3I5HB

The crystal structure of rigor like squid myosin s1 in the absence of nucleotide
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
145
structure length
145
Chain Sequence
RVKLSQRQMQELKEAFTMIDQDRDGFIGMEDLKDMFSSLGRVPPDDELNAMLKECPGQLNFTAFLTLFGEKVSGTDPEDALRNAFSMFDEDGQGFIPEDYLKDLLENMGDNFSKEEIKNVWKDAPLKNKQFNYNKMVDIKGKAED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain isoform A
publication title Rigor-like structures from muscle myosins reveal key mechanical elements in the transduction pathways of this allosteric motor.
pubmed doi rcsb
molecule tags Contractile protein
total genus 28
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2009-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3i5hB02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3i5hB01
1EH2A 5HLOA 1UWOA 2LVIA 1DMOA 1NCYA 2JT8A 3EK4A 1CFDA 3OP0A 4YGBB 1YRUB 1XFUO 2M1KB 3M0WA 4MN0A 4YGCB 5AEQA 3A8RA 2M1UA 1H8BA 4ORCB 3PALA 4HRHA 1MF8B 1B7TZ 1WLZA 2Q91A 4NDDA 1K9KA 3CGAA 4GGFA 1KK7Y 2NZ0A 2FOTA 4WQ2A 2FCEA 2KAVA 3CR5X 1CKKA 1DJWA 4N1FA 4OKHA 4M2PA 5KTYA 1MQ1A 2OTGC 1PULA 1G4YR 2F8PA 4MZJA 2Y1MA 4FQOA 2P6BB 4C0KA 1CMFA 1TNPA 1XFYO 2CCMA 2KGBC 1Q80A 3TUYC 1IWQA 1UHNA 1JFKA 1DGUA 2LP2A 2M97A 2BECA 1QASA 2L51A 1K9PA 1S6CA 3TS5B 2JOJA 1F70A 1XFXO 4ZCVA 1OSAA 1OZSA 4OCIA 4PDZA 1EG3A 4C0LA 1QIVA 1JFJA 1QJTA 1R6PA 4JWQA 4DCKA 3DVJA 1KFUL 2LNKA 1K93D 2G2BA 2LVJA 2L4IA 3BXKA 1DJYA 1IG5A 1B8RA 5D7FA 2E6WA 1UHKA 1L2OB 3EKHA 3TDZA 1L7ZA 1Y1UA 2OS8B 1CDPA 1KFXS 1IRJA 1CDLA 1PSRA 3DVMA 2M49B 1OZOA 1RWYA 2LUCA 2M7LA 3O78A 2NCOA 3VRQA 3OHMB 5CSIA 2K7BA 1KK7Z 2MJWB 2WORA 2BCBA 2KBIA 1AJ4A 1R2UA 2LMUA 4P5OE 2JNXA 2SCPA 1WDCB 2KI6C 1B8LA 2LLSA 3BUNB 1JBAA 1QXPA 1JWDA 1KQVA 4I5NB 3LK1A 1UHIA 4WRIA 1N2DA 2PALA 3GOFA 2BL0B 2FCDA 2KGRA 1SBJA 3DF0B 1CDNA 2I7AA 3OB1B 1AP4A 1DVIA 2KQYA 1QX7A 1EL4A 1BU3A 3BUMB 1F71A 2K7OA 4MZKA 4D1EA 3DVKA 2NLNA 1XYDA 2JC2A 2EGDA 2M0RA 2EC6B 3TS5C 4DIRA 1NIWA 1ALVA 3BOWB 2BBMA 3SIAA 2F2PA 4IL1A 3HX4A 5ER4X 1NUBA 1SL8A 5HLVA 1CFPA 2H61C 1UURA 2F3ZA 1ZMZA 4AOMA 1BMOA 1YRTB 1NX0A 2JULA 2KYCA 3OB2B 2QPTA 2ZKMX 1G33A 4L9MA 1IKUA 1SCMB 3VRRA 2JPTA 2L50A 1UHHA 5ER5A 2PRUA 4YGEB 1FI6A 2K61A 1CM4A 1MUXA 2M29A 1DTLA 2ZN9A 1L2OC 1BJFA 1UP5A 2JQ6A 1TN4A 3CTNA 2GGZA 2MLEC 2OS8C 2KOTA 5AANA 1B4CA 3CZTX 4HSZA 1X02A 1IJ6A 4USLA 1U5IB 2LVKA 5DKRA 3SJSA 4PALA 5HYDA 1YX8A 5I8NA 4TNCA 1NP8A 3DVEA 4YRUA 1SR6B 5JOLA 2ZN8A 1A29A 1QS7A 5AERA 2LVVA 1CNPA 1KFUS 1BG1A 5PALA 1FW4A 2KFHA 2V53A 1BOCA 1Y1AA 3PM8A 1S1EA 2KSPA 4M2OA 5BPJA 2ZNEA 3SG5A 4PHNA 1LA3A 4CIDA 1SPYA 1BT6A 1K8UA 1EXRA 3C1VA 1SY9A 1SL7A 1MWNA 1JSAA 1FF1A 2H61A 1CMGA 4ZCUA 2EC6C 1Y6WA 1QLSA 2H2KA 2KDHA 1WLMA 3RM1A 1N65A 3JTDC 4P2YB 3GK4X 1HT9A 2IS9A 2KFGA 4UPGA 2L98A 3O2PA 4A4CA 2KAXA 1SCMC 1DGVA 4GBAA 1DJZA 1MR8A 1NCXA 4N5XA 1GGWA 1XK4C 1KQMB 1VRKA 3HCMA 2HQWA 2K2AA 1EJ3A 2M8UA 3E3RA 3OX6A 3SG4A 5FYXA 1YURA 4FTGA 1OOJA 2WCEA 4GFTA 2HF5A 1NWDA 4DS7A 3I5HB 5IBWA 2KQ6A 5JJGA 3LCPC 2M3WA 1A2XA 1CB1A 1DJIA 1SRAA 1UHJA 3CS1A 2LM5A 1B1GA 3PN7B 3I5GB 4MSPA 1JF2A 4QJ5B 3LLEA 1WRLA 1A4PA 2ZRSA 1QVIY 1ODBA 2TN4A 4YI9A 4XJKB 1SCVA 3BUOB 1SYMA 4HREE 2LAPA 1AK8A 1B9AA 1PK0D 1F55A 1OQPA 2K2FA 3IF7A 5F6TA 1CLMA 2GGMA 2AAOA 3JVTB 1TCFA 2HETA 2CXJA 1FBVA 2CTNA 3BOWA 5HKZA 1K90D 1G8IA 1LA0A 2JZIA 1RK9A 2BKIB 2JWWA 4R1EA 2WOSA 2KAYA 3EK7A 5AXIA 5DKQA 4NQGA 1M46A 4BY5A 4JPZB 3KO0A 4OV2A 2M7NA 3D10A 3KEVA 4YI8A 1KCYA 4CFRA 1XK4A 5CSFA 1N0YA 1S5GY 3EKJA 1KK8B 3I5IB 3CWGA 2DOQA 3F45A 3BYAA 3KHEA 1YR5A 1CDMA 1U5IA 3SG3A 1K9UA 1DF0A 2Y1NA 1D1OA 2PSRA 1TRFA 1A03A 3VRNA 4PE4A 2GV5A 3KPXA 5AFPA 3EK8A 3I5HC 5D69A 1QVIZ 2L4HA 3I5FB 3IQQA 3LK0A 1BF5A 1SW8A 1YUTA 2F2OA 5G08A 5J3XA 1A75A 1V1FA 3AAKA 3FIAA 2BE6A 3I5GC 1QX2A 3PFVA 4GAOA 1F54A 5DKNA 2KYFA 2LE9B 4QJ4B 1LKJA 3IQOA 2LANA 2WC8A 2F33A 1RFJA 1BR1B 1AHRA 1PVBA 1ZUZA 3O4YA 1S36A 3FWBA 4MZLA 1BODA 3CR2A 4I5KA 2COLB 2O60A 2LHLA 3PATA 3O6BA 1SKTA 3SG6A 1HQVA 4ICBA 4YGDB 2KHNA 1WDCC 2Y4QA 1QATA 1S5GZ 1B8CA 3VROA 2LMTA 3BUXB 1QTXA 4MBEA 1UUSA 2JXLA 2F3YA 2RGIA 1DT7B 2NXQA 1ALWA 2WCBA 1LINA 2BL0C 4PE1A 2G9BA 3I5IC 2E30A 1OMRA 1S26D 2LHIA 3FS7A 4C0JA 5GQQC 2HPSA 1XO5A 2BKHB 1TCOB 4MRYA 2SASA 4CFQA 1CLLA 2Y5IA 1OMDA 2O5GA 2QACA 3TZ1A 1YUSA 3MSEB 1LVCD 2CT9A 2PASA 2BCAA 4GGNA 2MA2A 2WCFA 5I2OA 1WY9A 3AKAA 2ZNDA 1J55A 1TOPA 4XJKA 3NSOA 4XYNA 1OMVA 4DRWA 1C07A 4YGAA 3D0YB 1M45A 4PE0A 3AAJA 2JU0A 4F0ZB 4N1GA 2K7CA 4CLNA 4M2QA 1J7OA 1JF0A 2Q4UA 1MXEA 3NSKA 1ZOTB 2KI4B 4MVFA 3OX5A 3H4SE 1K94A 1SNLA 5I2LA 2JNFA 3WHTB 5I2QA 3NSLA 1IQ5A 2LLUA 3WXAA 5KU1A 1NCZA 5CPVA 3SG2A 4OVNF 4AQJA 1JC2A 1F8HA 1KSOA 1MHOA 1W7IB 2BBNA 3EVRA 1J1DA 3DF0A 1CM1A 2KNEA 2L2EA 1SR6C 2M9GA 4MEWA 2LP3A 1S6JA 4DUQA 2EHBA 2JTTA 1FI5A 3KF9A 1CLBA 1XFZO 4A4BA 2L5XB 1AVSA 1QIWA 1KWOB 2LMVA 4PCWA 4PHKA 3ZNIA 3SG7A 4JQ0D 3CLNA 5CSNA 4ORBB 1XA5A 1K95A 4YBHB 5HKWA 1DJGA 2KI6D 4E68A 2KBMA 2JTZA 1NYAA 2MRDA 1YX7A 3EVUA 3BQ3A 2MBXA 3NSIA 1PSBA 1H4BA 1ZACA 3VRPA 2NCPA 3NXAA 3TDUA 1DJXA 1M31A 4ETOA 2I2RE 3QRXA 2R2IA 1ZFSA 1XFWO 1GGZA 4NDBA 4PHMA 3ZWHA 4BY4A 1PALA 2ZRTA 4PE7A 2I94A 3FWCA 4MRXA 4OR9B 2K8MB 1QV1A 2PMYA 2PVBA 4Q04A 4QJ3B 2MAZA 2BCXA 3PLFB 2AUCA 2KI4C 1KQMC 1E8AA 1TTXA 4MLWA 1TIZA 3A4UB 2VRGA 3ICBA 3GK2A 1V1GA 2HQ8A 3AKBA 2MLFC 1K96A 1AJ5A 2B1UA 1AUIB 4CPVA 2FJUB 1SL9A 1IJ5A 1NX2A 4I5JA 1YVLA 2LC5A 3VGOA 1GQMA 3CR4X 2A4JA 1EG4A 3EVVA 2D8NA 1CTRA 1WRKA 2LUXA 1IH0A 2ISDA 3PN7C 1W7JB 3BUWB 5CSJA 4WQ3A 4GNKB 1IGVA 1NSHA 1RTP1 3PSRA 1B47A 1IQ3A 2K7DA 4GUKA 4GPLB 3RLZA 5HKYA 5K89A 4ORAB 1KWOC 2I18A 1J7RA 1XFVO 1M63B 3LL8B 1J1EA 3JVTC 1KSMA 1JUOA 1Y0VH 2WNDA 1TNXA 2JT0A 2LV7A 5TNCA 1NPQA 4AQIA 4I5LB 2LCPA 3WNXB 3JTDB 1BLQA 2K0JA 1M39A 2MHHA 4U8DA 1F4QA 1TNWA 2OPOA 1RECA 1OE9B 1GJYA 3D0YA 1B7TY 1DJHA 1RJVA 1RROA 2LLTA 1LXFC 2L0PA 1C7WA 1S6IA 2OTGB 4GGFC 2JXCA 1WRZA 2AMIA 1C7VA 1BR4B 1XVJA 1SK6D 3DD4A 1QX5B 4PHJA 1KFXL 1Y1XA 1CFFA 1KK8C 1NX1A 1YVHA 3TUYB 3WHUB 1NX3A 1PVAA 2CNPA 1MXLC 2BE4A 1F4OA 1TNQA 4HRGA 1PRWA 2CBLA 2JRFA 1DF0B 2ZFDA 5KSZA 1QLKA 1QV0A 1S3PA 1J7PA 1K2HA 1YTZC 1J7QA 2JT3A 2KFFA 3I5FC 3SIBA 5B8IB 1CFCA 1FPWA 4NDCA 3K21A 3GK1A 1YUUA 3TDIA 1SMGA 1A75B
