3I5HB

The crystal structure of rigor like squid myosin s1 in the absence of nucleotide
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
145
structure length
145
Chain Sequence
RVKLSQRQMQELKEAFTMIDQDRDGFIGMEDLKDMFSSLGRVPPDDELNAMLKECPGQLNFTAFLTLFGEKVSGTDPEDALRNAFSMFDEDGQGFIPEDYLKDLLENMGDNFSKEEIKNVWKDAPLKNKQFNYNKMVDIKGKAED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rigor-like structures from muscle myosins reveal key mechanical elements in the transduction pathways of this allosteric motor.
pubmed doi rcsb
molecule tags Contractile protein
molecule keywords Myosin heavy chain isoform A
total genus 28
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2009-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3i5hB02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3i5hB01
4OKHA 4PE0A 1MQ1A 2K7BA 4AQIA 1CDNA 3D10A 3SIBA 3EK7A 2Q91A 2K0JA 5AANA 4DS7A 1WLMA 1NX0A 1BF5A 2DOQA 2JQ6A 5I2OA 2GGMA 4I5NB 5DKQA 2ZNDA 4MRXA 1KK8B 1KQMB 1KFUL 1NIWA 4CFQA 3I5GB 2BCBA 1J7PA 1DJIA 1CB1A 3OB1B 3CR2A 5IBWA 2M7NA 2Y5IA 2JULA 1RK9A 1BMOA 1K96A 2KGRA 2PALA 1YRUB 1CLBA 1G8IA 1TN4A 2WCFA 1NX3A 1CDLA 4N1FA 2K7DA 2JXCA 4HRGA 2PRUA 1A03A 1TOPA 2QPTA 3ZWHA 1E8AA 1YUTA 1K9PA 1LINA 2KDHA 4OR9B 5HLVA 3D0YA 2LV7A 3K21A 5AEQA 1C7WA 1V1GA 1ZFSA 3I5GC 1J7RA 3OX5A 2BBMA 1IQ3A 3DVKA 4QJ3B 3AKBA 2KAXA 3CGAA 2LVKA 1FI6A 4XJKB 1SR6B 2PSRA 4PHMA 4PHJA 1DF0A 3NSIA 1QIWA 4MVFA 1TTXA 2KYCA 2WC8A 1AK8A 1XFUO 3NSKA 3WXAA 2WCEA 1CFCA 2LM5A 1AP4A 1J7OA 1K9KA 3NSLA 4FQOA 1OMDA 2I2RE 2SCPA 1YX8A 3DD4A 1SCMC 3QRXA 2L51A 2M29A 1M45A 4M2PA 2BKIB 2KAYA 1TCFA 3AKAA 1IG5A 1CM1A 3M0WA 2JXLA 3VGOA 2MA2A 2CBLA 2HPSA 3SG3A 4BY4A 1SR6C 1SYMA 3TDIA 1J7QA 1DJYA 2JZIA 1U5IA 2V53A 1VRKA 2OPOA 3CS1A 1EJ3A 1RFJA 1QV0A 4C0JA 3BUWB 5PALA 1CMFA 1SW8A 5B8IB 4JWQA 1B1GA 2I18A 1FBVA 3GK4X 3FWBA 1SK6D 1S3PA 1BR1B 4IL1A 4MZLA 2NLNA 1OZOA 3JVTB 5HKZA 2NCOA 2JTTA 1EH2A 1H4BA 2PVBA 3SG7A 2JRFA 5J3XA 2H2KA 2F8PA 4MBEA 4GUKA 1F54A 1J1DA 4GBAA 4HRHA 1B8RA 2LANA 1DT7B 1QV1A 2KGBC 3LL8B 1C07A 1GGZA 1B8CA 1LA3A 2KI4C 1B7TZ 1Q80A 2JU0A 3O78A 3GOFA 3AAJA 1H8BA 2BCAA 1UP5A 3LLEA 2LLTA 2VRGA 2ZNEA 3H4SE 3SG5A 2L4HA 2ZRSA 2L4IA 2LVJA 3PFVA 2EGDA 1DGUA 2L98A 1SBJA 1IJ5A 1PK0D 1SNLA 4YGDB 1B8LA 2KI6C 1BLQA 1JF2A 1CKKA 1BOCA 1S5GY 2M0RA 4P5OE 4BY5A 3I5HB 1ZACA 2KSPA 1KSOA 2MAZA 2BBNA 2H61C 3TZ1A 3VRRA 5ER5A 1CNPA 2LCPA 1IJ6A 3JTDC 3WHUB 2K2AA 1RTP1 2LP2A 1GJYA 2JPTA 5CSJA 1MR8A 1SPYA 1UURA 3D0YB 4PHNA 1W7JB 5HLOA 2BE4A 4QJ4B 4CIDA 3JTDB 1CDPA 4PALA 2AMIA 2Y4QA 4DIRA 1YVLA 3BXKA 3I5FC 1ZMZA 5KSZA 1KWOB 3OP0A 1B4CA 4WRIA 2K7OA 3O4YA 4OVNF 1BG1A 1CMGA 1F70A 2JNFA 1WLZA 1XFXO 2LHLA 4M2OA 2MBXA 1JC2A 3PM8A 3PSRA 2P6BB 2BKHB 2WORA 5AERA 4GFTA 1A4PA 2WOSA 2CNPA 2K7CA 2BE6A 1CFDA 1W7IB 4CLNA 2FCEA 1XVJA 3MSEB 2BL0C 4Q04A 1NYAA 4CPVA 1TNQA 5TNCA 2GV5A 1L7ZA 3TS5B 1F55A 2KHNA 3CWGA 3CR4X 3A4UB 1UWOA 3KPXA 1A29A 2KNEA 2ZFDA 1BJFA 1ZUZA 3EVRA 3EK8A 5JJGA 1YVHA 3IQQA 1F4QA 1OZSA 1F71A 1KCYA 1NSHA 2JC2A 1NX2A 2KBIA 5K89A 3DVEA 3SG4A 3JVTC 3PLFB 2LMTA 1EG4A 1X02A 1BU3A 4A4CA 1M46A 1WRLA 1DF0B 2H61A 2LLUA 2OS8B 3DVJA 4MZKA 2KOTA 2M8UA 1WDCC 2CCMA 2QACA 1IRJA 1S6IA 1DJZA 2M9GA 1F8HA 1LA0A 2OS8C 1PSRA 1AJ5A 1J55A 2FJUB 2F33A 1G33A 1M39A 1QJTA 1QVIZ 1WY9A 3BOWB 3BYAA 1D1OA 1DTLA 2F3ZA 2M3WA 4ORAB 1KQVA 2LE9B 2K61A 1MXLC 1LVCD 1IKUA 2CTNA 3F45A 4OCIA 2JT8A 3C1VA 3DF0B 1J1EA 1K90D 1CTRA 1KK7Z 1M63B 3CTNA 3EVVA 3PALA 5DKNA 1V1FA 3A8RA 1N0YA 1QX5B 1OMRA 4ICBA 1WRKA 4D1EA 2EC6B 5KTYA 3SIAA 1DMOA 1AVSA 2IS9A 2E6WA 4HSZA 1OE9B 2GGZA 1Y1AA 4PE4A 1CFFA 1EL4A 1OMVA 1GGWA 5DKRA 1QX7A 2JT0A 4MZJA 1CLMA 1SCMB 4JPZB 1FW4A 4I5JA 4WQ2A 2JTZA 1KWOC 2HQWA 1S1EA 1XFWO 5HYDA 1N2DA 2LAPA 3I5FB 1HQVA 4JQ0D 1A75B 1G4YR 2FOTA 2LMUA 4MEWA 2KFFA 1A2XA 1YTZC 1GQMA 4PCWA 4XYNA 1UUSA 2K2FA 2SASA 3DF0A 3LCPC 2R2IA 1SY9A 2LUCA 4TNCA 3WHTB 1KK8C 5AXIA 1L2OB 2NXQA 4M2QA 4YRUA 5I2QA 1JSAA 2NZ0A 5I8NA 4I5LB 4NDBA 5FYXA 3EVUA 1LXFC 2BECA 1FI5A 1QX2A 1SMGA 4YGBB 2COLB 3LK0A 1KFXS 4DUQA 2MLEC 2ZN8A 2KYFA 4L9MA 3GK2A 1XFVO 2FCDA 5ER4X 4PHKA 4E68A 5HKYA 2KI4B 3OX6A 2LP3A 1RJVA 2WNDA 1LKJA 1CDMA 2OTGB 4MLWA 4ZCVA 2MHHA 4A4BA 1DJWA 2G9BA 3DVMA 2HF5A 4GGNA 4DCKA 1OQPA 3EKJA 2Q4UA 3CLNA 2KAVA 2F3YA 3ICBA 4I5KA 5JOLA 4QJ5B 1ALVA 1XFZO 1F4OA 3HX4A 2M7LA 3BUMB 2PASA 1MUXA 1NUBA 2HETA 1U5IB 3KO0A 1CLLA 2MRDA 1HT9A 3ZNIA 3BOWA 1MXEA 1UHKA 4AOMA 2L0PA 2CXJA 2LUXA 3I5IB 1XO5A 4PDZA 1AJ4A 1XFYO 1KFUS 3KEVA 3EKHA 3OB2B 2LMVA 2EC6C 3IF7A 4ORBB 1YURA 1BODA 3KHEA 5CSNA 1JFJA 3FWCA 3HCMA 1QTXA 1R2UA 2ISDA 1MF8B 1KFXL 2L2EA 2L50A 1A75A 2LNKA 1KK7Y 2AAOA 4NDCA 5AFPA 1S6JA 1AHRA 5BPJA 1N65A 1IWQA 2TN4A 1PSBA 4USLA 2JOJA 1YX7A 3TDZA 1OSAA 1IH0A 4FTGA 1YUSA 2LHIA 1MWNA 2L5XB 1QVIY 2I7AA 4YI8A 1TNPA 2F2OA 1YUUA 1R6PA 1K94A 3BUNB 2OTGC 1IQ5A 1L2OC 1C7VA 1AUIB 1K8UA 1RROA 4GPLB 5CSFA 4P2YB 2JWWA 1KSMA 3RLZA 2ZKMX 1DJGA 2JNXA 4MN0A 1JFKA 1FPWA 4N5XA 1NPQA 3CZTX 2JT3A 5CPVA 2HQ8A 4C0LA 1ODBA 2O60A 2G2BA 2D8NA 4MRYA 1SL7A 2EHBA 4DRWA 1XK4A 2ZRTA 3TUYC 3FS7A 3IQOA 1KQMC 1Y1XA 1NWDA 1YR5A 2BL0B 2F2PA 2Y1NA 2KQ6A 4YGAA 2M1UA 4OV2A 3KF9A 1JWDA 1BT6A 2WCBA 2LVVA 1S36A 2LVIA 3LK1A 4GGFA 2NCPA 3EK4A 4ZCUA 2KFGA 3O6BA 1QLSA 1JF0A 1EXRA 4N1GA 3PN7B 2PMYA 4HREE 1PVBA 4YGEB 1PULA 2Y1MA 2KFHA 1K95A 1NCZA 1B9AA 1S26D 5HKWA 1Y0VH 1TNXA 1K2HA 3NXAA 2CT9A 3FIAA 2ZN9A 5KU1A 3TUYB 1JUOA 4YI9A 2I94A 1PVAA 1DJHA 4PE7A 2KI6D 5GQQC 3BQ3A 5D7FA 2M49B 2MJWB 2O5GA 1XA5A 1ALWA 1B47A 4ORCB 4U8DA 1DJXA 1DGVA 3TDUA 1PRWA 3NSOA 4GGFC 3SG2A 1QATA 3SG6A 1SKTA 4ETOA 4XJKA 1RECA 4GNKB 3VRQA 1XYDA 3RM1A 2LLSA 2BCXA 1S6CA 1UHHA 1B7TY 1OOJA 4MSPA 3VROA 1TCOB 2M1KB 4AQJA 1FF1A 3AAKA 1WDCB 1K93D 3WNXB 1NX1A 1ZOTB 2M97A 3TS5C 2K8MB 4GAOA 1IGVA 1XK4C 5F6TA 1DVIA 1EG3A 5I2LA 1NP8A 2A4JA 1Y1UA 4NQGA 3E3RA 3VRNA 1MHOA 4WQ3A 3PN7C 3SJSA 4UPGA 1SCVA 3O2PA 1CM4A 3CR5X 1QXPA 1K9UA 1JBAA 4CFRA 4F0ZB 1BR4B 2E30A 5G08A 1PALA 1Y6WA 1NCYA 1QIVA 4NDDA 1QASA 1QLKA 1TRFA 3BUOB 4YBHB 2RGIA 3VRPA 1SL9A 1UHNA 1NCXA 1UHIA 1SL8A 2KBMA 2KQYA 1M31A 3I5IC 4PE1A 4YGCB 3BUXB 5D69A 4C0KA 1UHJA 2AUCA 1CFPA 1SRAA 1RWYA 3I5HC 1S5GZ 1TIZA 2LC5A 3OHMB 3PATA 4R1EA 1YRTB 1TNWA 1WRZA 2B1UA 5CSIA 2MLFC 1QS7A 3GK1A
