3I5RA

Pi3k sh3 domain in complex with a peptide ligand
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
81
structure length
81
Chain Sequence
b'SAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGRKKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphatidylinositol 3-kinase regulatory subunit alpha
molecule tags Protein binding
source organism Homo sapiens
publication title Structural studies of the phosphatidylinositol 3-kinase (PI3K) SH3 domain in complex with a peptide ligand: role of the anchor residue in ligand binding.
pubmed doi rcsb
total genus 25
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3i5rA00
1XOVA 2KEAA 1IO6A 2K6DA 2ENMA 1PKSA 2VKNA 2D8HA 1JXOA 1J3TA 1AVZC 2KE9A 2RQUA 1S1NA 4HXJA 1NYGA 2JT4A 3EHQA 4F16A 3A98A 2KRMA 1WFWA 2C0TA 1WA7A 2VVKA 2G6FX 2O2OA 1VYTA 4K11A 3C0CA 1UGVA 5IXBA 1ZSGA 4OMMA 1WXBA 1GBQA 2LJ0A 1ABQA 2HDAA 1OPLA 2OJ2A 4F17A 1CKAA 4ZNXA 3M0SA 4LNPA 3GBQA 4IIOA 2QDLA 2HCKA 2O88A 2SEMA 1TUDA 1OV3A 1E6HA 2YT6A 2LJ3A 2L0AA 3PVQA 3VS0A 3NHNA 2JM9A 1RI9A 2DL7A 1K1ZA 2LP5A 3THKA 4LE9A 1Y0MA 3VS6A 4M4ZA 2L3QA 1ZUKA 1AEYA 5FW9A 2DVJA 1ARKA 1AWJA 1KSWA 1U3OA 2AKLA 1KIKA 4HVWA 1KFZA 2DF6A 1U06A 2JS2A 2FRYA 2YUOA 2OI3A 4EIKA 1BB9A 2JM8A 1GFCA 4J9IA 3U23A 2CSQA 2ABLA 5IHNA 3VS3A 2BTTA 2JS0A 2RNAA 2OAWA 3EG3A 3SHWA 2M0YA 2J7IA 2EGEA 1YP5A 3H0FA 3IQLA 2K7AA 4LN2A 4OMQA 1CSKA 2DILA 5GJWB 4RTZA 2DX1A 1MV3A 3O5ZA 3VS5A 2CT4A 2RN8A 2F2XA 2ROLA 2YDLA 1AZEA 2LZ6B 3EHRA 2M51A 2J6KA 2GBQA 1BU1A 2PNIA 1PRLC 2DLPA 4KRTA 2CUDA 2C0IA 2CUBA 1WI7A 4J9FA 2EYZA 2L2PA 1SHFA 2GTOA 3H0IA 2KT8A 3PE0A 3M0PA 1M30A 2RF0A 4ESRA 3EG2A 1ABOA 3H41A 4F14A 1UFFA 4WCIA 2GNCA 2CH4W 4X1VA 1BBZA 3NMZC 1AWOA 4AG2C 4LUEA 2EYXA 2DRKA 1RUWA 4ORZA 2JTEA 1NEBA 2F2VA 2EYYA 4LUDA 1UJYA 1UUEA 1JQQA 1UE9A 2RQRA 4D8KA 3H0HA 3UF4A 2O31A 2FEIA 1RLPC 2V1RA 2KYBA 1HJDA 4JZ3A 2EW3A 2FPEA 3M0RA 1SRLA 1WXTA 3SEMA 2LNHB 1U5SA 2YUQA 1NG2A 1AD5A 5FWBA 4J9CA 1YN8A 5FWCA 3VRYA 1NYFA 4RTXA 2KT1A 1UJ0A 3REBB 2JMAA 1SPKA 2FRWA 2C0OA 4JJCA 2AZVA 1GL5A 2YSQA 1V1CA 2LQWA 2PZ1A 1HD3A 2EGAA 2K79A 3VS7A 1M8MA 1GBRA 4HCKA 4OMNA 2D1XA 1ZUYA 4J9DA 2MOXA 1H92A 2ESWA 1X69A 4D8DA 2W10A 2K2MA 1SHGA 4Y92A 1GRIA 1YCSB 3NPFA 2L3PA 1WXUA 1ZUUA 2CDTA 2DBMA 2EQIA 1I07A 4AFZC 2ROTA 2LCSA 3R6NA 1EFNA 2CT3A 2B86A 4CC3A 1G83A 1AWXA 2ED0A 4J9HA 5GJVB 1TUCA 1PRMC 1T0JA 4GBQA 2EGCA 2BZ8A 3EG0A 1GCQA 5L23A 1X43A 1K0XA 1YWOA 1B07A 4RUGA 1BK2A 2MIOA 1G2BA 1VYVA 3ZL7C 2KRSA 2KNBB 1B3QA 2ECZA 4RTWA 3M0TA 2O9VA 3FJ5A 1X6BA 2VWFA 2HBWA 2BZYA 1JO8A 2HSPA 1NLOC 2EPDA 1UHFA 1NEGA 2KYMA 1JU5C 2CH4A 2MCNA 1OEBA 2DE0X 2YUPA 5IXFA 4J9BA 1FMKA 1AOJA 2DRMA 2AZSA 2GTJA 1GFDA 3ULRB 3I35A 2X3WD 3VS1A 1AZGB 1UTIA 2J05A 1Z9QA 2NUZA 4Z88A 4RTYA 2RMOA 1MV0B 2J06A 2A36A 2LX7A 2GGRA 4J9GA 2DYBA 3LH5A 2KRNA 1UECA 1MUZA 5EC7A 2DL3A 4JPBW 3QWXX 1X6GA 1VYUA 4OMPA 1CKBA 1Y57A 1ZX6A 4AFQC 3QWYA 4OMLA 2FPFA 2LMJA 1AWWA 2J6FA 1K4US 1K76A 4E6RA 4J9EA 1PNJA 2NWMA 2K3BA 4JJDA 1GCQC 4CC2A 4HVUA 1RLQC 2KXCA 1SSHA 3I5RA 2E5KA 4HVVA 3I5SA 1KJWA 1FYNA 4DEXA 2H8HA 1M3BA 1TG0A 3TSWA 1X2QA 3UA6A 2D8JA 1SRMA 5HCKA 1LCKA 1GCPA 1H8KA 1WYXA 4JZ4A 4RTUA 3VS4A 3VS2A 1QLYA 3CQTA 3TSZA 4AFUC 4AFSC 1A0NB 4RTTA 1T0HA 2IIMA 2KR3A 3I9QA 1H3HA 2KXDA 2O9SA 5IHIA 5IHKA 1UG1A 2RQWA 4CC7A 1ZBJA 1JEGA 1T3SA 1N5ZA 2PTKA 2DMOA 1WDXA 1JXMA 1K9AA 1UHCA 2AKKA 3NGPA 2K9GA 4Z8AA 2A08A 1M3AA 1PWTA 1X27A 2RPNA 4DEYA 1E7OA 2P4RA 2DL4A 1OPKA 3UATA 1QCFA 1NM7A 2EKHA 1SEMA 2YUNA 2JW4A 2SRCA 1W6XA 2W0ZA 2JMCA 3M0UA 2EVRA 1I1JA 3M0QA 3EGUA 2LJ1A 1T3LA 1YNZA 2L3SA 2EYWA 1QWFA 5I11A 5ECAA 3JV3A 2CSIA 2KROA 2XMFA 2D0NA 1X2KA 2JXBA 3PVLA 2DL5A 1UDLA 3RBBB 3UA7A 1OOTA 2LQNA 1K0SA 2J6OA 2DJQA 2FG0A 4R0KA 2EBPA 1NLPC 1VA7A 2RQTA 1PHTA 1ZLMA 2DNUA 4Z89A 2X3XD 1M27C 1QWEA 4A63B 1WIEA 2I0NA 2KBTA 1Z9ZA 2A28A 2KGTA 4CC4B 1M3CA 3TVTA 3EG1A 4JJBA 4IIMA 1PKTA 2ED1A 4OMOA 3RNJA 4RTVA 3REAB 4QT7A 2FPDA 2A37A 2FO0A 4AG1C 1WLPB 2GQIA 5I22A 2CREA 2V1QA 1E6GA 3KFVA 2DM1A 4FSSA 3VRZA 2DBKA 4GLMA 1QKXA 2DA9A 2AK5A 1I0CA 2F2WA 1YWPA 2BZXA 1QKWA 2HEQA 2RQVA 5IH2A 1WX6A 1W70A 1HSQA 1W1FA 2DL8A
chains in the Genus database with same CATH superfamily
1IO6A 2ZPIB 1KC8R 2VKNA 5LJ5d 2QK0A 5CKEA 5GAOq 3OYBA 1RAIB 4HT8A 4KH1B 1S1NA 4HXJA 4E7ZA 4F16A 5GANe 1JB0E 2C0TA 5KYXB 2O2OA 1IRXA 2VC8A 2XIDA 3C0CA 3P8DA 3QYHB 2LJ0A 4F17A 4TVRA 4BUGA 4ZNXA 1H3ZA 3JCMg 4QVCA 2DD4A 3M0SA 4JLIA 3OYDA 4M75G 4IIOA 4M78A 2HKNA 2DVEA 5AYFA 1E6HA 3QUIA 1BIBA 2YT6A 2CZ1B 4PJOA 3WXMB 2DXCA 1BKBA 1VQMT 3VS0A 4F7UG 3NHNA 3FJPA 1RI9A 1R77A 2DL7A 2LP5A 4ZGDB 5GAOp 1VQKT 4M4ZA 3X28B 4M77G 4RG8A 3CC4Q 1Q7YC 5FW9A 3VUBA 1KQ1A 4EDUA 3OYFA 1ZA1B 1AHJB 1U06A 2ZPFB 1G3YA 1D1CA 5HKCA 1BB9A 2K3XA 1GFCA 3OB9A 3E19A 1Y07A 1VQPA 4PNOA 2JNGA 3G6ET 2BTTA 2JS0A 1OI1A 2RNAA 1JBMA 4PJOB 3CD6Q 2LRQA 2J7IA 5KYWB 3H0FA 3IQLA 2DYIA 4HCCA 3CCJQ 4ELYC 4OMQA 2DILA 3CC4A 4C92G 3CCUA 1MV3A 5CKBA 1K73R 2PVDB 1VUBA 4M77C 2CT4A 2CZ7B 1JJ2A 3QSUA 2M51A 4C8QE 2D0QB 4JUVA 3OW2A 4FYYB 2K2VA 5GAOn 1VQ4T 4QQGA 2I2LA 2ZPEB 3V7SA 3VU3C 5GANd 1WI7A 2O4XA 2L2PA 1SHFA 2GTOA 3H0IA 2BE7D 3M0PA 1Q82C 2RF0A 4AT1B 1WHKA 2WSFE 2R57A 1UFFA 2WSCE 5A0LA 2CH4W 4OMFB 4AG2C 3CCEQ 2XK0A 1RUWA 2E6NA 2AHJB 1NEBA 5GAN5 2EYYA 1UUEA 4OB3B 1JQQA 2R58A 3CMEA 2EJGA 1UE9A 6AT1B 2Y90A 1MNDA 3A5ZB 1RLPC 2E12A 3CCSQ 1HJDA 4JZ3A 2ZGWA 3M0RA 4FSXA 3SEMA 3CCET 1O75A 3EG9B 5I2MA 1Q81U 1QVGA 2CS7A 2H3JA 1NYFA 3A8MB 1RAHB 2K79A 3S3NA 1G3TA 5GMKi 2XDPA 2D1XA 4J9DA 1X6OA 4J6XA 4OB2B 3HRUA 3CC7T 5GMKj 1H92A 1X69A 4C0GA 3QZ9B 3Q1JA 2K2MA 4HT9A 2V8JA 1GRIA 2L3PA 1WXUA 2CDTA 2DBMA 2A3LA 5IAYA 2LCSA 1EFNA 1G83A 2ED0A 3MJXA 5GAMe 3G6EQ 2QGGA 5GAN8 3HTRA 2BZ8A 3EG0A 3VJPA 1GCQA 2NYSA 2LVMA 1NZ9A 4HA8A 1VYVA 3VUZA 5C6SA 2HL5C 2KNBB 1B3QA 2L5QA 3OA6A 1VQ4Q 1W2BS 3URGA 2HBWA 4HKEA 3MKDA 1JO8A 2K3YA 3AHUA 5CKDA 3HPWA 1RI0A 3A8OB 1BCMA 4N0AA 1UHFA 2AIRB 3RMSA 1JU5C 2ZCFB 2MCNA 1OEBA 2RI2A 4C0DB 1YITA 4JRKA 3ULRB 3JAME 3EFSA 3VS1A 1AZGB 2J05A 1QW1A 2NUZA 3C95A 1X01A 3HFNA 5DM7R 2EWNA 2J06A 3PTAA 4RCCA 2GGRA 3OBYA 4BY6C 1KD1U 2LCCA 3LWIA 3GF5A 3EGDB 3CBOA 