chains in the Genus database with same CATH superfamily
1EH2A 5HLOA 1UWOA 2LVIA 1DMOA 1NCYA 2JT8A 3V2LA 1TUJA 3UNWA 3EK4A 1CFDA 3OP0A 4YGBB 1YRUB 1XFUO 2M1KB 3M0WA 1Z4HA 4MN0A 4YGCB 4JD9A 5AEQA 3A8RA 2M1UA 1H8BA 4ORCB 3PALA 4HRHA 1MF8B 1B7TZ 1WLZA 2Q91A 4NDDA 1K9KA 3CGAA 4GGFA 1KK7Y 2NZ0A 2FOTA 4WQ2A 2FCEA 2KAVA 3CR5X 1CKKA 1DJWA 4N1FA 4OKHA 4M2PA 5KTYA 1MQ1A 2OTGC 1PULA 1G4YR 2F8PA 4MZJA 2Y1MA 4FQOA 2P6BB 4C0KA 5HL1A 1CMFA 1OOGA 3OBVA 1TNPA 1XFYO 2CCMA 2KGBC 1Q80A 3TUYC 1IWQA 1UHNA 1JFKA 3NHTA 1DGUA 2LP2A 2M97A 2BECA 1QASA 2L51A 1K9PA 1S6CA 2GTEA 3TS5B 2JOJA 1F70A 1XFXO 4ZCVA 1OSAA 1OZSA 2FJYA 4OCIA 4PDZA 1EG3A 4C0LA 1QIVA 1JFJA 1QJTA 1R6PA 4JWQA 4DCKA 3DVJA 1KFUL 2LNKA 1K93D 2G2BA 2LVJA 2L4IA 3D75A 3BXKA 1DJYA 1IG5A 1B8RA 5D7FA 2E6WA 1UHKA 1L2OB 3EKHA 3TDZA 1L7ZA 1Y1UA 2OS8B 1CDPA 1KFXS 1IRJA 1CDLA 1PSRA 3DVMA 2M49B 2QDIA 1OZOA 1RWYA 2LUCA 3N7HA 3O78A 2NCOA 2M7LA 3OHMB 5CSIA 2K7BA 3VRQA 1KK7Z 2MJWB 2WORA 2BCBA 2KBIA 1AJ4A 1R2UA 2LMUA 4P5OE 2JNXA 1OOFA 1WDCB 2KI6C 1B8LA 2LLSA 2SCPA 3BUNB 1QXPA 1JBAA 1JWDA 1KQVA 4I5NB 3LK1A 3QMEA 1UHIA 4WRIA 1N2DA 3CDNA 2PALA 3GOFA 2BL0B 2FCDA 2KGRA 1SBJA 3DF0B 1CDNA 2I7AA 3OB1B 1AP4A 1DVIA 2KQYA 1DELA 1QX7A 3S0AA 1EL4A 1BU3A 3BUMB 5FI7A 1F71A 2K7OA 4MZKA 4D1EA 3DVKA 2NLNA 1XYDA 2JC2A 2EGDA 2M0RA 2EC6B 3TS5C 4DIRA 1NIWA 1ALVA 2KPHA 2BBMA 2PYQA 2F2PA 3BOWB 3HX4A 4IL1A 5ER4X 1NUBA 1SL8A 5HLVA 3BFBA 1CFPA 1TWOA 2H61C 1UURA 2F3ZA 1ZMZA 4AOMA 2H8VA 1BMOA 1YRTB 1NX0A 2JULA 2KYCA 3OB2B 2QPTA 4INWA 2ZKMX 1G33A 3R1OA 4L9MA 1SCMB 3VRRA 1IKUA 2JPTA 3DYEA 2L50A 1UHHA 5ER5A 2PRUA 4YGEB 1FI6A 3Q8IA 2K61A 1CM4A 1MUXA 2M29A 1DTLA 2WC6A 2ZN9A 1L2OC 1BJFA 1UP5A 2JQ6A 1TN4A 3CTNA 2GGZA 2MLEC 2OS8C 2KOTA 3VB1A 5AANA 2KLDA 1B4CA 3CZTX 4HSZA 1X02A 1GM0A 1IJ6A 4USLA 1U5IB 2LVKA 5DKRA 3SJSA 4PALA 3BFHA 5HYDA 1YX8A 5I8NA 3FE8A 5D3OA 4TNCA 1NP8A 3DVEA 4YRUA 1SR6B 5JOLA 2ZN8A 1A29A 1QS7A 5AERA 2LVVA 1CNPA 1KFUS 1BG1A 5PALA 1FW4A 2KFHA 2WC5A 3FE6A 3K1EA 2V53A 1BOCA 1Y1AA 3PM8A 1S1EA 2KSPA 4M2OA 5BPJA 2YGUA 2ZNEA 3SG5A 4PHNA 1LA3A 4CIDA 1SPYA 1BT6A 1K8UA 1EXRA 3C1VA 1SY9A 1SL7A 2WCJA 3L47A 1MWNA 1JSAA 1FF1A 2H61A 1CMGA 4ZCUA 2EC6C 3B86A 1Y6WA 1QLSA 2H2KA 2KDHA 3FE9A 1WLMA 3RM1A 1N65A 3JTDC 4P2YB 3GK4X 1HT9A 2IS9A 2KFGA 4UPGA 2L98A 3O2PA 3OGNA 4A4CA 2KAXA 1SCMC 2K60A 1DGVA 4FQTA 3B6XA 3NGVA 4GBAA 1DJZA 1MR8A 1NCXA 3B7AA 4N5XA 4JKTA 1GGWA 1XK4C 4KYNA 1KQMB 1VRKA 3HCMA 3SS5A 2HQWA 2K2AA 1EJ3A 2M8UA 3E3RA 3OX6A 3S0FA 3SG4A 5FYXA 3DZTA 1YURA 4FTGA 1OOJA 2QEBA 2WCEA 4GFTA 2HF5A 1NWDA 4DS7A 3I5HB 5IBWA 2KQ6A 5JJGA 3LCPC 2M3WA 1A2XA 1CB1A 1DJIA 1SRAA 1UHJA 3CS1A 2LM5A 1B1GA 3PN7B 3I5GB 4MSPA 1JF2A 4QJ5B 3LLEA 1WRLA 1A4PA 2ZRSA 1QVIY 1ODBA 2TN4A 4YI9A 4XJKB 1SCVA 3BUOB 1SYMA 4HREE 2LAPA 1AK8A 3SS3A 1B9AA 1PK0D 1F55A 1OQPA 2PQLA 2K2FA 3IF7A 5F6TA 3D78A 1CLMA 2GGMA 2AAOA 3JVTB 1TCFA 2HETA 2CXJA 1FBVA 2CTNA 3BOWA 3CYZA 3D76A 1K90D 5HKZA 1G8IA 1LA0A 1TUZA 2JZIA 1RK9A 2BKIB 2JWWA 4R1EA 2WOSA 2KAYA 3EK7A 5AXIA 5DKQA 4NQGA 1M46A 1ORGA 4BY5A 4JPZB 3KO0A 1C3ZA 4OV2A 2M7NA 3D10A 3KEVA 4YI8A 1KCYA 4CFRA 1XK4A 5CSFA 1N0YA 3CABA 1S5GY 3EKJA 1KK8B 3I5IB 3CWGA 2DOQA 3F45A 3PM2A 3BYAA 3PJIA 1DEKA 3KHEA 1YR5A 3CZ0A 3D77A 1CDMA 1U5IA 3SG3A 1K9UA 1DF0A 2Y1NA 1D1OA 2PSRA 1TRFA 1A03A 3S0GA 3VRNA 4PE4A 2GV5A 3KPXA 5AFPA 3EK8A 3I5HC 5D69A 1Z2CB 1QVIZ 2L4HA 3I5FB 3IQQA 3LK0A 1BF5A 1SW8A 1YUTA 2F2OA 5G08A 5J3XA 1A75A 1V1FA 3AAKA 3FIAA 2BE6A 3I5GC 1QX2A 3IVTA 3PFVA 4GAOA 5DICA 1F54A 1OOIX 5DKNA 2KYFA 3S0DA 2LE9B 2WCMA 4QJ4B 1LKJA 3IQOA 2LANA 2WC8A 2F33A 1RFJA 1BR1B 3BJHA 1AHRA 1PVBA 1ZUZA 1DQEA 1OW4A 1S36A 3FWBA 3O4YA 3CR2A 4MZLA 1BODA 4I5KA 3RZSA 2COLB 2O60A 2LHLA 3PATA 3O6BA 1SKTA 3SG6A 1HQVA 4ICBA 4YGDB 2KHNA 1WDCC 2Y4QA 1QATA 1S5GZ 1B8CA 3VROA 2LMTA 2WCHA 3BUXB 1QTXA 2QEVA 3BFAA 1UUSA 3R72A 2JXLA 2F3YA 2RGIA 4MBEA 2L5YA 1ALWA 2NXQA 2WCBA 1DT7B 4PT1A 1LINA 2BL0C 4PE1A 2G9BA 3R1VA 3I5IC 2E30A 1OMRA 1S26D 2LHIA 3FS7A 4C0JA 5GQQC 2HPSA 1XO5A 2BKHB 3DXLA 1TCOB 1T14A 4MRYA 2SASA 4CFQA 1CLLA 2Y5IA 1OMDA 2O5GA 1DC1A 2QACA 3TZ1A 1YUSA 3MSEB 1LVCD 2CT9A 2PASA 2BCAA 4GGNA 2MA2A 2WCFA 5I2OA 1WY9A 3AKAA 3CZ1A 2ZNDA 1J55A 1TOPA 4XJKA 3NSOA 4XYNA 1OMVA 4DRWA 1C07A 4YGAA 3D0YB 1M45A 4PE0A 3AAJA 2JU0A 2WCKA 4F0ZB 4N1GA 2K7CA 4CLNA 4M2QA 1J7OA 1JF0A 2Q4UA 1MXEA 3NSKA 1ZOTB 2KI4B 4MVFA 3OX5A 1C3YA 3H4SE 1K94A 1SNLA 5I2LA 2JNFA 3WHTB 5I2QA 3NSLA 1IQ5A 2LLUA 3WXAA 5KU1A 1NCZA 5CPVA 3SG2A 4OVNF 4AQJA 1JC2A 1XFRA 1F8HA 1KSOA 1MHOA 3DY9A 3S0EA 3S0BA 1W7IB 2BBNA 3EVRA 1J1DA 3DF0A 1CM1A 2KNEA 2L2EA 1SR6C 2M9GA 4MEWA 2LP3A 1S6JA 4DUQA 3R1PA 2EHBA 2JTTA 1FI5A 3KF9A 1CLBA 4OZDA 2ERBA 1XFZO 4A4BA 2L5XB 1AVSA 1QIWA 1SSEB 1KWOB 2LMVA 4PCWA 