chains in the Genus database with same CATH superfamily
4OKHA 4PE0A 1MQ1A 2K7BA 4AQIA 1CDNA 3D10A 3SIBA 3EK7A 2Q91A 2K0JA 5AANA 5DICA 4DS7A 1WLMA 1NX0A 1BF5A 2DOQA 2JQ6A 5I2OA 2GGMA 4I5NB 5DKQA 2ZNDA 4MRXA 1KK8B 1KQMB 1KFUL 1NIWA 4CFQA 3I5GB 2BCBA 1J7PA 1DJIA 1CB1A 3OB1B 3CR2A 3CZ1A 2M7NA 2Y5IA 5IBWA 2JULA 1RK9A 3FE8A 1BMOA 1K96A 2KGRA 2PALA 1YRUB 1CLBA 1G8IA 1TN4A 2WCFA 1NX3A 1CDLA 4N1FA 1OOIX 2K7DA 2JXCA 1DEKA 4HRGA 4IJ7A 2PRUA 1A03A 1TOPA 2QPTA 3ZWHA 1E8AA 2FJYA 1YUTA 1K9PA 1LINA 2KDHA 4OR9B 5HLVA 3D0YA 2LV7A 3K21A 5AEQA 1C7WA 2PYQA 1V1GA 1ZFSA 3S0GA 3I5GC 1J7RA 3OX5A 2BAPA 3BJHA 2BBMA 1IQ3A 2ERBA 3DVKA 4QJ3B 3AKBA 2KAXA 3CGAA 2LVKA 1FI6A 4XJKB 1SR6B 2PSRA 4PHMA 4PHJA 1DF0A 3NSIA 1QIWA 4MVFA 1TTXA 2KYCA 2WC8A 1Z4HA 1XFUO 1AK8A 3NSKA 3WXAA 2WCEA 1CFCA 2LM5A 1AP4A 2WCLA 1J7OA 1K9KA 3NSLA 4FQOA 1OMDA 2I2RE 2SCPA 1YX8A 3DD4A 1SCMC 3QRXA 2L51A 1OW4A 2M29A 4OZDA 1M45A 4M2PA 2BKIB 2KAYA 1TCFA 3AKAA 1IG5A 1CM1A 3M0WA 2JXLA 3VGOA 2MA2A 2CBLA 2HPSA 3SG3A 4BY4A 1SR6C 1SYMA 3TDIA 1J7QA 1DJYA 2JZIA 1U5IA 2V53A 1VRKA 2OPOA 3CS1A 1EJ3A 1RFJA 1QV0A 4C0JA 3BUWB 5PALA 1CMFA 1SW8A 5B8IB 2P70A 3R1OA 4JWQA 1B1GA 2I18A 1FBVA 3GK4X 2QEOA 3FWBA 1SK6D 1S3PA 1BR1B 4IL1A 4MZLA 2NLNA 1OZOA 3D76A 3JVTB 2NCOA 2JTTA 5HKZA 1H4BA 2PVBA 3D74A 3SG7A 3B6XA 2JRFA 5J3XA 2H2KA 2F8PA 2KLDA 1GM0A 4MBEA 4GUKA 1F54A 1J1DA 4GBAA 4HRHA 1B8RA 2LANA 1DT7B 2WC5A 1QV1A 2KGBC 3LL8B 1C07A 1GGZA 1B8CA 1LA3A 2KI4C 1B7TZ 1Q80A 2JU0A 3O78A 3GOFA 3AAJA 1H8BA 2BCAA 1UP5A 3LLEA 2LLTA 2VRGA 2ZNEA 3H4SE 3SG5A 2L4HA 2ZRSA 2L4IA 2LVJA 3PFVA 2EGDA 1DGUA 2L98A 1SBJA 1IJ5A 1PK0D 1SNLA 2WCMA 3UO9A 4YGDB 1B8LA 2KI6C 1BLQA 1JF2A 2P71A 1CKKA 2K60A 1BOCA 1S5GY 2M0RA 4P5OE 4BY5A 3I5HB 1ZACA 2KSPA 1C3YA 1KSOA 2MAZA 2BBNA 2H61C 3TZ1A 3VRRA 5ER5A 1CNPA 2LCPA 1IJ6A 3JTDC 3WHUB 2K2AA 3PM2A 1RTP1 2LP2A 1GJYA 2JPTA 5CSJA 1MR8A 1SPYA 1UURA 3D0YB 4PHNA 1W7JB 5HLOA 2BE4A 3CZ0A 3BFHA 4QJ4B 4CIDA 3CDNA 1ORGA 3JTDB 1CDPA 4PALA 2AMIA 2Y4QA 4DIRA 1YVLA 3BXKA 3I5FC 1TUJA 1ZMZA 3D75A 5KSZA 2WCKA 3BFBA 1KWOB 3OP0A 1B4CA 3SS5A 4WRIA 2K7OA 3O4YA 4OVNF 1BG1A 1CMGA 1F70A 2JNFA 1WLZA 1XFXO 2LHLA 4KYNA 4M2OA 2MBXA 1JC2A 3PM8A 3PSRA 1C3ZA 2P6BB 2BKHB 2WORA 5AERA 4GFTA 1A4PA 2WOSA 2CNPA 2K7CA 2BE6A 1CFDA 1W7IB 4CLNA 2FCEA 1XVJA 3MSEB 2BL0C 4Q04A 1NYAA 4CPVA 1TNQA 5TNCA 2GV5A 1L7ZA 3TS5B 1F55A 2KHNA 3DY9A 3CWGA 3CR4X 5EL2A 3R1VA 3A4UB 1UWOA 3KPXA 1A29A 2KNEA 2ZFDA 1BJFA 1Z2CB 1ZUZA 3EVRA 3BFAA 3EK8A 5JJGA 1YVHA 3IQQA 1F4QA 1OZSA 1F71A 1KCYA 1NSHA 3D77A 2JC2A 1NX2A 2KBIA 5K89A 3S0EA 3DVEA 3SG4A 3JVTC 3PLFB 2LMTA 1EG4A 1X02A 1BU3A 4A4CA 1M46A 1WRLA 1DF0B 2H61A 2LLUA 2OS8B 3DVJA 4MZKA 2KOTA 2M8UA 1WDCC 1T14A 2CCMA 2QACA 1IRJA 1S6IA 1DJZA 2M9GA 1F8HA 3OBVA 1LA0A 2OS8C 3B7AA 1PSRA 1AJ5A 1J55A 2FJUB 2F33A 1G33A 4F7FA 1M39A 1QJTA 1QVIZ 1WY9A 3BOWB 3BYAA 1D1OA 1DTLA 2F3ZA 2M3WA 4ORAB 3VB1A 1KQVA 2LE9B 5FI2A 2K61A 1MXLC 1LVCD 1IKUA 2CTNA 3F45A 4OCIA 1EH2A 2JT8A 3C1VA 3DF0B 1J1EA 1K90D 1CTRA 1KK7Z 1M63B 2GTEA 2L5YA 3CTNA 3DZTA 3EVVA 2L2CA 3PALA 5DKNA 1V1FA 3A8RA 1N0YA 2QEVA 1QX5B 1OMRA 4ICBA 1WRKA 4D1EA 1P28A 2EC6B 5KTYA 3SIAA 1DMOA 1AVSA 2IS9A 2E6WA 3DYEA 4HSZA 1OE9B 2GGZA 1Y1AA 4PE4A 1CFFA 1EL4A 1OMVA 1GGWA 5DKRA 1QX7A 2JT0A 4MZJA 1CLMA 1SCMB 4JPZB 1FW4A 4I5JA 4WQ2A 2JTZA 1KWOC 2HQWA 1S1EA 1XFWO 5HYDA 1N2DA 2LAPA 3I5FB 1HQVA 4JQ0D 1A75B 1G4YR 2FOTA 2LMUA 4MEWA 2WCHA 1LS8A 3NGVA 2KFFA 1A2XA 1YTZC 3O4XA 1GQMA 4PCWA 4XYNA 3L47A 1UUSA 2K2FA 2WC6A 2SASA 3DF0A 3LCPC 3NHIA 2R2IA 1SY9A 2LUCA 4TNCA 3WHTB 1KK8C 4JKTA 5AXIA 1L2OB 2NXQA 4M2QA 4YRUA 5I2QA 1JSAA 2NZ0A 3RZSA 5I8NA 4I5LB 4NDBA 2PQLA 5FYXA 3EVUA 3NHTA 1LXFC 2BECA 1FI5A 1QX2A 1SMGA 4YGBB 2COLB 3LK0A 1TWOA 1KFXS 5FI6A 4DUQA 2MLEC 2ZN8A 2KYFA 4L9MA 3GK2A 1XFVO 2FCDA 5ER4X 4PHKA 4E68A 5HKYA 2KI4B 3OX6A 2LP3A 3CABA 1RJVA 2WNDA 1LKJA 3IVTA 1CDMA 2OTGB 4MLWA 1XFRA 2MHHA 4ZCVA 1DJWA 2QEHA 4A4BA 2G9BA 3DVMA 2HF5A 4GGNA 4DCKA 1OQPA 3EKJA 3D78A 2Q4UA 3CLNA 3CZ2A 3FE6A 2KAVA 3B87A 2F3YA 3ICBA 4I5KA 5JOLA 4QJ5B 1ALVA 1XFZO 1F4OA 3HX4A 2M7LA 3BUMB 2PASA 1MUXA 1NUBA 2HETA 1U5IB 3KO0A 1CLLA 2MRDA 1HT9A 3ZNIA 3BOWA 1MXEA 1DQEA 1UHKA 4AOMA 2L0PA 2CXJA 2LUXA 3I5IB 1XO5A 4PDZA 1AJ4A 1XFYO 1KFUS 3KEVA 3EKHA 3OB2B 2LMVA 2EC6C 3IF7A 1OOFA 4ORBB 1YURA 1BODA 3KHEA 5CSNA 1JFJA 3FWCA 3HCMA 1QTXA 1R2UA 2ISDA 1MF8B 1KFXL 2L2EA 2L50A 1A75A 4FQTA 3UNWA 2LNKA 1KK7Y 2AAOA 4NDCA 5AFPA 1S6JA 1AHRA 5BPJA 1N65A 1IWQA 2TN4A 1PSBA 4USLA 2JOJA 3S0FA 1YX7A 3TDZA 1OSAA 1IH0A 4FTGA 2YGUA 1TUZA 1DELA 1YUSA 2LHIA 1MWNA 2L5XB 1QVIY 2I7AA 4YI8A 1TNPA 2F2OA 3B88A 1YUUA 1R6PA 1K94A 3BUNB 2OTGC 1IQ5A 3K1EA 1L2OC 1C7VA 1AUIB 1K8UA 1RROA 3FE9A 4GPLB 5CSFA 2KLEA 2JWWA 1KSMA 