1YI2T 5GAMd 2XDDA 1Q82U 1VQ6Q 3M4GA 3X20B 1Q86R 1QVFA 1MMAA 4M7DG 1ZX6A 1YJWQ 4AFQC 3CC2A 2LMJA 4XU2A 2RB6A 1VQKA 1K76A 4LDUA 4CC2A 3A8HB 3TREA 3A8LB 3QJYA 1VQ9T 2E5KA 4HVVA 1VQ7A 1XNIA 4J7IA 4QW2A 2H8HA 5CCAA 1YI2Q 2JVVA 5CR2A 1X2QA 1LCKA 3KBGA 3NFCA 1VOMA 4XTWA 1QVFP 4MDXA 4L5GA 1LPLA 1PD0A 2KK4A 2M16A 3ZFJA 1OX8A 1IGUA 4JZ4A 5LJ3g 3OS1A 4RTUA 4AFSC 2QTXA 1QQJA 3LGLA 5GAMf 4C92F 2DO3A 4N4HA 3I9QA 1DJ7B 3X26B 3EG9A 3OW2S 5IHKA 4CI0C 1KD1R 3OW2P 3QDFA 3I56A 3QKJA 4N0AC 5L8RE 4E7LA 2CP2A 3M9QA 3C4SA 1JXMA 3E1SA 1UHCA 3NGPA 3GNGA 1ZBXA 3MP1A 3EFOA 2CGHA 3CCRQ 3X24B 2FZGB 1MGQA 3CCMQ 5AT1B 1E7OA 3KUFA 4EMHA 3CD6A 1QCFA 2DTHA 3LWHA 1QP2A 2EKHA 4M78F 2ATCB 2W0ZA 3M0UA 2PUOB 2CP0A 1I1JA 2LJ1A 2GQVA 1TS9A 1MMDA 2YRDA 1QWFA 3CCEA 1WHJA 4FCYA 4EMKC 2JXBA 3CCRT 1MNEA 4M75A 3UPUA 1M2OA 4JLGA 5CKFA 1OOTA 2LQNA 2EAYA 4XTXA 5LJ5j 1RACB 2J6OA 3CBMA 1FMWA 4PJOG 4LD9K 4MDWA 1U8RA 2CP5A 4Z89A 2X4JA 5GAMh 1YITQ 8AT1B 2I0NA 5FU6C 2RD1A 2A28A 4CC4B 1XJWB 4PLLA 3VYGA 3EGDA 4JJBA 4IIMA 2ED1A 3CBPA 4RTVA 1NJIU 4XAXB 4QT7A 5M9OA 5GMKl 2GQIA 2CKKA 4JJNK 4A4HA 4HCZA 2DTOA 4C8QG 2DBKA 2ZPBB 3OYKA 2DA9A 4GY5A 1Q81R 3PNWC 2OTJT 2Z0WA 3OMGA 2F2WA 1KK7A 5GANg 3CCMA 1QKWA 1M5Q1 5LJ3d 3UWNA 1WX6A 2KQWA 1M1KR 3UDCA 2KEAA 1VQ7T 3S3OA 2QEXA 1VQ8A 2ENMA 1PKSA 1MHNA 1JXOA 2PVOB 4L59A 5C0MA 2QASA 5GMKe 3VKIA 4M7DC 2JT4A 2OTJQ 4WTOB 1WFWA 3P8BB 2WSEE 1U1SA 1WA7A 2VVKA 4J6WA 2EQMA 2F5TX 4X34A 3OYJA 1OQKA 1VYTA 2COYA 5IXBA 4XK8E 1GBQA 1ABQA 2HDAA 1OPLA 5J39A 4IUPA 2QDYB 2YLBA 1VQMA 3L2QA 2M9UA 2O88A 2RM4A 2P0QA 2ZAEA 3RIRA 4C0FA 4LDWA 2LJ3A 3AT1B 2K5IA 5DY9A 4M7DF 2JOYA 4MZMA 2JUFA 4IUQA 1N9RA 2L3QA 2L8DA 1N27A 5LJ3f 1JRIA 1AWJA 3H8ZA 2P0KA 5DLOA 1VQMQ 3R6OA 4J7FA 3HRSA 3G71Q 2DF6A 3QYGB 2JS2A 4M7AE 2JM8A 4J9IA 3JCMW 2YWWA 3M58A 1PM3A 5LJ5e 1I4K1 3CEYA 3ER0A 3SHWA 4ZN1A 1FXXA 1D09B 2EGEA 2K7AA 5KE3A 3EFOB 1YIJA 1VQOA 3OS0A 2FZKB 2M0OA 4JRIA 3O5ZA 3QJ6A 5LJ5g 2EJFA 4FYXB 5CIUA 2F2XA 2ROLA 3G7ZA 1AZEA 1K9MR 2GBQA 5CK9A 1VQNT 2HQHA 1UGQB 2PNIA 4PJLA 1PRLC 1AT1B 2DLPA 4PJJA 4KRTA 2OX7A 2KDSA 1YBYA 3NTHA 2KT8A 3MHXA 3CCJA 3L2VA 3CCSA 4WCIA 4PFZA 1BBZA 2FVUA 1VQPQ 1YITT 4EPCA 3GLXA 2JTEA 1V76A 1BYMA 2F2VA 2NLUA 1KC8U 4ZGEB 4B6MA 4BDYA 4FT4A 2RQRA 3SWNA 2PVGB 5FRNA 1K9MU 4DQ2A 2DEQA 2K4YA 1N6AA 4C8QB 4HCBA 3ME9A 1U5SA 2DJZA 2YUQA 3G4ST 1M90R 3VRYA 3X25B 4KUDK 1G8XA 1UJ0A 2JMAA 1SPKA 4JJCA 2C0OA 2AZVA 1GL5A 2YSQA 2QEXQ 4OB0B 2LQWA 1HD3A 3VS7A 3OYMA 2VGMA 3JCMV 4PJOF 1IXDA 4LXCA 4OMNA 2OTLQ 4C5IA 2MOXA 4ANJA 1HK9A 1KQ2A 4LDYA 2QQ9A 2EQUA 1M8VA 2DPPB 2G3RA 4D8DA 2EQKA 2ZPGB 2W10A 1B34B 2DKGA 1SHGA 4KGVB 4PFOA 1ZUUA 4E7KA 1KHCA 1LVKA 3R6NA 2B86A 5GJVB 1NBEB 1T0JA 1Q86C 4GBQA 2GFAA 3V7RA 4C5EA 5L23A 2QQAA 1X43A 2X35A 1K0XA 3JCMc 4DA4A 3RR6A 1VQOQ 2MIOA 1MMNA 1QP3A 4QVDA 1C1AA 3E2UA 3E9FA 3OSVA 1M2VB 2DXTA 2X4WA 2DIGA 3FJ5A 4QQ6A 2VWFA 2BZYA 3M55A 2E10A 2HSPA 3JCMP 5D6XA 2BKDN 1LNXA 2LT4A 5CVIA 2CH4A 3CC2T 1ZQ1A 2DE0X 2QQBA 1BCOA 1ACMB 1EIFA 1FMKA 4OVAA 2AZSA 3J7AF 3GNFB 2GTJA 1QVGS 3EGXB 4M78C 2MYSA 5IT9E 3FRNA 4XTYA 4CRIA 4NS5A 4DOWA 4E7HA 4Z88A 2LQ8A 2XHCA 4RTYA 3OYAA 1TXQA 4PKCC 4FYVB 3VV0A 2A36A 3I55Q 4PJNA 2LCLA 3SFMA 3LH5A 4BE2A 4KT0E 1NPPA 3DB4A 3UT1A 1TH7A 4B9XA 2KVQG 3JCMh 4JPBW 1Y96B 1X6GA 3CMAQ 1Q7YR 1CKBA 1Y57A 3L2RA 5HY6A 3CXCP 3QWYA 1C0MA 2RHUA 2FPFA 2J6FA 4AMCA 3I56Q 2F5KA 1KD1C 4JJDA 1GCQC 4A4FA 4IUVA 4HVUA 4M75E 3QHSA 1RLQC 1SSHA 4BACA 1VQLQ 2M02A 1C6VX 1KJWA 3RMQA 3J80E 5HCKA 2X51A 4UC4A 4A54A 1GCPA 1H8KA 4M7DB 2RO0A 3EAEA 3VS2A 1VQ5T 1ZA2B 3CD6T 1VQOT 2IIMA 1VIEA 4BB7A 2GCXA 3PGGA 1ZHIA 2KXDA 2O9SA 5IHIA 3OYCA 3G1JA 5IN1A 2XDBA 2QEXT 3OYHA 3OBWA 1WNLA 5KYNA 1M90U 2DMOA 1WDXA 1D1AA 2AKKA 2XKOC 4VUBA 3S6WA 3I55T 2IG0A 4II1A 4BE1A 1M3AA 1PWTA 1X27A 4PL6A 3RDVA 3E9GA 2P4RA 1ZSZB 2MK5A 3MP6A 3UATA 2DXBA 1Y71A 1NM7A 1WQWA 3JCMX 2IPOB 5FU7B 4M77D 4N4GA 2JW4A 2SRCA 4M77A 1W6XA 2JMCA 2EVRA 1PC0A 3EGUA 1T3LA 3G4SQ 2L3SA 4OGCA 5ECAA 3VYHB 5LL6S 2CSIA 1TWBA 1X2KA 1KQSS 5I2SA 3CMAT 2YLCA 4RCBA 2P0PA 3UA7A 4EMKB 1M90C 3D7SB 3I55A 2RQTA 4ATOA 1D1BA 1EZZB 1LOJA 1ZLMA 2DZ9A 1M27C 1QWEA 3M5AA 1WIEA 2NUPB 1M2VA 2KBTA 1Z9ZA 3H9NA 1QCOA 2QQRA 2AT1B 1YJ9A 3EG1A 5HK3A 1PKTA 5GAN7 1PD1A 2FO0A 3OYGA 1VQNQ 1E6GA 3O8VA 4FSSA 2QA4T 3VRZA 5CO7A 4GLMA 1YHQQ 2DK3A 1Q86U 1SF9A 5J26A 2HEQA 1KC8C 3CCJT 1RADB 4NL3A 1W70A 1W1FA 2DL8A 3CCLT 1K9MC 3RUXA 4A4KA 1RAEB 4NOYA 2K6DA 4P5NA 1W2BA 2D8HA 1J3TA 2RQUA 5GMKh 3G71T 4J6YA 4DBFA 2E4HA 2JZ2A 3OSSC 3T9NA 2G6FX 4BI4A 1VQKQ 3G4SA 2OJ2A 1G5VA 5GAOl 1CKAA 3L2UA 2DAQA 4LNPA 3GBQA 3J81E 4C92B 2LDMA 1SSFA 2QDLA 2OTLT 2HCKA 5GAOm 4C5HA 1OV3A 2KMTA 1G3WA 1N8RU 4JRQA 2L0AA 2P4TA 8ATCB 4M7DE 1K8AU 2JM9A 2X4XA 2V8KA 1K1ZA 3THKA 1I5OB 4LE9A 3VS6A 4C8QD 1WHHA 2HQEA 1FWZA 1VQ9Q 5EG2A 1ARKA 1QCNA 3JCMf 3JRZA 1KIKA 4HVWA 1KFZA 5KYYA 1M1KC 4A4GA 1YFNA 1SKUB 4EIKA 2F1LA 4EMGA 3KXTA 2RJFA 3U23A 3SD4A 4MMKA 2ABLA 5IHNA 4RKUE 3EG3A 3CMET 2QGFB 5KCHA 2WACA 1YP5A 4XU1A 4C92C 1NE8A 3SWNB 4RTZA 2DX1A 4PLIA 2HD0A 2YDLA 3QXEB 2LZ6B 3OQ5A 2J6KA 1BU1A 1K73C 3JB9H 4BY6B 2LX9A 2CUDA 2C0IA 3QG1A 2QAZA 2EYZA 1OZ2A 5GAN2 4WF2A 3PE0A 3MCAB 2LNVA 3M56A 4IKFA 3RKWA 3H41A 1VQPT 4F14A 1M1FA 3L1AA 1AWOA 3NMZC 4LUEA 4QVZA 1U1TA 3EGXA 2DRKA 4M7DA 4FYWB 4E7SA 4LUDA 2QA4A 3G71A 1TOVA 4LDVA 4D8KA 1OZ3A 3OYIA 4ZTJA 3UF4A 2O31A 3PIOA 4M7AD 2V1RA 2KYBA 4KH0B 2EW3A 4XU0A 2GFUA 1WXTA 1TU0B 5FU6B 4KGZB 3JB9D 3CXCS 4J9CA 1YN8A 4C0DC 2KT1A 1R0BG 3OY9A 4C8QC 3REBB 2FRWA 2O4XB 2CZ6B 1V1CA 3MPUB 2EGAA 4J5YA 2DZCA 1GBRA 2F69A 3ZEHA 3MEWA 4DOVA 2QA4Q 1ZUYA 1YJWA 1WQ7A 2ESWA 2BUDA 2E65A 1OYXA 4M75D 4XTVA 9ATCB 3RESA 5LJ5f 4N4IA 2E3HA 1YCSB 3NPFA 1IHVA 2EQIA 4AFZC 2ROTA 5GANh 3RKXA 4O6JA 4CC3A 4J9HA 1AWXA 4F7UA 1N8RC 2FYKA 4Y91A 2EGCA 1X75C 4NL2A 1KHIA 4C8QF 5LJ3e 4YTLA 2P84A 2VGNA 1S72T 1VQ7Q 1BK2A 2HSEB 4QQDA 3M4YA 2QXFA 2VXEA 3ZL7C 3HL8A 4XU3A 1S72A 3BDUA 1WJRA 1JJ2P 4KULA 1RABB 2L3RA 1I5LA 1NLOC 2EPDA 1NEGA 2KYMA 1KG1A 3M57A 1OU8A 2HAXA 5IXFA 4M78E 5I21A 1AOJA 3EFRA 1KQSA 2HMAA 4BI8B 5GANf 2E41A 4FW2A 1Z9QA 4OGEA 2RMOA 5LJ5h 3CCQQ 1MV0B 2LX7A 4J9GA 3SB2A 1YJNA 2E6ZA 1UECA 