4PHKA 3ZNIA 3SG7A 4JQ0D 3CLNA 4IJ7A 5CSNA 4ORBB 1XA5A 1K95A 3CZ2A 4YBHB 5HKWA 1DJGA 2KI6D 4E68A 2KBMA 2JTZA 1NYAA 2MRDA 1YX7A 3EVUA 3BQ3A 2MBXA 5FI6A 3NSIA 1PSBA 1H4BA 1ZACA 3VRPA 1W9ZA 2NCPA 3NXAA 5FI2A 1DJXA 1M31A 3TDUA 5EL2A 4INXA 4ETOA 3NHIA 2I2RE 3QRXA 2R2IA 1ZFSA 1XFWO 1GGZA 4NDBA 4PHMA 3ZWHA 4BY4A 3L4AA 1PALA 2P71A 2ZRTA 1P28A 3SS4A 4PE7A 2I94A 3FWCA 4MRXA 4OR9B 2QEOA 2K8MB 1QV1A 2PMYA 2PVBA 4Q04A 4QJ3B 2MAZA 2BCXA 3PLFB 2AUCA 2KI4C 1KQMC 1E8AA 1TTXA 4MLWA 1TIZA 3A4UB 4F7FA 2VRGA 3ICBA 3B87A 3GK2A 1V1GA 2HQ8A 3AKBA 2MLFC 3O4XA 1K96A 1AJ5A 2B1UA 3SIAA 1AUIB 4CPVA 2FJUB 1SL9A 1IJ5A 1NX2A 4I5JA 1YVLA 2LC5A 3VGOA 1GQMA 3CR4X 2A4JA 1EG4A 3EVVA 2D8NA 1CTRA 1WRKA 2LUXA 1IH0A 2ISDA 3PN7C 1W7JB 3BUWB 5CSJA 4WQ3A 4GNKB 1IGVA 1NSHA 1RTP1 3PSRA 1B47A 1IQ3A 2K7DA 4GUKA 4GPLB 3RLZA 5HKYA 5K89A 2BAPA 4ORAB 1KWOC 2I18A 1J7RA 1XFVO 1M63B 3LL8B 2KLEA 1J1EA 3JVTC 1KSMA 1JUOA 1Y0VH 2WNDA 2P70A 1TNXA 2JT0A 2LV7A 5TNCA 1NPQA 3UO9A 4AQIA 3EG5B 4I5LB 2LCPA 3WNXB 3JTDB 1BLQA 2WCLA 2K0JA 1M39A 2MHHA 4U8DA 1LS8A 1F4QA 1TNWA 2OPOA 1RECA 1OE9B 3D73A 1GJYA 3D0YA 1QWVA 1B7TY 1DJHA 1RJVA 1RROA 2LLTA 2QEHA 3L4LA 1LXFC 2L0PA 1C7WA 1S6IA 2OTGB 4GGFC 2JXCA 1WRZA 3B88A 2AMIA 2BNXA 1C7VA 1BR4B 1XVJA 1SK6D 3DD4A 1QX5B 4PHJA 1KFXL 1Y1XA 1CFFA 1KK8C 1NX1A 1YVHA 3TUYB 3WHUB 1NX3A 3D74A 1PVAA 2CNPA 1MXLC 2BE4A 1F4OA 1TNQA 4HRGA 1PRWA 2CBLA 2JRFA 1DF0B 2L2CA 2ZFDA 5KSZA 1QLKA 1QV0A 1S3PA 1J7PA 2JPOA 1K2HA 1YTZC 1J7QA 2JT3A 2KFFA 3I5FC 3SIBA 5B8IB 1CFCA 1FPWA 4NDCA 3K21A 3GK1A 1YUUA 5I94A 1IIOA 3TDIA 1SMGA 1A75B 1OOHA
chains in the Genus database with same CATH topology
1EH2A 5HLOA 1UWOA 2LVIA 1DMOA 1NCYA 2JT8A 3EK4A 1CFDA 3OP0A 4YGBB 1YRUB 1XFUO 2M1KB 3M0WA 4MN0A 4YGCB 5AEQA 3A8RA 2M1UA 1H8BA 4ORCB 3PALA 4HRHA 1MF8B 1B7TZ 1WLZA 2Q91A 4NDDA 1K9KA 3CGAA 4GGFA 1KK7Y 2NZ0A 2FOTA 4WQ2A 2FCEA 2KAVA 3CR5X 1CKKA 1DJWA 4N1FA 4OKHA 4M2PA 5KTYA 1MQ1A 2OTGC 1PULA 1G4YR 2F8PA 4MZJA 2Y1MA 4FQOA 2P6BB 4C0KA 1CMFA 1TNPA 1XFYO 2CCMA 2KGBC 1Q80A 3TUYC 1IWQA 1UHNA 1JFKA 1DGUA 2LP2A 2M97A 2BECA 1QASA 2L51A 1K9PA 1S6CA 3TS5B 2JOJA 1F70A 1XFXO 4ZCVA 1OSAA 1OZSA 4OCIA 4PDZA 1EG3A 4C0LA 1QIVA 1JFJA 1QJTA 1R6PA 4JWQA 4DCKA 3DVJA 1KFUL 2LNKA 1K93D 2G2BA 2LVJA 2L4IA 3BXKA 1DJYA 1IG5A 1B8RA 5D7FA 2E6WA 1UHKA 1L2OB 3EKHA 3TDZA 1L7ZA 1Y1UA 2OS8B 1CDPA 1KFXS 1IRJA 1CDLA 1PSRA 3DVMA 2M49B 1OZOA 1RWYA 2LUCA 2M7LA 3O78A 2NCOA 3VRQA 3OHMB 5CSIA 2K7BA 1KK7Z 2MJWB 2WORA 2BCBA 2KBIA 1AJ4A 1R2UA 2LMUA 4P5OE 2JNXA 2SCPA 1WDCB 2KI6C 1B8LA 2LLSA 3BUNB 1JBAA 1QXPA 1JWDA 1KQVA 4I5NB 3LK1A 1UHIA 4WRIA 1N2DA 2PALA 3GOFA 2BL0B 2FCDA 2KGRA 1SBJA 3DF0B 1CDNA 2I7AA 3OB1B 1AP4A 1DVIA 2KQYA 1QX7A 1EL4A 1BU3A 3BUMB 1F71A 2K7OA 4MZKA 4D1EA 3DVKA 2NLNA 1XYDA 2JC2A 2EGDA 2M0RA 2EC6B 3TS5C 4DIRA 1NIWA 1ALVA 3BOWB 2BBMA 3SIAA 2F2PA 4IL1A 3HX4A 5ER4X 1NUBA 1SL8A 5HLVA 1CFPA 2H61C 1UURA 2F3ZA 1ZMZA 4AOMA 1BMOA 1YRTB 1NX0A 2JULA 2KYCA 3OB2B 2QPTA 2ZKMX 1G33A 4L9MA 1IKUA 1SCMB 3VRRA 2JPTA 2L50A 1UHHA 5ER5A 2PRUA 4YGEB 1FI6A 2K61A 1CM4A 1MUXA 2M29A 1DTLA 2ZN9A 1L2OC 1BJFA 1UP5A 2JQ6A 1TN4A 3CTNA 2GGZA 2MLEC 2OS8C 2KOTA 5AANA 1B4CA 3CZTX 4HSZA 1X02A 1IJ6A 4USLA 1U5IB 2LVKA 5DKRA 3SJSA 4PALA 5HYDA 1YX8A 5I8NA 4TNCA 1NP8A 3DVEA 4YRUA 1SR6B 5JOLA 2ZN8A 1A29A 1QS7A 5AERA 2LVVA 1CNPA 1KFUS 1BG1A 5PALA 1FW4A 2KFHA 2V53A 1BOCA 1Y1AA 3PM8A 1S1EA 2KSPA 4M2OA 5BPJA 2ZNEA 3SG5A 4PHNA 1LA3A 4CIDA 1SPYA 1BT6A 1K8UA 1EXRA 3C1VA 1SY9A 1SL7A 1MWNA 1JSAA 1FF1A 2H61A 1CMGA 4ZCUA 2EC6C 1Y6WA 1QLSA 2H2KA 2KDHA 1WLMA 3RM1A 1N65A 3JTDC 4P2YB 3GK4X 1HT9A 2IS9A 2KFGA 4UPGA 2L98A 3O2PA 4A4CA 2KAXA 1SCMC 1DGVA 4GBAA 1DJZA 1MR8A 1NCXA 4N5XA 1GGWA 1XK4C 1KQMB 1VRKA 3HCMA 2HQWA 2K2AA 1EJ3A 2M8UA 3E3RA 3OX6A 3SG4A 5FYXA 1YURA 4FTGA 1OOJA 2WCEA 4GFTA 2HF5A 1NWDA 4DS7A 3I5HB 5IBWA 2KQ6A 5JJGA 3LCPC 2M3WA 1A2XA 1CB1A 1DJIA 1SRAA 1UHJA 3CS1A 2LM5A 1B1GA 3PN7B 3I5GB 4MSPA 1JF2A 4QJ5B 3LLEA 1WRLA 1A4PA 2ZRSA 1QVIY 1ODBA 2TN4A 4YI9A 4XJKB 1SCVA 3BUOB 1SYMA 4HREE 2LAPA 1AK8A 1B9AA 1PK0D 1F55A 1OQPA 2K2FA 3IF7A 5F6TA 1CLMA 2GGMA 2AAOA 3JVTB 1TCFA 2HETA 2CXJA 1FBVA 2CTNA 3BOWA 5HKZA 1K90D 1G8IA 1LA0A 2JZIA 1RK9A 2BKIB 2JWWA 4R1EA 2WOSA 2KAYA 3EK7A 5AXIA 5DKQA 4NQGA 1M46A 4BY5A 4JPZB 3KO0A 4OV2A 2M7NA 3D10A 3KEVA 4YI8A 1KCYA 4CFRA 1XK4A 5CSFA 1N0YA 1S5GY 3EKJA 1KK8B 3I5IB 3CWGA 2DOQA 3F45A 3BYAA 3KHEA 1YR5A 1CDMA 1U5IA 3SG3A 1K9UA 1DF0A 2Y1NA 1D1OA 2PSRA 1TRFA 1A03A 3VRNA 4PE4A 2GV5A 3KPXA 5AFPA 3EK8A 3I5HC 5D69A 1QVIZ 2L4HA 3I5FB 3IQQA 3LK0A 1BF5A 1SW8A 1YUTA 2F2OA 5G08A 5J3XA 1A75A 1V1FA 3AAKA 3FIAA 2BE6A 3I5GC 1QX2A 3PFVA 4GAOA 1F54A 5DKNA 2KYFA 2LE9B 4QJ4B 1LKJA 3IQOA 2LANA 2WC8A 2F33A 1RFJA 1BR1B 1AHRA 1PVBA 1ZUZA 3O4YA 1S36A 3FWBA 4MZLA 1BODA 3CR2A 4I5KA 2COLB 2O60A 2LHLA 3PATA 3O6BA 1SKTA 3SG6A 1HQVA 4ICBA 4YGDB 2KHNA 1WDCC 2Y4QA 1QATA 1S5GZ 1B8CA 3VROA 2LMTA 3BUXB 1QTXA 4MBEA 1UUSA 2JXLA 2F3YA 2RGIA 1DT7B 2NXQA 1ALWA 2WCBA 1LINA 2BL0C 4PE1A 2G9BA 3I5IC 2E30A 1OMRA 1S26D 2LHIA 3FS7A 4C0JA 5GQQC 2HPSA 1XO5A 2BKHB 1TCOB 4MRYA 2SASA 4CFQA 1CLLA 2Y5IA 1OMDA 2O5GA 2QACA 3TZ1A 1YUSA 3MSEB 1LVCD 2CT9A 2PASA 2BCAA 4GGNA 2MA2A 2WCFA 5I2OA 1WY9A 3AKAA 2ZNDA 1J55A 1TOPA 4XJKA 3NSOA 4XYNA 1OMVA 4DRWA 1C07A 4YGAA 3D0YB 1M45A 4PE0A 3AAJA 2JU0A 4F0ZB 4N1GA 2K7CA 4CLNA 4M2QA 1J7OA 1JF0A 2Q4UA 1MXEA 3NSKA 1ZOTB 2KI4B 4MVFA 3OX5A 3H4SE 1K94A 1SNLA 5I2LA 2JNFA 3WHTB 5I2QA 3NSLA 1IQ5A 2LLUA 3WXAA 5KU1A 1NCZA 5CPVA 3SG2A 4OVNF 