4P2YB 3RLZA 3S0AA 2BNXA 2WCJA 2ZKMX 1DJGA 2JNXA 3PJIA 4MN0A 1JFKA 1FPWA 4N5XA 1NPQA 3EG5B 3CZTX 2JT3A 5CPVA 2HQ8A 4C0LA 2QEBA 1ODBA 2O60A 2G2BA 2D8NA 4MRYA 1SL7A 1OOGA 4INWA 2EHBA 4DRWA 1XK4A 2ZRTA 3TUYC 3V2LA 3FS7A 1DC1A 3IQOA 1KQMC 1Y1XA 1NWDA 1YR5A 2BL0B 2F2PA 2Y1NA 2KQ6A 4YGAA 2M1UA 4OV2A 3KF9A 1JWDA 1BT6A 2WCBA 2LVVA 2QDIA 1W9ZA 1S36A 2LVIA 3LK1A 4GGFA 1OOHA 2NCPA 3EK4A 4ZCUA 5HL1A 2H8VA 2KFGA 3O6BA 1QLSA 1IIOA 1JF0A 1EXRA 4N1GA 3PN7B 2PMYA 4HREE 1PVBA 4YGEB 1PULA 1QWVA 2KFHA 2Y1MA 1K95A 1NCZA 4PT1A 1B9AA 1S26D 5FI7A 1Y0VH 1TNXA 5HKWA 1K2HA 3NXAA 3R72A 2CT9A 3FIAA 2ZN9A 5KU1A 3TUYB 1JUOA 4YI9A 2I94A 2KPHA 1PVAA 1DJHA 3L4LA 4PE7A 2KI6D 5GQQC 3BQ3A 5D7FA 2M49B 2MJWB 2O5GA 1XA5A 1ALWA 1B47A 3OGNA 4ORCB 3QMEA 4U8DA 1DJXA 1DGVA 3DXLA 3TDUA 1PRWA 3NSOA 4GGFC 3SG2A 1QATA 3SG6A 1SKTA 4ETOA 4XJKA 1RECA 4GNKB 3VRQA 1XYDA 3RM1A 1SSEB 2LLSA 2BCXA 1S6CA 1UHHA 1B7TY 1OOJA 4INXA 4MSPA 1TCOB 2M1KB 3VROA 4AQJA 1FF1A 3AAKA 1WDCB 1K93D 3D73A 3S0DA 3WNXB 1NX1A 1ZOTB 2M97A 3TS5C 2K8MB 4GAOA 1IGVA 1XK4C 2JPOA 1DVIA 1EG3A 5F6TA 5I2LA 1NP8A 3R1PA 2A4JA 1Y1UA 4NQGA 3E3RA 3VRNA 1MHOA 4WQ3A 3PN7C 3SJSA 4UPGA 1SCVA 3O2PA 1CM4A 3CR5X 1QXPA 3Q8IA 1K9UA 1JBAA 4CFRA 4F0ZB 1BR4B 2E30A 5G08A 1PALA 1Y6WA 3CYZA 3SS4A 1NCYA 1QIVA 4NDDA 1QASA 3B86A 4JD9A 1QLKA 1TRFA 3BUOB 4YBHB 2RGIA 3SS3A 3VRPA 1SL9A 3N7HA 1UHNA 1NCXA 1UHIA 1SL8A 2KBMA 2KQYA 1M31A 3I5IC 4PE1A 4YGCB 3BUXB 5D69A 4C0KA 1UHJA 3S0BA 2AUCA 1CFPA 1SRAA 1RWYA 3I5HC 1S5GZ 1TIZA 2LC5A 3OHMB 3PATA 5I94A 4R1EA 1YRTB 1TNWA 1WRZA 5D3OA 2B1UA 5CSIA 2MLFC 3L4AA 1QS7A 3GK1A
chains in the Genus database with same CATH topology
4OKHA 4PE0A 1MQ1A 2K7BA 4AQIA 1CDNA 3D10A 3SIBA 3EK7A 2Q91A 2K0JA 5AANA 4DS7A 1WLMA 1NX0A 1BF5A 2DOQA 2JQ6A 5I2OA 2GGMA 4I5NB 5DKQA 2ZNDA 4MRXA 1KK8B 1KQMB 1KFUL 1NIWA 4CFQA 3I5GB 2BCBA 1J7PA 1DJIA 1CB1A 3OB1B 3CR2A 5IBWA 2M7NA 2Y5IA 2JULA 1RK9A 1BMOA 1K96A 2KGRA 2PALA 1YRUB 1CLBA 1G8IA 1TN4A 2WCFA 1NX3A 1CDLA 4N1FA 2K7DA 2JXCA 4HRGA 2PRUA 1A03A 1TOPA 2QPTA 3ZWHA 1E8AA 1YUTA 1K9PA 1LINA 2KDHA 4OR9B 5HLVA 3D0YA 2LV7A 3K21A 5AEQA 1C7WA 1V1GA 1ZFSA 3I5GC 1J7RA 3OX5A 2BBMA 1IQ3A 3DVKA 4QJ3B 3AKBA 2KAXA 3CGAA 2LVKA 1FI6A 4XJKB 1SR6B 2PSRA 4PHMA 4PHJA 1DF0A 3NSIA 1QIWA 4MVFA 1TTXA 2KYCA 2WC8A 1AK8A 1XFUO 3NSKA 3WXAA 2WCEA 1CFCA 2LM5A 1AP4A 1J7OA 1K9KA 3NSLA 4FQOA 1OMDA 2I2RE 2SCPA 1YX8A 3DD4A 1SCMC 3QRXA 2L51A 2M29A 1M45A 4M2PA 2BKIB 2KAYA 1TCFA 3AKAA 1IG5A 1CM1A 3M0WA 2JXLA 3VGOA 2MA2A 2CBLA 2HPSA 3SG3A 4BY4A 1SR6C 1SYMA 3TDIA 1J7QA 1DJYA 2JZIA 1U5IA 2V53A 1VRKA 2OPOA 3CS1A 1EJ3A 1RFJA 1QV0A 4C0JA 3BUWB 5PALA 1CMFA 1SW8A 5B8IB 4JWQA 1B1GA 2I18A 1FBVA 3GK4X 3FWBA 1SK6D 1S3PA 1BR1B 4IL1A 4MZLA 2NLNA 1OZOA 3JVTB 5HKZA 2NCOA 2JTTA 1EH2A 1H4BA 2PVBA 3SG7A 2JRFA 5J3XA 2H2KA 2F8PA 4MBEA 4GUKA 1F54A 1J1DA 4GBAA 4HRHA 1B8RA 2LANA 1DT7B 1QV1A 2KGBC 3LL8B 1C07A 1GGZA 1B8CA 1LA3A 2KI4C 1B7TZ 1Q80A 2JU0A 3O78A 3GOFA 3AAJA 1H8BA 2BCAA 1UP5A 3LLEA 2LLTA 2VRGA 2ZNEA 3H4SE 3SG5A 2L4HA 2ZRSA 2L4IA 2LVJA 3PFVA 2EGDA 1DGUA 2L98A 1SBJA 1IJ5A 1PK0D 1SNLA 4YGDB 1B8LA 2KI6C 1BLQA 1JF2A 1CKKA 1BOCA 1S5GY 2M0RA 4P5OE 4BY5A 3I5HB 1ZACA 2KSPA 1KSOA 2MAZA 2BBNA 2H61C 3TZ1A 3VRRA 5ER5A 1CNPA 2LCPA 1IJ6A 3JTDC 3WHUB 2K2AA 1RTP1 2LP2A 1GJYA 2JPTA 5CSJA 1MR8A 1SPYA 1UURA 3D0YB 4PHNA 1W7JB 5HLOA 2BE4A 4QJ4B 4CIDA 3JTDB 1CDPA 4PALA 2AMIA 2Y4QA 4DIRA 1YVLA 3BXKA 3I5FC 1ZMZA 5KSZA 1KWOB 3OP0A 1B4CA 4WRIA 2K7OA 3O4YA 4OVNF 1BG1A 1CMGA 1F70A 2JNFA 1WLZA 1XFXO 2LHLA 4M2OA 2MBXA 1JC2A 3PM8A 3PSRA 2P6BB 2BKHB 2WORA 5AERA 4GFTA 1A4PA 2WOSA 2CNPA 2K7CA 2BE6A 1CFDA 1W7IB 4CLNA 2FCEA 1XVJA 3MSEB 2BL0C 4Q04A 1NYAA 4CPVA 1TNQA 5TNCA 2GV5A 1L7ZA 3TS5B 1F55A 2KHNA 3CWGA 3CR4X 3A4UB 1UWOA 3KPXA 1A29A 2KNEA 2ZFDA 1BJFA 1ZUZA 3EVRA 3EK8A 5JJGA 1YVHA 3IQQA 1F4QA 1OZSA 1F71A 1KCYA 1NSHA 2JC2A 1NX2A 2KBIA 5K89A 3DVEA 3SG4A 3JVTC 3PLFB 2LMTA 1EG4A 1X02A 1BU3A 4A4CA 1M46A 1WRLA 1DF0B 2H61A 2LLUA 2OS8B 3DVJA 4MZKA 2KOTA 2M8UA 1WDCC 2CCMA 2QACA 1IRJA 1S6IA 1DJZA 2M9GA 1F8HA 1LA0A 2OS8C 1PSRA 1AJ5A 1J55A 2FJUB 2F33A 1G33A 1M39A 1QJTA 1QVIZ 1WY9A 3BOWB 3BYAA 1D1OA 1DTLA 2F3ZA 2M3WA 4ORAB 1KQVA 2LE9B 2K61A 1MXLC 1LVCD 1IKUA 2CTNA 3F45A 4OCIA 2JT8A 3C1VA 3DF0B 1J1EA 1K90D 1CTRA 1KK7Z 1M63B 3CTNA 3EVVA 3PALA 5DKNA 1V1FA 3A8RA 1N0YA 1QX5B 1OMRA 4ICBA 1WRKA 4D1EA 2EC6B 5KTYA 3SIAA 1DMOA 1AVSA 2IS9A 2E6WA 4HSZA 1OE9B 2GGZA 1Y1AA 4PE4A 1CFFA 1EL4A 1OMVA 1GGWA 5DKRA 1QX7A 2JT0A 4MZJA 1CLMA 1SCMB 4JPZB 1FW4A 4I5JA 4WQ2A 2JTZA 1KWOC 2HQWA 1S1EA 1XFWO 5HYDA 1N2DA 2LAPA 3I5FB 1HQVA 4JQ0D 1A75B 1G4YR 2FOTA 2LMUA 4MEWA 2KFFA 1A2XA 1YTZC 1GQMA 4PCWA 4XYNA 1UUSA 2K2FA 2SASA 3DF0A 3LCPC 2R2IA 1SY9A 2LUCA 4TNCA 3WHTB 1KK8C 5AXIA 1L2OB 2NXQA 4M2QA 4YRUA 5I2QA 1JSAA 2NZ0A 5I8NA 4I5LB 4NDBA 5FYXA 3EVUA 1LXFC 2BECA 1FI5A 1QX2A 1SMGA 4YGBB 2COLB 3LK0A 1KFXS 4DUQA 2MLEC 2ZN8A 2KYFA 4L9MA 3GK2A 1XFVO 2FCDA 5ER4X 4PHKA 4E68A 5HKYA 2KI4B 3OX6A 2LP3A 1RJVA 2WNDA 1LKJA 1CDMA 2OTGB 4MLWA 4ZCVA 2MHHA 4A4BA 1DJWA 2G9BA 3DVMA 2HF5A 4GGNA 4DCKA 1OQPA 3EKJA 2Q4UA 3CLNA 2KAVA 2F3YA 3ICBA 4I5KA 5JOLA 4QJ5B 1ALVA 1XFZO 1F4OA 3HX4A 2M7LA 3BUMB 2PASA 1MUXA 1NUBA 2HETA 1U5IB 3KO0A 1CLLA 2MRDA 1HT9A 3ZNIA 3BOWA 1MXEA 1UHKA 4AOMA 2L0PA 2CXJA 2LUXA 3I5IB 1XO5A 4PDZA 1AJ4A 1XFYO 1KFUS 3KEVA 3EKHA 3OB2B 2LMVA 2EC6C 3IF7A 4ORBB 1YURA 1BODA 3KHEA 5CSNA 1JFJA 3FWCA 3HCMA 1QTXA 1R2UA 2ISDA 1MF8B 1KFXL 2L2EA 2L50A 1A75A 2LNKA 1KK7Y 2AAOA 4NDCA 5AFPA 