1MUZA 3H6ZA 1WHLA 2LQKA 2DL3A 2MMPA 4KUIA 1VYUA 4OMPA 4F7UF 1V29B 4F7UE 1W4SA 2RK2A 2V8IA 3I56T 2CP7A 2HZYA 1JJ2S 4OMLA 1AWWA 4M77F 2E70A 1PNJA 1OU9A 2RHZA 1D3BB 2NWMA 4C92E 2KAFA 3WVDB 1UGRB 5A2QE 3ZBDA 3TEEA 2RJCA 3I5SA 4X9DA 1M9SA 1M3BA 4IUTA 3CXCA 3UA6A 2D8JA 1SRMA 2BIVA 3EH1A 2Y4XA 3G6EA 1WYXA 1UB4A 2JTMA 2EJ9A 2LC4A 1QVGP 2PU9B 3VS4A 5CQXA 3CQTA 3CCQT 3TSZA 1QVPA 4AFUC 1VQLA 3M54A 2DFUA 5KYXA 4V2SA 1Q7YU 3CMEQ 1T0HA 2MWOA 4FM4B 2KR3A 2A0FB 5KYUB 3C12A 1XTDA 2K5FA 2KI7A 2HNIA 2DTIA 1UG1A 4CC7A 2MAMA 3OYLA 1JEGA 3JCMJ 1D0XA 1T3SA 2NUTA 1N5ZA 2A7YA 1K9AA 5A0DA 4ZTFA 2E1HA 2RJDA 4DBHA 3GOXA 2FB7A 3FDRA 3DB3A 1YHQT 2QG9B 2EYQA 4Z8AA 2A08A 3CC7Q 1PCXA 3CPWP 3L2WA 2E64A 2RPNA 5A0GA 3PMTA 3JB9J 5HK0A 4LDXA 1OPKA 4X9CA 3L2ZA 5CQYA 4IUUA 3GP8A 2XU8A 4BD3A 1SEMA 4GLKA 4JS5A 3A8GB 2VV5A 3CC2Q 2RA2A 3CCRA 4DBQA 2DIQA 3PFSA 5J3BA 2EYWA 3PT9A 5I11A 1VQ6A 2XD0A 3JV3A 2D0NA 2VUBA 2LT1A 1QVFS 3RERA 3PVLA 4XTUA 1WZOA 1RAFB 1WJQA 1K0SA 3QBYA 3V8LA 2DJQA 1EX4A 3P8HA 4M7AA 4EMKA 2Y4YA 2X3XD 4A4EA 4A63B 3WVEB 3CCLA 1VQ8Q 2D6FA 1H641 2KGTA 4E2FB 1PSFA 1M1GA 1K8AR 3RNJA 4M77B 4R56A 4MMLA 5GAN4 2FPDA 2A37A 1WLPB 2YRVA 1N9SA 5I22A 2V1QA 4F7UB 2RHYA 3LGFA 2CP3A 2M1HA 2OTLA 1VQLT 1I0CA 3TQ7P 4FT2A 3HHTB 1YWPA 2BZXA 4M78B 2JN0A 2RQVA 4M75B 3LH0A 5IH2A 4MZTA 2E3IA 1BI1A 2QQSA 1I8FA 1XOVA 1R8OB 3M53A 5KE2A 1HYOA 2RK1A 3CCLQ 7AT1B 1AVZC 2KE9A 1D0ZA 2EKOA 1YJ9T 4OB1B 1O9SA 4ELZC 1NYGA 3EHQA 4C92D 3A98A 1YHQA 2KRMA 2HQXA 4K11A 1UGVA 1ZSGA 3CPWS 4OMMA 1WXBA 3JCMe 1TSFA 1D0YA 1BI3A 4F04B 2CYZB 5LJ3j 2MPXC 5DLQE 2SEMA 1TUDA 1YI2A 1PG5B 2YRCA 1M4ZA 4KGXB 2GF7A 3PVQA 5KH6A 4JS4A 1SG5A 2QTVA 4E47A 1Y0MA 4FW1A 4OP0A 2CZ0B 1ZUKA 4M78D 4RG2A 1AEYA 2DVJA 3PMIA 4M7AF 1KSWA 2DEUA 1WJSA 2OAUA 1K8AC 2IVWA 1U3OA 1UGSB 2AKLA 4BI3A 4M7AC 2FRYA 2YUOA 2OI3A 2NUPA 1N8RR 3JB9F 1I81A 2CSQA 3VS3A 3OS5A 2OAWA 1FX7A 3CCQA 1RL2A 2M0YA 4LN2A 3DLLA 1B34A 2CP6A 1CSKA 2COZA 5GJWB 2XICA 1W2BP 2VASA 3VS5A 3QO3A 4BDZA 3JCMb 3QDRB 2RN8A 2JJ9A 3EHRA 2R5AA 3LYIA 4L6V5 2HKQB 2RHIA 1WGSA 2RI3A 5GAN3 4M75C 1IREB 4C5GA 2CUBA 3QIIA 4LD6A 4J9FA 4J8OA 3CCUQ 1WHMA 4ESRA 1M30A 2MI6A 2VXFA 3DKMA 1IGQA 3EG2A 1RAAB 1ABOA 1ZSZA 4C8QA 2GNCA 4X1VA 3FC3A 3S3MA 2H3EB 2X9HA 2EYXA 3TCJA 3MP8A 4ORZA 2VYTA 1B7TA 4XTZA 1UJYA 4JDSA 4M78G 3JB9I 3H0HA 2FEIA 4IURA 1M1KU 3F70A 2FPEA 3CCMT 1SRLA 2FZCB 5D6WA 2XG8D 2LNHB 1NG2A 1AD5A 2RJEA 5FWBA 5FWCA 4RTXA 1IHWA 2YXYA 4XQ3A 3MEAA 4J83A 4Y28E 2PZ1A 3META 3GPLA 2PUKB 1M8MA 4HCKA 2QI2A 3INZA 1UEBA 1NJIR 1TUGB 2DD5A 2EQJA 1IB8A 3MEVA 2BE9B 4E7JA 3MO8A 1TTHB 1RAGB 3HRTA 5GMKm 4Y92A 2RI5A 1P92A 4M7AB 3N5BB 3JSCA 3HSBA 2KY9A 1I07A 2R5MA 2CT3A 4C92A 3SDZA 1TUCA 1PRMC 2EIFA 4M7DD 3JCMQ 3CPWA 2D9TA 1YWOA 1B07A 4RUGA 1G2BA 3DLMA 1YIJQ 3FB9A 2KRSA 3LW5E 2ECZA 1YCYA 4RTWA 1Q82R 3HKSA 4ZN3A 3M0TA 1YJWT 2O9VA 2QYZA 4M77E 1X6BA 1OULA 2ZPHB 1XQHA 4R55A 3CMAA 3BFMA 1VQNA 1BI0A 2K57A 5GAMj 5GAMg 3NTIA 2YUPA 3MEUA 1LJOA 1QMCA 3NTKA 4J9BA 1YJ9Q 2DRMA 3OYEA 2NUTB 1GFDA 3V7CA 3I35A 2X3WD 2HBPA 1UTIA 1UGPB 1YJNT 3BY7A 4O5VA 1OX9A 4M75F 5D6YA 2DYBA 2KRNA 3JCMd 3QZ5B 2X4YA 4OF1A 5EC7A 2FL7A 4ME7A 1MMGA 3QWXX 3ASKA 5D7UA 5FRMA 5GAN6 1Y7XA 1R0CB 4PK4A 3OMCA 2OTJA 1YJNQ 1K4US 4MZPA 4E6RA 4J9EA 1BI2A 3FIFA 3SWNC 2K3BA 3QPHA 5KCOA 4M7AG 1D3BA 2HL3A 3FEOA 2KXCA 3I5RA 4A53A 1FYNA 4DEXA 4D6WA 3JB9G 1TG0A 3TSWA 4ZGJB 1VQ5A 1GXIE 4E7IA 5KYYB 4FIBA 2V26A 2KSSA 5FROA 1QLYA 3GIBA 1A0NB 3CCVQ 1WHGA 4RTTA 1YIJT 4PJOD 5GAOr 1Q95G 1H3HA 2MF2A 1S72Q 5GANj 4RMOA 2RQWA 1F1BB 1ZBJA 2XI9A 1VQ6T 2EFIA 2O01E 4JRPA 1FMVA 2PTKA 3EH2A 2B8AA 1VQ4A 4PJMA 3HFOA 1VQ9A 2K9GA 2ZZDA 2PQWA 3CCVT 3CCST 1G3SA 5KYWA 1IZ6A 3BDLA 3V8KA 2LTOA 4PJOE 1PSEA 2C06A 4DEYA 4KBMB 2DL4A 3V8JA 4QKUA 4Q5WA 2YUNA 3CPFA 3M0QA 4C0ZA 2K5LA 4PFPA 1YNZA 1K73U 2FHDA 4FL6A 1WPYA 5CKHA 2KROA 1VIFA 3LLRA 2XMFA 3LX7A 5LJ3h 3FLGA 3TU4K 2DL5A 2E5QA 4BE0A 3C94A 1UDLA 3RBBB 1HXDA 3RKYA 2COWA 5FLXE 1NPRA 2FG0A 4R0KA 4FU6A 4DBRA 2L89A 1Q81C 2EBPA 1NLPC 1VA7A 3OYYA 1PHTA 1VQ8T 2DNUA 2RH2A 3CC7A 5KYUA 2RHXA 3CCVA 1NJIC 1Y96A 5CAIA 3HP9A 3A1PA 3M59A 1M3CA 3TVTA 4OMOA 4PJOC 1VQ5Q 1BIAA 2YHTA 3CCUT 4B9WA 4Z02A 3PIPA 3REAB 2DXUA 4AG1C 3OS2A 2CREA 3KFVA 3CC4T 2DM1A 2VB6A 3L42A 1QKXA 2AK5A 2DERA 2JTFA 3BW1A 3BE3A 2DETA 1KQSP 1ZSZC 3OYNA 2MWPA 1HSQA 5FU7C
chains in the Genus database with same CATH topology
1XOVA 2KEAA 1IO6A 2K6DA 2ENMA 1PKSA 2VKNA 2D8HA 1JXOA 1J3TA 1AVZC 2KE9A 2RQUA 1S1NA 4HXJA 1NYGA 2JT4A 3EHQA 4F16A 3A98A 2KRMA 1WFWA 2C0TA 1WA7A 2VVKA 2G6FX 2O2OA 1VYTA 4K11A 3C0CA 1UGVA 5IXBA 1ZSGA 4OMMA 1WXBA 1GBQA 2LJ0A 1ABQA 2HDAA 1OPLA 2OJ2A 4F17A 1CKAA 4ZNXA 3M0SA 4LNPA 3GBQA 4IIOA 2QDLA 2HCKA 2O88A 2SEMA 1TUDA 1OV3A 1E6HA 2YT6A 2LJ3A 2L0AA 3PVQA 3VS0A 3NHNA 2JM9A 1RI9A 2DL7A 1K1ZA 2LP5A 3THKA 4LE9A 1Y0MA 3VS6A 4M4ZA 2L3QA 1ZUKA 1AEYA 5FW9A 2DVJA 1ARKA 1AWJA 1KSWA 1U3OA 2AKLA 1KIKA 4HVWA 1KFZA 2DF6A 1U06A 2JS2A 2FRYA 2YUOA 2OI3A 4EIKA 1BB9A 2JM8A 1GFCA 4J9IA 3U23A 2CSQA 2ABLA 5IHNA 3VS3A 2BTTA 2JS0A 2RNAA 2OAWA 3EG3A 3SHWA 2M0YA 2J7IA 2EGEA 1YP5A 3H0FA 3IQLA 2K7AA 4LN2A 4OMQA 1CSKA 2DILA 5GJWB 4RTZA 2DX1A 1MV3A 3O5ZA 3VS5A 2CT4A 2RN8A 2F2XA 2ROLA 2YDLA 1AZEA 2LZ6B 3EHRA 2M51A 2J6KA 2GBQA 1BU1A 2PNIA 1PRLC 2DLPA 4KRTA 2CUDA 2C0IA 2CUBA 1WI7A 4J9FA 2EYZA 2L2PA 1SHFA 2GTOA 3H0IA 2KT8A 3PE0A 3M0PA 1M30A 2RF0A 4ESRA 3EG2A 1ABOA 3H41A 4F14A 1UFFA 4WCIA 2GNCA 2CH4W 4X1VA 1BBZA 3NMZC 1AWOA 4AG2C 4LUEA 2EYXA 2DRKA 1RUWA 4ORZA 2JTEA 1NEBA 2F2VA 2EYYA 4LUDA 1UJYA 1UUEA 1JQQA 1UE9A 2RQRA 4D8KA 3H0HA 3UF4A 2O31A 2FEIA 1RLPC 2V1RA 2KYBA 1HJDA 4JZ3A 2EW3A 2FPEA 3M0RA 1SRLA 1WXTA 3SEMA 2LNHB 1U5SA 2YUQA 1NG2A 1AD5A 5FWBA 4J9CA 1YN8A 5FWCA 3VRYA 1NYFA 4RTXA 2KT1A 1UJ0A 3REBB 2JMAA 1SPKA 2FRWA 2C0OA 4JJCA 2AZVA 1GL5A 2YSQA 1V1CA 2LQWA 2PZ1A 1HD3A 2EGAA 2K79A 3VS7A 1M8MA 1GBRA 4HCKA 4OMNA 2D1XA 1ZUYA 4J9DA 2MOXA 1H92A 2ESWA 1X69A 4D8DA 2W10A 2K2MA 1SHGA 4Y92A 1GRIA 1YCSB 3NPFA 2L3PA 1WXUA 1ZUUA 2CDTA 2DBMA 2EQIA 1I07A 4AFZC 2ROTA 2LCSA 3R6NA 1EFNA 2CT3A 2B86A 4CC3A 1G83A 1AWXA 2ED0A 4J9HA 5GJVB 1TUCA 1PRMC 1T0JA 4GBQA 2EGCA 2BZ8A 3EG0A 1GCQA 5L23A 