4AQJA 1JC2A 1F8HA 1KSOA 1MHOA 1W7IB 2BBNA 3EVRA 1J1DA 3DF0A 1CM1A 2KNEA 2L2EA 1SR6C 2M9GA 4MEWA 2LP3A 1S6JA 4DUQA 2EHBA 2JTTA 1FI5A 3KF9A 1CLBA 1XFZO 4A4BA 2L5XB 1AVSA 1QIWA 1KWOB 2LMVA 4PCWA 4PHKA 3ZNIA 3SG7A 4JQ0D 3CLNA 5CSNA 4ORBB 1XA5A 1K95A 4YBHB 5HKWA 1DJGA 2KI6D 4E68A 2KBMA 2JTZA 1NYAA 2MRDA 1YX7A 3EVUA 3BQ3A 2MBXA 3NSIA 1PSBA 1H4BA 1ZACA 3VRPA 2NCPA 3NXAA 3TDUA 1DJXA 1M31A 4ETOA 2I2RE 3QRXA 2R2IA 1ZFSA 1XFWO 1GGZA 4NDBA 4PHMA 3ZWHA 4BY4A 1PALA 2ZRTA 4PE7A 2I94A 3FWCA 4MRXA 4OR9B 2K8MB 1QV1A 2PMYA 2PVBA 4Q04A 4QJ3B 2MAZA 2BCXA 3PLFB 2AUCA 2KI4C 1KQMC 1E8AA 1TTXA 4MLWA 1TIZA 3A4UB 2VRGA 3ICBA 3GK2A 1V1GA 2HQ8A 3AKBA 2MLFC 1K96A 1AJ5A 2B1UA 1AUIB 4CPVA 2FJUB 1SL9A 1IJ5A 1NX2A 4I5JA 1YVLA 2LC5A 3VGOA 1GQMA 3CR4X 2A4JA 1EG4A 3EVVA 2D8NA 1CTRA 1WRKA 2LUXA 1IH0A 2ISDA 3PN7C 1W7JB 3BUWB 5CSJA 4WQ3A 4GNKB 1IGVA 1NSHA 1RTP1 3PSRA 1B47A 1IQ3A 2K7DA 4GUKA 4GPLB 3RLZA 5HKYA 5K89A 4ORAB 1KWOC 2I18A 1J7RA 1XFVO 1M63B 3LL8B 1J1EA 3JVTC 1KSMA 1JUOA 1Y0VH 2WNDA 1TNXA 2JT0A 2LV7A 5TNCA 1NPQA 4AQIA 4I5LB 2LCPA 3WNXB 3JTDB 1BLQA 2K0JA 1M39A 2MHHA 4U8DA 1F4QA 1TNWA 2OPOA 1RECA 1OE9B 1GJYA 3D0YA 1B7TY 1DJHA 1RJVA 1RROA 2LLTA 1LXFC 2L0PA 1C7WA 1S6IA 2OTGB 4GGFC 2JXCA 1WRZA 2AMIA 1C7VA 1BR4B 1XVJA 1SK6D 3DD4A 1QX5B 4PHJA 1KFXL 1Y1XA 1CFFA 1KK8C 1NX1A 1YVHA 3TUYB 3WHUB 1NX3A 1PVAA 2CNPA 1MXLC 2BE4A 1F4OA 1TNQA 4HRGA 1PRWA 2CBLA 2JRFA 1DF0B 2ZFDA 5KSZA 1QLKA 1QV0A 1S3PA 1J7PA 1K2HA 1YTZC 1J7QA 2JT3A 2KFFA 3I5FC 3SIBA 5B8IB 1CFCA 1FPWA 4NDCA 3K21A 3GK1A 1YUUA 3TDIA 1SMGA 1A75B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EH2 A;  5HLO A;  1UWO A;  2LVI A;  1DMO A;  1NCY A;  2JT8 A;  3EK4 A;  1CFD A;  3OP0 A;  4YGB B;  1YRU B;  1XFU O;  2M1K B;  3M0W A;  4MN0 A;  4YGC B;  5AEQ A;  3A8R A;  2M1U A;  1H8B A;  4ORC B;  3PAL A;  4HRH A;  1MF8 B;  1B7T Z;  1WLZ A;  2Q91 A;  4NDD A;  1K9K A;  3CGA A;  4GGF A;  1KK7 Y;  2NZ0 A;  2FOT A;  4WQ2 A;  2FCE A;  2KAV A;  3CR5 X;  1CKK A;  1DJW A;  4N1F A;  4OKH A;  4M2P A;  5KTY A;  1MQ1 A;  2OTG C;  1PUL A;  1G4Y R;  2F8P A;  4MZJ A;  2Y1M A;  4FQO A;  2P6B B;  4C0K A;  1CMF A;  1TNP A;  1XFY O;  2CCM A;  2KGB C;  1Q80 A;  3TUY C;  1IWQ A;  1UHN A;  1JFK A;  1DGU A;  2LP2 A;  2M97 A;  2BEC A;  1QAS A;  2L51 A;  1K9P A;  1S6C A;  3TS5 B;  2JOJ A;  1F70 A;  1XFX O;  4ZCV A;  1OSA A;  1OZS A;  4OCI A;  4PDZ A;  1EG3 A;  4C0L A;  1QIV A;  1JFJ A;  1QJT A;  1R6P A;  4JWQ A;  4DCK A;  3DVJ A;  1KFU L;  2LNK A;  1K93 D;  2G2B A;  2LVJ A;  2L4I A;  3BXK A;  1DJY A;  1IG5 A;  1B8R A;  5D7F A;  2E6W A;  1UHK A;  1L2O B;  3EKH A;  3TDZ A;  1L7Z A;  1Y1U A;  2OS8 B;  1CDP A;  1KFX S;  1IRJ A;  1CDL A;  1PSR A;  3DVM A;  2M49 B;  1OZO A;  1RWY A;  2LUC A;  2M7L A;  3O78 A;  2NCO A;  3VRQ A;  3OHM B;  5CSI A;  2K7B A;  1KK7 Z;  2MJW B;  2WOR A;  2BCB A;  2KBI A;  1AJ4 A;  1R2U A;  2LMU A;  4P5O E;  2JNX A;  2SCP A;  1WDC B;  2KI6 C;  1B8L A;  2LLS A;  3BUN B;  1JBA A;  1QXP A;  1JWD A;  1KQV A;  4I5N B;  3LK1 A;  1UHI A;  4WRI A;  1N2D A;  2PAL A;  3GOF A;  2BL0 B;  2FCD A;  2KGR A;  1SBJ A;  3DF0 B;  1CDN A;  2I7A A;  3OB1 B;  1AP4 A;  1DVI A;  2KQY A;  1QX7 A;  1EL4 A;  1BU3 A;  3BUM B;  1F71 A;  2K7O A;  4MZK A;  4D1E A;  3DVK A;  2NLN A;  1XYD A;  2JC2 A;  2EGD A;  2M0R A;  2EC6 B;  3TS5 C;  4DIR A;  1NIW A;  1ALV A;  3BOW B;  2BBM A;  3SIA A;  2F2P A;  4IL1 A;  3HX4 A;  5ER4 X;  1NUB A;  1SL8 A;  5HLV A;  1CFP A;  2H61 C;  1UUR A;  2F3Z A;  1ZMZ A;  4AOM A;  1BMO A;  1YRT B;  1NX0 A;  2JUL A;  2KYC A;  3OB2 B;  2QPT A;  2ZKM X;  1G33 A;  4L9M A;  1IKU A;  1SCM B;  3VRR A;  2JPT A;  2L50 A;  1UHH A;  5ER5 A;  2PRU A;  4YGE B;  1FI6 A;  2K61 A;  1CM4 A;  1MUX A;  2M29 A;  1DTL A;  2ZN9 A;  1L2O C;  1BJF A;  1UP5 A;  2JQ6 A;  1TN4 A;  3CTN A;  2GGZ A;  2MLE C;  2OS8 C;  2KOT A;  5AAN A;  1B4C A;  3CZT X;  4HSZ A;  1X02 A;  1IJ6 A;  4USL A;  1U5I B;  2LVK A;  5DKR A;  3SJS A;  4PAL A;  5HYD A;  1YX8 A;  5I8N A;  4TNC A;  1NP8 A;  3DVE A;  4YRU A;  1SR6 B;  5JOL A;  2ZN8 A;  1A29 A;  1QS7 A;  5AER A;  2LVV A;  1CNP A;  1KFU S;  1BG1 A;  5PAL A;  1FW4 A;  2KFH A;  2V53 A;  1BOC A;  1Y1A A;  3PM8 A;  1S1E A;  2KSP A;  4M2O A;  5BPJ A;  2ZNE A;  3SG5 A;  4PHN A;  1LA3 A;  4CID A;  1SPY A;  1BT6 A;  1K8U A;  1EXR A;  3C1V A;  1SY9 A;  1SL7 A;  1MWN A;  1JSA A;  1FF1 A;  2H61 A;  1CMG A;  4ZCU A;  2EC6 C;  1Y6W A;  1QLS A;  2H2K A;  2KDH A;  1WLM A;  3RM1 A;  1N65 A;  3JTD C;  4P2Y B;  3GK4 X;  1HT9 A;  2IS9 A;  2KFG A;  4UPG A;  2L98 A;  3O2P A;  4A4C A;  2KAX A;  1SCM C;  1DGV A;  4GBA A;  1DJZ A;  1MR8 A;  1NCX A;  4N5X A;  1GGW A;  1XK4 C;  1KQM B;  1VRK A;  3HCM A;  2HQW A;  2K2A A;  1EJ3 A;  2M8U A;  3E3R A;  3OX6 A;  3SG4 A;  5FYX A;  1YUR A;  4FTG A;  1OOJ A;  2WCE A;  4GFT A;  2HF5 A;  1NWD A;  4DS7 A;  3I5H B;  5IBW A;  2KQ6 A;  5JJG A;  3LCP C;  2M3W A;  1A2X A;  1CB1 A;  1DJI A;  1SRA A;  1UHJ A;  3CS1 A;  2LM5 A;  1B1G A;  3PN7 B;  3I5G B;  4MSP A;  1JF2 A;  4QJ5 B;  3LLE A;  1WRL A;  1A4P A;  2ZRS A;  1QVI Y;  1ODB A;  2TN4 A;  4YI9 A;  4XJK B;  1SCV A;  3BUO B;  1SYM A;  4HRE E;  2LAP A;  1AK8 A;  1B9A A;  1PK0 D;  1F55 A;  1OQP A;  2K2F A;  3IF7 A;  5F6T A;  1CLM A;  2GGM A;  2AAO A;  3JVT B;  1TCF A;  2HET A;  2CXJ A;  1FBV A;  2CTN A;  3BOW A;  5HKZ A;  1K90 D;  1G8I A;  1LA0 A;  2JZI A;  1RK9 A;  2BKI B;  2JWW A;  4R1E A;  2WOS A;  2KAY A;  3EK7 A;  