1S6JA 1AHRA 5BPJA 1N65A 1IWQA 2TN4A 1PSBA 4USLA 2JOJA 1YX7A 3TDZA 1OSAA 1IH0A 4FTGA 1YUSA 2LHIA 1MWNA 2L5XB 1QVIY 2I7AA 4YI8A 1TNPA 2F2OA 1YUUA 1R6PA 1K94A 3BUNB 2OTGC 1IQ5A 1L2OC 1C7VA 1AUIB 1K8UA 1RROA 4GPLB 5CSFA 4P2YB 2JWWA 1KSMA 3RLZA 2ZKMX 1DJGA 2JNXA 4MN0A 1JFKA 1FPWA 4N5XA 1NPQA 3CZTX 2JT3A 5CPVA 2HQ8A 4C0LA 1ODBA 2O60A 2G2BA 2D8NA 4MRYA 1SL7A 2EHBA 4DRWA 1XK4A 2ZRTA 3TUYC 3FS7A 3IQOA 1KQMC 1Y1XA 1NWDA 1YR5A 2BL0B 2F2PA 2Y1NA 2KQ6A 4YGAA 2M1UA 4OV2A 3KF9A 1JWDA 1BT6A 2WCBA 2LVVA 1S36A 2LVIA 3LK1A 4GGFA 2NCPA 3EK4A 4ZCUA 2KFGA 3O6BA 1QLSA 1JF0A 1EXRA 4N1GA 3PN7B 2PMYA 4HREE 1PVBA 4YGEB 1PULA 2Y1MA 2KFHA 1K95A 1NCZA 1B9AA 1S26D 5HKWA 1Y0VH 1TNXA 1K2HA 3NXAA 2CT9A 3FIAA 2ZN9A 5KU1A 3TUYB 1JUOA 4YI9A 2I94A 1PVAA 1DJHA 4PE7A 2KI6D 5GQQC 3BQ3A 5D7FA 2M49B 2MJWB 2O5GA 1XA5A 1ALWA 1B47A 4ORCB 4U8DA 1DJXA 1DGVA 3TDUA 1PRWA 3NSOA 4GGFC 3SG2A 1QATA 3SG6A 1SKTA 4ETOA 4XJKA 1RECA 4GNKB 3VRQA 1XYDA 3RM1A 2LLSA 2BCXA 1S6CA 1UHHA 1B7TY 1OOJA 4MSPA 3VROA 1TCOB 2M1KB 4AQJA 1FF1A 3AAKA 1WDCB 1K93D 3WNXB 1NX1A 1ZOTB 2M97A 3TS5C 2K8MB 4GAOA 1IGVA 1XK4C 5F6TA 1DVIA 1EG3A 5I2LA 1NP8A 2A4JA 1Y1UA 4NQGA 3E3RA 3VRNA 1MHOA 4WQ3A 3PN7C 3SJSA 4UPGA 1SCVA 3O2PA 1CM4A 3CR5X 1QXPA 1K9UA 1JBAA 4CFRA 4F0ZB 1BR4B 2E30A 5G08A 1PALA 1Y6WA 1NCYA 1QIVA 4NDDA 1QASA 1QLKA 1TRFA 3BUOB 4YBHB 2RGIA 3VRPA 1SL9A 1UHNA 1NCXA 1UHIA 1SL8A 2KBMA 2KQYA 1M31A 3I5IC 4PE1A 4YGCB 3BUXB 5D69A 4C0KA 1UHJA 2AUCA 1CFPA 1SRAA 1RWYA 3I5HC 1S5GZ 1TIZA 2LC5A 3OHMB 3PATA 4R1EA 1YRTB 1TNWA 1WRZA 2B1UA 5CSIA 2MLFC 1QS7A 3GK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OKH A;  4PE0 A;  1MQ1 A;  2K7B A;  4AQI A;  1CDN A;  3D10 A;  3SIB A;  3EK7 A;  2Q91 A;  2K0J A;  5AAN A;  4DS7 A;  1WLM A;  1NX0 A;  1BF5 A;  2DOQ A;  2JQ6 A;  5I2O A;  2GGM A;  4I5N B;  5DKQ A;  2ZND A;  4MRX A;  1KK8 B;  1KQM B;  1KFU L;  1NIW A;  4CFQ A;  3I5G B;  2BCB A;  1J7P A;  1DJI A;  1CB1 A;  3OB1 B;  3CR2 A;  5IBW A;  2M7N A;  2Y5I A;  2JUL A;  1RK9 A;  1BMO A;  1K96 A;  2KGR A;  2PAL A;  1YRU B;  1CLB A;  1G8I A;  1TN4 A;  2WCF A;  1NX3 A;  1CDL A;  4N1F A;  2K7D A;  2JXC A;  4HRG A;  2PRU A;  1A03 A;  1TOP A;  2QPT A;  3ZWH A;  1E8A A;  1YUT A;  1K9P A;  1LIN A;  2KDH A;  4OR9 B;  5HLV A;  3D0Y A;  2LV7 A;  3K21 A;  5AEQ A;  1C7W A;  1V1G A;  1ZFS A;  3I5G C;  1J7R A;  3OX5 A;  2BBM A;  1IQ3 A;  3DVK A;  4QJ3 B;  3AKB A;  2KAX A;  3CGA A;  2LVK A;  1FI6 A;  4XJK B;  1SR6 B;  2PSR A;  4PHM A;  4PHJ A;  1DF0 A;  3NSI A;  1QIW A;  4MVF A;  1TTX A;  2KYC A;  2WC8 A;  1AK8 A;  1XFU O;  3NSK A;  3WXA A;  2WCE A;  1CFC A;  2LM5 A;  1AP4 A;  1J7O A;  1K9K A;  3NSL A;  4FQO A;  1OMD A;  2I2R E;  2SCP A;  1YX8 A;  3DD4 A;  1SCM C;  3QRX A;  2L51 A;  2M29 A;  1M45 A;  4M2P A;  2BKI B;  2KAY A;  1TCF A;  3AKA A;  1IG5 A;  1CM1 A;  3M0W A;  2JXL A;  3VGO A;  2MA2 A;  2CBL A;  2HPS A;  3SG3 A;  4BY4 A;  1SR6 C;  1SYM A;  3TDI A;  1J7Q A;  1DJY A;  2JZI A;  1U5I A;  2V53 A;  1VRK A;  2OPO A;  3CS1 A;  1EJ3 A;  1RFJ A;  1QV0 A;  4C0J A;  3BUW B;  5PAL A;  1CMF A;  1SW8 A;  5B8I B;  4JWQ A;  1B1G A;  2I18 A;  1FBV A;  3GK4 X;  3FWB A;  1SK6 D;  1S3P A;  1BR1 B;  4IL1 A;  4MZL A;  2NLN A;  1OZO A;  3JVT B;  5HKZ A;  2NCO A;  2JTT A;  1EH2 A;  1H4B A;  2PVB A;  3SG7 A;  2JRF A;  5J3X A;  2H2K A;  2F8P A;  4MBE A;  4GUK A;  1F54 A;  1J1D A;  4GBA A;  4HRH A;  1B8R A;  2LAN A;  1DT7 B;  1QV1 A;  2KGB C;  3LL8 B;  1C07 A;  1GGZ A;  1B8C A;  1LA3 A;  2KI4 C;  1B7T Z;  1Q80 A;  2JU0 A;  3O78 A;  3GOF A;  3AAJ A;  1H8B A;  2BCA A;  1UP5 A;  3LLE A;  2LLT A;  2VRG A;  2ZNE A;  3H4S E;  3SG5 A;  2L4H A;  2ZRS A;  2L4I A;  2LVJ A;  3PFV A;  2EGD A;  1DGU A;  2L98 A;  1SBJ A;  1IJ5 A;  1PK0 D;  1SNL A;  4YGD B;  1B8L A;  2KI6 C;  1BLQ A;  1JF2 A;  1CKK A;  1BOC A;  1S5G Y;  2M0R A;  4P5O E;  4BY5 A;  3I5H B;  1ZAC A;  2KSP A;  1KSO A;  2MAZ A;  2BBN A;  2H61 C;  3TZ1 A;  3VRR A;  5ER5 A;  1CNP A;  2LCP A;  1IJ6 A;  3JTD C;  3WHU B;  2K2A A;  1RTP 1;  2LP2 A;  1GJY A;  2JPT A;  5CSJ A;  1MR8 A;  1SPY A;  1UUR A;  3D0Y B;  4PHN A;  1W7J B;  5HLO A;  2BE4 A;  4QJ4 B;  4CID A;  3JTD B;  1CDP A;  4PAL A;  2AMI A;  2Y4Q A;  4DIR A;  1YVL A;  3BXK A;  3I5F C;  1ZMZ A;  5KSZ A;  1KWO B;  3OP0 A;  1B4C A;  4WRI A;  2K7O A;  3O4Y A;  4OVN F;  1BG1 A;  1CMG A;  1F70 A;  2JNF A;  1WLZ A;  1XFX O;  2LHL A;  4M2O A;  2MBX A;  1JC2 A;  3PM8 A;  3PSR A;  2P6B B;  2BKH B;  2WOR A;  5AER A;  4GFT A;  1A4P A;  2WOS A;  2CNP A;  2K7C A;  2BE6 A;  1CFD A;  1W7I B;  4CLN A;  2FCE A;  1XVJ A;  3MSE B;  2BL0 C;  4Q04 A;  1NYA A;  4CPV A;  1TNQ A;  5TNC A;  2GV5 A;  1L7Z A;  3TS5 B;  1F55 A;  2KHN A;  3CWG A;  3CR4 X;  3A4U B;  1UWO A;  3KPX A;  1A29 A;  2KNE A;  2ZFD A;  1BJF A;  1ZUZ A;  3EVR A;  3EK8 A;  5JJG A;  1YVH A;  3IQQ A;  1F4Q A;  1OZS A;  1F71 A;  1KCY A;  1NSH A;  2JC2 A;  1NX2 A;  2KBI A;  5K89 A;  3DVE A;  3SG4 A;  3JVT C;  3PLF B;  2LMT A;  1EG4 A;  1X02 A;  1BU3 A;  4A4C A;  1M46 A;  1WRL A;  1DF0 B;  2H61 A;  2LLU A;  2OS8 B;  3DVJ A;  4MZK A;  2KOT A;  2M8U A;  1WDC C;  2CCM A;  2QAC A;  1IRJ A;  1S6I A;  1DJZ A;  2M9G A;  1F8H A;  1LA0 A;  2OS8 C;  1PSR A;  1AJ5 A;  1J55 A;  2FJU B;  2F33 A;  1G33 A;  1M39 A;  1QJT A;  1QVI Z;  1WY9 A;  3BOW B;  3BYA A;  1D1O A;  1DTL A;  2F3Z A;  2M3W A;  4ORA B;  1KQV A;  2LE9 B;  2K61 A;  1MXL C;  1LVC D;  1IKU A;  2CTN A;  3F45 A;  4OCI A;  