1X43A 1K0XA 1YWOA 1B07A 4RUGA 1BK2A 2MIOA 1G2BA 1VYVA 3ZL7C 2KRSA 2KNBB 1B3QA 2ECZA 4RTWA 3M0TA 2O9VA 3FJ5A 1X6BA 2VWFA 2HBWA 2BZYA 1JO8A 2HSPA 1NLOC 2EPDA 1UHFA 1NEGA 2KYMA 1JU5C 2CH4A 2MCNA 1OEBA 2DE0X 2YUPA 5IXFA 4J9BA 1FMKA 1AOJA 2DRMA 2AZSA 2GTJA 1GFDA 3ULRB 3I35A 2X3WD 3VS1A 1AZGB 1UTIA 2J05A 1Z9QA 2NUZA 4Z88A 4RTYA 2RMOA 1MV0B 2J06A 2A36A 2LX7A 2GGRA 4J9GA 2DYBA 3LH5A 2KRNA 1UECA 1MUZA 5EC7A 2DL3A 4JPBW 3QWXX 1X6GA 1VYUA 4OMPA 1CKBA 1Y57A 1ZX6A 4AFQC 3QWYA 4OMLA 2FPFA 2LMJA 1AWWA 2J6FA 1K4US 1K76A 4E6RA 4J9EA 1PNJA 2NWMA 2K3BA 4JJDA 1GCQC 4CC2A 4HVUA 1RLQC 2KXCA 1SSHA 3I5RA 2E5KA 4HVVA 3I5SA 1KJWA 1FYNA 4DEXA 2H8HA 1M3BA 1TG0A 3TSWA 1X2QA 3UA6A 2D8JA 1SRMA 5HCKA 1LCKA 1GCPA 1H8KA 1WYXA 4JZ4A 4RTUA 3VS4A 3VS2A 1QLYA 3CQTA 3TSZA 4AFUC 4AFSC 1A0NB 4RTTA 1T0HA 2IIMA 2KR3A 3I9QA 1H3HA 2KXDA 2O9SA 5IHIA 5IHKA 1UG1A 2RQWA 4CC7A 1ZBJA 1JEGA 1T3SA 1N5ZA 2PTKA 2DMOA 1WDXA 1JXMA 1K9AA 1UHCA 2AKKA 3NGPA 2K9GA 4Z8AA 2A08A 1M3AA 1PWTA 1X27A 2RPNA 4DEYA 1E7OA 2P4RA 2DL4A 1OPKA 3UATA 1QCFA 1NM7A 2EKHA 1SEMA 2YUNA 2JW4A 2SRCA 1W6XA 2W0ZA 2JMCA 3M0UA 2EVRA 1I1JA 3M0QA 3EGUA 2LJ1A 1T3LA 1YNZA 2L3SA 2EYWA 1QWFA 5I11A 5ECAA 3JV3A 2CSIA 2KROA 2XMFA 2D0NA 1X2KA 2JXBA 3PVLA 2DL5A 1UDLA 3RBBB 3UA7A 1OOTA 2LQNA 1K0SA 2J6OA 2DJQA 2FG0A 4R0KA 2EBPA 1NLPC 1VA7A 2RQTA 1PHTA 1ZLMA 2DNUA 4Z89A 2X3XD 1M27C 1QWEA 4A63B 1WIEA 2I0NA 2KBTA 1Z9ZA 2A28A 2KGTA 4CC4B 1M3CA 3TVTA 3EG1A 4JJBA 4IIMA 1PKTA 2ED1A 4OMOA 3RNJA 4RTVA 3REAB 4QT7A 2FPDA 2A37A 2FO0A 4AG1C 1WLPB 2GQIA 5I22A 2CREA 2V1QA 1E6GA 3KFVA 2DM1A 4FSSA 3VRZA 2DBKA 4GLMA 1QKXA 2DA9A 2AK5A 1I0CA 2F2WA 1YWPA 2BZXA 1QKWA 2HEQA 2RQVA 5IH2A 1WX6A 1W70A 1HSQA 1W1FA 2DL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XOV A;  2KEA A;  1IO6 A;  2K6D A;  2ENM A;  1PKS A;  2VKN A;  2D8H A;  1JXO A;  1J3T A;  1AVZ C;  2KE9 A;  2RQU A;  1S1N A;  4HXJ A;  1NYG A;  2JT4 A;  3EHQ A;  4F16 A;  3A98 A;  2KRM A;  1WFW A;  2C0T A;  1WA7 A;  2VVK A;  2G6F X;  2O2O A;  1VYT A;  4K11 A;  3C0C A;  1UGV A;  5IXB A;  1ZSG A;  4OMM A;  1WXB A;  1GBQ A;  2LJ0 A;  1ABQ A;  2HDA A;  1OPL A;  2OJ2 A;  4F17 A;  1CKA A;  4ZNX A;  3M0S A;  4LNP A;  3GBQ A;  4IIO A;  2QDL A;  2HCK A;  2O88 A;  2SEM A;  1TUD A;  1OV3 A;  1E6H A;  2YT6 A;  2LJ3 A;  2L0A A;  3PVQ A;  3VS0 A;  3NHN A;  2JM9 A;  1RI9 A;  2DL7 A;  1K1Z A;  2LP5 A;  3THK A;  4LE9 A;  1Y0M A;  3VS6 A;  4M4Z A;  2L3Q A;  1ZUK A;  1AEY A;  5FW9 A;  2DVJ A;  1ARK A;  1AWJ A;  1KSW A;  1U3O A;  2AKL A;  1KIK A;  4HVW A;  1KFZ A;  2DF6 A;  1U06 A;  2JS2 A;  2FRY A;  2YUO A;  2OI3 A;  4EIK A;  1BB9 A;  2JM8 A;  1GFC A;  4J9I A;  3U23 A;  2CSQ A;  2ABL A;  5IHN A;  3VS3 A;  2BTT A;  2JS0 A;  2RNA A;  2OAW A;  3EG3 A;  3SHW A;  2M0Y A;  2J7I A;  2EGE A;  1YP5 A;  3H0F A;  3IQL A;  2K7A A;  4LN2 A;  4OMQ A;  1CSK A;  2DIL A;  5GJW B;  4RTZ A;  2DX1 A;  1MV3 A;  3O5Z A;  3VS5 A;  2CT4 A;  2RN8 A;  2F2X A;  2ROL A;  2YDL A;  1AZE A;  2LZ6 B;  3EHR A;  2M51 A;  2J6K A;  2GBQ A;  1BU1 A;  2PNI A;  1PRL C;  2DLP A;  4KRT A;  2CUD A;  2C0I A;  2CUB A;  1WI7 A;  4J9F A;  2EYZ A;  2L2P A;  1SHF A;  2GTO A;  3H0I A;  2KT8 A;  3PE0 A;  3M0P A;  1M30 A;  2RF0 A;  4ESR A;  3EG2 A;  1ABO A;  3H41 A;  4F14 A;  1UFF A;  4WCI A;  2GNC A;  2CH4 W;  4X1V A;  1BBZ A;  3NMZ C;  1AWO A;  4AG2 C;  4LUE A;  2EYX A;  2DRK A;  1RUW A;  4ORZ A;  2JTE A;  1NEB A;  2F2V A;  2EYY A;  4LUD A;  1UJY A;  1UUE A;  1JQQ A;  1UE9 A;  2RQR A;  4D8K A;  3H0H A;  3UF4 A;  2O31 A;  2FEI A;  1RLP C;  2V1R A;  2KYB A;  1HJD A;  4JZ3 A;  2EW3 A;  2FPE A;  3M0R A;  1SRL A;  1WXT A;  3SEM A;  2LNH B;  1U5S A;  2YUQ A;  1NG2 A;  1AD5 A;  5FWB A;  4J9C A;  1YN8 A;  5FWC A;  3VRY A;  1NYF A;  4RTX A;  2KT1 A;  1UJ0 A;  3REB B;  2JMA A;  1SPK A;  2FRW A;  2C0O A;  4JJC A;  2AZV A;  1GL5 A;  2YSQ A;  1V1C A;  2LQW A;  2PZ1 A;  1HD3 A;  2EGA A;  2K79 A;  3VS7 A;  1M8M A;  1GBR A;  4HCK A;  4OMN A;  2D1X A;  1ZUY A;  4J9D A;  2MOX A;  1H92 A;  2ESW A;  1X69 A;  4D8D A;  2W10 A;  2K2M A;  1SHG A;  4Y92 A;  1GRI A;  1YCS B;  3NPF A;  2L3P A;  1WXU A;  1ZUU A;  2CDT A;  2DBM A;  2EQI A;  1I07 A;  4AFZ C;  2ROT A;  2LCS A;  3R6N A;  1EFN A;  2CT3 A;  2B86 A;  4CC3 A;  1G83 A;  1AWX A;  2ED0 A;  4J9H A;  5GJV B;  1TUC A;  1PRM C;  1T0J A;  4GBQ A;  2EGC A;  2BZ8 A;  3EG0 A;  1GCQ A;  5L23 A;  1X43 A;  1K0X A;  1YWO A;  1B07 A;  4RUG A;  1BK2 A;  2MIO A;  1G2B A;  1VYV A;  3ZL7 C;  2KRS A;  2KNB B;  1B3Q A;  2ECZ A;  4RTW A;  3M0T A;  2O9V A;  3FJ5 A;  1X6B A;  2VWF A;  2HBW A;  2BZY A;  1JO8 A;  2HSP A;  1NLO C;  2EPD A;  1UHF A;  1NEG A;  2KYM A;  1JU5 C;  2CH4 A;  2MCN A;  1OEB A;  2DE0 X;  2YUP A;  5IXF A;  4J9B A;  1FMK A;  1AOJ A;  2DRM A;  2AZS A;  2GTJ A;  1GFD A;  3ULR B;  3I35 A;  2X3W D;  3VS1 A;  1AZG B;  1UTI A;  2J05 A;  1Z9Q A;  2NUZ A;  4Z88 A;  4RTY A;  2RMO A;  1MV0 B;  2J06 A;  2A36 A;  2LX7 A;  2GGR A;  4J9G A;  2DYB A;  3LH5 A;  2KRN A;  1UEC A;  1MUZ A;  5EC7 A;  2DL3 A;  4JPB W;  3QWX X;  1X6G A;  1VYU A;  4OMP A;  1CKB A;  1Y57 A;  1ZX6 A;  4AFQ C;  3QWY A;  4OML A;  2FPF A;  2LMJ A;  1AWW A;  2J6F A;  1K4U S;  1K76 A;  4E6R A;  4J9E A;  1PNJ A;  2NWM A;  2K3B A;  4JJD A;  1GCQ C;  4CC2 A;  4HVU A;  1RLQ C;  2KXC A;  1SSH A;  3I5R A;  2E5K A;  4HVV A;  3I5S A;  1KJW A;  1FYN A;  4DEX A;  2H8H A;  1M3B A;  1TG0 A;  3TSW A;  1X2Q A;  3UA6 A;  2D8J A;  1SRM A;  5HCK A;  1LCK A;  1GCP A;  1H8K A;  1WYX A;  4JZ4 A;  4RTU A;  3VS4 A;  3VS2 A;  1QLY A;  3CQT A;  3TSZ A;  4AFU C;  4AFS C;  1A0N B;  4RTT A;  1T0H A;  2IIM A;  2KR3 A;  3I9Q A;  1H3H A;  2KXD A;  2O9S A;  5IHI A;  5IHK A;  1UG1 A;  2RQW A;  4CC7 A;  1ZBJ A;  1JEG A;  1T3S A;  1N5Z A;  2PTK A;  2DMO A;  1WDX A;  1JXM A;  1K9A A;  1UHC A;  2AKK A;  3NGP A;  2K9G A;  4Z8A A;  2A08 A;  1M3A A;  1PWT A;  1X27 A;  2RPN A;  4DEY A;  1E7O A;  2P4R A;  2DL4 A;  1OPK A;  3UAT A;  1QCF A;  1NM7 A;  2EKH A;  1SEM A;  2YUN A;  2JW4 A;  2SRC A;  1W6X A;  2W0Z A;  2JMC A;  3M0U A;  2EVR A;  1I1J A;  3M0Q A;  3EGU A;  2LJ1 A;  1T3L A;  1YNZ A;  2L3S A;  2EYW A;  1QWF A;  5I11 A;  5ECA A;  3JV3 A;  2CSI A;  2KRO A;  2XMF A;  2D0N A;  1X2K A;  2JXB A;  3PVL A;  2DL5 A;  1UDL A;  3RBB B;  3UA7 A;  1OOT A;  2LQN A;  1K0S A;  2J6O A;  2DJQ A;  2FG0 A;  4R0K A;  2EBP A;  1NLP C;  1VA7 A;  2RQT A;  1PHT A;  1ZLM A;  2DNU A;  4Z89 A;  2X3X D;  1M27 C;  1QWE A;  4A63 B;  1WIE A;  2I0N A;  2KBT A;  1Z9Z A;  2A28 A;  2KGT A;  4CC4 B;  1M3C A;  3TVT A;  3EG1 A;  4JJB A;  4IIM A;  1PKT A;  2ED1 A;  4OMO A;  3RNJ A;  4RTV A;  3REA B;  4QT7 A;  2FPD A;  2A37 A;  2FO0 A;  4AG1 C;  1WLP B;  2GQI A;  5I22 A;  2CRE A;  2V1Q A;  1E6G A;  3KFV A;  2DM1 A;  4FSS A;  3VRZ A;  2DBK A;  4GLM A;  1QKX A;  2DA9 A;  2AK5 A;  1I0C A;  2F2W A;  1YWP A;  2BZX A;  1QKW A;  2HEQ A;  2RQV A;  5IH2 A;  1WX6 A;  1W70 A;  1HSQ A;  1W1F A;  2DL8 A; 
