3I5RA

Pi3k sh3 domain in complex with a peptide ligand
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
81
structure length
81
Chain Sequence
b'SAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGRKKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphatidylinositol 3-kinase regulatory subunit alpha
publication title Structural studies of the phosphatidylinositol 3-kinase (PI3K) SH3 domain in complex with a peptide ligand: role of the anchor residue in ligand binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 25
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3i5rA00
2KT1A 3I35A 1Z9QA 1X2QA 4LN2A 2DE0X 4ESRA 1W70A 2DX1A 4AFSC 4J9GA 5ECAA 2A36A 2CT3A 2LJ1A 1WXBA 3KFVA 2DL3A 2YSQA 4CC2A 2GNCA 3FJ5A 2RQUA 2DNUA 1X43A 2ROTA 1WA7A 2ECZA 1SSHA 4OMOA 1AWXA 2RQWA 4RTXA 3EG0A 1GCQA 1M3AA 4HVVA 4JJBA 1VYUA 1GBQA 1E6GA 1T0HA 1UFFA 2LMJA 4F16A 4GLMA 2M0YA 4OMNA 2D8HA 1AWWA 1SEMA 3RBBB 2CREA 1FYNA 2BZXA 4AFZC 1PHTA 1ZBJA 1CSKA 1PKTA 2PTKA 1U3OA 3QWYA 1Y57A 2JMCA 1X6GA 2CUBA 2RN8A 4F17A 4D8DA 1U06A 4OMMA 3U23A 4HVWA 2CT4A 1AZGB 1PRLC 4LUEA 1BK2A 4KRTA 2DYBA 4LNPA 2D0NA 3M0UA 4ORZA 2EYXA 2GTOA 1QWEA 2JMAA 2OI3A 2V1QA 2F2WA 4LUDA 2LCSA 4Y92A 5I11A 3I5SA 1M27C 2C0OA 1GRIA 2VWFA 2DBMA 1SHFA 2KXCA 4OMPA 2J6KA 2JM8A 3PVQA 1OPKA 2L3SA 2RMOA 1G2BA 1E6HA 1WX6A 2BTTA 2K6DA 4RTUA 1PWTA 1I1JA 2DRKA 4QT7A 1ZLMA 3R6NA 2L3PA 1AZEA 1GCQC 2KT8A 2F2VA 1S1NA 2J06A 1ZUUA 2FPDA 2EYZA 2K7AA 3A98A 3H0HA 1GL5A 2NWMA 2B86A 1AD5A 2AKLA 2CSIA 1ABQA 4Z88A 1OOTA 4RTWA 3NMZC 5FWCA 1B3QA 4JZ4A 4Z8AA 3EG2A 1MV3A 4CC3A 5FWBA 2DF6A 2DMOA 2JTEA 2X3WD 1A0NB 1M3BA 1JO8A 5IHNA 3C0CA 5IHIA 1Y0MA 1K0XA 2PZ1A 4HVUA 2W10A 3M0QA 4AFUC 2OJ2A 4Z89A 2P4RA 1QCFA 1AVZC 4AFQC 1OPLA 2A28A 2CDTA 4IIOA 1UGVA 1AEYA 1GFDA 4J9DA 3H0IA 2EGEA 3SEMA 2L0AA 1X6BA 1YNZA 4D8KA 3VS6A 5IXFA 4ZNXA 1MUZA 2D1XA 1ZSGA 1X2KA 1RLQC 1NYGA 1AWJA 2EGCA 3PE0A 3UF4A 2O2OA 4CC4B 2KGTA 1Z9ZA 1M8MA 3VRZA 1PRMC 4RTYA 2EQIA 1YN8A 4FSSA 1BU1A 1JXOA 2EYWA 1HSQA 3REAB 2DVJA 1UTIA 1NG2A 1TUCA 2HCKA 1X27A 2HDAA 1CKBA 1I07A 2CH4A 2K79A 1QWFA 2LQNA 4JJCA 2ENMA 4DEXA 2CSQA 2AKKA 3GBQA 5EC7A 2LP5A 1TUDA 2DLPA 3EHRA 2YUNA 1BBZA 2DRMA 2RQRA 3VS2A 1W1FA 2YUQA 1RUWA 3M0TA 1RLPC 1HJDA 2RQVA 1QKWA 1WI7A 1HD3A 4M4ZA 2JS2A 1JEGA 2KR3A 3THKA 1CKAA 1RI9A 2EKHA 4EIKA 1OEBA 4RTZA 2L3QA 4X1VA 4OMLA 2FG0A 2YUPA 2KRSA 4J9FA 1UHCA 1N5ZA 4JPBW 1UJYA 3EG1A 3QWXX 3ULRB 2ROLA 2BZYA 5FW9A 2A08A 2DL8A 1V1CA 3O5ZA 5GJVB 1U5SA 3EGUA 1W6XA 4WCIA 4GBQA 2K9GA 3VS4A 2LZ6B 3ZL7C 2EYYA 2J7IA 1K0SA 4A63B 3TSWA 1ABOA 2FRWA 3VS5A 3TVTA 3TSZA 2VVKA 1H3HA 1NEBA 1XOVA 3I5RA 2KNBB 2ED0A 2J6OA 1PNJA 4JZ3A 4RTTA 2C0TA 5I22A 2HBWA 2CUDA 1H92A 1K4US 4CC7A 2GBQA 2FPFA 2RQTA 2O88A 2J05A 1UUEA 3REBB 1E7OA 2W0ZA 3M0PA 4K11A 4JJDA 1ZUYA 4OMQA 2CH4W 1T3SA 2JS0A 4IIMA 1GBRA 2EBPA 2O9VA 2AZVA 2RNAA 2LQWA 2KRNA 3NGPA 1UG1A 2FPEA 1PKSA 2EGAA 1FMKA 1SRMA 2DL7A 1UDLA 2C0IA 2L2PA 3H41A 3I9QA 2PNIA 3EG3A 4HXJA 2I0NA 5GJWB 1WDXA 5HCKA 1JXMA 1TG0A 1KIKA 2DBKA 2H8HA 1NM7A 1ARKA 2KXDA 2G6FX 2HEQA 1VYTA 2MOXA 3VS1A 1WFWA 2XMFA 2SRCA 1NYFA 4AG2C 1YCSB 4F14A 4R0KA 1YWOA 2NUZA 3H0FA 2YDLA 2QDLA 2GQIA 3PVLA 1VA7A 2LJ3A 2YUOA 4J9HA 1MV0B 2RPNA 3VS3A 4E6RA 5IHKA 2EVRA 1WXTA 4J9EA 1ZUKA 1BB9A 2E5KA 1UECA 1WYXA 2X3XD 3SHWA 2IIMA 3UA6A 2HSPA 1I0CA 3CQTA 2FRYA 4RUGA 1K1ZA 5L23A 2YT6A 2JW4A 1NEGA 1T0JA 3RNJA 3NPFA 5IH2A 1T3LA 1YP5A 1SHGA 1WXUA 2FO0A 1NLPC 2GGRA 2OAWA 2DM1A 2KROA 2D8JA 4RTVA 2KE9A 3M0RA 1VYVA 2K3BA 1GCPA 2KYMA 1B07A 1X69A 1UE9A 2ABLA 1AOJA 2MCNA 2M51A 4J9CA 1AWOA 1JQQA 5IXBA 3NHNA 1SPKA 2KYBA 1UJ0A 4HCKA 2JM9A 2DILA 3JV3A 4DEYA 4LE9A 1IO6A 2EW3A 1QLYA 2SEMA 3UA7A 2DJQA 3VS7A 2BZ8A 1M3CA 2AZSA 1G83A 2ESWA 1KSWA 2EPDA 3EHQA 3VS0A 4AG1C 3M0SA 2DL5A 2JT4A 2KRMA 2FEIA 2KBTA 1J3TA 1QKXA 1H8KA 2KEAA 4J9BA 2F2XA 1EFNA 2LX7A 1ZX6A 2ED1A 3IQLA 1K76A 2AK5A 2DL4A 2JXBA 4J9IA 1GFCA 2V1RA 2J6FA 2O31A 1KJWA 1WIEA 2A37A 1KFZA 1LCKA 1JU5C 3LH5A 2MIOA 2LJ0A 3UATA 2DA9A 1UHFA 1M30A 1WLPB 1OV3A 1K9AA 2GTJA 2K2MA 2LNHB 2O9SA 1YWPA 3VRYA 1NLOC 2RF0A 1SRLA 2VKNA
chains in the Genus database with same CATH superfamily
2KT1A 1Q7YR 2EQJA 4FYVB 3I35A 1Z9QA 2R5MA 4LN2A 2DE0X 4ESRA 3GLXA 3TCJA 1YJ9A 3RMSA 1YBYA 1ZSZC 3M4GA 2CT3A 2LJ1A 3CC4T 3KFVA 3EFRA 1M1KR 2LX9A 2RJFA 2XU8A 4M75C 4CC2A 3FJ5A 2RQUA 5A2QE 3OSVA 2DNUA 2VGNA 4GLKA 2CP3A 2X4XA 2RHIA 1SSHA 2L5QA 3S3OA 2QG9B 1VQ8A 5FLXE 3EG0A 4E7JA 1HYOA 1GBQA 3CCEA 4XAXB 3RBBB 2LT4A 2QXFA 1H3ZA 4YTLA 2JUFA 1PKTA 2O4XB 3EGXB 1U3OA 2LQ8A 1VQ7Q 1VQKA 1IHWA 1X01A 1X6GA 1WJRA 3CEYA 4D8DA 5I2SA 3CCLA 2YRVA 4KUDK 5A0GA 4HVWA 5CQYA 1Q82U 1AZGB 1PRLC 3L2ZA 3QJ6A 1NJIC 4KRTA 1IB8A 3L2UA 3M0UA 5GAMf 4M77D 1FMWA 3FLGA 2GTOA 2JMAA 2V1QA 2BUDA 2KQWA 3GOXA 4WTOB 1M27C 3N5BB 2Y4XA 1S72A 1FMVA 1SHFA 2AHJB 5CKFA 1YHQT 2JM8A 1K73U 1E6HA 5DY9A 3A8MB 1I1JA 3META 4M77F 3UT1A 3E1SA 2M0OA 5DLOA 3QZ5B 5GANj 2F1LA 1AZEA 3FDRA 2F2VA 4FL6A 5GAN5 2J06A 1MHNA 5LJ3g 2FPDA 2ZZDA 1QVGP 4A4EA 3G6EQ 4EMHA 4JRQA 1ABQA 5KYWA 3LGFA 4Z88A 1YJWA 4FT2A 4FYWB 2HAXA 3HSBA 4Z8AA 1NBEB 1KC8U 1WHMA 1JO8A 4M77E 1Y0MA 2CP7A 3JCMc 3OYEA 2PZ1A 1UGPB 2OTJT 4AFUC 3JCMf 3CCJQ 2QA4A 1BCOA 5KYXB 2XDPA 2NUPA 3FC3A 5GAOp 5CR2A 3OMCA 4KUIA 1AEYA 3PTAA 3H0IA 2EGEA 3SEMA 3PT9A 1X6BA 2VB6A 3CCET 1Q7YU 3RUXA 2EKOA 2PVOB 3RKYA 1X2KA 2VYTA 4PLIA 4NL3A 3OYGA 1M2OA 3CC2Q 3PE0A 2O2OA 1VQKT 5CVIA 4DQ2A 8ATCB 1PD0A 1KK7A 3VRZA 1PRMC 2EQIA 3CCLT 4C92A 4LDWA 4M7AD 1M1KU 3JCMQ 1IREB 5GAOq 1PM3A 4IUUA 4KH0B 4PJOB 3OB9A 3VU3C 2D6FA 2E65A 2HCKA 1X27A 2HDAA 5GMKh 4JJCA 1KQ1A 2LQNA 4DEXA 2CSQA 3CPFA 3GBQA 3CC7A 5EC7A 2LP5A 3CCMQ 3JCMJ 2DJZA 4C0FA 1WHLA 5J26A 1BBZA 2DRMA 4M7AF 3E2UA 1VQ4Q 2RI3A 4DOWA 1RLPC 3CCRT 5LJ5e 4XTYA 1OU8A 2JS2A 3S3MA 2LC4A 1RI9A 2QEXA 3OW2A 2XIDA 3X26B 1OEBA 5GAOm 1WQ7A 2L3QA 2KRSA 4J9FA 1UJYA 2ZPBB 3SWNC 1SSFA 4C8QD 2A08A 2DL8A 1Y96B 4LDYA 2A3LA 3J81E 2EWNA 3BY7A 3EGUA 1YJWT 4WCIA 2ATCB 4LD9K 1VQNQ 1SF9A 1M2VB 5GAOn 2EYYA 5LJ3e 2EIFA 2J7IA 2EAYA 2ZPHB 3TVTA 2VVKA 4R56A 1H3HA 1XOVA 4C8QF 2PQWA 3I55A 3GP8A 2ED0A 1VQ5A 3QG1A 4RTTA 1YIJA 4ELYC 2CUDA 1Q82C 1RAHB 2RHZA 2GBQA 2J05A 3EG9A 