2JT8 A;  3C1V A;  3DF0 B;  1J1E A;  1K90 D;  1CTR A;  1KK7 Z;  1M63 B;  3CTN A;  3EVV A;  3PAL A;  5DKN A;  1V1F A;  3A8R A;  1N0Y A;  1QX5 B;  1OMR A;  4ICB A;  1WRK A;  4D1E A;  2EC6 B;  5KTY A;  3SIA A;  1DMO A;  1AVS A;  2IS9 A;  2E6W A;  4HSZ A;  1OE9 B;  2GGZ A;  1Y1A A;  4PE4 A;  1CFF A;  1EL4 A;  1OMV A;  1GGW A;  5DKR A;  1QX7 A;  2JT0 A;  4MZJ A;  1CLM A;  1SCM B;  4JPZ B;  1FW4 A;  4I5J A;  4WQ2 A;  2JTZ A;  1KWO C;  2HQW A;  1S1E A;  1XFW O;  5HYD A;  1N2D A;  2LAP A;  3I5F B;  1HQV A;  4JQ0 D;  1A75 B;  1G4Y R;  2FOT A;  2LMU A;  4MEW A;  2KFF A;  1A2X A;  1YTZ C;  1GQM A;  4PCW A;  4XYN A;  1UUS A;  2K2F A;  2SAS A;  3DF0 A;  3LCP C;  2R2I A;  1SY9 A;  2LUC A;  4TNC A;  3WHT B;  1KK8 C;  5AXI A;  1L2O B;  2NXQ A;  4M2Q A;  4YRU A;  5I2Q A;  1JSA A;  2NZ0 A;  5I8N A;  4I5L B;  4NDB A;  5FYX A;  3EVU A;  1LXF C;  2BEC A;  1FI5 A;  1QX2 A;  1SMG A;  4YGB B;  2COL B;  3LK0 A;  1KFX S;  4DUQ A;  2MLE C;  2ZN8 A;  2KYF A;  4L9M A;  3GK2 A;  1XFV O;  2FCD A;  5ER4 X;  4PHK A;  4E68 A;  5HKY A;  2KI4 B;  3OX6 A;  2LP3 A;  1RJV A;  2WND A;  1LKJ A;  1CDM A;  2OTG B;  4MLW A;  4ZCV A;  2MHH A;  4A4B A;  1DJW A;  2G9B A;  3DVM A;  2HF5 A;  4GGN A;  4DCK A;  1OQP A;  3EKJ A;  2Q4U A;  3CLN A;  2KAV A;  2F3Y A;  3ICB A;  4I5K A;  5JOL A;  4QJ5 B;  1ALV A;  1XFZ O;  1F4O A;  3HX4 A;  2M7L A;  3BUM B;  2PAS A;  1MUX A;  1NUB A;  2HET A;  1U5I B;  3KO0 A;  1CLL A;  2MRD A;  1HT9 A;  3ZNI A;  3BOW A;  1MXE A;  1UHK A;  4AOM A;  2L0P A;  2CXJ A;  2LUX A;  3I5I B;  1XO5 A;  4PDZ A;  1AJ4 A;  1XFY O;  1KFU S;  3KEV A;  3EKH A;  3OB2 B;  2LMV A;  2EC6 C;  3IF7 A;  4ORB B;  1YUR A;  1BOD A;  3KHE A;  5CSN A;  1JFJ A;  3FWC A;  3HCM A;  1QTX A;  1R2U A;  2ISD A;  1MF8 B;  1KFX L;  2L2E A;  2L50 A;  1A75 A;  2LNK A;  1KK7 Y;  2AAO A;  4NDC A;  5AFP A;  1S6J A;  1AHR A;  5BPJ A;  1N65 A;  1IWQ A;  2TN4 A;  1PSB A;  4USL A;  2JOJ A;  1YX7 A;  3TDZ A;  1OSA A;  1IH0 A;  4FTG A;  1YUS A;  2LHI A;  1MWN A;  2L5X B;  1QVI Y;  2I7A A;  4YI8 A;  1TNP A;  2F2O A;  1YUU A;  1R6P A;  1K94 A;  3BUN B;  2OTG C;  1IQ5 A;  1L2O C;  1C7V A;  1AUI B;  1K8U A;  1RRO A;  4GPL B;  5CSF A;  4P2Y B;  2JWW A;  1KSM A;  3RLZ A;  2ZKM X;  1DJG A;  2JNX A;  4MN0 A;  1JFK A;  1FPW A;  4N5X A;  1NPQ A;  3CZT X;  2JT3 A;  5CPV A;  2HQ8 A;  4C0L A;  1ODB A;  2O60 A;  2G2B A;  2D8N A;  4MRY A;  1SL7 A;  2EHB A;  4DRW A;  1XK4 A;  2ZRT A;  3TUY C;  3FS7 A;  3IQO A;  1KQM C;  1Y1X A;  1NWD A;  1YR5 A;  2BL0 B;  2F2P A;  2Y1N A;  2KQ6 A;  4YGA A;  2M1U A;  4OV2 A;  3KF9 A;  1JWD A;  1BT6 A;  2WCB A;  2LVV A;  1S36 A;  2LVI A;  3LK1 A;  4GGF A;  2NCP A;  3EK4 A;  4ZCU A;  2KFG A;  3O6B A;  1QLS A;  1JF0 A;  1EXR A;  4N1G A;  3PN7 B;  2PMY A;  4HRE E;  1PVB A;  4YGE B;  1PUL A;  2Y1M A;  2KFH A;  1K95 A;  1NCZ A;  1B9A A;  1S26 D;  5HKW A;  1Y0V H;  1TNX A;  1K2H A;  3NXA A;  2CT9 A;  3FIA A;  2ZN9 A;  5KU1 A;  3TUY B;  1JUO A;  4YI9 A;  2I94 A;  1PVA A;  1DJH A;  4PE7 A;  2KI6 D;  5GQQ C;  3BQ3 A;  5D7F A;  2M49 B;  2MJW B;  2O5G A;  1XA5 A;  1ALW A;  1B47 A;  4ORC B;  4U8D A;  1DJX A;  1DGV A;  3TDU A;  1PRW A;  3NSO A;  4GGF C;  3SG2 A;  1QAT A;  3SG6 A;  1SKT A;  4ETO A;  4XJK A;  1REC A;  4GNK B;  3VRQ A;  1XYD A;  3RM1 A;  2LLS A;  2BCX A;  1S6C A;  1UHH A;  1B7T Y;  1OOJ A;  4MSP A;  3VRO A;  1TCO B;  2M1K B;  4AQJ A;  1FF1 A;  3AAK A;  1WDC B;  1K93 D;  3WNX B;  1NX1 A;  1ZOT B;  2M97 A;  3TS5 C;  2K8M B;  4GAO A;  1IGV A;  1XK4 C;  5F6T A;  1DVI A;  1EG3 A;  5I2L A;  1NP8 A;  2A4J A;  1Y1U A;  4NQG A;  3E3R A;  3VRN A;  1MHO A;  4WQ3 A;  3PN7 C;  3SJS A;  4UPG A;  1SCV A;  3O2P A;  1CM4 A;  3CR5 X;  1QXP A;  1K9U A;  1JBA A;  4CFR A;  4F0Z B;  1BR4 B;  2E30 A;  5G08 A;  1PAL A;  1Y6W A;  1NCY A;  1QIV A;  4NDD A;  1QAS A;  1QLK A;  1TRF A;  3BUO B;  4YBH B;  2RGI A;  3VRP A;  1SL9 A;  1UHN A;  1NCX A;  1UHI A;  1SL8 A;  2KBM A;  2KQY A;  1M31 A;  3I5I C;  4PE1 A;  4YGC B;  3BUX B;  5D69 A;  4C0K A;  1UHJ A;  2AUC A;  1CFP A;  1SRA A;  1RWY A;  3I5H C;  1S5G Z;  1TIZ A;  2LC5 A;  3OHM B;  3PAT A;  4R1E A;  1YRT B;  1TNW A;  1WRZ A;  2B1U A;  5CSI A;  2MLF C;  1QS7 A;  3GK1 A; 
#chains in the Genus database with same CATH topology
 4OKH A;  4PE0 A;  1MQ1 A;  2K7B A;  4AQI A;  1CDN A;  3D10 A;  3SIB A;  3EK7 A;  2Q91 A;  2K0J A;  5AAN A;  5DIC A;  4DS7 A;  1WLM A;  1NX0 A;  1BF5 A;  2DOQ A;  2JQ6 A;  5I2O A;  2GGM A;  4I5N B;  5DKQ A;  2ZND A;  4MRX A;  1KK8 B;  1KQM B;  1KFU L;  1NIW A;  4CFQ A;  3I5G B;  2BCB A;  1J7P A;  1DJI A;  1CB1 A;  3OB1 B;  3CR2 A;  3CZ1 A;  2M7N A;  2Y5I A;  5IBW A;  2JUL A;  1RK9 A;  3FE8 A;  1BMO A;  1K96 A;  2KGR A;  2PAL A;  1YRU B;  1CLB A;  1G8I A;  1TN4 A;  2WCF A;  1NX3 A;  1CDL A;  4N1F A;  1OOI X;  2K7D A;  2JXC A;  1DEK A;  4HRG A;  4IJ7 A;  2PRU A;  1A03 A;  1TOP A;  2QPT A;  3ZWH A;  1E8A A;  2FJY A;  1YUT A;  1K9P A;  1LIN A;  2KDH A;  4OR9 B;  5HLV A;  3D0Y A;  2LV7 A;  3K21 A;  5AEQ A;  1C7W A;  2PYQ A;  1V1G A;  1ZFS A;  3S0G A;  3I5G C;  1J7R A;  3OX5 A;  2BAP A;  3BJH A;  2BBM A;  1IQ3 A;  2ERB A;  3DVK A;  4QJ3 B;  3AKB A;  2KAX A;  3CGA A;  2LVK A;  1FI6 A;  4XJK B;  1SR6 B;  2PSR A;  4PHM A;  4PHJ A;  1DF0 A;  3NSI A;  1QIW A;  4MVF A;  1TTX A;  2KYC A;  2WC8 A;  1Z4H A;  1XFU O;  1AK8 A;  3NSK A;  3WXA A;  2WCE A;  1CFC A;  2LM5 A;  1AP4 A;  2WCL A;  1J7O A;  1K9K