#chains in the Genus database with same CATH topology
 1IO6 A;  2ZPI B;  1KC8 R;  2VKN A;  5LJ5 d;  2QK0 A;  5CKE A;  5GAO q;  3OYB A;  1RAI B;  4HT8 A;  4KH1 B;  1S1N A;  4HXJ A;  4E7Z A;  4F16 A;  5GAN e;  1JB0 E;  2C0T A;  5KYX B;  2O2O A;  1IRX A;  2VC8 A;  2XID A;  3C0C A;  3P8D A;  3QYH B;  2LJ0 A;  4F17 A;  4TVR A;  4BUG A;  4ZNX A;  1H3Z A;  3JCM g;  4QVC A;  2DD4 A;  3M0S A;  4JLI A;  3OYD A;  4M75 G;  4IIO A;  4M78 A;  2HKN A;  2DVE A;  5AYF A;  1E6H A;  3QUI A;  1BIB A;  2YT6 A;  2CZ1 B;  4PJO A;  3WXM B;  2DXC A;  1BKB A;  1VQM T;  3VS0 A;  4F7U G;  3NHN A;  3FJP A;  1RI9 A;  1R77 A;  2DL7 A;  2LP5 A;  4ZGD B;  5GAO p;  1VQK T;  4M4Z A;  3X28 B;  4M77 G;  4RG8 A;  3CC4 Q;  1Q7Y C;  5FW9 A;  3VUB A;  1KQ1 A;  4EDU A;  3OYF A;  1ZA1 B;  1AHJ B;  1U06 A;  2ZPF B;  1G3Y A;  1D1C A;  5HKC A;  1BB9 A;  2K3X A;  1GFC A;  3OB9 A;  3E19 A;  1Y07 A;  1VQP A;  4PNO A;  2JNG A;  3G6E T;  2BTT A;  2JS0 A;  1OI1 A;  2RNA A;  1JBM A;  4PJO B;  3CD6 Q;  2LRQ A;  2J7I A;  5KYW B;  3H0F A;  3IQL A;  2DYI A;  4HCC A;  3CCJ Q;  4ELY C;  4OMQ A;  2DIL A;  3CC4 A;  4C92 G;  3CCU A;  1MV3 A;  5CKB A;  1K73 R;  2PVD B;  1VUB A;  4M77 C;  2CT4 A;  2CZ7 B;  1JJ2 A;  3QSU A;  2M51 A;  4C8Q E;  2D0Q B;  4JUV A;  3OW2 A;  4FYY B;  2K2V A;  5GAO n;  1VQ4 T;  4QQG A;  2I2L A;  2ZPE B;  3V7S A;  3VU3 C;  5GAN d;  1WI7 A;  2O4X A;  2L2P A;  1SHF A;  2GTO A;  3H0I A;  2BE7 D;  3M0P A;  1Q82 C;  2RF0 A;  4AT1 B;  1WHK A;  2WSF E;  2R57 A;  1UFF A;  2WSC E;  5A0L A;  2CH4 W;  4OMF B;  4AG2 C;  3CCE Q;  2XK0 A;  1RUW A;  2E6N A;  2AHJ B;  1NEB A;  5GAN 5;  2EYY A;  1UUE A;  4OB3 B;  1JQQ A;  2R58 A;  3CME A;  2EJG A;  1UE9 A;  6AT1 B;  2Y90 A;  1MND A;  3A5Z B;  1RLP C;  2E12 A;  3CCS Q;  1HJD A;  4JZ3 A;  2ZGW A;  3M0R A;  4FSX A;  3SEM A;  3CCE T;  1O75 A;  3EG9 B;  5I2M A;  1Q81 U;  1QVG A;  2CS7 A;  2H3J A;  1NYF A;  3A8M B;  1RAH B;  2K79 A;  3S3N A;  1G3T A;  5GMK i;  2XDP A;  2D1X A;  4J9D A;  1X6O A;  4J6X A;  4OB2 B;  3HRU A;  3CC7 T;  5GMK j;  1H92 A;  1X69 A;  4C0G A;  3QZ9 B;  3Q1J A;  2K2M A;  4HT9 A;  2V8J A;  1GRI A;  2L3P A;  1WXU A;  2CDT A;  2DBM A;  2A3L A;  5IAY A;  2LCS A;  1EFN A;  1G83 A;  2ED0 A;  3MJX A;  5GAM e;  3G6E Q;  2QGG A;  5GAN 8;  3HTR A;  2BZ8 A;  3EG0 A;  3VJP A;  1GCQ A;  2NYS A;  2LVM A;  1NZ9 A;  4HA8 A;  1VYV A;  3VUZ A;  5C6S A;  2HL5 C;  2KNB B;  1B3Q A;  2L5Q A;  3OA6 A;  1VQ4 Q;  1W2B S;  3URG A;  2HBW A;  4HKE A;  3MKD A;  1JO8 A;  2K3Y A;  3AHU A;  5CKD A;  3HPW A;  1RI0 A;  3A8O B;  1BCM A;  4N0A A;  1UHF A;  2AIR B;  3RMS A;  1JU5 C;  2ZCF B;  2MCN A;  1OEB A;  2RI2 A;  4C0D B;  1YIT A;  4JRK A;  3ULR B;  3JAM E;  3EFS A;  3VS1 A;  1AZG B;  2J05 A;  1QW1 A;  2NUZ A;  3C95 A;  1X01 A;  3HFN A;  5DM7 R;  2EWN A;  2J06 A;  3PTA A;  4RCC A;  2GGR A;  3OBY A;  4BY6 C;  1KD1 U;  2LCC A;  3LWI A;  3GF5 A;  3EGD B;  3CBO A;  1YI2 T;  5GAM d;  2XDD A;  1Q82 U;  1VQ6 Q;  3M4G A;  3X20 B;  1Q86 R;  1QVF A;  1MMA A;  4M7D G;  1ZX6 A;  1YJW Q;  4AFQ C;  3CC2 A;  2LMJ A;  4XU2 A;  2RB6 A;  1VQK A;  1K76 A;  4LDU A;  4CC2 A;  3A8H B;  3TRE A;  3A8L B;  3QJY A;  1VQ9 T;  2E5K A;  4HVV A;  1VQ7 A;  1XNI A;  4J7I A;  4QW2 A;  2H8H A;  5CCA A;  1YI2 Q;  2JVV A;  5CR2 A;  1X2Q A;  1LCK A;  3KBG A;  3NFC A;  1VOM A;  4XTW A;  1QVF P;  4MDX A;  4L5G A;  1LPL A;  1PD0 A;  2KK4 A;  2M16 A;  3ZFJ A;  1OX8 A;  1IGU A;  4JZ4 A;  5LJ3 g;  3OS1 A;  4RTU A;  4AFS C;  2QTX A;  1QQJ A;  3LGL A;  5GAM f;  4C92 F;  2DO3 A;  4N4H A;  3I9Q A;  1DJ7 B;  3X26 B;  3EG9 A;  3OW2 S;  5IHK A;  4CI0 C;  1KD1 R;  3OW2 P;  3QDF A;  3I56 A;  3QKJ A;  4N0A C;  5L8R E;  4E7L A;  2CP2 A;  3M9Q A;  3C4S A;  1JXM A;  3E1S A;  1UHC A;  3NGP A;  3GNG A;  1ZBX A;  3MP1 A;  3EFO A;  2CGH A;  3CCR Q;  3X24 B;  2FZG B;  1MGQ A;  3CCM Q;  5AT1 B;  1E7O A;  3KUF A;  4EMH A;  3CD6 A;  1QCF A;  2DTH A;  3LWH A;  1QP2 A;  2EKH A;  4M78 F;  2ATC B;  2W0Z A;  3M0U A;  2PUO B;  2CP0 A;  1I1J A;  2LJ1 A;  2GQV A;  1TS9 A;  1MMD A;  2YRD A;  1QWF A;  3CCE A;  1WHJ A;  4FCY A;  4EMK C;  2JXB A;  3CCR T;  1MNE A;  4M75 A;  3UPU A;  1M2O A;  4JLG A;  5CKF A;  1OOT A;  2LQN A;  2EAY A;  4XTX A;  5LJ5 j;  1RAC B;  2J6O A;  3CBM A;  1FMW A;  4PJO G;  4LD9 K;  4MDW A;  1U8R A;  2CP5 A;  4Z89 A;  2X4J A;  5GAM h;  1YIT Q;  8AT1 B;  2I0N A;  5FU6 C;  2RD1 A;  2A28 A;  4CC4 B;  1XJW B;  4PLL A;  3VYG A;  3EGD A;  4JJB A;  4IIM A;  2ED1 A;  3CBP A;  4RTV A;  1NJI U;  4XAX B;  4QT7 A;  5M9O A;  5GMK l;  2GQI A;  2CKK A;  4JJN K;  4A4H A;  4HCZ A;  2DTO A;  4C8Q G;  2DBK A;  2ZPB B;  3OYK A;  2DA9 A;  4GY5 A;  1Q81 R;  3PNW C;  2OTJ T;  2Z0W A;  3OMG A;  2F2W A;  1KK7 A;  5GAN g;  3CCM A;  1QKW A;  1M5Q 1;  5LJ3 d;  3UWN A;  1WX6 A;  2KQW A;  1M1K R;  3UDC A;  2KEA A;  1VQ7 T;  3S3O A;  2QEX A;  1VQ8 A;  2ENM A;  1PKS A;  1MHN A;  1JXO A;  2PVO B;  4L59 A;  5C0M A;  2QAS A;  5GMK e;  3VKI A;  4M7D C;  2JT4 A;  2OTJ Q;  4WTO B;  1WFW A;  3P8B B;  2WSE E;  1U1S A;  1WA7 A;  2VVK A;  4J6W A;  2EQM A;  2F5T X;  4X34 A;  3OYJ A;  1OQK A;  1VYT A;  2COY A;  5IXB A;  4XK8 E;  1GBQ A;  1ABQ A;  2HDA A;  1OPL A;  5J39 A;  4IUP A;  2QDY B;  2YLB A;  1VQM A;  3L2Q A;  2M9U A;  2O88 