1UUEA 4M7DA 1KQSA 3VUZA 5GMKi 4LDXA 2LNVA 3M0PA 3MJXA 4K11A 1AT1B 4JJDA 2CH4W 1YI2T 2JS0A 2EBPA 2RNAA 2LQWA 2KRNA 2FPEA 4XU3A 3OYJA 1K73C 2R5AA 3JCMb 4C8QE 2L2PA 2EYQA 4XU0A 3EG3A 1C6VX 5GJWB 2RM4A 3LW5E 3GIBA 1M9SA 5HY6A 1KIKA 3AT1B 4RKUE 3I56T 2Z0WA 4MMKA 1MMNA 1VQMA 3AHUA 1WFWA 2DO3A 2SRCA 1NYFA 3OYDA 4J7IA 1Q95G 4R0KA 1YWOA 3CPWA 2K5IA 4OMFB 3PVLA 3JCMW 2QEXT 1VA7A 3CD6T 2YUOA 1KC8C 1MV0B 2L8DA 4JJNK 3OBWA 3R6OA 3UA6A 2HSPA 4A4KA 2EJGA 5L23A 4LDUA 3V8KA 5C6SA 1UB4A 1VQLQ 1X75C 2RB6A 1WQWA 1MMGA 1N8RC 1YJNQ 3EH2A 4OP0A 1Q7YC 5GAN6 2QDYB 4F7UA 5GAN3 1VQ6Q 2GF7A 3CMEQ 2FO0A 2OAWA 3A8GB 3I55T 3CCQQ 3LYIA 1VQ5T 4L59A 1W2BS 4DBHA 1RAFB 1G8XA 4M75F 1M1KC 2B8AA 1X69A 3Q1JA 5KYWB 5GANf 2DFUA 3OBYA 3HRSA 5KCOA 2KMTA 3TEEA 4HCCA 4FSXA 4FT4A 3SD4A 2COWA 1BI2A 1VIFA 3CMAT 2Y4YA 1QVFA 4LE9A 4BDYA 5FU7C 1QLYA 1C1AA 1NZ9A 3JB9G 1M3CA 2AZSA 1VQPT 4R55A 2NUPB 3LLRA 2JT4A 2CYZB 4IUVA 4BY6B 1SG5A 3CXCP 4J9BA 1KG1A 2F2XA 1EFNA 2HD0A 3IQLA 2CZ6B 3JCMV 2AK5A 2DIQA 1YITA 4XU2A 3BDUA 4P5NA 1IRXA 2J6FA 3OS5A 2CZ7B 1VQMT 2X35A 4C92B 2LT1A 3JSCA 2YWWA 5IAYA 3UATA 2ZAEA 1M30A 5A0DA 2GTJA 4FW1A 1G3TA 2VXEA 5CK9A 1SKUB 3OYMA 2FB7A 3MPUB 3BDLA 4M78A 1HXDA 1X2QA 2DXCA 4JS5A 4HCZA 2DX1A 5LJ5j 2QTXA 3RKWA 3ZBDA 4J9GA 1WXBA 3ZEHA 1BI0A 4QVDA 4N0AA 2L89A 1TU0B 5CKBA 2E1HA 3SB2A 2XG8D 3CCVQ 1GCQA 4EPCA 3MEVA 1C0MA 1GXIE 1VQ9Q 1T0HA 1UFFA 4GLMA 2M0YA 2E12A 3L2VA 3DLMA 2D8HA 3NTHA 1SEMA 1FYNA 2BZXA 4VUBA 4AFZC 1ZBJA 3MEUA 5LJ3j 4XTWA 2PTKA 3QWYA 2PVDB 2CUBA 1Q81R 4MDWA 5GAN7 5GAMh 2ZGWA 4LUEA 4QW2A 1WHKA 4ORZA 4FCYA 3RR6A 2LCSA 4Y92A 3I5SA 2QYZA 4HA8A 4BY6C 3UWNA 2D9TA 3EG9B 3MEWA 1M5Q1 4M7DB 1RACB 4ANJA 1YITT 1OPKA 2RMOA 2MYSA 2BTTA 2K6DA 4J6YA 3R6NA 4DBQA 4C92C 3L2RA 2L3PA 1D0YA 2DAQA 3TREA 1Y71A 1MNDA 1EX4A 1ZUUA 2EYZA 3JRZA 4C92G 1VQ7A 4QQDA 2LRQA 2MI6A 4AT1B 5FWCA 4RTWA 3NMZC 2ZPGB 2OTLQ 4NL2A 1OQKA 3VJPA 3CCUQ 3M0QA 4IUTA 1NE8A 3M56A 4Z89A 2P4RA 2G3RA 2A28A 3EFOA 4Q5WA 1WJSA 3SDZA 1M90R 3ER0A 4IIOA 1UGVA 4J9DA 4OB1B 3CC4Q 5KYUA 3OS0A 5IXFA 1ZSGA 2KDSA 1Q86R 2VV5A 1JJ2A 1F1BB 4ZGDB 3L1AA 1Z9ZA 3BE3A 3CCST 4RTYA 4FSSA 5I2MA 3G6EA 1JXOA 4HT8A 1WGSA 3ME9A 3MO8A 3REAB 4C5GA 4F7UB 4FW2A 1NG2A 1TUCA 3QBYA 2WSFE 1TTHB 2CH4A 1QWFA 4X9CA 2AKKA 3FJPA 4J6WA 1TUDA 4M7DC 2DLPA 3EHRA 3CCJA 4QVCA 5CAIA 3VS2A 1W1FA 4E7IA 1U1TA 2IVWA 2YUQA 3M0TA 4M7DG 3M4YA 2GFAA 3LWHA 4JRIA 2M02A 1QKWA 1HK9A 1WI7A 4JS4A 5LJ5g 2DYIA 3OW2P 3THKA 4JUVA 4EIKA 3FB9A 1RAGB 2RK1A 3CC2A 4M7AA 4BD3A 4OMLA 1XQHA 4JPBW 3ULRB 2DK3A 3QWXX 2ROLA 4CI0C 2BZYA 5FW9A 5J39A 5GJVB 1BIAA 2DZCA 5FU6B 1I5OB 4XTUA 4GBQA 1XTDA 1QMCA 4PJLA 4PFOA 2LZ6B 4EMKC 3ZL7C 3HHTB 1BCMA 4ZN1A 4C5EA 2P84A 4PJOE 2FZKB 1K0SA 4A63B 3TSWA 1ABOA 2DEUA 3VS5A 3C94A 4PJMA 3G4ST 3CCMA 3INZA 5GAN4 3CBMA 2RO0A 3HKSA 2KNBB 2GCXA 2QQBA 1PNJA 3RERA 3EAEA 2C0TA 5I22A 2HBWA 2RJDA 5D7UA 5HK3A 1VQ4A 1H92A 1OX8A 3TQ7P 1KQSP 2DTIA 1YJ9T 3L2WA 4M78B 3LWIA 1E7OA 2W0ZA 2NLUA 4ZN3A 2OTJQ 4C5HA 3JB9D 1ZUYA 1VIEA 2E10A 3JB9J 1VQ8T 2AZVA 1O75A 1SRMA 1I81A 3OSSC 1OZ2A 4MZPA 1N8RU 3NTIA 4ZTFA 1VQNA 1VQKQ 3S6WA 3I9QA 2M1HA 3A1PA 3JB9F 1M90U 4F7UG 5FROA 4HXJA 3CCLQ 1TG0A 1I8FA 3KUFA 2JVVA 2H8HA 2QQSA 2MK5A 4E7ZA 3OMGA 1QVGS 5KE2A 9ATCB 2G6FX 2MOXA 3CCJT 1V76A 1YCSB 3CPWP 2NUZA 4EMGA 4KT0E 5LJ3f 2ZPFB 3VS3A 4E6RA 5IHKA 1S72T 3JB9H 1ZUKA 3CCRQ 2E5KA 1UECA 1WYXA 2PUOB 2X3XD 1I0CA 2FRYA 1FXXA 2DTHA 5GMKl 4QKUA 2JW4A 3RNJA 3JCMe 5IH2A 1T3LA 2MMPA 3QJYA 2NYSA 2RK2A 3CCMT 4RCBA 5KYYA 2P0KA 4XU1A 1ZA1B 1NPPA 4RTVA 5GANh 1VYVA 4O5VA 4ZGEB 4V2SA 2ABLA 3VKIA 1AOJA 2E6NA 2F69A 2MCNA 4KGXB 1AWOA 2XDDA 1JQQA 2XD0A 3DB4A 1OULA 4PLLA 4PKCC 4M78G 4HT9A 4N0AC 1N9RA 2DILA 2M9UA 1ZSZA 1QVFP 1KHCA 3OYAA 4HCBA 2E6ZA 2WSCE 3ZFJA 1VQOA 2EW3A 4B9XA 2QA4T 2CS7A 3UA7A 4M75A 1U1SA 3VS7A 1JRIA 2EPDA 2HQXA 4N4HA 3EFOB 4AG1C 3M0SA 3CBOA 1OU9A 2DL5A 7AT1B 3OYHA 2IG0A 1YI2Q 1Q81C 1H8KA 2KEAA 2QGGA 5KYUB 1VQLA 2MF2A 2LX7A 1QCOA 4RMOA 4OGCA 5CCAA 1TH7A 2FZGB 4NOYA 1QP2A 2JXBA 2KSSA 1GFCA 2FYKA 2QASA 4J9IA 1VQ6A 1G5VA 2QI2A 3CMEA 2V1RA 3CCQA 4C92D 2LTOA 2F5KA 3EGDA 1KJWA 1WIEA 4KULA 5HK0A 1KFZA 3URGA 4PJOC 1D0XA 3PMIA 3LH5A 5GAN2 1IGQA 1K8AR 2PVGB 5HKCA 3I56Q 2K2MA 2O9SA 3CC7T 4Z02A 4PJOG 3VRYA 2VKNA 2E3HA 2QTVA 3P8DA 1UGQB 4C92F 2NUTA 3QXEB 2A36A 3CD6Q 4HKEA 8AT1B 2K5FA 2CP5A 1IGUA 3HP9A 1X43A 2ROTA 1WA7A 2LDMA 1AWXA 2DXUA 2RQWA 4RTXA 1XJWB 1M3AA 4HVVA 4JJBA 4M7AB 2LMJA 4F16A 3OQ5A 1AWWA 2CREA 5D6XA 2K57A 1TS9A 1P92A 4FM4B 4C92E 2D0QB 3L2QA 2XK0A 4J83A 3I55Q 1M90C 3X24B 2CT4A 1VQOT 5CQXA 1ZBXA 4LNPA 2D0NA 2JZ2A 2MWOA 1YIJT 1QWEA 3OY9A 2KAFA 2OI3A 2F2WA 4LUDA 2DETA 5GAMd 4MDXA 4PFZA 5I11A 5KYNA 2QAZA 4RCCA 4M7DD 4JRKA 2P0QA 2C0OA 2HBPA 2X51A 1GRIA 2VWFA 3CMAQ 2XICA 1VQLT 2DBMA 5KCHA 2BE9B 3H9NA 4OMPA 2J6KA 3CCVA 3PVQA 2HMAA 2L3SA 4PJJA 1VQPQ 1WX6A 1VQ6T 1M1GA 4RTUA 2EQMA 3CCQT 4J6XA 1VQ9A 3NTKA 2RJCA 4OVAA 4M7DF 5GMKe 2HQHA 1UGSB 3QSUA 2K7AA 5C0MA 3QYHB 2K4YA 2NWMA 1AD5A 2CP2A 2AKLA 2CSIA 4CRIA 2X9HA 1BIBA 4LDVA 1OOTA 1KD1R 4OB0B 1B3QA 4PL6A 4E7KA 1LJOA 4CC3A 4E7HA 2DF6A 2DMOA 1V29B 2COZA 1A0NB 2RHYA 3C12A 3LH0A 5IHIA 5CKDA 3LX7A 2W10A 1R0BG 1AVZC 2YRDA 1AHJB 4M7DE 3E19A 4C0DB 2CDTA 1RL2A 3JCMd 2V26A 1GFDA 1YNZA 3VS6A 1MUZA 2D1XA 4M7AG 3SWNA 1RLQC 1NYGA 1EZZB 5D6WA 4CC4B 1JJ2P 2KGTA 3FIFA 6AT1B 5KH6A 1BKBA 1FWZA 1YN8A 3CXCS 5GAOr 1W2BA 2EYWA 2KI7A 1HSQA 2RI5A 2X4WA 2DVJA 2DXBA 4A4GA 3G71Q 5KYYB 1CKBA 2OTLA 3QDRB 1B34A 4BI4A 1I5LA 3SFMA 1RADB 4MZMA 2YUNA 3CCUA 3OS1A 4F7UF 2CP0A 1RUWA 2JJ9A 1D09B 4M4ZA 1ZSZB 3CC4A 3QPHA 1ACMB 2KR3A 2YLCA 3M54A 1CKAA 4M75B 1UEBA 3X25B 3WVEB 4OF1A 2LQKA 4RTZA 3FRNA 3FEOA 3JB9I 1JJ2S 1N5ZA 3H8ZA 2RHXA 1V1CA 3OYFA 3RDVA 2LCCA 3JCMP 2MWPA 3S3NA 1QW1A 4RG8A 1QCNA 4F7UE 3EGDB 2FRWA 5J3BA 1OYXA 4PJNA 3TSZA 3HL8A 4FU6A 2EQUA 1NEBA 3I5RA 1WZOA 2DTOA 4M77A 4C0DC 4A4HA 3CBPA 3DB3A 1PG5B 4FYXB 1Y7XA 4CC7A 4KH1B 2FPFA 2RQTA 3PNWC 2OX7A 1FX7A 5IN1A 2XHCA 3QZ9B 2QQ9A 1WHJA 2NUTB 2DZ9A 3V7RA 2CGHA 4OMQA 1KD1U 2GFUA 1KC8R 4IIMA 1IXDA 3WVDB 1G3YA 2O9VA 4BE2A 5LJ5h 5GAMg 2E64A 3NGPA 1UG1A 2EGAA 3M5AA 2OAUA 3V8LA 4L5GA 2WSEE 3CCSQ 2I0NA 1LVKA 1JB0E 4B6MA 3A5ZB 4NS5A 2DBKA 