A;  3NSL A;  4FQO A;  1OMD A;  2I2R E;  2SCP A;  1YX8 A;  3DD4 A;  1SCM C;  3QRX A;  2L51 A;  1OW4 A;  2M29 A;  4OZD A;  1M45 A;  4M2P A;  2BKI B;  2KAY A;  1TCF A;  3AKA A;  1IG5 A;  1CM1 A;  3M0W A;  2JXL A;  3VGO A;  2MA2 A;  2CBL A;  2HPS A;  3SG3 A;  4BY4 A;  1SR6 C;  1SYM A;  3TDI A;  1J7Q A;  1DJY A;  2JZI A;  1U5I A;  2V53 A;  1VRK A;  2OPO A;  3CS1 A;  1EJ3 A;  1RFJ A;  1QV0 A;  4C0J A;  3BUW B;  5PAL A;  1CMF A;  1SW8 A;  5B8I B;  2P70 A;  3R1O A;  4JWQ A;  1B1G A;  2I18 A;  1FBV A;  3GK4 X;  2QEO A;  3FWB A;  1SK6 D;  1S3P A;  1BR1 B;  4IL1 A;  4MZL A;  2NLN A;  1OZO A;  3D76 A;  3JVT B;  2NCO A;  2JTT A;  5HKZ A;  1H4B A;  2PVB A;  3D74 A;  3SG7 A;  3B6X A;  2JRF A;  5J3X A;  2H2K A;  2F8P A;  2KLD A;  1GM0 A;  4MBE A;  4GUK A;  1F54 A;  1J1D A;  4GBA A;  4HRH A;  1B8R A;  2LAN A;  1DT7 B;  2WC5 A;  1QV1 A;  2KGB C;  3LL8 B;  1C07 A;  1GGZ A;  1B8C A;  1LA3 A;  2KI4 C;  1B7T Z;  1Q80 A;  2JU0 A;  3O78 A;  3GOF A;  3AAJ A;  1H8B A;  2BCA A;  1UP5 A;  3LLE A;  2LLT A;  2VRG A;  2ZNE A;  3H4S E;  3SG5 A;  2L4H A;  2ZRS A;  2L4I A;  2LVJ A;  3PFV A;  2EGD A;  1DGU A;  2L98 A;  1SBJ A;  1IJ5 A;  1PK0 D;  1SNL A;  2WCM A;  3UO9 A;  4YGD B;  1B8L A;  2KI6 C;  1BLQ A;  1JF2 A;  2P71 A;  1CKK A;  2K60 A;  1BOC A;  1S5G Y;  2M0R A;  4P5O E;  4BY5 A;  3I5H B;  1ZAC A;  2KSP A;  1C3Y A;  1KSO A;  2MAZ A;  2BBN A;  2H61 C;  3TZ1 A;  3VRR A;  5ER5 A;  1CNP A;  2LCP A;  1IJ6 A;  3JTD C;  3WHU B;  2K2A A;  3PM2 A;  1RTP 1;  2LP2 A;  1GJY A;  2JPT A;  5CSJ A;  1MR8 A;  1SPY A;  1UUR A;  3D0Y B;  4PHN A;  1W7J B;  5HLO A;  2BE4 A;  3CZ0 A;  3BFH A;  4QJ4 B;  4CID A;  3CDN A;  1ORG A;  3JTD B;  1CDP A;  4PAL A;  2AMI A;  2Y4Q A;  4DIR A;  1YVL A;  3BXK A;  3I5F C;  1TUJ A;  1ZMZ A;  3D75 A;  5KSZ A;  2WCK A;  3BFB A;  1KWO B;  3OP0 A;  1B4C A;  3SS5 A;  4WRI A;  2K7O A;  3O4Y A;  4OVN F;  1BG1 A;  1CMG A;  1F70 A;  2JNF A;  1WLZ A;  1XFX O;  2LHL A;  4KYN A;  4M2O A;  2MBX A;  1JC2 A;  3PM8 A;  3PSR A;  1C3Z A;  2P6B B;  2BKH B;  2WOR A;  5AER A;  4GFT A;  1A4P A;  2WOS A;  2CNP A;  2K7C A;  2BE6 A;  1CFD A;  1W7I B;  4CLN A;  2FCE A;  1XVJ A;  3MSE B;  2BL0 C;  4Q04 A;  1NYA A;  4CPV A;  1TNQ A;  5TNC A;  2GV5 A;  1L7Z A;  3TS5 B;  1F55 A;  2KHN A;  3DY9 A;  3CWG A;  3CR4 X;  5EL2 A;  3R1V A;  3A4U B;  1UWO A;  3KPX A;  1A29 A;  2KNE A;  2ZFD A;  1BJF A;  1Z2C B;  1ZUZ A;  3EVR A;  3BFA A;  3EK8 A;  5JJG A;  1YVH A;  3IQQ A;  1F4Q A;  1OZS A;  1F71 A;  1KCY A;  1NSH A;  3D77 A;  2JC2 A;  1NX2 A;  2KBI A;  5K89 A;  3S0E A;  3DVE A;  3SG4 A;  3JVT C;  3PLF B;  2LMT A;  1EG4 A;  1X02 A;  1BU3 A;  4A4C A;  1M46 A;  1WRL A;  1DF0 B;  2H61 A;  2LLU A;  2OS8 B;  3DVJ A;  4MZK A;  2KOT A;  2M8U A;  1WDC C;  1T14 A;  2CCM A;  2QAC A;  1IRJ A;  1S6I A;  1DJZ A;  2M9G A;  1F8H A;  3OBV A;  1LA0 A;  2OS8 C;  3B7A A;  1PSR A;  1AJ5 A;  1J55 A;  2FJU B;  2F33 A;  1G33 A;  4F7F A;  1M39 A;  1QJT A;  1QVI Z;  1WY9 A;  3BOW B;  3BYA A;  1D1O A;  1DTL A;  2F3Z A;  2M3W A;  4ORA B;  3VB1 A;  1KQV A;  2LE9 B;  5FI2 A;  2K61 A;  1MXL C;  1LVC D;  1IKU A;  2CTN A;  3F45 A;  4OCI A;  1EH2 A;  2JT8 A;  3C1V A;  3DF0 B;  1J1E A;  1K90 D;  1CTR A;  1KK7 Z;  1M63 B;  2GTE A;  2L5Y A;  3CTN A;  3DZT A;  3EVV A;  2L2C A;  3PAL A;  5DKN A;  1V1F A;  3A8R A;  1N0Y A;  2QEV A;  1QX5 B;  1OMR A;  4ICB A;  1WRK A;  4D1E A;  1P28 A;  2EC6 B;  5KTY A;  3SIA A;  1DMO A;  1AVS A;  2IS9 A;  2E6W A;  3DYE A;  4HSZ A;  1OE9 B;  2GGZ A;  1Y1A A;  4PE4 A;  1CFF A;  1EL4 A;  1OMV A;  1GGW A;  5DKR A;  1QX7 A;  2JT0 A;  4MZJ A;  1CLM A;  1SCM B;  4JPZ B;  1FW4 A;  4I5J A;  4WQ2 A;  2JTZ A;  1KWO C;  2HQW A;  1S1E A;  1XFW O;  5HYD A;  1N2D A;  2LAP A;  3I5F B;  1HQV A;  4JQ0 D;  1A75 B;  1G4Y R;  2FOT A;  2LMU A;  4MEW A;  2WCH A;  1LS8 A;  3NGV A;  2KFF A;  1A2X A;  1YTZ C;  3O4X A;  1GQM A;  4PCW A;  4XYN A;  3L47 A;  1UUS A;  2K2F A;  2WC6 A;  2SAS A;  3DF0 A;  3LCP C;  3NHI A;  2R2I A;  1SY9 A;  2LUC A;  4TNC A;  3WHT B;  1KK8 C;  4JKT A;  5AXI A;  1L2O B;  2NXQ A;  4M2Q A;  4YRU A;  5I2Q A;  1JSA A;  2NZ0 A;  3RZS A;  5I8N A;  4I5L B;  4NDB A;  2PQL A;  5FYX A;  3EVU A;  3NHT A;  1LXF C;  2BEC A;  1FI5 A;  1QX2 A;  1SMG A;  4YGB B;  2COL B;  3LK0 A;  1TWO A;  1KFX S;  5FI6 A;  4DUQ A;  2MLE C;  2ZN8 A;  2KYF A;  4L9M A;  3GK2 A;  1XFV O;  2FCD A;  5ER4 X;  4PHK A;  4E68 A;  5HKY A;  2KI4 B;  3OX6 A;  2LP3 A;  3CAB A;  1RJV A;  2WND A;  1LKJ A;  3IVT A;  1CDM A;  2OTG B;  4MLW A;  1XFR A;  2MHH A;  4ZCV A;  1DJW A;  2QEH A;  4A4B A;  2G9B A;  3DVM A;  2HF5 A;  4GGN A;  4DCK A;  1OQP A;  3EKJ A;  3D78 A;  2Q4U A;  3CLN A;  3CZ2 A;  3FE6 A;  2KAV A;  3B87 A;  2F3Y A;  3ICB A;  4I5K A;  5JOL A;  4QJ5 B;  1ALV A;  1XFZ O;  1F4O A;  3HX4 A;  2M7L A;  3BUM B;  2PAS A;  1MUX A;  1NUB A;  2HET A;  1U5I B;  3KO0 A;  1CLL A;  2MRD A;  1HT9 A;  3ZNI A;  3BOW A;  1MXE A;  1DQE A;  1UHK A;  4AOM A;  2L0P A;  2CXJ A;  2LUX A;  3I5I B;  1XO5 A;  4PDZ A;  1AJ4 A;  1XFY O;  1KFU S;  3KEV A;  3EKH A;  3OB2 B;  2LMV A;  2EC6 C;  3IF7 A;  1OOF A;  4ORB B;  1YUR A;  1BOD A;  3KHE A;  5CSN A;  1JFJ A;  3FWC A;  3HCM A;  1QTX A;  1R2U A;  2ISD A;  1MF8 B;  1KFX L;  2L2E A;  2L50 A;  1A75 A;  4FQT A;  3UNW A;  2LNK A;  1KK7 Y;  2AAO A;  4NDC A;  5AFP A;  1S6J A;  1AHR A;  5BPJ A;  1N65 A;  1IWQ A;  2TN4 A;  1PSB A;  4USL A;  2JOJ A;  3S0F A;  1YX7 