5AXI A;  5DKQ A;  4NQG A;  1M46 A;  4BY5 A;  4JPZ B;  3KO0 A;  4OV2 A;  2M7N A;  3D10 A;  3KEV A;  4YI8 A;  1KCY A;  4CFR A;  1XK4 A;  5CSF A;  1N0Y A;  1S5G Y;  3EKJ A;  1KK8 B;  3I5I B;  3CWG A;  2DOQ A;  3F45 A;  3BYA A;  3KHE A;  1YR5 A;  1CDM A;  1U5I A;  3SG3 A;  1K9U A;  1DF0 A;  2Y1N A;  1D1O A;  2PSR A;  1TRF A;  1A03 A;  3VRN A;  4PE4 A;  2GV5 A;  3KPX A;  5AFP A;  3EK8 A;  3I5H C;  5D69 A;  1QVI Z;  2L4H A;  3I5F B;  3IQQ A;  3LK0 A;  1BF5 A;  1SW8 A;  1YUT A;  2F2O A;  5G08 A;  5J3X A;  1A75 A;  1V1F A;  3AAK A;  3FIA A;  2BE6 A;  3I5G C;  1QX2 A;  3PFV A;  4GAO A;  1F54 A;  5DKN A;  2KYF A;  2LE9 B;  4QJ4 B;  1LKJ A;  3IQO A;  2LAN A;  2WC8 A;  2F33 A;  1RFJ A;  1BR1 B;  1AHR A;  1PVB A;  1ZUZ A;  3O4Y A;  1S36 A;  3FWB A;  4MZL A;  1BOD A;  3CR2 A;  4I5K A;  2COL B;  2O60 A;  2LHL A;  3PAT A;  3O6B A;  1SKT A;  3SG6 A;  1HQV A;  4ICB A;  4YGD B;  2KHN A;  1WDC C;  2Y4Q A;  1QAT A;  1S5G Z;  1B8C A;  3VRO A;  2LMT A;  3BUX B;  1QTX A;  4MBE A;  1UUS A;  2JXL A;  2F3Y A;  2RGI A;  1DT7 B;  2NXQ A;  1ALW A;  2WCB A;  1LIN A;  2BL0 C;  4PE1 A;  2G9B A;  3I5I C;  2E30 A;  1OMR A;  1S26 D;  2LHI A;  3FS7 A;  4C0J A;  5GQQ C;  2HPS A;  1XO5 A;  2BKH B;  1TCO B;  4MRY A;  2SAS A;  4CFQ A;  1CLL A;  2Y5I A;  1OMD A;  2O5G A;  2QAC A;  3TZ1 A;  1YUS A;  3MSE B;  1LVC D;  2CT9 A;  2PAS A;  2BCA A;  4GGN A;  2MA2 A;  2WCF A;  5I2O A;  1WY9 A;  3AKA A;  2ZND A;  1J55 A;  1TOP A;  4XJK A;  3NSO A;  4XYN A;  1OMV A;  4DRW A;  1C07 A;  4YGA A;  3D0Y B;  1M45 A;  4PE0 A;  3AAJ A;  2JU0 A;  4F0Z B;  4N1G A;  2K7C A;  4CLN A;  4M2Q A;  1J7O A;  1JF0 A;  2Q4U A;  1MXE A;  3NSK A;  1ZOT B;  2KI4 B;  4MVF A;  3OX5 A;  3H4S E;  1K94 A;  1SNL A;  5I2L A;  2JNF A;  3WHT B;  5I2Q A;  3NSL A;  1IQ5 A;  2LLU A;  3WXA A;  5KU1 A;  1NCZ A;  5CPV A;  3SG2 A;  4OVN F;  4AQJ A;  1JC2 A;  1F8H A;  1KSO A;  1MHO A;  1W7I B;  2BBN A;  3EVR A;  1J1D A;  3DF0 A;  1CM1 A;  2KNE A;  2L2E A;  1SR6 C;  2M9G A;  4MEW A;  2LP3 A;  1S6J A;  4DUQ A;  2EHB A;  2JTT A;  1FI5 A;  3KF9 A;  1CLB A;  1XFZ O;  4A4B A;  2L5X B;  1AVS A;  1QIW A;  1KWO B;  2LMV A;  4PCW A;  4PHK A;  3ZNI A;  3SG7 A;  4JQ0 D;  3CLN A;  5CSN A;  4ORB B;  1XA5 A;  1K95 A;  4YBH B;  5HKW A;  1DJG A;  2KI6 D;  4E68 A;  2KBM A;  2JTZ A;  1NYA A;  2MRD A;  1YX7 A;  3EVU A;  3BQ3 A;  2MBX A;  3NSI A;  1PSB A;  1H4B A;  1ZAC A;  3VRP A;  2NCP A;  3NXA A;  3TDU A;  1DJX A;  1M31 A;  4ETO A;  2I2R E;  3QRX A;  2R2I A;  1ZFS A;  1XFW O;  1GGZ A;  4NDB A;  4PHM A;  3ZWH A;  4BY4 A;  1PAL A;  2ZRT A;  4PE7 A;  2I94 A;  3FWC A;  4MRX A;  4OR9 B;  2K8M B;  1QV1 A;  2PMY A;  2PVB A;  4Q04 A;  4QJ3 B;  2MAZ A;  2BCX A;  3PLF B;  2AUC A;  2KI4 C;  1KQM C;  1E8A A;  1TTX A;  4MLW A;  1TIZ A;  3A4U B;  2VRG A;  3ICB A;  3GK2 A;  1V1G A;  2HQ8 A;  3AKB A;  2MLF C;  1K96 A;  1AJ5 A;  2B1U A;  1AUI B;  4CPV A;  2FJU B;  1SL9 A;  1IJ5 A;  1NX2 A;  4I5J A;  1YVL A;  2LC5 A;  3VGO A;  1GQM A;  3CR4 X;  2A4J A;  1EG4 A;  3EVV A;  2D8N A;  1CTR A;  1WRK A;  2LUX A;  1IH0 A;  2ISD A;  3PN7 C;  1W7J B;  3BUW B;  5CSJ A;  4WQ3 A;  4GNK B;  1IGV A;  1NSH A;  1RTP 1;  3PSR A;  1B47 A;  1IQ3 A;  2K7D A;  4GUK A;  4GPL B;  3RLZ A;  5HKY A;  5K89 A;  4ORA B;  1KWO C;  2I18 A;  1J7R A;  1XFV O;  1M63 B;  3LL8 B;  1J1E A;  3JVT C;  1KSM A;  1JUO A;  1Y0V H;  2WND A;  1TNX A;  2JT0 A;  2LV7 A;  5TNC A;  1NPQ A;  4AQI A;  4I5L B;  2LCP A;  3WNX B;  3JTD B;  1BLQ A;  2K0J A;  1M39 A;  2MHH A;  4U8D A;  1F4Q A;  1TNW A;  2OPO A;  1REC A;  1OE9 B;  1GJY A;  3D0Y A;  1B7T Y;  1DJH A;  1RJV A;  1RRO A;  2LLT A;  1LXF C;  2L0P A;  1C7W A;  1S6I A;  2OTG B;  4GGF C;  2JXC A;  1WRZ A;  2AMI A;  1C7V A;  1BR4 B;  1XVJ A;  1SK6 D;  3DD4 A;  1QX5 B;  4PHJ A;  1KFX L;  1Y1X A;  1CFF A;  1KK8 C;  1NX1 A;  1YVH A;  3TUY B;  3WHU B;  1NX3 A;  1PVA A;  2CNP A;  1MXL C;  2BE4 A;  1F4O A;  1TNQ A;  4HRG A;  1PRW A;  2CBL A;  2JRF A;  1DF0 B;  2ZFD A;  5KSZ A;  1QLK A;  1QV0 A;  1S3P A;  1J7P A;  1K2H A;  1YTZ C;  1J7Q A;  2JT3 A;  2KFF A;  3I5F C;  3SIB A;  5B8I B;  1CFC A;  1FPW A;  4NDC A;  3K21 A;  3GK1 A;  1YUU A;  3TDI A;  1SMG A;  1A75 B; 
#chains in the Genus database with same CATH topology
 1EH2 A;  5HLO A;  1UWO A;  2LVI A;  1DMO A;  1NCY A;  2JT8 A;  3V2L A;  1TUJ A;  3UNW A;  3EK4 A;  1CFD A;  3OP0 A;  4YGB B;  1YRU B;  1XFU O;  2M1K B;  3M0W A;  1Z4H A;  4MN0 A;  4YGC B;  4JD9 A;  5AEQ A;  3A8R A;  2M1U A;  1H8B A;  4ORC B;  3PAL A;  4HRH A;  1MF8 B;  1B7T Z;  1WLZ A;  2Q91 A;  4NDD A;  1K9K A;  3CGA A;  4GGF A;  1KK7 Y;  2NZ0 A;  2FOT A;  4WQ2 A;  2FCE A;  2KAV A;  3CR5 X;  1CKK A;  1DJW A;  4N1F A;  4OKH A;  4M2P A;  5KTY A;  1MQ1 A;  2OTG C;  1PUL A;  1G4Y R;  2F8P A;  4MZJ A;  2Y1M A;  4FQO A;  2P6B B;  4C0K A;  5HL1 A;  1CMF A;  1OOG A;  3OBV A;  1TNP A;  1XFY O;  2CCM A;  2KGB C;  1Q80 A;  3TUY C;  1IWQ A;  1UHN A;  1JFK A;  3NHT A;  1DGU A;  2LP2 A;  2M97 A;  2BEC A;  1QAS A;  2L51 A;  1K9P A;  1S6C A;  2GTE A;  3TS5 B;  2JOJ A;  1F70 A;  1XFX O;  4ZCV A;  1OSA A;  1OZS A;  2FJY A;  4OCI A;  4PDZ A;  1EG3 A;  4C0L A;  1QIV A;  1JFJ A;  1QJT A;  1R6P A;  4JWQ A;  4DCK A;  3DVJ A;  1KFU L;  2LNK A;  1K93 D;  2G2B A;  2LVJ A;  2L4I A;  3D75 A;  3BXK A;  1DJY A;  1IG5 A;  1B8R A;  5D7F A;  2E6W A;  1UHK A;  1L2O B;  3EKH A;  3TDZ A;  1L7Z A;  1Y1U A;  2OS8 B;  1CDP A;  1KFX