2YLBA 2EJ9A 3CCUT 4ZGJB 3PIPA 2X4YA 1ARKA 4JLGA 3VS1A 2E41A 4PJOD 2DXTA 3GPLA 1ZA2B 4C5IA 5LJ3h 4ZTJA 4F14A 3H0FA 3V7SA 2YDLA 4D6WA 1G3SA 2QDLA 1QVPA 2OTJA 3ASKA 4M78E 4J9HA 1DJ7B 2VC8A 2ZCFB 2RPNA 2Y90A 4M75G 3MP1A 1WXTA 4N4GA 3M58A 4PJOF 1TWBA 4IUPA 1QQJA 4J7FA 4RG2A 2JOYA 2IPOB 3PIOA 3CQTA 4FYYB 2JTFA 4RUGA 2HL3A 2KVQG 1Q81U 4TVRA 1K8AC 3JCMX 3OYIA 1TSFA 5GMKj 1NEGA 3OYCA 1MGQA 5CO7A 1YHQQ 3JCMg 2H3JA 1WXUA 1VQ7T 4QQGA 4IKFA 4GY5A 2DM1A 4OB2B 2KROA 2QQAA 2QGFB 4X34A 2D8JA 2E70A 3M0RA 4XTXA 2ZPEB 1B07A 1D0ZA 2M51A 2K3YA 3G4SQ 3QYGB 5IXBA 1SPKA 2KYBA 4ATOA 4HCKA 2JM9A 4PFPA 5GANd 2DEQA 5L8RE 4DEYA 3A8LB 1IO6A 3CCRA 4QQ6A 2LCLA 3RKXA 1YJ9Q 2DJQA 3PMTA 1LNXA 2ESWA 4C0GA 3VS0A 5GAN8 4XTVA 2KRMA 2AIRB 1N27A 2KBTA 3OW2S 1VQ8Q 4KGVB 4C8QA 4E47A 3H6ZA 1M1FA 1ZX6A 3G1JA 2FL7A 3SWNB 5GAMe 3NFCA 4LD6A 1MMAA 3G6ET 2RJEA 3CCEQ 2PUKB 2HKQB 2A37A 3X28B 1LCKA 3GNGA 1JU5C 5LJ5f 2MIOA 5GAOl 1OI1A 2LJ0A 4Y91A 2DA9A 1WLPB 1OV3A 2LNHB 2K5LA 2F5TX 3MCAB 1NLOC 2V8JA 1SRLA 3VYGA 1B7TA 2KY9A 1B34B 2K3XA 1W70A 1PD1A 1Q86U 4KBMB 1PSFA 4AFSC 5ECAA 1LPLA 1R0CB 2DL3A 2JN0A 2YSQA 2GNCA 1KQSS 1YI2A 1S72Q 1KQ2A 2EQKA 2ECZA 3CC2T 4OMOA 1KD1C 1O9SA 1VYUA 3V7CA 1E6GA 4X9DA 5FU6C 4OMNA 2K2VA 1PC0A 3MP6A 1PHTA 1K9MR 1CSKA 4II1A 1RAIB 4B9WA 2EFIA 3OYKA 1Y57A 2JMCA 2VASA 4N4IA 2A0FB 2RN8A 3DLLA 4F17A 3GF5A 2LVMA 3I56A 1U06A 1MNEA 4OMMA 3U23A 4DBRA 1BI3A 4IURA 1YJWQ 1BK2A 2DYBA 2EYXA 4XK8E 4BB7A 1VQ4T 4M77B 4M78C 2RHUA 3CD6A 3QO3A 1D3BA 3CPWS 2R58A 3RMQA 3RESA 3P8BB 2KXCA 3BW1A 2BKDN 2QA4Q 4ELZC 1D1AA 3HFNA 1G2BA 4LXCA 1IHVA 5EG2A 1PWTA 3HRUA 2DRKA 4QT7A 4WF2A 1ZLMA 2CKKA 4M7AE 2HZYA 1GCQC 2KT8A 1S1NA 4DA4A 4AMCA 5AYFA 1VQNT 3MEAA 3BFMA 2HSEB 1QVGA 3A98A 1YJNA 2GQVA 3M55A 3H0HA 1GL5A 3VUBA 2B86A 2DIGA 4BUGA 3HRTA 3C95A 4DOVA 4E7SA 1M8VA 4J5YA 2RA2A 2YXYA 2XKOC 3KXTA 2HL5C 4JZ4A 3EG2A 1MV3A 1VOMA 5FWBA 2JTEA 3CC7Q 2X3WD 5GMKm 4J8OA 1M3BA 5IHNA 4F04B 3C0CA 3OYLA 5AT1B 1K0XA 4HVUA 3CMAA 1YCYA 2OJ2A 1EIFA 1QCFA 4AFQC 1OPLA 5FU7B 2MAMA 2L3RA 1R77A 1VQPA 2VXFA 1QVFS 1WHHA 2L0AA 3HPWA 1NJIR 2QQRA 1TUGB 4D8KA 2QEXQ 4ZNXA 2FHDA 5GANg 1PCXA 2YHTA 2EGCA 1AWJA 5FRMA 1H641 3UF4A 1TXQA 1ZHIA 4QVZA 2RI2A 1M8MA 5DM7R 2I2LA 2WACA 1U8RA 4EMKA 1W2BP 1BU1A 4XTZA 2VUBA 4E2FB 1RAEB 2JNGA 4MZTA 2FZCB 2PU9B 1UTIA 4DBFA 1QP3A 4M77C 3PFSA 1ZQ1A 1I07A 2K79A 2ENMA 1D1CA 2FVUA 2E3IA 2DD4A 4A54A 2HQEA 2CZ1B 4M77G 2HNIA 4L6V5 1VQOQ 3M57A 1Y07A 1VQ5Q 5CKHA 1K9MU 2RQRA 3V8JA 1YIJQ 3OYBA 4C0ZA 3RIRA 1WJQA 3PGGA 1MMDA 1HJDA 2RQVA 3QHSA 1HD3A 4M75D 3HTRA 1WNLA 1JEGA 4BDZA 2XI9A 3QUIA 1Q86C 2EKHA 2O01E 2ZPIB 4X1VA 2FG0A 2YUPA 1UHCA 1YJNT 2M16A 3EG1A 5GAMj 3M59A 3O5ZA 5KE3A 3TU4K 1U5SA 2O4XA 3EGXA 4C8QB 3CMET 4OB3B 1W6XA 2K9GA 1RI0A 3VS4A 1X6OA 2QK0A 3X20B 2JTMA 3G71A 2VGMA 4JDSA 2R57A 4BI8B 2HKNA 4BE1A 5LL6S 3J7AF 3QKJA 3T9NA 3A8HB 3E9FA 3D7SB 1VQMQ 3EFSA 2J6OA 4JZ3A 3GNFB 3MP8A 5IT9E 4BI3A 1K4US 2O88A 2X4JA 1WHGA 3REBB 3F70A 2DKGA 4A53A 3OYYA 1N9SA 2P4TA 4M75E 1T3SA 2V8KA 1GBRA 2BE7D 2A7YA 1YFNA 4JLIA 1JBMA 3QIIA 4E7LA 1I4K1 2H3EB 4M7AC 1K8AU 1IZ6A 1PKSA 1FMKA 4PK4A 1G3WA 2DL7A 5CKEA 5GANe 1UDLA 2C0IA 1M4ZA 3H41A 1BI1A 3G7ZA 5D6YA 2PNIA 1LOJA 5LJ5d 1WDXA 5HCKA 1JXMA 5A0LA 4PNOA 3E9GA 1NJIU 3OA6A 1NM7A 4A4FA 1OX9A 1TOVA 2KXDA 1RABB 2HEQA 3EH1A 1VYTA 2XMFA 2P0PA 4AG2C 5CIUA 2C06A 5DLQE 5KYXA 2GQIA 2V8IA 2LJ3A 2EJFA 3OYNA 2BIVA 2EVRA 4J9EA 3UPUA 1N6AA 1BB9A 5LJ3d 1D3BB 3CCVT 3J80E 4C8QC 3SHWA 3P8HA 2IIMA 3JAME 1K1ZA 4MMLA 4OGEA 2E5QA 1VQ9T 5FRNA 1Q82R 3KBGA 2DPPB 4C8QG 2XDBA 2DVEA 2YT6A 3G71T 1T0JA 1VUBA 3NPFA 4BE0A 3CCSA 1YITQ 1YP5A 1SHGA 3MKDA 4PJOA 1NLPC 2GGRA 2AT1B 2DERA 4UC4A 2KE9A 2K3BA 2RD1A 3LGLA 3M53A 1GCPA 2KYMA 4Y28E 1UE9A 1RAAB 1WPYA 4IUQA 3QDFA 1K73R 3MHXA 1OZ3A 1KHIA 4J9CA 3OS2A 3M9QA 4BACA 3UDCA 3NHNA 1UJ0A 1PSEA 2RH2A 3JV3A 1W4SA 2SEMA 2BZ8A 2MPXC 1G83A 4M78D 1KSWA 4O6JA 1K9MC 3EHQA 1XNIA 4KGZB 3C4SA 2YRCA 2FEIA 4XQ3A 3WXMB 1Y96A 1J3TA 1QKXA 3O8VA 3CXCA 3DKMA 2ED1A 3VV0A 4JRPA 1K76A 1R8OB 3A8OB 1YHQA 2DL4A 1NPRA 2COYA 5I21A 1M2VA 2CZ0B 1UGRB 2O31A 4M78F 4EDUA 4EMKB 4ME7A 2KK4A 3VYHB 4FIBA 2CP6A 3JCMh 1D1BA 3L42A 3HFOA 2OTLT 2DD5A 1UHFA 5M9OA 1BYMA 1K9AA 2E4HA 3G4SA 1YWPA 1N8RR 2RF0A
chains in the Genus database with same CATH topology
2KT1A 3I35A 1Z9QA 1X2QA 4LN2A 2DE0X 4ESRA 1W70A 2DX1A 4AFSC 4J9GA 5ECAA 2A36A 2CT3A 2LJ1A 1WXBA 3KFVA 2DL3A 2YSQA 4CC2A 2GNCA 3FJ5A 2RQUA 2DNUA 1X43A 2ROTA 1WA7A 2ECZA 1SSHA 4OMOA 1AWXA 2RQWA 4RTXA 3EG0A 1GCQA 1M3AA 4HVVA 4JJBA 1VYUA 1GBQA 1E6GA 1T0HA 1UFFA 2LMJA 4F16A 4GLMA 2M0YA 4OMNA 2D8HA 1AWWA 1SEMA 3RBBB 2CREA 1FYNA 2BZXA 4AFZC 1PHTA 1ZBJA 1CSKA 1PKTA 2PTKA 1U3OA 3QWYA 1Y57A 2JMCA 1X6GA 2CUBA 2RN8A 4F17A 4D8DA 1U06A 4OMMA 3U23A 4HVWA 2CT4A 1AZGB 1PRLC 4LUEA 1BK2A 4KRTA 2DYBA 4LNPA 2D0NA 3M0UA 4ORZA 2EYXA 2GTOA 1QWEA 2JMAA 2OI3A 2V1QA 2F2WA 4LUDA 2LCSA 4Y92A 5I11A 3I5SA 1M27C 2C0OA 1GRIA 2VWFA 2DBMA 1SHFA 2KXCA 4OMPA 2J6KA 2JM8A 3PVQA 1OPKA 2L3SA 2RMOA 1G2BA 1E6HA 1WX6A 2BTTA 2K6DA 4RTUA 1PWTA 1I1JA 2DRKA 4QT7A 1ZLMA 3R6NA 2L3PA 1AZEA 1GCQC 2KT8A 2F2VA 1S1NA 2J06A 1ZUUA 2FPDA 2EYZA 2K7AA 3A98A 3H0HA 1GL5A 2NWMA 2B86A 1AD5A 2AKLA 2CSIA 1ABQA 4Z88A 1OOTA 4RTWA 3NMZC 5FWCA 1B3QA 4JZ4A 4Z8AA 3EG2A 1MV3A 4CC3A 5FWBA 2DF6A 2DMOA 2JTEA 2X3WD 1A0NB 1M3BA 1JO8A 5IHNA 3C0CA 5IHIA 1Y0MA 1K0XA 2PZ1A 4HVUA 2W10A 3M0QA 4AFUC 2OJ2A 4Z89A 2P4RA 1QCFA 1AVZC 4AFQC 1OPLA 2A28A 2CDTA 4IIOA 1UGVA 1AEYA 1GFDA 4J9DA 3H0IA 2EGEA 3SEMA 2L0AA 1X6BA 1YNZA 4D8KA 3VS6A 5IXFA 4ZNXA 1MUZA 2D1XA 1ZSGA 1X2KA 1RLQC 1NYGA 1AWJA 2EGCA 3PE0A 3UF4A 2O2OA 4CC4B 2KGTA 1Z9ZA 1M8MA 3VRZA 1PRMC 4RTYA 2EQIA 1YN8A 4FSSA 1BU1A 1JXOA 2EYWA 1HSQA 3REAB 2DVJA 1UTIA 1NG2A 1TUCA 2HCKA 1X27A 2HDAA 1CKBA 1I07A 2CH4A 2K79A 1QWFA 2LQNA 4JJCA 2ENMA 4DEXA 2CSQA 2AKKA 3GBQA 5EC7A 2LP5A 1TUDA 2DLPA 3EHRA 2YUNA 1BBZA 2DRMA 2RQRA 3VS2A 1W1FA 2YUQA 1RUWA 3M0TA 1RLPC 1HJDA 2RQVA 1QKWA 1WI7A 1HD3A 4M4ZA 2JS2A 1JEGA 2KR3A 3THKA 1CKAA 1RI9A 2EKHA 4EIKA 1OEBA 4RTZA 2L3QA 4X1VA 4OMLA 2FG0A 2YUPA 2KRSA 4J9FA 1UHCA 1N5ZA 4JPBW 1UJYA 3EG1A 3QWXX 3ULRB 2ROLA 2BZYA 5FW9A 2A08A 2DL8A 1V1CA 3O5ZA 5GJVB 1U5SA 3EGUA 