A;  2RM4 A;  2P0Q A;  2ZAE A;  3RIR A;  4C0F A;  4LDW A;  2LJ3 A;  3AT1 B;  2K5I A;  5DY9 A;  4M7D F;  2JOY A;  4MZM A;  2JUF A;  4IUQ A;  1N9R A;  2L3Q A;  2L8D A;  1N27 A;  5LJ3 f;  1JRI A;  1AWJ A;  3H8Z A;  2P0K A;  5DLO A;  1VQM Q;  3R6O A;  4J7F A;  3HRS A;  3G71 Q;  2DF6 A;  3QYG B;  2JS2 A;  4M7A E;  2JM8 A;  4J9I A;  3JCM W;  2YWW A;  3M58 A;  1PM3 A;  5LJ5 e;  1I4K 1;  3CEY A;  3ER0 A;  3SHW A;  4ZN1 A;  1FXX A;  1D09 B;  2EGE A;  2K7A A;  5KE3 A;  3EFO B;  1YIJ A;  1VQO A;  3OS0 A;  2FZK B;  2M0O A;  4JRI A;  3O5Z A;  3QJ6 A;  5LJ5 g;  2EJF A;  4FYX B;  5CIU A;  2F2X A;  2ROL A;  3G7Z A;  1AZE A;  1K9M R;  2GBQ A;  5CK9 A;  1VQN T;  2HQH A;  1UGQ B;  2PNI A;  4PJL A;  1PRL C;  1AT1 B;  2DLP A;  4PJJ A;  4KRT A;  2OX7 A;  2KDS A;  1YBY A;  3NTH A;  2KT8 A;  3MHX A;  3CCJ A;  3L2V A;  3CCS A;  4WCI A;  4PFZ A;  1BBZ A;  2FVU A;  1VQP Q;  1YIT T;  4EPC A;  3GLX A;  2JTE A;  1V76 A;  1BYM A;  2F2V A;  2NLU A;  1KC8 U;  4ZGE B;  4B6M A;  4BDY A;  4FT4 A;  2RQR A;  3SWN A;  2PVG B;  5FRN A;  1K9M U;  4DQ2 A;  2DEQ A;  2K4Y A;  1N6A A;  4C8Q B;  4HCB A;  3ME9 A;  1U5S A;  2DJZ A;  2YUQ A;  3G4S T;  1M90 R;  3VRY A;  3X25 B;  4KUD K;  1G8X A;  1UJ0 A;  2JMA A;  1SPK A;  4JJC A;  2C0O A;  2AZV A;  1GL5 A;  2YSQ A;  2QEX Q;  4OB0 B;  2LQW A;  1HD3 A;  3VS7 A;  3OYM A;  2VGM A;  3JCM V;  4PJO F;  1IXD A;  4LXC A;  4OMN A;  2OTL Q;  4C5I A;  2MOX A;  4ANJ A;  1HK9 A;  1KQ2 A;  4LDY A;  2QQ9 A;  2EQU A;  1M8V A;  2DPP B;  2G3R A;  4D8D A;  2EQK A;  2ZPG B;  2W10 A;  1B34 B;  2DKG A;  1SHG A;  4KGV B;  4PFO A;  1ZUU A;  4E7K A;  1KHC A;  1LVK A;  3R6N A;  2B86 A;  5GJV B;  1NBE B;  1T0J A;  1Q86 C;  4GBQ A;  2GFA A;  3V7R A;  4C5E A;  5L23 A;  2QQA A;  1X43 A;  2X35 A;  1K0X A;  3JCM c;  4DA4 A;  3RR6 A;  1VQO Q;  2MIO A;  1MMN A;  1QP3 A;  4QVD A;  1C1A A;  3E2U A;  3E9F A;  3OSV A;  1M2V B;  2DXT A;  2X4W A;  2DIG A;  3FJ5 A;  4QQ6 A;  2VWF A;  2BZY A;  3M55 A;  2E10 A;  2HSP A;  3JCM P;  5D6X A;  2BKD N;  1LNX A;  2LT4 A;  5CVI A;  2CH4 A;  3CC2 T;  1ZQ1 A;  2DE0 X;  2QQB A;  1BCO A;  1ACM B;  1EIF A;  1FMK A;  4OVA A;  2AZS A;  3J7A F;  3GNF B;  2GTJ A;  1QVG S;  3EGX B;  4M78 C;  2MYS A;  5IT9 E;  3FRN A;  4XTY A;  4CRI A;  4NS5 A;  4DOW A;  4E7H A;  4Z88 A;  2LQ8 A;  2XHC A;  4RTY A;  3OYA A;  1TXQ A;  4PKC C;  4FYV B;  3VV0 A;  2A36 A;  3I55 Q;  4PJN A;  2LCL A;  3SFM A;  3LH5 A;  4BE2 A;  4KT0 E;  1NPP A;  3DB4 A;  3UT1 A;  1TH7 A;  4B9X A;  2KVQ G;  3JCM h;  4JPB W;  1Y96 B;  1X6G A;  3CMA Q;  1Q7Y R;  1CKB A;  1Y57 A;  3L2R A;  5HY6 A;  3CXC P;  3QWY A;  1C0M A;  2RHU A;  2FPF A;  2J6F A;  4AMC A;  3I56 Q;  2F5K A;  1KD1 C;  4JJD A;  1GCQ C;  4A4F A;  4IUV A;  4HVU A;  4M75 E;  3QHS A;  1RLQ C;  1SSH A;  4BAC A;  1VQL Q;  2M02 A;  1C6V X;  1KJW A;  3RMQ A;  3J80 E;  5HCK A;  2X51 A;  4UC4 A;  4A54 A;  1GCP A;  1H8K A;  4M7D B;  2RO0 A;  3EAE A;  3VS2 A;  1VQ5 T;  1ZA2 B;  3CD6 T;  1VQO T;  2IIM A;  1VIE A;  4BB7 A;  2GCX A;  3PGG A;  1ZHI A;  2KXD A;  2O9S A;  5IHI A;  3OYC A;  3G1J A;  5IN1 A;  2XDB A;  2QEX T;  3OYH A;  3OBW A;  1WNL A;  5KYN A;  1M90 U;  2DMO A;  1WDX A;  1D1A A;  2AKK A;  2XKO C;  4VUB A;  3S6W A;  3I55 T;  2IG0 A;  4II1 A;  4BE1 A;  1M3A A;  1PWT A;  1X27 A;  4PL6 A;  3RDV A;  3E9G A;  2P4R A;  1ZSZ B;  2MK5 A;  3MP6 A;  3UAT A;  2DXB A;  1Y71 A;  1NM7 A;  1WQW A;  3JCM X;  2IPO B;  5FU7 B;  4M77 D;  4N4G A;  2JW4 A;  2SRC A;  4M77 A;  1W6X A;  2JMC A;  2EVR A;  1PC0 A;  3EGU A;  1T3L A;  3G4S Q;  2L3S A;  4OGC A;  5ECA A;  3VYH B;  5LL6 S;  2CSI A;  1TWB A;  1X2K A;  1KQS S;  5I2S A;  3CMA T;  2YLC A;  4RCB A;  2P0P A;  3UA7 A;  4EMK B;  1M90 C;  3D7S B;  3I55 A;  2RQT A;  4ATO A;  1D1B A;  1EZZ B;  1LOJ A;  1ZLM A;  2DZ9 A;  1M27 C;  1QWE A;  3M5A A;  1WIE A;  2NUP B;  1M2V A;  2KBT A;  1Z9Z A;  3H9N A;  1QCO A;  2QQR A;  2AT1 B;  1YJ9 A;  3EG1 A;  5HK3 A;  1PKT A;  5GAN 7;  1PD1 A;  2FO0 A;  3OYG A;  1VQN Q;  1E6G A;  3O8V A;  4FSS A;  2QA4 T;  3VRZ A;  5CO7 A;  4GLM A;  1YHQ Q;  2DK3 A;  1Q86 U;  1SF9 A;  5J26 A;  2HEQ A;  1KC8 C;  3CCJ T;  1RAD B;  4NL3 A;  1W70 A;  1W1F A;  2DL8 A;  3CCL T;  1K9M C;  3RUX A;  4A4K A;  1RAE B;  4NOY A;  2K6D A;  4P5N A;  1W2B A;  2D8H A;  1J3T A;  2RQU A;  5GMK h;  3G71 T;  4J6Y A;  4DBF A;  2E4H A;  2JZ2 A;  3OSS C;  3T9N A;  2G6F X;  4BI4 A;  1VQK Q;  3G4S A;  2OJ2 A;  1G5V A;  5GAO l;  1CKA A;  3L2U A;  2DAQ A;  4LNP A;  3GBQ A;  3J81 E;  4C92 B;  2LDM A;  1SSF A;  2QDL A;  2OTL T;  2HCK A;  5GAO m;  4C5H A;  1OV3 A;  2KMT A;  1G3W A;  1N8R U;  4JRQ A;  2L0A A;  2P4T A;  8ATC B;  4M7D E;  1K8A U;  2JM9 A;  2X4X A;  2V8K A;  1K1Z A;  3THK A;  1I5O B;  4LE9 A;  3VS6 A;  4C8Q D;  1WHH A;  2HQE A;  1FWZ A;  1VQ9 Q;  5EG2 A;  1ARK A;  1QCN A;  3JCM f;  3JRZ A;  1KIK A;  4HVW A;  1KFZ A;  5KYY A;  1M1K C;  4A4G A;  1YFN A;  1SKU B;  4EIK A;  2F1L A;  4EMG A;  3KXT A;  2RJF A;  3U23 A;  3SD4 A;  4MMK A;  2ABL A;  5IHN A;  4RKU E;  3EG3 A;  3CME T;  2QGF B;  5KCH A;  2WAC A;  1YP5 A;  4XU1 A;  4C92 C;  1NE8 A;  3SWN B;  4RTZ A;  2DX1 A;  4PLI A;  2HD0 A;  2YDL A;  3QXE B;  2LZ6 B;  3OQ5 A;  2J6K A;  1BU1 A;  1K73 C;  3JB9 H;  4BY6 B;  2LX9 A;  2CUD A;  2C0I A;  3QG1 A;  2QAZ A;  2EYZ A;  1OZ2 A;  5GAN 2;  4WF2 A;  3PE0 A;  3MCA B;  2LNV A;  3M56 A;  4IKF A;  3RKW A;  3H41 A;  1VQP T;  4F14 A;  1M1F A;  3L1A A;  1AWO A;  3NMZ C;  4LUE A;  4QVZ A;  1U1T A;  3EGX A;  2DRK A;  4M7D A;  4FYW B;  4E7S A;  4LUD A;  2QA4 A;  3G71 A;  1TOV A;  4LDV A;  4D8K A;  1OZ3 A;  3OYI A;  4ZTJ A;  3UF4 A;  2O31 A;  3PIO A;  4M7A D;  2V1R A;  2KYB A;  4KH0 B;  2EW3 A;  4XU0 A;  2GFU A;  1WXT A;  1TU0 B;  5FU6 B;  4KGZ B;  3JB9 D;  3CXC S;  4J9C A;  1YN8 A;  4C0D C;  2KT1 A;  1R0B G;  3OY9 A;  4C8Q C;  3REB B;  2FRW A;  2O4X B;  2CZ6 B;  1V1C A;  3MPU B;  2EGA A;  4J5Y A;  2DZC A;  1GBR A;  2F69 A;  3ZEH A;  3MEW A;  4DOV A;  2QA4 Q;  1ZUY A;  1YJW A;  1WQ7 A;  2ESW A;  2BUD A;  2E65 A;  1OYX A;  4M75 D;  4XTV A;  9ATC B;  3RES A;  5LJ5 f;  4N4I A;  