S;  1IRJ A;  1CDL A;  1PSR A;  3DVM A;  2M49 B;  2QDI A;  1OZO A;  1RWY A;  2LUC A;  3N7H A;  3O78 A;  2NCO A;  2M7L A;  3OHM B;  5CSI A;  2K7B A;  3VRQ A;  1KK7 Z;  2MJW B;  2WOR A;  2BCB A;  2KBI A;  1AJ4 A;  1R2U A;  2LMU A;  4P5O E;  2JNX A;  1OOF A;  1WDC B;  2KI6 C;  1B8L A;  2LLS A;  2SCP A;  3BUN B;  1QXP A;  1JBA A;  1JWD A;  1KQV A;  4I5N B;  3LK1 A;  3QME A;  1UHI A;  4WRI A;  1N2D A;  3CDN A;  2PAL A;  3GOF A;  2BL0 B;  2FCD A;  2KGR A;  1SBJ A;  3DF0 B;  1CDN A;  2I7A A;  3OB1 B;  1AP4 A;  1DVI A;  2KQY A;  1DEL A;  1QX7 A;  3S0A A;  1EL4 A;  1BU3 A;  3BUM B;  5FI7 A;  1F71 A;  2K7O A;  4MZK A;  4D1E A;  3DVK A;  2NLN A;  1XYD A;  2JC2 A;  2EGD A;  2M0R A;  2EC6 B;  3TS5 C;  4DIR A;  1NIW A;  1ALV A;  2KPH A;  2BBM A;  2PYQ A;  2F2P A;  3BOW B;  3HX4 A;  4IL1 A;  5ER4 X;  1NUB A;  1SL8 A;  5HLV A;  3BFB A;  1CFP A;  1TWO A;  2H61 C;  1UUR A;  2F3Z A;  1ZMZ A;  4AOM A;  2H8V A;  1BMO A;  1YRT B;  1NX0 A;  2JUL A;  2KYC A;  3OB2 B;  2QPT A;  4INW A;  2ZKM X;  1G33 A;  3R1O A;  4L9M A;  1SCM B;  3VRR A;  1IKU A;  2JPT A;  3DYE A;  2L50 A;  1UHH A;  5ER5 A;  2PRU A;  4YGE B;  1FI6 A;  3Q8I A;  2K61 A;  1CM4 A;  1MUX A;  2M29 A;  1DTL A;  2WC6 A;  2ZN9 A;  1L2O C;  1BJF A;  1UP5 A;  2JQ6 A;  1TN4 A;  3CTN A;  2GGZ A;  2MLE C;  2OS8 C;  2KOT A;  3VB1 A;  5AAN A;  2KLD A;  1B4C A;  3CZT X;  4HSZ A;  1X02 A;  1GM0 A;  1IJ6 A;  4USL A;  1U5I B;  2LVK A;  5DKR A;  3SJS A;  4PAL A;  3BFH A;  5HYD A;  1YX8 A;  5I8N A;  3FE8 A;  5D3O A;  4TNC A;  1NP8 A;  3DVE A;  4YRU A;  1SR6 B;  5JOL A;  2ZN8 A;  1A29 A;  1QS7 A;  5AER A;  2LVV A;  1CNP A;  1KFU S;  1BG1 A;  5PAL A;  1FW4 A;  2KFH A;  2WC5 A;  3FE6 A;  3K1E A;  2V53 A;  1BOC A;  1Y1A A;  3PM8 A;  1S1E A;  2KSP A;  4M2O A;  5BPJ A;  2YGU A;  2ZNE A;  3SG5 A;  4PHN A;  1LA3 A;  4CID A;  1SPY A;  1BT6 A;  1K8U A;  1EXR A;  3C1V A;  1SY9 A;  1SL7 A;  2WCJ A;  3L47 A;  1MWN A;  1JSA A;  1FF1 A;  2H61 A;  1CMG A;  4ZCU A;  2EC6 C;  3B86 A;  1Y6W A;  1QLS A;  2H2K A;  2KDH A;  3FE9 A;  1WLM A;  3RM1 A;  1N65 A;  3JTD C;  4P2Y B;  3GK4 X;  1HT9 A;  2IS9 A;  2KFG A;  4UPG A;  2L98 A;  3O2P A;  3OGN A;  4A4C A;  2KAX A;  1SCM C;  2K60 A;  1DGV A;  4FQT A;  3B6X A;  3NGV A;  4GBA A;  1DJZ A;  1MR8 A;  1NCX A;  3B7A A;  4N5X A;  4JKT A;  1GGW A;  1XK4 C;  4KYN A;  1KQM B;  1VRK A;  3HCM A;  3SS5 A;  2HQW A;  2K2A A;  1EJ3 A;  2M8U A;  3E3R A;  3OX6 A;  3S0F A;  3SG4 A;  5FYX A;  3DZT A;  1YUR A;  4FTG A;  1OOJ A;  2QEB A;  2WCE A;  4GFT A;  2HF5 A;  1NWD A;  4DS7 A;  3I5H B;  5IBW A;  2KQ6 A;  5JJG A;  3LCP C;  2M3W A;  1A2X A;  1CB1 A;  1DJI A;  1SRA A;  1UHJ A;  3CS1 A;  2LM5 A;  1B1G A;  3PN7 B;  3I5G B;  4MSP A;  1JF2 A;  4QJ5 B;  3LLE A;  1WRL A;  1A4P A;  2ZRS A;  1QVI Y;  1ODB A;  2TN4 A;  4YI9 A;  4XJK B;  1SCV A;  3BUO B;  1SYM A;  4HRE E;  2LAP A;  1AK8 A;  3SS3 A;  1B9A A;  1PK0 D;  1F55 A;  1OQP A;  2PQL A;  2K2F A;  3IF7 A;  5F6T A;  3D78 A;  1CLM A;  2GGM A;  2AAO A;  3JVT B;  1TCF A;  2HET A;  2CXJ A;  1FBV A;  2CTN A;  3BOW A;  3CYZ A;  3D76 A;  1K90 D;  5HKZ A;  1G8I A;  1LA0 A;  1TUZ A;  2JZI A;  1RK9 A;  2BKI B;  2JWW A;  4R1E A;  2WOS A;  2KAY A;  3EK7 A;  5AXI A;  5DKQ A;  4NQG A;  1M46 A;  1ORG A;  4BY5 A;  4JPZ B;  3KO0 A;  1C3Z A;  4OV2 A;  2M7N A;  3D10 A;  3KEV A;  4YI8 A;  1KCY A;  4CFR A;  1XK4 A;  5CSF A;  1N0Y A;  3CAB A;  1S5G Y;  3EKJ A;  1KK8 B;  3I5I B;  3CWG A;  2DOQ A;  3F45 A;  3PM2 A;  3BYA A;  3PJI A;  1DEK A;  3KHE A;  1YR5 A;  3CZ0 A;  3D77 A;  1CDM A;  1U5I A;  3SG3 A;  1K9U A;  1DF0 A;  2Y1N A;  1D1O A;  2PSR A;  1TRF A;  1A03 A;  3S0G A;  3VRN A;  4PE4 A;  2GV5 A;  3KPX A;  5AFP A;  3EK8 A;  3I5H C;  5D69 A;  1Z2C B;  1QVI Z;  2L4H A;  3I5F B;  3IQQ A;  3LK0 A;  1BF5 A;  1SW8 A;  1YUT A;  2F2O A;  5G08 A;  5J3X A;  1A75 A;  1V1F A;  3AAK A;  3FIA A;  2BE6 A;  3I5G C;  1QX2 A;  3IVT A;  3PFV A;  4GAO A;  5DIC A;  1F54 A;  1OOI X;  5DKN A;  2KYF A;  3S0D A;  2LE9 B;  2WCM A;  4QJ4 B;  1LKJ A;  3IQO A;  2LAN A;  2WC8 A;  2F33 A;  1RFJ A;  1BR1 B;  3BJH A;  1AHR A;  1PVB A;  1ZUZ A;  1DQE A;  1OW4 A;  1S36 A;  3FWB A;  3O4Y A;  3CR2 A;  4MZL A;  1BOD A;  4I5K A;  3RZS A;  2COL B;  2O60 A;  2LHL A;  3PAT A;  3O6B A;  1SKT A;  3SG6 A;  1HQV A;  4ICB A;  4YGD B;  2KHN A;  1WDC C;  2Y4Q A;  1QAT A;  1S5G Z;  1B8C A;  3VRO A;  2LMT A;  2WCH A;  3BUX B;  1QTX A;  2QEV A;  3BFA A;  1UUS A;  3R72 A;  2JXL A;  2F3Y A;  2RGI A;  4MBE A;  2L5Y A;  1ALW A;  2NXQ A;  2WCB A;  1DT7 B;  4PT1 A;  1LIN A;  2BL0 C;  4PE1 A;  2G9B A;  3R1V A;  3I5I C;  2E30 A;  1OMR A;  1S26 D;  2LHI A;  3FS7 A;  4C0J A;  5GQQ C;  2HPS A;  1XO5 A;  2BKH B;  3DXL A;  1TCO B;  1T14 A;  4MRY A;  2SAS A;  4CFQ A;  1CLL A;  2Y5I A;  1OMD A;  2O5G A;  1DC1 A;  2QAC A;  3TZ1 A;  1YUS A;  3MSE B;  1LVC D;  2CT9 A;  2PAS A;  2BCA A;  4GGN A;  2MA2 A;  2WCF A;  5I2O A;  1WY9 A;  3AKA A;  3CZ1 A;  2ZND A;  1J55 A;  1TOP A;  4XJK A;  3NSO A;  4XYN A;  1OMV A;  4DRW A;  1C07 A;  4YGA A;  3D0Y B;  1M45 A;  4PE0 A;  3AAJ A;  2JU0 A;  2WCK A;  4F0Z B;  4N1G A;  2K7C A;  4CLN A;  4M2Q A;  1J7O A;  1JF0 A;  2Q4U A;  1MXE A;  3NSK A;  1ZOT B;  2KI4 B;  4MVF A;  3OX5 A;  1C3Y A;  3H4S E;  1K94 A;  1SNL A;  5I2L A;  2JNF A;  3WHT B;  5I2Q A;  3NSL A;  1IQ5 A;  2LLU A;  3WXA A;  5KU1 A;  1NCZ A;  5CPV A;  3SG2 A;  4OVN F;  4AQJ A;  1JC2 A;  1XFR A;  