1W6XA 4WCIA 4GBQA 2K9GA 3VS4A 2LZ6B 3ZL7C 2EYYA 2J7IA 1K0SA 4A63B 3TSWA 1ABOA 2FRWA 3VS5A 3TVTA 3TSZA 2VVKA 1H3HA 1NEBA 1XOVA 3I5RA 2KNBB 2ED0A 2J6OA 1PNJA 4JZ3A 4RTTA 2C0TA 5I22A 2HBWA 2CUDA 1H92A 1K4US 4CC7A 2GBQA 2FPFA 2RQTA 2O88A 2J05A 1UUEA 3REBB 1E7OA 2W0ZA 3M0PA 4K11A 4JJDA 1ZUYA 4OMQA 2CH4W 1T3SA 2JS0A 4IIMA 1GBRA 2EBPA 2O9VA 2AZVA 2RNAA 2LQWA 2KRNA 3NGPA 1UG1A 2FPEA 1PKSA 2EGAA 1FMKA 1SRMA 2DL7A 1UDLA 2C0IA 2L2PA 3H41A 3I9QA 2PNIA 3EG3A 4HXJA 2I0NA 5GJWB 1WDXA 5HCKA 1JXMA 1TG0A 1KIKA 2DBKA 2H8HA 1NM7A 1ARKA 2KXDA 2G6FX 2HEQA 1VYTA 2MOXA 3VS1A 1WFWA 2XMFA 2SRCA 1NYFA 4AG2C 1YCSB 4F14A 4R0KA 1YWOA 2NUZA 3H0FA 2YDLA 2QDLA 2GQIA 3PVLA 1VA7A 2LJ3A 2YUOA 4J9HA 1MV0B 2RPNA 3VS3A 4E6RA 5IHKA 2EVRA 1WXTA 4J9EA 1ZUKA 1BB9A 2E5KA 1UECA 1WYXA 2X3XD 3SHWA 2IIMA 3UA6A 2HSPA 1I0CA 3CQTA 2FRYA 4RUGA 1K1ZA 5L23A 2YT6A 2JW4A 1NEGA 1T0JA 3RNJA 3NPFA 5IH2A 1T3LA 1YP5A 1SHGA 1WXUA 2FO0A 1NLPC 2GGRA 2OAWA 2DM1A 2KROA 2D8JA 4RTVA 2KE9A 3M0RA 1VYVA 2K3BA 1GCPA 2KYMA 1B07A 1X69A 1UE9A 2ABLA 1AOJA 2MCNA 2M51A 4J9CA 1AWOA 1JQQA 5IXBA 3NHNA 1SPKA 2KYBA 1UJ0A 4HCKA 2JM9A 2DILA 3JV3A 4DEYA 4LE9A 1IO6A 2EW3A 1QLYA 2SEMA 3UA7A 2DJQA 3VS7A 2BZ8A 1M3CA 2AZSA 1G83A 2ESWA 1KSWA 2EPDA 3EHQA 3VS0A 4AG1C 3M0SA 2DL5A 2JT4A 2KRMA 2FEIA 2KBTA 1J3TA 1QKXA 1H8KA 2KEAA 4J9BA 2F2XA 1EFNA 2LX7A 1ZX6A 2ED1A 3IQLA 1K76A 2AK5A 2DL4A 2JXBA 4J9IA 1GFCA 2V1RA 2J6FA 2O31A 1KJWA 1WIEA 2A37A 1KFZA 1LCKA 1JU5C 3LH5A 2MIOA 2LJ0A 3UATA 2DA9A 1UHFA 1M30A 1WLPB 1OV3A 1K9AA 2GTJA 2K2MA 2LNHB 2O9SA 1YWPA 3VRYA 1NLOC 2RF0A 1SRLA 2VKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KT1 A;  3I35 A;  1Z9Q A;  1X2Q A;  4LN2 A;  2DE0 X;  4ESR A;  1W70 A;  2DX1 A;  4AFS C;  4J9G A;  5ECA A;  2A36 A;  2CT3 A;  2LJ1 A;  1WXB A;  3KFV A;  2DL3 A;  2YSQ A;  4CC2 A;  2GNC A;  3FJ5 A;  2RQU A;  2DNU A;  1X43 A;  2ROT A;  1WA7 A;  2ECZ A;  1SSH A;  4OMO A;  1AWX A;  2RQW A;  4RTX A;  3EG0 A;  1GCQ A;  1M3A A;  4HVV A;  4JJB A;  1VYU A;  1GBQ A;  1E6G A;  1T0H A;  1UFF A;  2LMJ A;  4F16 A;  4GLM A;  2M0Y A;  4OMN A;  2D8H A;  1AWW A;  1SEM A;  3RBB B;  2CRE A;  1FYN A;  2BZX A;  4AFZ C;  1PHT A;  1ZBJ A;  1CSK A;  1PKT A;  2PTK A;  1U3O A;  3QWY A;  1Y57 A;  2JMC A;  1X6G A;  2CUB A;  2RN8 A;  4F17 A;  4D8D A;  1U06 A;  4OMM A;  3U23 A;  4HVW A;  2CT4 A;  1AZG B;  1PRL C;  4LUE A;  1BK2 A;  4KRT A;  2DYB A;  4LNP A;  2D0N A;  3M0U A;  4ORZ A;  2EYX A;  2GTO A;  1QWE A;  2JMA A;  2OI3 A;  2V1Q A;  2F2W A;  4LUD A;  2LCS A;  4Y92 A;  5I11 A;  3I5S A;  1M27 C;  2C0O A;  1GRI A;  2VWF A;  2DBM A;  1SHF A;  2KXC A;  4OMP A;  2J6K A;  2JM8 A;  3PVQ A;  1OPK A;  2L3S A;  2RMO A;  1G2B A;  1E6H A;  1WX6 A;  2BTT A;  2K6D A;  4RTU A;  1PWT A;  1I1J A;  2DRK A;  4QT7 A;  1ZLM A;  3R6N A;  2L3P A;  1AZE A;  1GCQ C;  2KT8 A;  2F2V A;  1S1N A;  2J06 A;  1ZUU A;  2FPD A;  2EYZ A;  2K7A A;  3A98 A;  3H0H A;  1GL5 A;  2NWM A;  2B86 A;  1AD5 A;  2AKL A;  2CSI A;  1ABQ A;  4Z88 A;  1OOT A;  4RTW A;  3NMZ C;  5FWC A;  1B3Q A;  4JZ4 A;  4Z8A A;  3EG2 A;  1MV3 A;  4CC3 A;  5FWB A;  2DF6 A;  2DMO A;  2JTE A;  2X3W D;  1A0N B;  1M3B A;  1JO8 A;  5IHN A;  3C0C A;  5IHI A;  1Y0M A;  1K0X A;  2PZ1 A;  4HVU A;  2W10 A;  3M0Q A;  4AFU C;  2OJ2 A;  4Z89 A;  2P4R A;  1QCF A;  1AVZ C;  4AFQ C;  1OPL A;  2A28 A;  2CDT A;  4IIO A;  1UGV A;  1AEY A;  1GFD A;  4J9D A;  3H0I A;  2EGE A;  3SEM A;  2L0A A;  1X6B A;  1YNZ A;  4D8K A;  3VS6 A;  5IXF A;  4ZNX A;  1MUZ A;  2D1X A;  1ZSG A;  1X2K A;  1RLQ C;  1NYG A;  1AWJ A;  2EGC A;  3PE0 A;  3UF4 A;  2O2O A;  4CC4 B;  2KGT A;  1Z9Z A;  1M8M A;  3VRZ A;  1PRM C;  4RTY A;  2EQI A;  1YN8 A;  4FSS A;  1BU1 A;  1JXO A;  2EYW A;  1HSQ A;  3REA B;  2DVJ A;  1UTI A;  1NG2 A;  1TUC A;  2HCK A;  1X27 A;  2HDA A;  1CKB A;  1I07 A;  2CH4 A;  2K79 A;  1QWF A;  2LQN A;  4JJC A;  2ENM A;  4DEX A;  2CSQ A;  2AKK A;  3GBQ A;  5EC7 A;  2LP5 A;  1TUD A;  2DLP A;  3EHR A;  2YUN A;  1BBZ A;  2DRM A;  2RQR A;  3VS2 A;  1W1F A;  2YUQ A;  1RUW A;  3M0T A;  1RLP C;  1HJD A;  2RQV A;  1QKW A;  1WI7 A;  1HD3 A;  4M4Z A;  2JS2 A;  1JEG A;  2KR3 A;  3THK A;  1CKA A;  1RI9 A;  2EKH A;  4EIK A;  1OEB A;  4RTZ A;  2L3Q A;  4X1V A;  4OML A;  2FG0 A;  2YUP A;  2KRS A;  4J9F A;  1UHC A;  1N5Z A;  4JPB W;  1UJY A;  3EG1 A;  3QWX X;  3ULR B;  2ROL A;  2BZY A;  5FW9 A;  2A08 A;  2DL8 A;  1V1C A;  3O5Z A;  5GJV B;  1U5S A;  3EGU A;  1W6X A;  4WCI A;  4GBQ A;  2K9G A;  3VS4 A;  2LZ6 B;  3ZL7 C;  2EYY A;  2J7I A;  1K0S A;  4A63 B;  3TSW A;  1ABO A;  2FRW A;  3VS5 A;  3TVT A;  3TSZ A;  2VVK A;  1H3H A;  1NEB A;  1XOV A;  3I5R A;  2KNB B;  2ED0 A;  2J6O A;  1PNJ A;  4JZ3 A;  4RTT A;  2C0T A;  5I22 A;  2HBW A;  2CUD A;  1H92 A;  1K4U S;  4CC7 A;  2GBQ A;  2FPF A;  2RQT A;  2O88 A;  2J05 A;  1UUE A;  3REB B;  1E7O A;  2W0Z A;  3M0P A;  4K11 A;  4JJD A;  1ZUY A;  4OMQ A;  2CH4 W;  1T3S A;  2JS0 A;  4IIM A;  1GBR A;  2EBP A;  2O9V A;  2AZV A;  2RNA A;  2LQW A;  2KRN A;  3NGP A;  1UG1 A;  2FPE A;  1PKS A;  2EGA A;  1FMK A;  1SRM A;  2DL7 A;  1UDL A;  2C0I A;  2L2P A;  3H41 A;  3I9Q A;  2PNI A;  3EG3 A;  4HXJ A;  2I0N A;  5GJW B;  1WDX A;  5HCK A;  1JXM A;  1TG0 A;  1KIK A;  2DBK A;  2H8H A;  1NM7 A;  1ARK A;  2KXD A;  2G6F X;  2HEQ A;  1VYT A;  2MOX A;  3VS1 A;  1WFW A;  2XMF A;  2SRC A;  1NYF A;  4AG2 C;  1YCS B;  4F14 A;  4R0K A;  1YWO A;  2NUZ A;  3H0F A;  2YDL A;  2QDL A;  2GQI A;  3PVL A;  1VA7 A;  2LJ3 A;  2YUO A;  4J9H A;  1MV0 B;  2RPN A;  3VS3 A;  4E6R A;  5IHK A;  2EVR A;  1WXT A;  4J9E A;  1ZUK A;  1BB9 A;  2E5K A;  1UEC A;  1WYX A;  2X3X D;  3SHW A;  2IIM A;  3UA6 A;  2HSP A;  1I0C A;  3CQT A;  2FRY A;  4RUG A;  1K1Z A;  5L23 A;  2YT6 A;  2JW4 A;  1NEG A;  1T0J A;  3RNJ A;  3NPF A;  5IH2 A;  1T3L A;  1YP5 A;  1SHG A;  1WXU A;  2FO0 A;  1NLP C;  2GGR A;  2OAW A;  2DM1 A;  2KRO A;  2D8J A;  4RTV A;  2KE9 A;  3M0R A;  1VYV A;  2K3B A;  1GCP A;  2KYM A;  1B07 A;  1X69 A;  1UE9 A;  2ABL A;  1AOJ A;  2MCN A;  2M51 A;  4J9C A;  1AWO A;  1JQQ A;  5IXB A;  3NHN A;  1SPK A;  2KYB A;  1UJ0 A;  4HCK A;  2JM9 A;  2DIL A;  3JV3 A;  4DEY A;  4LE9 A;  1IO6 A;  2EW3 A;  1QLY A;  2SEM A;  3UA7 A;  2DJQ A;  3VS7 A;  2BZ8 A;  1M3C A;  2AZS A;  1G83 A;  2ESW A;  1KSW A;  2EPD A;  3EHQ A;  3VS0 A;  4AG1 C;  3M0S A;  2DL5 A;  2JT4 A;  2KRM A;  2FEI A;  2KBT A;  1J3T A;  1QKX A;  1H8K A;  2KEA A;  4J9B A;  2F2X A;  1EFN A;  2LX7 A;  1ZX6 A;  2ED1 A;  3IQL A;  1K76 A;  2AK5 A;  2DL4 A;  2JXB A;  4J9I A;  1GFC A;  2V1R A;  2J6F A;  2O31 A;  1KJW A;  1WIE A;  2A37 A;  1KFZ A;  1LCK A;  1JU5 C;  3LH5 A;  2MIO A;  2LJ0 A;  3UAT A;  2DA9 A;  1UHF A;  1M30 A;  1WLP B;  1OV3 A;  1K9A A;  2GTJ A;  2K2M A;  2LNH B;  2O9S A;  1YWP A;  3VRY A;  1NLO C;  2RF0 A;  1SRL A;  2VKN A; 