A;  3TDZ A;  1OSA A;  1IH0 A;  4FTG A;  2YGU A;  1TUZ A;  1DEL A;  1YUS A;  2LHI A;  1MWN A;  2L5X B;  1QVI Y;  2I7A A;  4YI8 A;  1TNP A;  2F2O A;  3B88 A;  1YUU A;  1R6P A;  1K94 A;  3BUN B;  2OTG C;  1IQ5 A;  3K1E A;  1L2O C;  1C7V A;  1AUI B;  1K8U A;  1RRO A;  3FE9 A;  4GPL B;  5CSF A;  2KLE A;  2JWW A;  1KSM A;  4P2Y B;  3RLZ A;  3S0A A;  2BNX A;  2WCJ A;  2ZKM X;  1DJG A;  2JNX A;  3PJI A;  4MN0 A;  1JFK A;  1FPW A;  4N5X A;  1NPQ A;  3EG5 B;  3CZT X;  2JT3 A;  5CPV A;  2HQ8 A;  4C0L A;  2QEB A;  1ODB A;  2O60 A;  2G2B A;  2D8N A;  4MRY A;  1SL7 A;  1OOG A;  4INW A;  2EHB A;  4DRW A;  1XK4 A;  2ZRT A;  3TUY C;  3V2L A;  3FS7 A;  1DC1 A;  3IQO A;  1KQM C;  1Y1X A;  1NWD A;  1YR5 A;  2BL0 B;  2F2P A;  2Y1N A;  2KQ6 A;  4YGA A;  2M1U A;  4OV2 A;  3KF9 A;  1JWD A;  1BT6 A;  2WCB A;  2LVV A;  2QDI A;  1W9Z A;  1S36 A;  2LVI A;  3LK1 A;  4GGF A;  1OOH A;  2NCP A;  3EK4 A;  4ZCU A;  5HL1 A;  2H8V A;  2KFG A;  3O6B A;  1QLS A;  1IIO A;  1JF0 A;  1EXR A;  4N1G A;  3PN7 B;  2PMY A;  4HRE E;  1PVB A;  4YGE B;  1PUL A;  1QWV A;  2KFH A;  2Y1M A;  1K95 A;  1NCZ A;  4PT1 A;  1B9A A;  1S26 D;  5FI7 A;  1Y0V H;  1TNX A;  5HKW A;  1K2H A;  3NXA A;  3R72 A;  2CT9 A;  3FIA A;  2ZN9 A;  5KU1 A;  3TUY B;  1JUO A;  4YI9 A;  2I94 A;  2KPH A;  1PVA A;  1DJH A;  3L4L A;  4PE7 A;  2KI6 D;  5GQQ C;  3BQ3 A;  5D7F A;  2M49 B;  2MJW B;  2O5G A;  1XA5 A;  1ALW A;  1B47 A;  3OGN A;  4ORC B;  3QME A;  4U8D A;  1DJX A;  1DGV A;  3DXL A;  3TDU A;  1PRW A;  3NSO A;  4GGF C;  3SG2 A;  1QAT A;  3SG6 A;  1SKT A;  4ETO A;  4XJK A;  1REC A;  4GNK B;  3VRQ A;  1XYD A;  3RM1 A;  1SSE B;  2LLS A;  2BCX A;  1S6C A;  1UHH A;  1B7T Y;  1OOJ A;  4INX A;  4MSP A;  1TCO B;  2M1K B;  3VRO A;  4AQJ A;  1FF1 A;  3AAK A;  1WDC B;  1K93 D;  3D73 A;  3S0D A;  3WNX B;  1NX1 A;  1ZOT B;  2M97 A;  3TS5 C;  2K8M B;  4GAO A;  1IGV A;  1XK4 C;  2JPO A;  1DVI A;  1EG3 A;  5F6T A;  5I2L A;  1NP8 A;  3R1P A;  2A4J A;  1Y1U A;  4NQG A;  3E3R A;  3VRN A;  1MHO A;  4WQ3 A;  3PN7 C;  3SJS A;  4UPG A;  1SCV A;  3O2P A;  1CM4 A;  3CR5 X;  1QXP A;  3Q8I A;  1K9U A;  1JBA A;  4CFR A;  4F0Z B;  1BR4 B;  2E30 A;  5G08 A;  1PAL A;  1Y6W A;  3CYZ A;  3SS4 A;  1NCY A;  1QIV A;  4NDD A;  1QAS A;  3B86 A;  4JD9 A;  1QLK A;  1TRF A;  3BUO B;  4YBH B;  2RGI A;  3SS3 A;  3VRP A;  1SL9 A;  3N7H A;  1UHN A;  1NCX A;  1UHI A;  1SL8 A;  2KBM A;  2KQY A;  1M31 A;  3I5I C;  4PE1 A;  4YGC B;  3BUX B;  5D69 A;  4C0K A;  1UHJ A;  3S0B A;  2AUC A;  1CFP A;  1SRA A;  1RWY A;  3I5H C;  1S5G Z;  1TIZ A;  2LC5 A;  3OHM B;  3PAT A;  5I94 A;  4R1E A;  1YRT B;  1TNW A;  1WRZ A;  5D3O A;  2B1U A;  5CSI A;  2MLF C;  3L4A A;  1QS7 A;  3GK1 A; 
#chains in the Genus database with same CATH homology
 4OKH A;  4PE0 A;  1MQ1 A;  2K7B A;  4AQI A;  1CDN A;  3D10 A;  3SIB A;  3EK7 A;  2Q91 A;  2K0J A;  5AAN A;  4DS7 A;  1WLM A;  1NX0 A;  1BF5 A;  2DOQ A;  2JQ6 A;  5I2O A;  2GGM A;  4I5N B;  5DKQ A;  2ZND A;  4MRX A;  1KK8 B;  1KQM B;  1KFU L;  1NIW A;  4CFQ A;  3I5G B;  2BCB A;  1J7P A;  1DJI A;  1CB1 A;  3OB1 B;  3CR2 A;  5IBW A;  2M7N A;  2Y5I A;  2JUL A;  1RK9 A;  1BMO A;  1K96 A;  2KGR A;  2PAL A;  1YRU B;  1CLB A;  1G8I A;  1TN4 A;  2WCF A;  1NX3 A;  1CDL A;  4N1F A;  2K7D A;  2JXC A;  4HRG A;  2PRU A;  1A03 A;  1TOP A;  2QPT A;  3ZWH A;  1E8A A;  1YUT A;  1K9P A;  1LIN A;  2KDH A;  4OR9 B;  5HLV A;  3D0Y A;  2LV7 A;  3K21 A;  5AEQ A;  1C7W A;  1V1G A;  1ZFS A;  3I5G C;  1J7R A;  3OX5 A;  2BBM A;  1IQ3 A;  3DVK A;  4QJ3 B;  3AKB A;  2KAX A;  3CGA A;  2LVK A;  1FI6 A;  4XJK B;  1SR6 B;  2PSR A;  4PHM A;  4PHJ A;  1DF0 A;  3NSI A;  1QIW A;  4MVF A;  1TTX A;  2KYC A;  2WC8 A;  1AK8 A;  1XFU O;  3NSK A;  3WXA A;  2WCE A;  1CFC A;  2LM5 A;  1AP4 A;  1J7O A;  1K9K A;  3NSL A;  4FQO A;  1OMD A;  2I2R E;  2SCP A;  1YX8 A;  3DD4 A;  1SCM C;  3QRX A;  2L51 A;  2M29 A;  1M45 A;  4M2P A;  2BKI B;  2KAY A;  1TCF A;  3AKA A;  1IG5 A;  1CM1 A;  3M0W A;  2JXL A;  3VGO A;  2MA2 A;  2CBL A;  2HPS A;  3SG3 A;  4BY4 A;  1SR6 C;  1SYM A;  3TDI A;  1J7Q A;  1DJY A;  2JZI A;  1U5I A;  2V53 A;  1VRK A;  2OPO A;  3CS1 A;  1EJ3 A;  1RFJ A;  1QV0 A;  4C0J A;  3BUW B;  5PAL A;  1CMF A;  1SW8 A;  5B8I B;  4JWQ A;  1B1G A;  2I18 A;  1FBV A;  3GK4 X;  3FWB A;  1SK6 D;  1S3P A;  1BR1 B;  4IL1 A;  4MZL A;  2NLN A;  1OZO A;  3JVT B;  5HKZ A;  2NCO A;  2JTT A;  1EH2 A;  1H4B A;  2PVB A;  3SG7 A;  2JRF A;  5J3X A;  2H2K A;  2F8P A;  4MBE A;  4GUK A;  1F54 A;  1J1D A;  4GBA A;  4HRH A;  1B8R A;  2LAN A;  1DT7 B;  1QV1 A;  2KGB C;  3LL8 B;  1C07 A;  1GGZ A;  1B8C A;  1LA3 A;  2KI4 C;  1B7T Z;  1Q80 A;  2JU0 A;  3O78 A;  3GOF A;  3AAJ A;  1H8B A;  2BCA A;  1UP5 A;  3LLE A;  2LLT A;  2VRG A;  2ZNE A;  3H4S E;  3SG5 A;  2L4H A;  2ZRS A;  2L4I A;  2LVJ A;  3PFV A;  2EGD A;  1DGU A;  2L98 A;  1SBJ A;  1IJ5 A;  1PK0 D;  1SNL A;  4YGD B;  1B8L A;  2KI6 C;  1BLQ A;  1JF2 A;  1CKK A;  1BOC A;  1S5G Y;  2M0R A;  4P5O E;  4BY5 A;  3I5H B;  1ZAC A;  2KSP A;  1KSO A;  2MAZ A;  2BBN A;  2H61 C;  3TZ1 A;  3VRR A;  5ER5 A;  1CNP A;  2LCP A;  1IJ6 A;  3JTD C;  3WHU B;  2K2A A;  1RTP 1;  2LP2 A;  1GJY A;  2JPT A;  5CSJ A;  1MR8 A;  1SPY A;  1UUR A;  3D0Y B;  4PHN A;  1W7J B;  5HLO A;  2BE4 A;  4QJ4 B;  4CID A;  3JTD B;  1CDP A;  4PAL A;  2AMI A;  2Y4Q A;  4DIR A;  1YVL A;  3BXK A;  3I5F C;  1ZMZ A;  5KSZ A;  1KWO B;  3OP0 A;  