1F8H A;  1KSO A;  1MHO A;  3DY9 A;  3S0E A;  3S0B A;  1W7I B;  2BBN A;  3EVR A;  1J1D A;  3DF0 A;  1CM1 A;  2KNE A;  2L2E A;  1SR6 C;  2M9G A;  4MEW A;  2LP3 A;  1S6J A;  4DUQ A;  3R1P A;  2EHB A;  2JTT A;  1FI5 A;  3KF9 A;  1CLB A;  4OZD A;  2ERB A;  1XFZ O;  4A4B A;  2L5X B;  1AVS A;  1QIW A;  1SSE B;  1KWO B;  2LMV A;  4PCW A;  4PHK A;  3ZNI A;  3SG7 A;  4JQ0 D;  3CLN A;  4IJ7 A;  5CSN A;  4ORB B;  1XA5 A;  1K95 A;  3CZ2 A;  4YBH B;  5HKW A;  1DJG A;  2KI6 D;  4E68 A;  2KBM A;  2JTZ A;  1NYA A;  2MRD A;  1YX7 A;  3EVU A;  3BQ3 A;  2MBX A;  5FI6 A;  3NSI A;  1PSB A;  1H4B A;  1ZAC A;  3VRP A;  1W9Z A;  2NCP A;  3NXA A;  5FI2 A;  1DJX A;  1M31 A;  3TDU A;  5EL2 A;  4INX A;  4ETO A;  3NHI A;  2I2R E;  3QRX A;  2R2I A;  1ZFS A;  1XFW O;  1GGZ A;  4NDB A;  4PHM A;  3ZWH A;  4BY4 A;  3L4A A;  1PAL A;  2P71 A;  2ZRT A;  1P28 A;  3SS4 A;  4PE7 A;  2I94 A;  3FWC A;  4MRX A;  4OR9 B;  2QEO A;  2K8M B;  1QV1 A;  2PMY A;  2PVB A;  4Q04 A;  4QJ3 B;  2MAZ A;  2BCX A;  3PLF B;  2AUC A;  2KI4 C;  1KQM C;  1E8A A;  1TTX A;  4MLW A;  1TIZ A;  3A4U B;  4F7F A;  2VRG A;  3ICB A;  3B87 A;  3GK2 A;  1V1G A;  2HQ8 A;  3AKB A;  2MLF C;  3O4X A;  1K96 A;  1AJ5 A;  2B1U A;  3SIA A;  1AUI B;  4CPV A;  2FJU B;  1SL9 A;  1IJ5 A;  1NX2 A;  4I5J A;  1YVL A;  2LC5 A;  3VGO A;  1GQM A;  3CR4 X;  2A4J A;  1EG4 A;  3EVV A;  2D8N A;  1CTR A;  1WRK A;  2LUX A;  1IH0 A;  2ISD A;  3PN7 C;  1W7J B;  3BUW B;  5CSJ A;  4WQ3 A;  4GNK B;  1IGV A;  1NSH A;  1RTP 1;  3PSR A;  1B47 A;  1IQ3 A;  2K7D A;  4GUK A;  4GPL B;  3RLZ A;  5HKY A;  5K89 A;  2BAP A;  4ORA B;  1KWO C;  2I18 A;  1J7R A;  1XFV O;  1M63 B;  3LL8 B;  2KLE A;  1J1E A;  3JVT C;  1KSM A;  1JUO A;  1Y0V H;  2WND A;  2P70 A;  1TNX A;  2JT0 A;  2LV7 A;  5TNC A;  1NPQ A;  3UO9 A;  4AQI A;  3EG5 B;  4I5L B;  2LCP A;  3WNX B;  3JTD B;  1BLQ A;  2WCL A;  2K0J A;  1M39 A;  2MHH A;  4U8D A;  1LS8 A;  1F4Q A;  1TNW A;  2OPO A;  1REC A;  1OE9 B;  3D73 A;  1GJY A;  3D0Y A;  1QWV A;  1B7T Y;  1DJH A;  1RJV A;  1RRO A;  2LLT A;  2QEH A;  3L4L A;  1LXF C;  2L0P A;  1C7W A;  1S6I A;  2OTG B;  4GGF C;  2JXC A;  1WRZ A;  3B88 A;  2AMI A;  2BNX A;  1C7V A;  1BR4 B;  1XVJ A;  1SK6 D;  3DD4 A;  1QX5 B;  4PHJ A;  1KFX L;  1Y1X A;  1CFF A;  1KK8 C;  1NX1 A;  1YVH A;  3TUY B;  3WHU B;  1NX3 A;  3D74 A;  1PVA A;  2CNP A;  1MXL C;  2BE4 A;  1F4O A;  1TNQ A;  4HRG A;  1PRW A;  2CBL A;  2JRF A;  1DF0 B;  2L2C A;  2ZFD A;  5KSZ A;  1QLK A;  1QV0 A;  1S3P A;  1J7P A;  2JPO A;  1K2H A;  1YTZ C;  1J7Q A;  2JT3 A;  2KFF A;  3I5F C;  3SIB A;  5B8I B;  1CFC A;  1FPW A;  4NDC A;  3K21 A;  3GK1 A;  1YUU A;  5I94 A;  1IIO A;  3TDI A;  1SMG A;  1A75 B;  1OOH A; 
#chains in the Genus database with same CATH homology
 1EH2 A;  5HLO A;  1UWO A;  2LVI A;  1DMO A;  1NCY A;  2JT8 A;  3EK4 A;  1CFD A;  3OP0 A;  4YGB B;  1YRU B;  1XFU O;  2M1K B;  3M0W A;  4MN0 A;  4YGC B;  5AEQ A;  3A8R A;  2M1U A;  1H8B A;  4ORC B;  3PAL A;  4HRH A;  1MF8 B;  1B7T Z;  1WLZ A;  2Q91 A;  4NDD A;  1K9K A;  3CGA A;  4GGF A;  1KK7 Y;  2NZ0 A;  2FOT A;  4WQ2 A;  2FCE A;  2KAV A;  3CR5 X;  1CKK A;  1DJW A;  4N1F A;  4OKH A;  4M2P A;  5KTY A;  1MQ1 A;  2OTG C;  1PUL A;  1G4Y R;  2F8P A;  4MZJ A;  2Y1M A;  4FQO A;  2P6B B;  4C0K A;  1CMF A;  1TNP A;  1XFY O;  2CCM A;  2KGB C;  1Q80 A;  3TUY C;  1IWQ A;  1UHN A;  1JFK A;  1DGU A;  2LP2 A;  2M97 A;  2BEC A;  1QAS A;  2L51 A;  1K9P A;  1S6C A;  3TS5 B;  2JOJ A;  1F70 A;  1XFX O;  4ZCV A;  1OSA A;  1OZS A;  4OCI A;  4PDZ A;  1EG3 A;  4C0L A;  1QIV A;  1JFJ A;  1QJT A;  1R6P A;  4JWQ A;  4DCK A;  3DVJ A;  1KFU L;  2LNK A;  1K93 D;  2G2B A;  2LVJ A;  2L4I A;  3BXK A;  1DJY A;  1IG5 A;  1B8R A;  5D7F A;  2E6W A;  1UHK A;  1L2O B;  3EKH A;  3TDZ A;  1L7Z A;  1Y1U A;  2OS8 B;  1CDP A;  1KFX S;  1IRJ A;  1CDL A;  1PSR A;  3DVM A;  2M49 B;  1OZO A;  1RWY A;  2LUC A;  2M7L A;  3O78 A;  2NCO A;  3VRQ A;  3OHM B;  5CSI A;  2K7B A;  1KK7 Z;  2MJW B;  2WOR A;  2BCB A;  2KBI A;  1AJ4 A;  1R2U A;  2LMU A;  4P5O E;  2JNX A;  2SCP A;  1WDC B;  2KI6 C;  1B8L A;  2LLS A;  3BUN B;  1JBA A;  1QXP A;  1JWD A;  1KQV A;  4I5N B;  3LK1 A;  1UHI A;  4WRI A;  1N2D A;  2PAL A;  3GOF A;  2BL0 B;  2FCD A;  2KGR A;  1SBJ A;  3DF0 B;  1CDN A;  2I7A A;  3OB1 B;  1AP4 A;  1DVI A;  2KQY A;  1QX7 A;  1EL4 A;  1BU3 A;  3BUM B;  1F71 A;  2K7O A;  4MZK A;  4D1E A;  3DVK A;  2NLN A;  1XYD A;  2JC2 A;  2EGD A;  2M0R A;  2EC6 B;  3TS5 C;  4DIR A;  1NIW A;  1ALV A;  3BOW B;  2BBM A;  3SIA A;  2F2P A;  4IL1 A;  3HX4 A;  5ER4 X;  1NUB A;  1SL8 A;  5HLV A;  1CFP A;  2H61 C;  1UUR A;  2F3Z A;  1ZMZ A;  4AOM A;  1BMO A;  1YRT B;  1NX0 A;  2JUL A;  2KYC A;  3OB2 B;  2QPT A;  2ZKM X;  1G33 A;  4L9M A;  1IKU A;  1SCM B;  3VRR A;  2JPT A;  2L50 A;  1UHH A;  5ER5 A;  2PRU A;  4YGE B;  1FI6 A;  2K61 A;  1CM4 A;  1MUX A;  2M29 A;  1DTL A;  2ZN9 A;  1L2O C;  1BJF A;  1UP5 A;  2JQ6 A;  1TN4 A;  3CTN A;  2GGZ A;  2MLE C;  2OS8 C;  2KOT A;  5AAN A;  1B4C A;  3CZT X;  4HSZ A;  1X02 A;  1IJ6 A;  4USL A;  1U5I B;  2LVK A;  5DKR A;  3SJS A;  4PAL A;  5HYD A;  1YX8 A;  5I8N A;  4TNC A;  1NP8 A;  3DVE A;  4YRU A;  1SR6 B;  5JOL A;  2ZN8 A;  1A29 A;  1QS7 A;  5AER A;  2LVV A;  1CNP A;  1KFU S;  1BG1 A;  5PAL A;  1FW4 A;  2KFH A;  2V53 A;  1BOC A;  1Y1A A;  3PM8 A;  1S1E A;  2KSP A;  4M2O A;  5BPJ A;  2ZNE A;  3SG5 A;  4PHN A;  1LA3 A;  