#chains in the Genus database with same CATH topology
 2KT1 A;  1Q7Y R;  2EQJ A;  4FYV B;  3I35 A;  1Z9Q A;  2R5M A;  4LN2 A;  2DE0 X;  4ESR A;  3GLX A;  3TCJ A;  1YJ9 A;  3RMS A;  1YBY A;  1ZSZ C;  3M4G A;  2CT3 A;  2LJ1 A;  3CC4 T;  3KFV A;  3EFR A;  1M1K R;  2LX9 A;  2RJF A;  2XU8 A;  4M75 C;  4CC2 A;  3FJ5 A;  2RQU A;  5A2Q E;  3OSV A;  2DNU A;  2VGN A;  4GLK A;  2CP3 A;  2X4X A;  2RHI A;  1SSH A;  2L5Q A;  3S3O A;  2QG9 B;  1VQ8 A;  5FLX E;  3EG0 A;  4E7J A;  1HYO A;  1GBQ A;  3CCE A;  4XAX B;  3RBB B;  2LT4 A;  2QXF A;  1H3Z A;  4YTL A;  2JUF A;  1PKT A;  2O4X B;  3EGX B;  1U3O A;  2LQ8 A;  1VQ7 Q;  1VQK A;  1IHW A;  1X01 A;  1X6G A;  1WJR A;  3CEY A;  4D8D A;  5I2S A;  3CCL A;  2YRV A;  4KUD K;  5A0G A;  4HVW A;  5CQY A;  1Q82 U;  1AZG B;  1PRL C;  3L2Z A;  3QJ6 A;  1NJI C;  4KRT A;  1IB8 A;  3L2U A;  3M0U A;  5GAM f;  4M77 D;  1FMW A;  3FLG A;  2GTO A;  2JMA A;  2V1Q A;  2BUD A;  2KQW A;  3GOX A;  4WTO B;  1M27 C;  3N5B B;  2Y4X A;  1S72 A;  1FMV A;  1SHF A;  2AHJ B;  5CKF A;  1YHQ T;  2JM8 A;  1K73 U;  1E6H A;  5DY9 A;  3A8M B;  1I1J A;  3MET A;  4M77 F;  3UT1 A;  3E1S A;  2M0O A;  5DLO A;  3QZ5 B;  5GAN j;  2F1L A;  1AZE A;  3FDR A;  2F2V A;  4FL6 A;  5GAN 5;  2J06 A;  1MHN A;  5LJ3 g;  2FPD A;  2ZZD A;  1QVG P;  4A4E A;  3G6E Q;  4EMH A;  4JRQ A;  1ABQ A;  5KYW A;  3LGF A;  4Z88 A;  1YJW A;  4FT2 A;  4FYW B;  2HAX A;  3HSB A;  4Z8A A;  1NBE B;  1KC8 U;  1WHM A;  1JO8 A;  4M77 E;  1Y0M A;  2CP7 A;  3JCM c;  3OYE A;  2PZ1 A;  1UGP B;  2OTJ T;  4AFU C;  3JCM f;  3CCJ Q;  2QA4 A;  1BCO A;  5KYX B;  2XDP A;  2NUP A;  3FC3 A;  5GAO p;  5CR2 A;  3OMC A;  4KUI A;  1AEY A;  3PTA A;  3H0I A;  2EGE A;  3SEM A;  3PT9 A;  1X6B A;  2VB6 A;  3CCE T;  1Q7Y U;  3RUX A;  2EKO A;  2PVO B;  3RKY A;  1X2K A;  2VYT A;  4PLI A;  4NL3 A;  3OYG A;  1M2O A;  3CC2 Q;  3PE0 A;  2O2O A;  1VQK T;  5CVI A;  4DQ2 A;  8ATC B;  1PD0 A;  1KK7 A;  3VRZ A;  1PRM C;  2EQI A;  3CCL T;  4C92 A;  4LDW A;  4M7A D;  1M1K U;  3JCM Q;  1IRE B;  5GAO q;  1PM3 A;  4IUU A;  4KH0 B;  4PJO B;  3OB9 A;  3VU3 C;  2D6F A;  2E65 A;  2HCK A;  1X27 A;  2HDA A;  5GMK h;  4JJC A;  1KQ1 A;  2LQN A;  4DEX A;  2CSQ A;  3CPF A;  3GBQ A;  3CC7 A;  5EC7 A;  2LP5 A;  3CCM Q;  3JCM J;  2DJZ A;  4C0F A;  1WHL A;  5J26 A;  1BBZ A;  2DRM A;  4M7A F;  3E2U A;  1VQ4 Q;  2RI3 A;  4DOW A;  1RLP C;  3CCR T;  5LJ5 e;  4XTY A;  1OU8 A;  2JS2 A;  3S3M A;  2LC4 A;  1RI9 A;  2QEX A;  3OW2 A;  2XID A;  3X26 B;  1OEB A;  5GAO m;  1WQ7 A;  2L3Q A;  2KRS A;  4J9F A;  1UJY A;  2ZPB B;  3SWN C;  1SSF A;  4C8Q D;  2A08 A;  2DL8 A;  1Y96 B;  4LDY A;  2A3L A;  3J81 E;  2EWN A;  3BY7 A;  3EGU A;  1YJW T;  4WCI A;  2ATC B;  4LD9 K;  1VQN Q;  1SF9 A;  1M2V B;  5GAO n;  2EYY A;  5LJ3 e;  2EIF A;  2J7I A;  2EAY A;  2ZPH B;  3TVT A;  2VVK A;  4R56 A;  1H3H A;  1XOV A;  4C8Q F;  2PQW A;  3I55 A;  3GP8 A;  2ED0 A;  1VQ5 A;  3QG1 A;  4RTT A;  1YIJ A;  4ELY C;  2CUD A;  1Q82 C;  1RAH B;  2RHZ A;  2GBQ A;  2J05 A;  3EG9 A;  1UUE A;  4M7D A;  1KQS A;  3VUZ A;  5GMK i;  4LDX A;  2LNV A;  3M0P A;  3MJX A;  4K11 A;  1AT1 B;  4JJD A;  2CH4 W;  1YI2 T;  2JS0 A;  2EBP A;  2RNA A;  2LQW A;  2KRN A;  2FPE A;  4XU3 A;  3OYJ A;  1K73 C;  2R5A A;  3JCM b;  4C8Q E;  2L2P A;  2EYQ A;  4XU0 A;  3EG3 A;  1C6V X;  5GJW B;  2RM4 A;  3LW5 E;  3GIB A;  1M9S A;  5HY6 A;  1KIK A;  3AT1 B;  4RKU E;  3I56 T;  2Z0W A;  4MMK A;  1MMN A;  1VQM A;  3AHU A;  1WFW A;  2DO3 A;  2SRC A;  1NYF A;  3OYD A;  4J7I A;  1Q95 G;  4R0K A;  1YWO A;  3CPW A;  2K5I A;  4OMF B;  3PVL A;  3JCM W;  2QEX T;  1VA7 A;  3CD6 T;  2YUO A;  1KC8 C;  1MV0 B;  2L8D A;  4JJN K;  3OBW A;  3R6O A;  3UA6 A;  2HSP A;  4A4K A;  2EJG A;  5L23 A;  4LDU A;  3V8K A;  5C6S A;  1UB4 A;  1VQL Q;  1X75 C;  2RB6 A;  1WQW A;  1MMG A;  1N8R C;  1YJN Q;  3EH2 A;  4OP0 A;  1Q7Y C;  5GAN 6;  2QDY B;  4F7U A;  5GAN 3;  1VQ6 Q;  2GF7 A;  3CME Q;  2FO0 A;  2OAW A;  3A8G B;  3I55 T;  3CCQ Q;  3LYI A;  1VQ5 T;  4L59 A;  1W2B S;  4DBH A;  1RAF B;  1G8X A;  4M75 F;  1M1K C;  2B8A A;  1X69 A;  3Q1J A;  5KYW B;  5GAN f;  2DFU A;  3OBY A;  3HRS A;  5KCO A;  2KMT A;  3TEE A;  4HCC A;  4FSX A;  4FT4 A;  3SD4 A;  2COW A;  1BI2 A;  1VIF A;  3CMA T;  2Y4Y A;  1QVF A;  4LE9 A;  4BDY A;  5FU7 C;  1QLY A;  1C1A A;  1NZ9 A;  3JB9 G;  1M3C A;  2AZS A;  1VQP T;  4R55 A;  2NUP B;  3LLR A;  2JT4 A;  2CYZ B;  4IUV A;  4BY6 B;  1SG5 A;  3CXC P;  4J9B A;  1KG1 A;  2F2X A;  1EFN A;  2HD0 A;  3IQL A;  2CZ6 B;  3JCM V;  2AK5 A;  2DIQ A;  1YIT A;  4XU2 A;  3BDU A;  4P5N A;  1IRX A;  2J6F A;  3OS5 A;  2CZ7 B;  1VQM T;  2X35 A;  4C92 B;  2LT1 A;  3JSC A;  2YWW A;  5IAY A;  3UAT A;  2ZAE A;  1M30 A;  5A0D A;  2GTJ A;  4FW1 A;  1G3T A;  2VXE A;  5CK9 A;  1SKU B;  3OYM A;  2FB7 A;  3MPU B;  3BDL A;  4M78 A;  1HXD A;  1X2Q A;  2DXC A;  4JS5 A;  4HCZ A;  2DX1 A;  5LJ5 j;  2QTX A;  3RKW A;  3ZBD A;  4J9G A;  1WXB A;  3ZEH A;  1BI0 A;  4QVD A;  4N0A A;  2L89 A;  1TU0 B;  5CKB A;  2E1H A;  3SB2 A;  2XG8 D;  3CCV Q;  1GCQ A;  4EPC A;  3MEV A;  1C0M A;  1GXI E;  1VQ9 Q;  1T0H A;  1UFF A;  4GLM A;  2M0Y A;  2E12 A;  3L2V A;  3DLM A;  2D8H A;  3NTH A;  1SEM A;  1FYN A;  2BZX A;  4VUB A;  4AFZ C;  1ZBJ A;  3MEU A;  5LJ3 j;  4XTW A;  2PTK A;  3QWY A;  2PVD B;  2CUB A;  1Q81 R;  4MDW A;  5GAN 7;  5GAM h;  2ZGW A;  4LUE A;  4QW2 A;  1WHK A;  4ORZ A;  4FCY A;  3RR6 A;  2LCS A;  4Y92 A;  