2E3H A;  1YCS B;  3NPF A;  1IHV A;  2EQI A;  4AFZ C;  2ROT A;  5GAN h;  3RKX A;  4O6J A;  4CC3 A;  4J9H A;  1AWX A;  4F7U A;  1N8R C;  2FYK A;  4Y91 A;  2EGC A;  1X75 C;  4NL2 A;  1KHI A;  4C8Q F;  5LJ3 e;  4YTL A;  2P84 A;  2VGN A;  1S72 T;  1VQ7 Q;  1BK2 A;  2HSE B;  4QQD A;  3M4Y A;  2QXF A;  2VXE A;  3ZL7 C;  3HL8 A;  4XU3 A;  1S72 A;  3BDU A;  1WJR A;  1JJ2 P;  4KUL A;  1RAB B;  2L3R A;  1I5L A;  1NLO C;  2EPD A;  1NEG A;  2KYM A;  1KG1 A;  3M57 A;  1OU8 A;  2HAX A;  5IXF A;  4M78 E;  5I21 A;  1AOJ A;  3EFR A;  1KQS A;  2HMA A;  4BI8 B;  5GAN f;  2E41 A;  4FW2 A;  1Z9Q A;  4OGE A;  2RMO A;  5LJ5 h;  3CCQ Q;  1MV0 B;  2LX7 A;  4J9G A;  3SB2 A;  1YJN A;  2E6Z A;  1UEC A;  1MUZ A;  3H6Z A;  1WHL A;  2LQK A;  2DL3 A;  2MMP A;  4KUI A;  1VYU A;  4OMP A;  4F7U F;  1V29 B;  4F7U E;  1W4S A;  2RK2 A;  2V8I A;  3I56 T;  2CP7 A;  2HZY A;  1JJ2 S;  4OML A;  1AWW A;  4M77 F;  2E70 A;  1PNJ A;  1OU9 A;  2RHZ A;  1D3B B;  2NWM A;  4C92 E;  2KAF A;  3WVD B;  1UGR B;  5A2Q E;  3ZBD A;  3TEE A;  2RJC A;  3I5S A;  4X9D A;  1M9S A;  1M3B A;  4IUT A;  3CXC A;  3UA6 A;  2D8J A;  1SRM A;  2BIV A;  3EH1 A;  2Y4X A;  3G6E A;  1WYX A;  1UB4 A;  2JTM A;  2EJ9 A;  2LC4 A;  1QVG P;  2PU9 B;  3VS4 A;  5CQX A;  3CQT A;  3CCQ T;  3TSZ A;  1QVP A;  4AFU C;  1VQL A;  3M54 A;  2DFU A;  5KYX A;  4V2S A;  1Q7Y U;  3CME Q;  1T0H A;  2MWO A;  4FM4 B;  2KR3 A;  2A0F B;  5KYU B;  3C12 A;  1XTD A;  2K5F A;  2KI7 A;  2HNI A;  2DTI A;  1UG1 A;  4CC7 A;  2MAM A;  3OYL A;  1JEG A;  3JCM J;  1D0X A;  1T3S A;  2NUT A;  1N5Z A;  2A7Y A;  1K9A A;  5A0D A;  4ZTF A;  2E1H A;  2RJD A;  4DBH A;  3GOX A;  2FB7 A;  3FDR A;  3DB3 A;  1YHQ T;  2QG9 B;  2EYQ A;  4Z8A A;  2A08 A;  3CC7 Q;  1PCX A;  3CPW P;  3L2W A;  2E64 A;  2RPN A;  5A0G A;  3PMT A;  3JB9 J;  5HK0 A;  4LDX A;  1OPK A;  4X9C A;  3L2Z A;  5CQY A;  4IUU A;  3GP8 A;  2XU8 A;  4BD3 A;  1SEM A;  4GLK A;  4JS5 A;  3A8G B;  2VV5 A;  3CC2 Q;  2RA2 A;  3CCR A;  4DBQ A;  2DIQ A;  3PFS A;  5J3B A;  2EYW A;  3PT9 A;  5I11 A;  1VQ6 A;  2XD0 A;  3JV3 A;  2D0N A;  2VUB A;  2LT1 A;  1QVF S;  3RER A;  3PVL A;  4XTU A;  1WZO A;  1RAF B;  1WJQ A;  1K0S A;  3QBY A;  3V8L A;  2DJQ A;  1EX4 A;  3P8H A;  4M7A A;  4EMK A;  2Y4Y A;  2X3X D;  4A4E A;  4A63 B;  3WVE B;  3CCL A;  1VQ8 Q;  2D6F A;  1H64 1;  2KGT A;  4E2F B;  1PSF A;  1M1G A;  1K8A R;  3RNJ A;  4M77 B;  4R56 A;  4MML A;  5GAN 4;  2FPD A;  2A37 A;  1WLP B;  2YRV A;  1N9S A;  5I22 A;  2V1Q A;  4F7U B;  2RHY A;  3LGF A;  2CP3 A;  2M1H A;  2OTL A;  1VQL T;  1I0C A;  3TQ7 P;  4FT2 A;  3HHT B;  1YWP A;  2BZX A;  4M78 B;  2JN0 A;  2RQV A;  4M75 B;  3LH0 A;  5IH2 A;  4MZT A;  2E3I A;  1BI1 A;  2QQS A;  1I8F A;  1XOV A;  1R8O B;  3M53 A;  5KE2 A;  1HYO A;  2RK1 A;  3CCL Q;  7AT1 B;  1AVZ C;  2KE9 A;  1D0Z A;  2EKO A;  1YJ9 T;  4OB1 B;  1O9S A;  4ELZ C;  1NYG A;  3EHQ A;  4C92 D;  3A98 A;  1YHQ A;  2KRM A;  2HQX A;  4K11 A;  1UGV A;  1ZSG A;  3CPW S;  4OMM A;  1WXB A;  3JCM e;  1TSF A;  1D0Y A;  1BI3 A;  4F04 B;  2CYZ B;  5LJ3 j;  2MPX C;  5DLQ E;  2SEM A;  1TUD A;  1YI2 A;  1PG5 B;  2YRC A;  1M4Z A;  4KGX B;  2GF7 A;  3PVQ A;  5KH6 A;  4JS4 A;  1SG5 A;  2QTV A;  4E47 A;  1Y0M A;  4FW1 A;  4OP0 A;  2CZ0 B;  1ZUK A;  4M78 D;  4RG2 A;  1AEY A;  2DVJ A;  3PMI A;  4M7A F;  1KSW A;  2DEU A;  1WJS A;  2OAU A;  1K8A C;  2IVW A;  1U3O A;  1UGS B;  2AKL A;  4BI3 A;  4M7A C;  2FRY A;  2YUO A;  2OI3 A;  2NUP A;  1N8R R;  3JB9 F;  1I81 A;  2CSQ A;  3VS3 A;  3OS5 A;  2OAW A;  1FX7 A;  3CCQ A;  1RL2 A;  2M0Y A;  4LN2 A;  3DLL A;  1B34 A;  2CP6 A;  1CSK A;  2COZ A;  5GJW B;  2XIC A;  1W2B P;  2VAS A;  3VS5 A;  3QO3 A;  4BDZ A;  3JCM b;  3QDR B;  2RN8 A;  2JJ9 A;  3EHR A;  2R5A A;  3LYI A;  4L6V 5;  2HKQ B;  2RHI A;  1WGS A;  2RI3 A;  5GAN 3;  4M75 C;  1IRE B;  4C5G A;  2CUB A;  3QII A;  4LD6 A;  4J9F A;  4J8O A;  3CCU Q;  1WHM A;  4ESR A;  1M30 A;  2MI6 A;  2VXF A;  3DKM A;  1IGQ A;  3EG2 A;  1RAA B;  1ABO A;  1ZSZ A;  4C8Q A;  2GNC A;  4X1V A;  3FC3 A;  3S3M A;  2H3E B;  2X9H A;  2EYX A;  3TCJ A;  3MP8 A;  4ORZ A;  2VYT A;  1B7T A;  4XTZ A;  1UJY A;  4JDS A;  4M78 G;  3JB9 I;  3H0H A;  2FEI A;  4IUR A;  1M1K U;  3F70 A;  2FPE A;  3CCM T;  1SRL A;  2FZC B;  5D6W A;  2XG8 D;  2LNH B;  1NG2 A;  1AD5 A;  2RJE A;  5FWB A;  5FWC A;  4RTX A;  1IHW A;  2YXY A;  4XQ3 A;  3MEA A;  4J83 A;  4Y28 E;  2PZ1 A;  3MET A;  3GPL A;  2PUK B;  1M8M A;  4HCK A;  2QI2 A;  3INZ A;  1UEB A;  1NJI R;  1TUG B;  2DD5 A;  2EQJ A;  1IB8 A;  3MEV A;  2BE9 B;  4E7J A;  3MO8 A;  1TTH B;  1RAG B;  3HRT A;  5GMK m;  4Y92 A;  2RI5 A;  1P92 A;  4M7A B;  3N5B B;  3JSC A;  3HSB A;  2KY9 A;  1I07 A;  2R5M A;  2CT3 A;  4C92 A;  3SDZ A;  1TUC A;  1PRM C;  2EIF A;  4M7D D;  3JCM Q;  3CPW A;  2D9T A;  1YWO A;  1B07 A;  4RUG A;  1G2B A;  3DLM A;  1YIJ Q;  3FB9 A;  2KRS A;  3LW5 E;  2ECZ A;  1YCY A;  4RTW A;  1Q82 R;  3HKS A;  4ZN3 A;  3M0T A;  1YJW T;  2O9V A;  2QYZ A;  4M77 E;  1X6B A;  1OUL A;  2ZPH B;  1XQH A;  4R55 A;  3CMA A;  3BFM A;  1VQN A;  1BI0 A;  2K57 A;  5GAM j;  5GAM g;  3NTI A;  2YUP A;  3MEU A;  1LJO A;  1QMC A;  3NTK A;  4J9B A;  1YJ9 Q;  2DRM A;  3OYE A;  2NUT B;  1GFD A;  3V7C A;  3I35 A;  2X3W D;  2HBP A;  1UTI A;  1UGP B;  1YJN T;  3BY7 A;  4O5V A;  1OX9 A;  4M75 F;  5D6Y A;  2DYB A;  2KRN A;  3JCM d;  3QZ5 B;  2X4Y A;  4OF1 A;  5EC7 A;  2FL7 A;  4ME7 A;  1MMG A;  3QWX X;  3ASK A;  5D7U A;  5FRM A;  5GAN 6;  1Y7X A;  1R0C B;  4PK4 A;  3OMC A;  2OTJ A;  1YJN Q;  1K4U S;  4MZP A;  4E6R A;  4J9E A;  1BI2 A;  3FIF A;  3SWN C;  2K3B A;  3QPH A;  5KCO A;  4M7A G;  1D3B A;  2HL3 A;  3FEO A;  2KXC A;  3I5R A;  4A53 A;  1FYN A;  4DEX A;  4D6W A;  3JB9 G;  1TG0 A;  3TSW A;  4ZGJ B;  1VQ5 A;  1GXI E;  4E7I A;  5KYY B;  4FIB A;  2V26 A;  2KSS A;  5FRO A;  1QLY A;  3GIB A;  1A0N B;  3CCV Q;  1WHG A;  4RTT A;  1YIJ T;  4PJO D;  5GAO r;  1Q95 G;  1H3H A;  2MF2 A;  1S72 Q;  5GAN j;  4RMO A;  2RQW A;  1F1B B;  1ZBJ A;  2XI9 A;  1VQ6 T;  2EFI A;  2O01 E;  4JRP A;  1FMV A;  2PTK A;  3EH2 A;  2B8A A;  1VQ4 