1B4C A;  4WRI A;  2K7O A;  3O4Y A;  4OVN F;  1BG1 A;  1CMG A;  1F70 A;  2JNF A;  1WLZ A;  1XFX O;  2LHL A;  4M2O A;  2MBX A;  1JC2 A;  3PM8 A;  3PSR A;  2P6B B;  2BKH B;  2WOR A;  5AER A;  4GFT A;  1A4P A;  2WOS A;  2CNP A;  2K7C A;  2BE6 A;  1CFD A;  1W7I B;  4CLN A;  2FCE A;  1XVJ A;  3MSE B;  2BL0 C;  4Q04 A;  1NYA A;  4CPV A;  1TNQ A;  5TNC A;  2GV5 A;  1L7Z A;  3TS5 B;  1F55 A;  2KHN A;  3CWG A;  3CR4 X;  3A4U B;  1UWO A;  3KPX A;  1A29 A;  2KNE A;  2ZFD A;  1BJF A;  1ZUZ A;  3EVR A;  3EK8 A;  5JJG A;  1YVH A;  3IQQ A;  1F4Q A;  1OZS A;  1F71 A;  1KCY A;  1NSH A;  2JC2 A;  1NX2 A;  2KBI A;  5K89 A;  3DVE A;  3SG4 A;  3JVT C;  3PLF B;  2LMT A;  1EG4 A;  1X02 A;  1BU3 A;  4A4C A;  1M46 A;  1WRL A;  1DF0 B;  2H61 A;  2LLU A;  2OS8 B;  3DVJ A;  4MZK A;  2KOT A;  2M8U A;  1WDC C;  2CCM A;  2QAC A;  1IRJ A;  1S6I A;  1DJZ A;  2M9G A;  1F8H A;  1LA0 A;  2OS8 C;  1PSR A;  1AJ5 A;  1J55 A;  2FJU B;  2F33 A;  1G33 A;  1M39 A;  1QJT A;  1QVI Z;  1WY9 A;  3BOW B;  3BYA A;  1D1O A;  1DTL A;  2F3Z A;  2M3W A;  4ORA B;  1KQV A;  2LE9 B;  2K61 A;  1MXL C;  1LVC D;  1IKU A;  2CTN A;  3F45 A;  4OCI A;  2JT8 A;  3C1V A;  3DF0 B;  1J1E A;  1K90 D;  1CTR A;  1KK7 Z;  1M63 B;  3CTN A;  3EVV A;  3PAL A;  5DKN A;  1V1F A;  3A8R A;  1N0Y A;  1QX5 B;  1OMR A;  4ICB A;  1WRK A;  4D1E A;  2EC6 B;  5KTY A;  3SIA A;  1DMO A;  1AVS A;  2IS9 A;  2E6W A;  4HSZ A;  1OE9 B;  2GGZ A;  1Y1A A;  4PE4 A;  1CFF A;  1EL4 A;  1OMV A;  1GGW A;  5DKR A;  1QX7 A;  2JT0 A;  4MZJ A;  1CLM A;  1SCM B;  4JPZ B;  1FW4 A;  4I5J A;  4WQ2 A;  2JTZ A;  1KWO C;  2HQW A;  1S1E A;  1XFW O;  5HYD A;  1N2D A;  2LAP A;  3I5F B;  1HQV A;  4JQ0 D;  1A75 B;  1G4Y R;  2FOT A;  2LMU A;  4MEW A;  2KFF A;  1A2X A;  1YTZ C;  1GQM A;  4PCW A;  4XYN A;  1UUS A;  2K2F A;  2SAS A;  3DF0 A;  3LCP C;  2R2I A;  1SY9 A;  2LUC A;  4TNC A;  3WHT B;  1KK8 C;  5AXI A;  1L2O B;  2NXQ A;  4M2Q A;  4YRU A;  5I2Q A;  1JSA A;  2NZ0 A;  5I8N A;  4I5L B;  4NDB A;  5FYX A;  3EVU A;  1LXF C;  2BEC A;  1FI5 A;  1QX2 A;  1SMG A;  4YGB B;  2COL B;  3LK0 A;  1KFX S;  4DUQ A;  2MLE C;  2ZN8 A;  2KYF A;  4L9M A;  3GK2 A;  1XFV O;  2FCD A;  5ER4 X;  4PHK A;  4E68 A;  5HKY A;  2KI4 B;  3OX6 A;  2LP3 A;  1RJV A;  2WND A;  1LKJ A;  1CDM A;  2OTG B;  4MLW A;  4ZCV A;  2MHH A;  4A4B A;  1DJW A;  2G9B A;  3DVM A;  2HF5 A;  4GGN A;  4DCK A;  1OQP A;  3EKJ A;  2Q4U A;  3CLN A;  2KAV A;  2F3Y A;  3ICB A;  4I5K A;  5JOL A;  4QJ5 B;  1ALV A;  1XFZ O;  1F4O A;  3HX4 A;  2M7L A;  3BUM B;  2PAS A;  1MUX A;  1NUB A;  2HET A;  1U5I B;  3KO0 A;  1CLL A;  2MRD A;  1HT9 A;  3ZNI A;  3BOW A;  1MXE A;  1UHK A;  4AOM A;  2L0P A;  2CXJ A;  2LUX A;  3I5I B;  1XO5 A;  4PDZ A;  1AJ4 A;  1XFY O;  1KFU S;  3KEV A;  3EKH A;  3OB2 B;  2LMV A;  2EC6 C;  3IF7 A;  4ORB B;  1YUR A;  1BOD A;  3KHE A;  5CSN A;  1JFJ A;  3FWC A;  3HCM A;  1QTX A;  1R2U A;  2ISD A;  1MF8 B;  1KFX L;  2L2E A;  2L50 A;  1A75 A;  2LNK A;  1KK7 Y;  2AAO A;  4NDC A;  5AFP A;  1S6J A;  1AHR A;  5BPJ A;  1N65 A;  1IWQ A;  2TN4 A;  1PSB A;  4USL A;  2JOJ A;  1YX7 A;  3TDZ A;  1OSA A;  1IH0 A;  4FTG A;  1YUS A;  2LHI A;  1MWN A;  2L5X B;  1QVI Y;  2I7A A;  4YI8 A;  1TNP A;  2F2O A;  1YUU A;  1R6P A;  1K94 A;  3BUN B;  2OTG C;  1IQ5 A;  1L2O C;  1C7V A;  1AUI B;  1K8U A;  1RRO A;  4GPL B;  5CSF A;  4P2Y B;  2JWW A;  1KSM A;  3RLZ A;  2ZKM X;  1DJG A;  2JNX A;  4MN0 A;  1JFK A;  1FPW A;  4N5X A;  1NPQ A;  3CZT X;  2JT3 A;  5CPV A;  2HQ8 A;  4C0L A;  1ODB A;  2O60 A;  2G2B A;  2D8N A;  4MRY A;  1SL7 A;  2EHB A;  4DRW A;  1XK4 A;  2ZRT A;  3TUY C;  3FS7 A;  3IQO A;  1KQM C;  1Y1X A;  1NWD A;  1YR5 A;  2BL0 B;  2F2P A;  2Y1N A;  2KQ6 A;  4YGA A;  2M1U A;  4OV2 A;  3KF9 A;  1JWD A;  1BT6 A;  2WCB A;  2LVV A;  1S36 A;  2LVI A;  3LK1 A;  4GGF A;  2NCP A;  3EK4 A;  4ZCU A;  2KFG A;  3O6B A;  1QLS A;  1JF0 A;  1EXR A;  4N1G A;  3PN7 B;  2PMY A;  4HRE E;  1PVB A;  4YGE B;  1PUL A;  2Y1M A;  2KFH A;  1K95 A;  1NCZ A;  1B9A A;  1S26 D;  5HKW A;  1Y0V H;  1TNX A;  1K2H A;  3NXA A;  2CT9 A;  3FIA A;  2ZN9 A;  5KU1 A;  3TUY B;  1JUO A;  4YI9 A;  2I94 A;  1PVA A;  1DJH A;  4PE7 A;  2KI6 D;  5GQQ C;  3BQ3 A;  5D7F A;  2M49 B;  2MJW B;  2O5G A;  1XA5 A;  1ALW A;  1B47 A;  4ORC B;  4U8D A;  1DJX A;  1DGV A;  3TDU A;  1PRW A;  3NSO A;  4GGF C;  3SG2 A;  1QAT A;  3SG6 A;  1SKT A;  4ETO A;  4XJK A;  1REC A;  4GNK B;  3VRQ A;  1XYD A;  3RM1 A;  2LLS A;  2BCX A;  1S6C A;  1UHH A;  1B7T Y;  1OOJ A;  4MSP A;  3VRO A;  1TCO B;  2M1K B;  4AQJ A;  1FF1 A;  3AAK A;  1WDC B;  1K93 D;  3WNX B;  1NX1 A;  1ZOT B;  2M97 A;  3TS5 C;  2K8M B;  4GAO A;  1IGV A;  1XK4 C;  5F6T A;  1DVI A;  1EG3 A;  5I2L A;  1NP8 A;  2A4J A;  1Y1U A;  4NQG A;  3E3R A;  3VRN A;  1MHO A;  4WQ3 A;  3PN7 C;  3SJS A;  4UPG A;  1SCV A;  3O2P A;  1CM4 A;  3CR5 X;  1QXP A;  1K9U A;  1JBA A;  4CFR A;  4F0Z B;  1BR4 B;  2E30 A;  5G08 A;  1PAL A;  1Y6W A;  1NCY A;  1QIV A;  4NDD A;  1QAS A;  1QLK A;  1TRF A;  3BUO B;  4YBH B;  2RGI A;  3VRP A;  1SL9 A;  1UHN A;  1NCX A;  1UHI A;  1SL8 A;  2KBM A;  2KQY A;  1M31 A;  3I5I C;  4PE1 A;  4YGC B;  3BUX B;  5D69 A;  4C0K A;  1UHJ A;  2AUC A;  1CFP A;  1SRA A;  1RWY A;  3I5H C;  1S5G Z;  1TIZ A;  2LC5 A;  3OHM B;  3PAT A;  4R1E A;  1YRT B;  1TNW A;  1WRZ A;  2B1U A;  5CSI A;  2MLF C;  1QS7 A;  3GK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...