3I5S A;  2QYZ A;  4HA8 A;  4BY6 C;  3UWN A;  2D9T A;  3EG9 B;  3MEW A;  1M5Q 1;  4M7D B;  1RAC B;  4ANJ A;  1YIT T;  1OPK A;  2RMO A;  2MYS A;  2BTT A;  2K6D A;  4J6Y A;  3R6N A;  4DBQ A;  4C92 C;  3L2R A;  2L3P A;  1D0Y A;  2DAQ A;  3TRE A;  1Y71 A;  1MND A;  1EX4 A;  1ZUU A;  2EYZ A;  3JRZ A;  4C92 G;  1VQ7 A;  4QQD A;  2LRQ A;  2MI6 A;  4AT1 B;  5FWC A;  4RTW A;  3NMZ C;  2ZPG B;  2OTL Q;  4NL2 A;  1OQK A;  3VJP A;  3CCU Q;  3M0Q A;  4IUT A;  1NE8 A;  3M56 A;  4Z89 A;  2P4R A;  2G3R A;  2A28 A;  3EFO A;  4Q5W A;  1WJS A;  3SDZ A;  1M90 R;  3ER0 A;  4IIO A;  1UGV A;  4J9D A;  4OB1 B;  3CC4 Q;  5KYU A;  3OS0 A;  5IXF A;  1ZSG A;  2KDS A;  1Q86 R;  2VV5 A;  1JJ2 A;  1F1B B;  4ZGD B;  3L1A A;  1Z9Z A;  3BE3 A;  3CCS T;  4RTY A;  4FSS A;  5I2M A;  3G6E A;  1JXO A;  4HT8 A;  1WGS A;  3ME9 A;  3MO8 A;  3REA B;  4C5G A;  4F7U B;  4FW2 A;  1NG2 A;  1TUC A;  3QBY A;  2WSF E;  1TTH B;  2CH4 A;  1QWF A;  4X9C A;  2AKK A;  3FJP A;  4J6W A;  1TUD A;  4M7D C;  2DLP A;  3EHR A;  3CCJ A;  4QVC A;  5CAI A;  3VS2 A;  1W1F A;  4E7I A;  1U1T A;  2IVW A;  2YUQ A;  3M0T A;  4M7D G;  3M4Y A;  2GFA A;  3LWH A;  4JRI A;  2M02 A;  1QKW A;  1HK9 A;  1WI7 A;  4JS4 A;  5LJ5 g;  2DYI A;  3OW2 P;  3THK A;  4JUV A;  4EIK A;  3FB9 A;  1RAG B;  2RK1 A;  3CC2 A;  4M7A A;  4BD3 A;  4OML A;  1XQH A;  4JPB W;  3ULR B;  2DK3 A;  3QWX X;  2ROL A;  4CI0 C;  2BZY A;  5FW9 A;  5J39 A;  5GJV B;  1BIA A;  2DZC A;  5FU6 B;  1I5O B;  4XTU A;  4GBQ A;  1XTD A;  1QMC A;  4PJL A;  4PFO A;  2LZ6 B;  4EMK C;  3ZL7 C;  3HHT B;  1BCM A;  4ZN1 A;  4C5E A;  2P84 A;  4PJO E;  2FZK B;  1K0S A;  4A63 B;  3TSW A;  1ABO A;  2DEU A;  3VS5 A;  3C94 A;  4PJM A;  3G4S T;  3CCM A;  3INZ A;  5GAN 4;  3CBM A;  2RO0 A;  3HKS A;  2KNB B;  2GCX A;  2QQB A;  1PNJ A;  3RER A;  3EAE A;  2C0T A;  5I22 A;  2HBW A;  2RJD A;  5D7U A;  5HK3 A;  1VQ4 A;  1H92 A;  1OX8 A;  3TQ7 P;  1KQS P;  2DTI A;  1YJ9 T;  3L2W A;  4M78 B;  3LWI A;  1E7O A;  2W0Z A;  2NLU A;  4ZN3 A;  2OTJ Q;  4C5H A;  3JB9 D;  1ZUY A;  1VIE A;  2E10 A;  3JB9 J;  1VQ8 T;  2AZV A;  1O75 A;  1SRM A;  1I81 A;  3OSS C;  1OZ2 A;  4MZP A;  1N8R U;  3NTI A;  4ZTF A;  1VQN A;  1VQK Q;  3S6W A;  3I9Q A;  2M1H A;  3A1P A;  3JB9 F;  1M90 U;  4F7U G;  5FRO A;  4HXJ A;  3CCL Q;  1TG0 A;  1I8F A;  3KUF A;  2JVV A;  2H8H A;  2QQS A;  2MK5 A;  4E7Z A;  3OMG A;  1QVG S;  5KE2 A;  9ATC B;  2G6F X;  2MOX A;  3CCJ T;  1V76 A;  1YCS B;  3CPW P;  2NUZ A;  4EMG A;  4KT0 E;  5LJ3 f;  2ZPF B;  3VS3 A;  4E6R A;  5IHK A;  1S72 T;  3JB9 H;  1ZUK A;  3CCR Q;  2E5K A;  1UEC A;  1WYX A;  2PUO B;  2X3X D;  1I0C A;  2FRY A;  1FXX A;  2DTH A;  5GMK l;  4QKU A;  2JW4 A;  3RNJ A;  3JCM e;  5IH2 A;  1T3L A;  2MMP A;  3QJY A;  2NYS A;  2RK2 A;  3CCM T;  4RCB A;  5KYY A;  2P0K A;  4XU1 A;  1ZA1 B;  1NPP A;  4RTV A;  5GAN h;  1VYV A;  4O5V A;  4ZGE B;  4V2S A;  2ABL A;  3VKI A;  1AOJ A;  2E6N A;  2F69 A;  2MCN A;  4KGX B;  1AWO A;  2XDD A;  1JQQ A;  2XD0 A;  3DB4 A;  1OUL A;  4PLL A;  4PKC C;  4M78 G;  4HT9 A;  4N0A C;  1N9R A;  2DIL A;  2M9U A;  1ZSZ A;  1QVF P;  1KHC A;  3OYA A;  4HCB A;  2E6Z A;  2WSC E;  3ZFJ A;  1VQO A;  2EW3 A;  4B9X A;  2QA4 T;  2CS7 A;  3UA7 A;  4M75 A;  1U1S A;  3VS7 A;  1JRI A;  2EPD A;  2HQX A;  4N4H A;  3EFO B;  4AG1 C;  3M0S A;  3CBO A;  1OU9 A;  2DL5 A;  7AT1 B;  3OYH A;  2IG0 A;  1YI2 Q;  1Q81 C;  1H8K A;  2KEA A;  2QGG A;  5KYU B;  1VQL A;  2MF2 A;  2LX7 A;  1QCO A;  4RMO A;  4OGC A;  5CCA A;  1TH7 A;  2FZG B;  4NOY A;  1QP2 A;  2JXB A;  2KSS A;  1GFC A;  2FYK A;  2QAS A;  4J9I A;  1VQ6 A;  1G5V A;  2QI2 A;  3CME A;  2V1R A;  3CCQ A;  4C92 D;  2LTO A;  2F5K A;  3EGD A;  1KJW A;  1WIE A;  4KUL A;  5HK0 A;  1KFZ A;  3URG A;  4PJO C;  1D0X A;  3PMI A;  3LH5 A;  5GAN 2;  1IGQ A;  1K8A R;  2PVG B;  5HKC A;  3I56 Q;  2K2M A;  2O9S A;  3CC7 T;  4Z02 A;  4PJO G;  3VRY A;  2VKN A;  2E3H A;  2QTV A;  3P8D A;  1UGQ B;  4C92 F;  2NUT A;  3QXE B;  2A36 A;  3CD6 Q;  4HKE A;  8AT1 B;  2K5F A;  2CP5 A;  1IGU A;  3HP9 A;  1X43 A;  2ROT A;  1WA7 A;  2LDM A;  1AWX A;  2DXU A;  2RQW A;  4RTX A;  1XJW B;  1M3A A;  4HVV A;  4JJB A;  4M7A B;  2LMJ A;  4F16 A;  3OQ5 A;  1AWW A;  2CRE A;  5D6X A;  2K57 A;  1TS9 A;  1P92 A;  4FM4 B;  4C92 E;  2D0Q B;  3L2Q A;  2XK0 A;  4J83 A;  3I55 Q;  1M90 C;  3X24 B;  2CT4 A;  1VQO T;  5CQX A;  1ZBX A;  4LNP A;  2D0N A;  2JZ2 A;  2MWO A;  1YIJ T;  1QWE A;  3OY9 A;  2KAF A;  2OI3 A;  2F2W A;  4LUD A;  2DET A;  5GAM d;  4MDX A;  4PFZ A;  5I11 A;  5KYN A;  2QAZ A;  4RCC A;  4M7D D;  4JRK A;  2P0Q A;  2C0O A;  2HBP A;  2X51 A;  1GRI A;  2VWF A;  3CMA Q;  2XIC A;  1VQL T;  2DBM A;  5KCH A;  2BE9 B;  3H9N A;  4OMP A;  2J6K A;  3CCV A;  3PVQ A;  2HMA A;  2L3S A;  4PJJ A;  1VQP Q;  1WX6 A;  1VQ6 T;  1M1G A;  4RTU A;  2EQM A;  3CCQ T;  4J6X A;  1VQ9 A;  3NTK A;  2RJC A;  4OVA A;  4M7D F;  5GMK e;  2HQH A;  1UGS B;  3QSU A;  2K7A A;  5C0M A;  3QYH B;  2K4Y A;  2NWM A;  1AD5 A;  2CP2 A;  2AKL A;  2CSI A;  4CRI A;  2X9H A;  1BIB A;  4LDV A;  1OOT A;  1KD1 R;  4OB0 B;  1B3Q A;  4PL6 A;  4E7K A;  1LJO A;  4CC3 A;  4E7H A;  2DF6 A;  2DMO A;  1V29 B;  2COZ A;  1A0N B;  2RHY A;  3C12 A;  3LH0 A;  5IHI A;  5CKD A;  3LX7 A;  2W10 A;  1R0B G;  1AVZ C;  2YRD A;  1AHJ B;  4M7D E;  3E19 A;  4C0D B;  2CDT A;  1RL2 A;  3JCM d;  2V26 A;  1GFD A;  1YNZ A;  3VS6 A;  1MUZ A;  2D1X A;  4M7A G;  3SWN A;  1RLQ C;  1NYG A;  1EZZ B;  5D6W A;  4CC4 B;  1JJ2 P;  2KGT A;  3FIF A;  6AT1 B;  5KH6 A;  1BKB A;  1FWZ A;  1YN8 A;  3CXC S;  5GAO r;  1W2B A;  2EYW A;  2KI7 A;  1HSQ A;  2RI5 A;  2X4W A;  2DVJ A;  2DXB A;  4A4G A;  3G71 Q;  5KYY B;  1CKB A;  2OTL A;  3QDR B;  1B34 A;  4BI4 A;  1I5L A;  3SFM A;  1RAD B;  4MZM A;  2YUN A;  3CCU A;  3OS1 A;  4F7U F;  2CP0 A;  1RUW A;  2JJ9 A;  1D09 B;  4M4Z A;  1ZSZ B;  3CC4 A;  3QPH A;  1ACM B;  2KR3 A;  2YLC A;  3M54 A;  1CKA A;  4M75 B;  1UEB A;  3X25 B;  3WVE B;  4OF1 A;  2LQK A;  4RTZ A;  3FRN A;  3FEO A;  3JB9 I;  1JJ2 S;  1N5Z A;  3H8Z A;  2RHX A;  1V1C A;  3OYF A;  3RDV A;  2LCC A;  3JCM P;  2MWP A;  3S3N A;  