  3FB5 C;  2R9I A;  4FFB A;  4ZKI A;  4P2Z A;  5JVD B;  2DJV A;  4JTC B;  1OCC C;  2OWO A;  3ML0 A;  4CS2 A;  1YDX A;  3ABU A;  4DV7 O;  1FYJ A;  3ZRW B;  3M8A A;  4I5S A;  2IJH A;  5JCO C;  3CB2 A;  1IDS A;  4E2L A;  5LXT A;  1Q6U A;  3K03 A;  3JAM N;  3ZX6 A;  5J9P C;  2UXC O;  4LNU A;  1I08 A;  3MDS A;  4B3S O;  1S77 D;  3NR7 A;  2ZKO A;  4K0K B;  2XAJ A;  1DF4 A;  3B8N A;  2LGW A;  1PV0 A;  1VQM V;  1M56 B;  1K8A W;  3EVK A;  3A0R A;  3GWK C;  2UUB O;  2IJK A;  4YJ2 B;  3JAL B;  5CA1 A;  3K9A A;  2KB1 A;  4CC5 A;  4AIL C;  3OR6 C;  4TV9 B;  3LSQ A;  3RYF B;  3CJH A;  2Y69 B;  3F7Y C;  5GTH Z;  1XMQ O;  2HVK C;  4DUY O;  2Y0P A;  1N0J A;  1BL8 A;  4DV6 O;  4LBE C;  2EIN C;  5B66 Z;  2F95 B;  4ZBM A;  4QE9 A;  4X1I A;  4JAU A;  5H9C A;  1K33 A;  4RUF A;  2Q5Z A;  4DRX B;  2DYR C;  3CP1 A;  1EM1 A;  5LBQ A;  5LOV A;  3B4S A;  3FB8 C;  1PPJ H;  1OJH A;  2ETN A;  2HFE C;  5B1A B;  1KBH A;  4FMT A;  1Y74 A;  2AZ2 A;  3SR2 C;  3G4S V;  2OIG A;  5L3C A;  3H1L H;  4GX2 A;  4LF7 B;  1BSM A;  2ZCE A;  3BCC H;  3AG7 A;  4MTX A;  4W4K A;  4CH3 A;  1PM9 A;  4Q6G A;  2JRI A;  3D8C A;  1Q82 W;  4RAI A;  4JI2 O;  1N33 O;  2EIK C;  3P3N A;  3RYI B;  3RYH B;  1PL0 A;  1NR1 A;  1F7Y A;  3H01 A;  2XT9 A;  4G2K A;  3ZBH A;  4UXN A;  4KP4 A;  3APQ A;  5LMN O;  2W0F C;  1X59 A;  5JCO A;  2DWD C;  1DK1 A;  3P3P A;  3HKB B;  3SDL A;  3LUT B;  4ZOL A;  4GKK B;  1EBO A;  3OR7 C;  4UCS A;  4JYB A;  4I50 B;  5JH7 A;  4N23 A;  3L75 H;  4PEL A;  4X1K A;  4HNA A;  1EN6 A;  4DR7 O;  4JI6 B;  1H2S B;  1QR9 A;  3RW0 A;  1WPX A;  1B04 A;  5CBF A;  4OX9 B;  4OXS A;  4E4E A;  1Q3E A;  4WBN A;  4I55 B;  2CTQ A;  3SYQ A;  4P9P A;  1YIJ V;  5IJ9 B;  3K0G A;  4X89 A;  1FFX A;  2DQ3 A;  2YIC A;  1TVK B;  2ZE5 A;  4PA3 A;  5LA6 B;  3STZ C;  1QVG U;  1FXV A;  3MHS C;  1HNW O;  2FML A;  1AR1 B;  1V9P A;  1QNM A;  3ZED A;  1GKF A;  4B7E A;  4BR6 A;  1AI4 A;  2CH7 A;  2BOB C;  2GDS A;  3S3X A;  4DXW A;  2IJI A;  5B3S C;  4LF9 O;  3HR0 A;  2E76 B;  3MHH C;  2W6J G;  1N32 O;  2IU3 A;  5AG2 A;  1N33 B;  3ZMT A;  2RQ6 A; 
#chains in the Genus database with same CATH homology
 3I5D A;  4DW0 A;  4DW1 A;  3H9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...