4CID A;  1SPY A;  1BT6 A;  1K8U A;  1EXR A;  3C1V A;  1SY9 A;  1SL7 A;  1MWN A;  1JSA A;  1FF1 A;  2H61 A;  1CMG A;  4ZCU A;  2EC6 C;  1Y6W A;  1QLS A;  2H2K A;  2KDH A;  1WLM A;  3RM1 A;  1N65 A;  3JTD C;  4P2Y B;  3GK4 X;  1HT9 A;  2IS9 A;  2KFG A;  4UPG A;  2L98 A;  3O2P A;  4A4C A;  2KAX A;  1SCM C;  1DGV A;  4GBA A;  1DJZ A;  1MR8 A;  1NCX A;  4N5X A;  1GGW A;  1XK4 C;  1KQM B;  1VRK A;  3HCM A;  2HQW A;  2K2A A;  1EJ3 A;  2M8U A;  3E3R A;  3OX6 A;  3SG4 A;  5FYX A;  1YUR A;  4FTG A;  1OOJ A;  2WCE A;  4GFT A;  2HF5 A;  1NWD A;  4DS7 A;  3I5H B;  5IBW A;  2KQ6 A;  5JJG A;  3LCP C;  2M3W A;  1A2X A;  1CB1 A;  1DJI A;  1SRA A;  1UHJ A;  3CS1 A;  2LM5 A;  1B1G A;  3PN7 B;  3I5G B;  4MSP A;  1JF2 A;  4QJ5 B;  3LLE A;  1WRL A;  1A4P A;  2ZRS A;  1QVI Y;  1ODB A;  2TN4 A;  4YI9 A;  4XJK B;  1SCV A;  3BUO B;  1SYM A;  4HRE E;  2LAP A;  1AK8 A;  1B9A A;  1PK0 D;  1F55 A;  1OQP A;  2K2F A;  3IF7 A;  5F6T A;  1CLM A;  2GGM A;  2AAO A;  3JVT B;  1TCF A;  2HET A;  2CXJ A;  1FBV A;  2CTN A;  3BOW A;  5HKZ A;  1K90 D;  1G8I A;  1LA0 A;  2JZI A;  1RK9 A;  2BKI B;  2JWW A;  4R1E A;  2WOS A;  2KAY A;  3EK7 A;  5AXI A;  5DKQ A;  4NQG A;  1M46 A;  4BY5 A;  4JPZ B;  3KO0 A;  4OV2 A;  2M7N A;  3D10 A;  3KEV A;  4YI8 A;  1KCY A;  4CFR A;  1XK4 A;  5CSF A;  1N0Y A;  1S5G Y;  3EKJ A;  1KK8 B;  3I5I B;  3CWG A;  2DOQ A;  3F45 A;  3BYA A;  3KHE A;  1YR5 A;  1CDM A;  1U5I A;  3SG3 A;  1K9U A;  1DF0 A;  2Y1N A;  1D1O A;  2PSR A;  1TRF A;  1A03 A;  3VRN A;  4PE4 A;  2GV5 A;  3KPX A;  5AFP A;  3EK8 A;  3I5H C;  5D69 A;  1QVI Z;  2L4H A;  3I5F B;  3IQQ A;  3LK0 A;  1BF5 A;  1SW8 A;  1YUT A;  2F2O A;  5G08 A;  5J3X A;  1A75 A;  1V1F A;  3AAK A;  3FIA A;  2BE6 A;  3I5G C;  1QX2 A;  3PFV A;  4GAO A;  1F54 A;  5DKN A;  2KYF A;  2LE9 B;  4QJ4 B;  1LKJ A;  3IQO A;  2LAN A;  2WC8 A;  2F33 A;  1RFJ A;  1BR1 B;  1AHR A;  1PVB A;  1ZUZ A;  3O4Y A;  1S36 A;  3FWB A;  4MZL A;  1BOD A;  3CR2 A;  4I5K A;  2COL B;  2O60 A;  2LHL A;  3PAT A;  3O6B A;  1SKT A;  3SG6 A;  1HQV A;  4ICB A;  4YGD B;  2KHN A;  1WDC C;  2Y4Q A;  1QAT A;  1S5G Z;  1B8C A;  3VRO A;  2LMT A;  3BUX B;  1QTX A;  4MBE A;  1UUS A;  2JXL A;  2F3Y A;  2RGI A;  1DT7 B;  2NXQ A;  1ALW A;  2WCB A;  1LIN A;  2BL0 C;  4PE1 A;  2G9B A;  3I5I C;  2E30 A;  1OMR A;  1S26 D;  2LHI A;  3FS7 A;  4C0J A;  5GQQ C;  2HPS A;  1XO5 A;  2BKH B;  1TCO B;  4MRY A;  2SAS A;  4CFQ A;  1CLL A;  2Y5I A;  1OMD A;  2O5G A;  2QAC A;  3TZ1 A;  1YUS A;  3MSE B;  1LVC D;  2CT9 A;  2PAS A;  2BCA A;  4GGN A;  2MA2 A;  2WCF A;  5I2O A;  1WY9 A;  3AKA A;  2ZND A;  1J55 A;  1TOP A;  4XJK A;  3NSO A;  4XYN A;  1OMV A;  4DRW A;  1C07 A;  4YGA A;  3D0Y B;  1M45 A;  4PE0 A;  3AAJ A;  2JU0 A;  4F0Z B;  4N1G A;  2K7C A;  4CLN A;  4M2Q A;  1J7O A;  1JF0 A;  2Q4U A;  1MXE A;  3NSK A;  1ZOT B;  2KI4 B;  4MVF A;  3OX5 A;  3H4S E;  1K94 A;  1SNL A;  5I2L A;  2JNF A;  3WHT B;  5I2Q A;  3NSL A;  1IQ5 A;  2LLU A;  3WXA A;  5KU1 A;  1NCZ A;  5CPV A;  3SG2 A;  4OVN F;  4AQJ A;  1JC2 A;  1F8H A;  1KSO A;  1MHO A;  1W7I B;  2BBN A;  3EVR A;  1J1D A;  3DF0 A;  1CM1 A;  2KNE A;  2L2E A;  1SR6 C;  2M9G A;  4MEW A;  2LP3 A;  1S6J A;  4DUQ A;  2EHB A;  2JTT A;  1FI5 A;  3KF9 A;  1CLB A;  1XFZ O;  4A4B A;  2L5X B;  1AVS A;  1QIW A;  1KWO B;  2LMV A;  4PCW A;  4PHK A;  3ZNI A;  3SG7 A;  4JQ0 D;  3CLN A;  5CSN A;  4ORB B;  1XA5 A;  1K95 A;  4YBH B;  5HKW A;  1DJG A;  2KI6 D;  4E68 A;  2KBM A;  2JTZ A;  1NYA A;  2MRD A;  1YX7 A;  3EVU A;  3BQ3 A;  2MBX A;  3NSI A;  1PSB A;  1H4B A;  1ZAC A;  3VRP A;  2NCP A;  3NXA A;  3TDU A;  1DJX A;  1M31 A;  4ETO A;  2I2R E;  3QRX A;  2R2I A;  1ZFS A;  1XFW O;  1GGZ A;  4NDB A;  4PHM A;  3ZWH A;  4BY4 A;  1PAL A;  2ZRT A;  4PE7 A;  2I94 A;  3FWC A;  4MRX A;  4OR9 B;  2K8M B;  1QV1 A;  2PMY A;  2PVB A;  4Q04 A;  4QJ3 B;  2MAZ A;  2BCX A;  3PLF B;  2AUC A;  2KI4 C;  1KQM C;  1E8A A;  1TTX A;  4MLW A;  1TIZ A;  3A4U B;  2VRG A;  3ICB A;  3GK2 A;  1V1G A;  2HQ8 A;  3AKB A;  2MLF C;  1K96 A;  1AJ5 A;  2B1U A;  1AUI B;  4CPV A;  2FJU B;  1SL9 A;  1IJ5 A;  1NX2 A;  4I5J A;  1YVL A;  2LC5 A;  3VGO A;  1GQM A;  3CR4 X;  2A4J A;  1EG4 A;  3EVV A;  2D8N A;  1CTR A;  1WRK A;  2LUX A;  1IH0 A;  2ISD A;  3PN7 C;  1W7J B;  3BUW B;  5CSJ A;  4WQ3 A;  4GNK B;  1IGV A;  1NSH A;  1RTP 1;  3PSR A;  1B47 A;  1IQ3 A;  2K7D A;  4GUK A;  4GPL B;  3RLZ A;  5HKY A;  5K89 A;  4ORA B;  1KWO C;  2I18 A;  1J7R A;  1XFV O;  1M63 B;  3LL8 B;  1J1E A;  3JVT C;  1KSM A;  1JUO A;  1Y0V H;  2WND A;  1TNX A;  2JT0 A;  2LV7 A;  5TNC A;  1NPQ A;  4AQI A;  4I5L B;  2LCP A;  3WNX B;  3JTD B;  1BLQ A;  2K0J A;  1M39 A;  2MHH A;  4U8D A;  1F4Q A;  1TNW A;  2OPO A;  1REC A;  1OE9 B;  1GJY A;  3D0Y A;  1B7T Y;  1DJH A;  1RJV A;  1RRO A;  2LLT A;  1LXF C;  2L0P A;  1C7W A;  1S6I A;  2OTG B;  4GGF C;  2JXC A;  1WRZ A;  2AMI A;  1C7V A;  1BR4 B;  1XVJ A;  1SK6 D;  3DD4 A;  1QX5 B;  4PHJ A;  1KFX L;  1Y1X A;  1CFF A;  1KK8 C;  1NX1 A;  1YVH A;  3TUY B;  3WHU B;  1NX3 A;  1PVA A;  2CNP A;  1MXL C;  2BE4 A;  1F4O A;  1TNQ A;  4HRG A;  1PRW A;  2CBL A;  2JRF A;  1DF0 B;  2ZFD A;  5KSZ A;  1QLK A;  1QV0 A;  1S3P A;  1J7P A;  1K2H A;  1YTZ C;  1J7Q A;  2JT3 A;  2KFF A;  3I5F C;  3SIB A;  5B8I B;  1CFC A;  1FPW A;  4NDC A;  3K21 A;  3GK1 A;  1YUU A;  3TDI A;  1SMG A;  1A75 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...