1QW1 A;  4RG8 A;  1QCN A;  4F7U E;  3EGD B;  2FRW A;  5J3B A;  1OYX A;  4PJN A;  3TSZ A;  3HL8 A;  4FU6 A;  2EQU A;  1NEB A;  3I5R A;  1WZO A;  2DTO A;  4M77 A;  4C0D C;  4A4H A;  3CBP A;  3DB3 A;  1PG5 B;  4FYX B;  1Y7X A;  4CC7 A;  4KH1 B;  2FPF A;  2RQT A;  3PNW C;  2OX7 A;  1FX7 A;  5IN1 A;  2XHC A;  3QZ9 B;  2QQ9 A;  1WHJ A;  2NUT B;  2DZ9 A;  3V7R A;  2CGH A;  4OMQ A;  1KD1 U;  2GFU A;  1KC8 R;  4IIM A;  1IXD A;  3WVD B;  1G3Y A;  2O9V A;  4BE2 A;  5LJ5 h;  5GAM g;  2E64 A;  3NGP A;  1UG1 A;  2EGA A;  3M5A A;  2OAU A;  3V8L A;  4L5G A;  2WSE E;  3CCS Q;  2I0N A;  1LVK A;  1JB0 E;  4B6M A;  3A5Z B;  4NS5 A;  2DBK A;  2YLB A;  2EJ9 A;  3CCU T;  4ZGJ B;  3PIP A;  2X4Y A;  1ARK A;  4JLG A;  3VS1 A;  2E41 A;  4PJO D;  2DXT A;  3GPL A;  1ZA2 B;  4C5I A;  5LJ3 h;  4ZTJ A;  4F14 A;  3H0F A;  3V7S A;  2YDL A;  4D6W A;  1G3S A;  2QDL A;  1QVP A;  2OTJ A;  3ASK A;  4M78 E;  4J9H A;  1DJ7 B;  2VC8 A;  2ZCF B;  2RPN A;  2Y90 A;  4M75 G;  3MP1 A;  1WXT A;  4N4G A;  3M58 A;  4PJO F;  1TWB A;  4IUP A;  1QQJ A;  4J7F A;  4RG2 A;  2JOY A;  2IPO B;  3PIO A;  3CQT A;  4FYY B;  2JTF A;  4RUG A;  2HL3 A;  2KVQ G;  1Q81 U;  4TVR A;  1K8A C;  3JCM X;  3OYI A;  1TSF A;  5GMK j;  1NEG A;  3OYC A;  1MGQ A;  5CO7 A;  1YHQ Q;  3JCM g;  2H3J A;  1WXU A;  1VQ7 T;  4QQG A;  4IKF A;  4GY5 A;  2DM1 A;  4OB2 B;  2KRO A;  2QQA A;  2QGF B;  4X34 A;  2D8J A;  2E70 A;  3M0R A;  4XTX A;  2ZPE B;  1B07 A;  1D0Z A;  2M51 A;  2K3Y A;  3G4S Q;  3QYG B;  5IXB A;  1SPK A;  2KYB A;  4ATO A;  4HCK A;  2JM9 A;  4PFP A;  5GAN d;  2DEQ A;  5L8R E;  4DEY A;  3A8L B;  1IO6 A;  3CCR A;  4QQ6 A;  2LCL A;  3RKX A;  1YJ9 Q;  2DJQ A;  3PMT A;  1LNX A;  2ESW A;  4C0G A;  3VS0 A;  5GAN 8;  4XTV A;  2KRM A;  2AIR B;  1N27 A;  2KBT A;  3OW2 S;  1VQ8 Q;  4KGV B;  4C8Q A;  4E47 A;  3H6Z A;  1M1F A;  1ZX6 A;  3G1J A;  2FL7 A;  3SWN B;  5GAM e;  3NFC A;  4LD6 A;  1MMA A;  3G6E T;  2RJE A;  3CCE Q;  2PUK B;  2HKQ B;  2A37 A;  3X28 B;  1LCK A;  3GNG A;  1JU5 C;  5LJ5 f;  2MIO A;  5GAO l;  1OI1 A;  2LJ0 A;  4Y91 A;  2DA9 A;  1WLP B;  1OV3 A;  2LNH B;  2K5L A;  2F5T X;  3MCA B;  1NLO C;  2V8J A;  1SRL A;  3VYG A;  1B7T A;  2KY9 A;  1B34 B;  2K3X A;  1W70 A;  1PD1 A;  1Q86 U;  4KBM B;  1PSF A;  4AFS C;  5ECA A;  1LPL A;  1R0C B;  2DL3 A;  2JN0 A;  2YSQ A;  2GNC A;  1KQS S;  1YI2 A;  1S72 Q;  1KQ2 A;  2EQK A;  2ECZ A;  3CC2 T;  4OMO A;  1KD1 C;  1O9S A;  1VYU A;  3V7C A;  1E6G A;  4X9D A;  5FU6 C;  4OMN A;  2K2V A;  1PC0 A;  3MP6 A;  1PHT A;  1K9M R;  1CSK A;  4II1 A;  1RAI B;  4B9W A;  2EFI A;  3OYK A;  1Y57 A;  2JMC A;  2VAS A;  4N4I A;  2A0F B;  2RN8 A;  3DLL A;  4F17 A;  3GF5 A;  2LVM A;  3I56 A;  1U06 A;  1MNE A;  4OMM A;  3U23 A;  4DBR A;  1BI3 A;  4IUR A;  1YJW Q;  1BK2 A;  2DYB A;  2EYX A;  4XK8 E;  4BB7 A;  1VQ4 T;  4M77 B;  4M78 C;  2RHU A;  3CD6 A;  3QO3 A;  1D3B A;  3CPW S;  2R58 A;  3RMQ A;  3RES A;  3P8B B;  2KXC A;  3BW1 A;  2BKD N;  2QA4 Q;  4ELZ C;  1D1A A;  3HFN A;  1G2B A;  4LXC A;  1IHV A;  5EG2 A;  1PWT A;  3HRU A;  2DRK A;  4QT7 A;  4WF2 A;  1ZLM A;  2CKK A;  4M7A E;  2HZY A;  1GCQ C;  2KT8 A;  1S1N A;  4DA4 A;  4AMC A;  5AYF A;  1VQN T;  3MEA A;  3BFM A;  2HSE B;  1QVG A;  3A98 A;  1YJN A;  2GQV A;  3M55 A;  3H0H A;  1GL5 A;  3VUB A;  2B86 A;  2DIG A;  4BUG A;  3HRT A;  3C95 A;  4DOV A;  4E7S A;  1M8V A;  4J5Y A;  2RA2 A;  2YXY A;  2XKO C;  3KXT A;  2HL5 C;  4JZ4 A;  3EG2 A;  1MV3 A;  1VOM A;  5FWB A;  2JTE A;  3CC7 Q;  2X3W D;  5GMK m;  4J8O A;  1M3B A;  5IHN A;  4F04 B;  3C0C A;  3OYL A;  5AT1 B;  1K0X A;  4HVU A;  3CMA A;  1YCY A;  2OJ2 A;  1EIF A;  1QCF A;  4AFQ C;  1OPL A;  5FU7 B;  2MAM A;  2L3R A;  1R77 A;  1VQP A;  2VXF A;  1QVF S;  1WHH A;  2L0A A;  3HPW A;  1NJI R;  2QQR A;  1TUG B;  4D8K A;  2QEX Q;  4ZNX A;  2FHD A;  5GAN g;  1PCX A;  2YHT A;  2EGC A;  1AWJ A;  5FRM A;  1H64 1;  3UF4 A;  1TXQ A;  1ZHI A;  4QVZ A;  2RI2 A;  1M8M A;  5DM7 R;  2I2L A;  2WAC A;  1U8R A;  4EMK A;  1W2B P;  1BU1 A;  4XTZ A;  2VUB A;  4E2F B;  1RAE B;  2JNG A;  4MZT A;  2FZC B;  2PU9 B;  1UTI A;  4DBF A;  1QP3 A;  4M77 C;  3PFS A;  1ZQ1 A;  1I07 A;  2K79 A;  2ENM A;  1D1C A;  2FVU A;  2E3I A;  2DD4 A;  4A54 A;  2HQE A;  2CZ1 B;  4M77 G;  2HNI A;  4L6V 5;  1VQO Q;  3M57 A;  1Y07 A;  1VQ5 Q;  5CKH A;  1K9M U;  2RQR A;  3V8J A;  1YIJ Q;  3OYB A;  4C0Z A;  3RIR A;  1WJQ A;  3PGG A;  1MMD A;  1HJD A;  2RQV A;  3QHS A;  1HD3 A;  4M75 D;  3HTR A;  1WNL A;  1JEG A;  4BDZ A;  2XI9 A;  3QUI A;  1Q86 C;  2EKH A;  2O01 E;  2ZPI B;  4X1V A;  2FG0 A;  2YUP A;  1UHC A;  1YJN T;  2M16 A;  3EG1 A;  5GAM j;  3M59 A;  3O5Z A;  5KE3 A;  3TU4 K;  1U5S A;  2O4X A;  3EGX A;  4C8Q B;  3CME T;  4OB3 B;  1W6X A;  2K9G A;  1RI0 A;  3VS4 A;  1X6O A;  2QK0 A;  3X20 B;  2JTM A;  3G71 A;  2VGM A;  4JDS A;  2R57 A;  4BI8 B;  2HKN A;  4BE1 A;  5LL6 S;  3J7A F;  3QKJ A;  3T9N A;  3A8H B;  3E9F A;  3D7S B;  1VQM Q;  3EFS A;  2J6O A;  4JZ3 A;  3GNF B;  3MP8 A;  5IT9 E;  4BI3 A;  1K4U S;  2O88 A;  2X4J A;  1WHG A;  3REB B;  3F70 A;  2DKG A;  4A53 A;  3OYY A;  1N9S A;  2P4T A;  4M75 E;  1T3S A;  2V8K A;  1GBR A;  2BE7 D;  2A7Y A;  1YFN A;  4JLI A;  1JBM A;  3QII A;  4E7L A;  1I4K 1;  2H3E B;  4M7A C;  1K8A U;  1IZ6 A;  1PKS A;  1FMK A;  4PK4 A;  1G3W A;  2DL7 A;  5CKE A;  5GAN e;  1UDL A;  2C0I A;  1M4Z A;  3H41 A;  1BI1 A;  3G7Z A;  5D6Y A;  2PNI A;  1LOJ A;  5LJ5 d;  1WDX A;  5HCK A;  1JXM A;  5A0L A;  4PNO A;  3E9G A;  1NJI U;  3OA6 A;  1NM7 A;  4A4F A;  1OX9 A;  1TOV A;  2KXD A;  1RAB B;  2HEQ A;  3EH1 A;  1VYT A;  2XMF A;  2P0P A;  4AG2 C;  5CIU A;  2C06 A;  5DLQ E;  5KYX A;  2GQI A;  2V8I A;  2LJ3 A;  2EJF A;  3OYN A;  2BIV A;  2EVR A;  4J9E A;  3UPU A;  1N6A A;  1BB9 A;  5LJ3 d;  1D3B B;  3CCV T;  3J80 E;  4C8Q C;  3SHW A;  3P8H A;  2IIM A;  3JAM E;  1K1Z A;  4MML A;  4OGE A;  2E5Q A;  1VQ9 T;  5FRN A;  1Q82 R;  3KBG A;  2DPP B;  4C8Q G;  2XDB A;  2DVE A;  2YT6 A;  3G71 T;  1T0J A;  1VUB A;  3NPF A;  4BE0 A;  3CCS A;  1YIT Q;  1YP5 A;  1SHG A;  3MKD A;  4PJO A;  1NLP C;  2GGR A;  2AT1 B;  2DER A;  4UC4 A;  2KE9 A;  2K3B A;  2RD1 A;  3LGL A;  3M53 A;  1GCP A;  2KYM A;  4Y28 E;  1UE9 A;  1RAA B;  1WPY A;  4IUQ A;  3QDF A;  1K73 R;  3MHX A;  1OZ3 A;  1KHI A;  4J9C A;  3OS2 A;  3M9Q A;  4BAC A;  3UDC A;  3NHN A;  1UJ0 A;  1PSE A;  2RH2 A;  3JV3 A;  1W4S A;  2SEM A;  2BZ8 A;  2MPX C;  1G83 A;  4M78 D;  1KSW A;  4O6J A;  1K9M C;  3EHQ A;  1XNI A;  4KGZ B;  3C4S A;  2YRC A;  2FEI A;  4XQ3 A;  3WXM B;  1Y96 A;  1J3T A;  1QKX A;  3O8V A;  3CXC A;  3DKM A;  2ED1 A;  3VV0 A;  4JRP A;  1K76 A;  1R8O B;  3A8O B;  1YHQ A;  2DL4 A;  1NPR A;  2COY A;  5I21 A;  1M2V A;  2CZ0 B;  1UGR B;  2O31 A;  4M78 F;  4EDU A;  4EMK B;  4ME7 A;  2KK4 A;  3VYH B;  4FIB A;  2CP6 A;  3JCM h;  1D1B A;  3L42 A;  3HFO A;  2OTL T;  2DD5 A;  1UHF A;  5M9O A;  1BYM A;  1K9A A;  2E4H A;  3G4S A;  1YWP A;  1N8R R;  2RF0 A; 
#chains in the Genus database with same CATH homology
 2KT1 A;  3I35 A;  1Z9Q A;  1X2Q A;  4LN2 A;  2DE0 X;  4ESR A;  1W70 A;  2DX1 A;  4AFS C;  4J9G A;  5ECA A;  2A36 A;  2CT3 A;  2LJ1 A;  1WXB A;  3KFV A;  2DL3 A;  2YSQ A;  4CC2 A;  2GNC A;  3FJ5 A;  2RQU A;  2DNU A;  1X43 A;  2ROT A;  1WA7 A;  2ECZ A;  1SSH A;  4OMO A;  1AWX A;  2RQW A;  4RTX A;  3EG0 A;  1GCQ A;  1M3A A;  4HVV A;  4JJB A;  1VYU A;  1GBQ A;  1E6G A;  1T0H A;  1UFF A;  2LMJ A;  4F16 A;  4GLM A;  2M0Y A;  4OMN A;  2D8H A;  1AWW A;  1SEM A;  3RBB B;  2CRE A;  1FYN A;  2BZX A;  4AFZ C;  1PHT A;  1ZBJ A;  1CSK A;  1PKT A;  2PTK A;  1U3O A;  3QWY A;  1Y57 A;  2JMC A;  1X6G A;  2CUB A;  2RN8 A;  4F17 A;  4D8D A;  1U06 A;  4OMM A;  3U23 A;  4HVW A;  2CT4 A;  1AZG B;  1PRL C;  4LUE A;  1BK2 A;  4KRT A;  2DYB A;  4LNP A;  2D0N A;  3M0U A;  4ORZ A;  2EYX A;  2GTO A;  1QWE A;  2JMA A;  2OI3 A;  2V1Q A;  2F2W A;  4LUD A;  2LCS A;  4Y92 A;  5I11 A;  3I5S A;  1M27 C;  2C0O A;  1GRI A;  2VWF A;  2DBM A;  1SHF A;  2KXC A;  4OMP A;  2J6K A;  2JM8 A;  3PVQ A;  1OPK A;  2L3S A;  2RMO A;  1G2B A;  1E6H A;  1WX6 A;  2BTT A;  2K6D A;  4RTU A;  1PWT A;  1I1J A;  2DRK A;  4QT7 A;  1ZLM A;  3R6N A;  2L3P A;  1AZE A;  1GCQ C;  2KT8 A;  2F2V A;  1S1N A;  2J06 A;  1ZUU A;  2FPD A;  2EYZ A;  2K7A A;  3A98 A;  3H0H A;  1GL5 A;  2NWM A;  2B86 A;  1AD5 A;  2AKL A;  2CSI A;  1ABQ A;  4Z88 A;  1OOT A;  4RTW A;  3NMZ C;  5FWC A;  1B3Q A;  4JZ4 A;  4Z8A A;  3EG2 A;  1MV3 A;  4CC3 A;  5FWB A;  2DF6 A;  2DMO A;  2JTE A;  2X3W D;  1A0N B;  1M3B A;  1JO8 A;  5IHN A;  3C0C A;  5IHI A;  1Y0M A;  1K0X A;  2PZ1 A;  4HVU A;  2W10 A;  3M0Q A;  4AFU C;  2OJ2 A;  4Z89 A;  2P4R A;  1QCF A;  1AVZ C;  4AFQ C;  1OPL A;  2A28 A;  2CDT A;  4IIO A;  1UGV A;  1AEY A;  1GFD A;  4J9D A;  3H0I A;  2EGE A;  3SEM A;  2L0A A;  1X6B A;  1YNZ A;  4D8K A;  3VS6 A;  5IXF A;  4ZNX A;  1MUZ A;  2D1X A;  1ZSG A;  1X2K A;  1RLQ C;  1NYG A;  1AWJ A;  2EGC A;  3PE0 A;  3UF4 A;  2O2O A;  4CC4 B;  2KGT A;  1Z9Z A;  1M8M A;  3VRZ A;  1PRM C;  4RTY A;  2EQI A;  1YN8 A;  4FSS A;  1BU1 A;  1JXO A;  2EYW A;  1HSQ A;  3REA B;  2DVJ A;  1UTI A;  1NG2 A;  1TUC A;  2HCK A;  1X27 A;  2HDA A;  1CKB A;  1I07 A;  2CH4 A;  2K79 A;  1QWF A;  2LQN A;  4JJC A;  2ENM A;  4DEX A;  2CSQ A;  2AKK A;  3GBQ A;  5EC7 A;  2LP5 A;  1TUD A;  2DLP A;  3EHR A;  2YUN A;  1BBZ A;  2DRM A;  2RQR A;  3VS2 A;  1W1F A;  2YUQ A;  1RUW A;  3M0T A;  1RLP C;  1HJD A;  2RQV A;  1QKW A;  1WI7 A;  1HD3 A;  4M4Z A;  2JS2 A;  1JEG A;  2KR3 A;  3THK A;  1CKA A;  1RI9 A;  2EKH A;  4EIK A;  1OEB A;  4RTZ A;  2L3Q A;  4X1V A;  4OML A;  2FG0 A;  2YUP A;  2KRS A;  4J9F A;  1UHC A;  1N5Z A;  4JPB W;  1UJY A;  3EG1 A;  3QWX X;  3ULR B;  2ROL A;  2BZY A;  5FW9 A;  2A08 A;  2DL8 A;  1V1C A;  3O5Z A;  5GJV B;  1U5S A;  3EGU A;  1W6X A;  4WCI A;  4GBQ A;  2K9G A;  3VS4 A;  2LZ6 B;  3ZL7 C;  2EYY A;  2J7I A;  1K0S A;  4A63 B;  3TSW A;  1ABO A;  2FRW A;  3VS5 A;  3TVT A;  3TSZ A;  2VVK A;  1H3H A;  1NEB A;  1XOV A;  3I5R A;  2KNB B;  2ED0 A;  2J6O A;  1PNJ A;  4JZ3 A;  4RTT A;  2C0T A;  5I22 A;  2HBW A;  2CUD A;  1H92 A;  1K4U S;  4CC7 A;  2GBQ A;  2FPF A;  2RQT A;  2O88 A;  2J05 A;  1UUE A;  3REB B;  1E7O A;  2W0Z A;  3M0P A;  4K11 A;  4JJD A;  1ZUY A;  4OMQ A;  2CH4 W;  1T3S A;  2JS0 A;  4IIM A;  1GBR A;  2EBP A;  2O9V A;  2AZV A;  2RNA A;  2LQW A;  2KRN A;  3NGP A;  1UG1 A;  2FPE A;  1PKS A;  2EGA A;  1FMK A;  1SRM A;  2DL7 A;  1UDL A;  2C0I A;  2L2P A;  3H41 A;  3I9Q A;  2PNI A;  3EG3 A;  4HXJ A;  2I0N A;  5GJW B;  1WDX A;  5HCK A;  1JXM A;  1TG0 A;  1KIK A;  2DBK A;  2H8H A;  1NM7 A;  1ARK A;  2KXD A;  2G6F X;  2HEQ A;  1VYT A;  2MOX A;  3VS1 A;  1WFW A;  2XMF A;  2SRC A;  1NYF A;  4AG2 C;  1YCS B;  4F14 A;  4R0K A;  1YWO A;  2NUZ A;  3H0F A;  2YDL A;  2QDL A;  2GQI A;  3PVL A;  1VA7 A;  2LJ3 A;  2YUO A;  4J9H A;  1MV0 B;  2RPN A;  3VS3 A;  4E6R A;  5IHK A;  2EVR A;  1WXT A;  4J9E A;  1ZUK A;  1BB9 A;  2E5K A;  1UEC A;  1WYX A;  2X3X D;  3SHW A;  2IIM A;  3UA6 A;  2HSP A;  1I0C A;  3CQT A;  2FRY A;  4RUG A;  1K1Z A;  5L23 A;  2YT6 A;  2JW4 A;  1NEG A;  1T0J A;  3RNJ A;  3NPF A;  5IH2 A;  1T3L A;  1YP5 A;  1SHG A;  1WXU A;  2FO0 A;  1NLP C;  2GGR A;  2OAW A;  2DM1 A;  2KRO A;  2D8J A;  4RTV A;  2KE9 A;  3M0R A;  1VYV A;  2K3B A;  1GCP A;  2KYM A;  1B07 A;  1X69 A;  1UE9 A;  2ABL A;  1AOJ A;  2MCN A;  2M51 A;  4J9C A;  1AWO A;  1JQQ A;  5IXB A;  3NHN A;  1SPK A;  2KYB A;  1UJ0 A;  4HCK A;  2JM9 A;  2DIL A;  3JV3 A;  4DEY A;  4LE9 A;  1IO6 A;  2EW3 A;  1QLY A;  2SEM A;  3UA7 A;  2DJQ A;  3VS7 A;  2BZ8 A;  1M3C A;  2AZS A;  1G83 A;  2ESW A;  1KSW A;  2EPD A;  3EHQ A;  3VS0 A;  4AG1 C;  3M0S A;  2DL5 A;  2JT4 A;  2KRM A;  2FEI A;  2KBT A;  1J3T A;  1QKX A;  1H8K A;  2KEA A;  4J9B A;  2F2X A;  1EFN A;  2LX7 A;  1ZX6 A;  2ED1 A;  3IQL A;  1K76 A;  2AK5 A;  2DL4 A;  2JXB A;  4J9I A;  1GFC A;  2V1R A;  2J6F A;  2O31 A;  1KJW A;  1WIE A;  2A37 A;  1KFZ A;  1LCK A;  1JU5 C;  3LH5 A;  2MIO A;  2LJ0 A;  3UAT A;  2DA9 A;  1UHF A;  1M30 A;  1WLP B;  1OV3 A;  1K9A A;  2GTJ A;  2K2M A;  2LNH B;  2O9S A;  1YWP A;  3VRY A;  1NLO C;  2RF0 A;  1SRL A;  2VKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...