A;  4PJM A;  3HFO A;  1VQ9 A;  2K9G A;  2ZZD A;  2PQW A;  3CCV T;  3CCS T;  1G3S A;  5KYW A;  1IZ6 A;  3BDL A;  3V8K A;  2LTO A;  4PJO E;  1PSE A;  2C06 A;  4DEY A;  4KBM B;  2DL4 A;  3V8J A;  4QKU A;  4Q5W A;  2YUN A;  3CPF A;  3M0Q A;  4C0Z A;  2K5L A;  4PFP A;  1YNZ A;  1K73 U;  2FHD A;  4FL6 A;  1WPY A;  5CKH A;  2KRO A;  1VIF A;  3LLR A;  2XMF A;  3LX7 A;  5LJ3 h;  3FLG A;  3TU4 K;  2DL5 A;  2E5Q A;  4BE0 A;  3C94 A;  1UDL A;  3RBB B;  1HXD A;  3RKY A;  2COW A;  5FLX E;  1NPR A;  2FG0 A;  4R0K A;  4FU6 A;  4DBR A;  2L89 A;  1Q81 C;  2EBP A;  1NLP C;  1VA7 A;  3OYY A;  1PHT A;  1VQ8 T;  2DNU A;  2RH2 A;  3CC7 A;  5KYU A;  2RHX A;  3CCV A;  1NJI C;  1Y96 A;  5CAI A;  3HP9 A;  3A1P A;  3M59 A;  1M3C A;  3TVT A;  4OMO A;  4PJO C;  1VQ5 Q;  1BIA A;  2YHT A;  3CCU T;  4B9W A;  4Z02 A;  3PIP A;  3REA B;  2DXU A;  4AG1 C;  3OS2 A;  2CRE A;  3KFV A;  3CC4 T;  2DM1 A;  2VB6 A;  3L42 A;  1QKX A;  2AK5 A;  2DER A;  2JTF A;  3BW1 A;  3BE3 A;  2DET A;  1KQS P;  1ZSZ C;  3OYN A;  2MWP A;  1HSQ A;  5FU7 C; 
#chains in the Genus database with same CATH homology
 1XOV A;  2KEA A;  1IO6 A;  2K6D A;  2ENM A;  1PKS A;  2VKN A;  2D8H A;  1JXO A;  1J3T A;  1AVZ C;  2KE9 A;  2RQU A;  1S1N A;  4HXJ A;  1NYG A;  2JT4 A;  3EHQ A;  4F16 A;  3A98 A;  2KRM A;  1WFW A;  2C0T A;  1WA7 A;  2VVK A;  2G6F X;  2O2O A;  1VYT A;  4K11 A;  3C0C A;  1UGV A;  5IXB A;  1ZSG A;  4OMM A;  1WXB A;  1GBQ A;  2LJ0 A;  1ABQ A;  2HDA A;  1OPL A;  2OJ2 A;  4F17 A;  1CKA A;  4ZNX A;  3M0S A;  4LNP A;  3GBQ A;  4IIO A;  2QDL A;  2HCK A;  2O88 A;  2SEM A;  1TUD A;  1OV3 A;  1E6H A;  2YT6 A;  2LJ3 A;  2L0A A;  3PVQ A;  3VS0 A;  3NHN A;  2JM9 A;  1RI9 A;  2DL7 A;  1K1Z A;  2LP5 A;  3THK A;  4LE9 A;  1Y0M A;  3VS6 A;  4M4Z A;  2L3Q A;  1ZUK A;  1AEY A;  5FW9 A;  2DVJ A;  1ARK A;  1AWJ A;  1KSW A;  1U3O A;  2AKL A;  1KIK A;  4HVW A;  1KFZ A;  2DF6 A;  1U06 A;  2JS2 A;  2FRY A;  2YUO A;  2OI3 A;  4EIK A;  1BB9 A;  2JM8 A;  1GFC A;  4J9I A;  3U23 A;  2CSQ A;  2ABL A;  5IHN A;  3VS3 A;  2BTT A;  2JS0 A;  2RNA A;  2OAW A;  3EG3 A;  3SHW A;  2M0Y A;  2J7I A;  2EGE A;  1YP5 A;  3H0F A;  3IQL A;  2K7A A;  4LN2 A;  4OMQ A;  1CSK A;  2DIL A;  5GJW B;  4RTZ A;  2DX1 A;  1MV3 A;  3O5Z A;  3VS5 A;  2CT4 A;  2RN8 A;  2F2X A;  2ROL A;  2YDL A;  1AZE A;  2LZ6 B;  3EHR A;  2M51 A;  2J6K A;  2GBQ A;  1BU1 A;  2PNI A;  1PRL C;  2DLP A;  4KRT A;  2CUD A;  2C0I A;  2CUB A;  1WI7 A;  4J9F A;  2EYZ A;  2L2P A;  1SHF A;  2GTO A;  3H0I A;  2KT8 A;  3PE0 A;  3M0P A;  1M30 A;  2RF0 A;  4ESR A;  3EG2 A;  1ABO A;  3H41 A;  4F14 A;  1UFF A;  4WCI A;  2GNC A;  2CH4 W;  4X1V A;  1BBZ A;  3NMZ C;  1AWO A;  4AG2 C;  4LUE A;  2EYX A;  2DRK A;  1RUW A;  4ORZ A;  2JTE A;  1NEB A;  2F2V A;  2EYY A;  4LUD A;  1UJY A;  1UUE A;  1JQQ A;  1UE9 A;  2RQR A;  4D8K A;  3H0H A;  3UF4 A;  2O31 A;  2FEI A;  1RLP C;  2V1R A;  2KYB A;  1HJD A;  4JZ3 A;  2EW3 A;  2FPE A;  3M0R A;  1SRL A;  1WXT A;  3SEM A;  2LNH B;  1U5S A;  2YUQ A;  1NG2 A;  1AD5 A;  5FWB A;  4J9C A;  1YN8 A;  5FWC A;  3VRY A;  1NYF A;  4RTX A;  2KT1 A;  1UJ0 A;  3REB B;  2JMA A;  1SPK A;  2FRW A;  2C0O A;  4JJC A;  2AZV A;  1GL5 A;  2YSQ A;  1V1C A;  2LQW A;  2PZ1 A;  1HD3 A;  2EGA A;  2K79 A;  3VS7 A;  1M8M A;  1GBR A;  4HCK A;  4OMN A;  2D1X A;  1ZUY A;  4J9D A;  2MOX A;  1H92 A;  2ESW A;  1X69 A;  4D8D A;  2W10 A;  2K2M A;  1SHG A;  4Y92 A;  1GRI A;  1YCS B;  3NPF A;  2L3P A;  1WXU A;  1ZUU A;  2CDT A;  2DBM A;  2EQI A;  1I07 A;  4AFZ C;  2ROT A;  2LCS A;  3R6N A;  1EFN A;  2CT3 A;  2B86 A;  4CC3 A;  1G83 A;  1AWX A;  2ED0 A;  4J9H A;  5GJV B;  1TUC A;  1PRM C;  1T0J A;  4GBQ A;  2EGC A;  2BZ8 A;  3EG0 A;  1GCQ A;  5L23 A;  1X43 A;  1K0X A;  1YWO A;  1B07 A;  4RUG A;  1BK2 A;  2MIO A;  1G2B A;  1VYV A;  3ZL7 C;  2KRS A;  2KNB B;  1B3Q A;  2ECZ A;  4RTW A;  3M0T A;  2O9V A;  3FJ5 A;  1X6B A;  2VWF A;  2HBW A;  2BZY A;  1JO8 A;  2HSP A;  1NLO C;  2EPD A;  1UHF A;  1NEG A;  2KYM A;  1JU5 C;  2CH4 A;  2MCN A;  1OEB A;  2DE0 X;  2YUP A;  5IXF A;  4J9B A;  1FMK A;  1AOJ A;  2DRM A;  2AZS A;  2GTJ A;  1GFD A;  3ULR B;  3I35 A;  2X3W D;  3VS1 A;  1AZG B;  1UTI A;  2J05 A;  1Z9Q A;  2NUZ A;  4Z88 A;  4RTY A;  2RMO A;  1MV0 B;  2J06 A;  2A36 A;  2LX7 A;  2GGR A;  4J9G A;  2DYB A;  3LH5 A;  2KRN A;  1UEC A;  1MUZ A;  5EC7 A;  2DL3 A;  4JPB W;  3QWX X;  1X6G A;  1VYU A;  4OMP A;  1CKB A;  1Y57 A;  1ZX6 A;  4AFQ C;  3QWY A;  4OML A;  2FPF A;  2LMJ A;  1AWW A;  2J6F A;  1K4U S;  1K76 A;  4E6R A;  4J9E A;  1PNJ A;  2NWM A;  2K3B A;  4JJD A;  1GCQ C;  4CC2 A;  4HVU A;  1RLQ C;  2KXC A;  1SSH A;  3I5R A;  2E5K A;  4HVV A;  3I5S A;  1KJW A;  1FYN A;  4DEX A;  2H8H A;  1M3B A;  1TG0 A;  3TSW A;  1X2Q A;  3UA6 A;  2D8J A;  1SRM A;  5HCK A;  1LCK A;  1GCP A;  1H8K A;  1WYX A;  4JZ4 A;  4RTU A;  3VS4 A;  3VS2 A;  1QLY A;  3CQT A;  3TSZ A;  4AFU C;  4AFS C;  1A0N B;  4RTT A;  1T0H A;  2IIM A;  2KR3 A;  3I9Q A;  1H3H A;  2KXD A;  2O9S A;  5IHI A;  5IHK A;  1UG1 A;  2RQW A;  4CC7 A;  1ZBJ A;  1JEG A;  1T3S A;  1N5Z A;  2PTK A;  2DMO A;  1WDX A;  1JXM A;  1K9A A;  1UHC A;  2AKK A;  3NGP A;  2K9G A;  4Z8A A;  2A08 A;  1M3A A;  1PWT A;  1X27 A;  2RPN A;  4DEY A;  1E7O A;  2P4R A;  2DL4 A;  1OPK A;  3UAT A;  1QCF A;  1NM7 A;  2EKH A;  1SEM A;  2YUN A;  2JW4 A;  2SRC A;  1W6X A;  2W0Z A;  2JMC A;  3M0U A;  2EVR A;  1I1J A;  3M0Q A;  3EGU A;  2LJ1 A;  1T3L A;  1YNZ A;  2L3S A;  2EYW A;  1QWF A;  5I11 A;  5ECA A;  3JV3 A;  2CSI A;  2KRO A;  2XMF A;  2D0N A;  1X2K A;  2JXB A;  3PVL A;  2DL5 A;  1UDL A;  3RBB B;  3UA7 A;  1OOT A;  2LQN A;  1K0S A;  2J6O A;  2DJQ A;  2FG0 A;  4R0K A;  2EBP A;  1NLP C;  1VA7 A;  2RQT A;  1PHT A;  1ZLM A;  2DNU A;  4Z89 A;  2X3X D;  1M27 C;  1QWE A;  4A63 B;  1WIE A;  2I0N A;  2KBT A;  1Z9Z A;  2A28 A;  2KGT A;  4CC4 B;  1M3C A;  3TVT A;  3EG1 A;  4JJB A;  4IIM A;  1PKT A;  2ED1 A;  4OMO A;  3RNJ A;  4RTV A;  3REA B;  4QT7 A;  2FPD A;  2A37 A;  2FO0 A;  4AG1 C;  1WLP B;  2GQI A;  5I22 A;  2CRE A;  2V1Q A;  1E6G A;  3KFV A;  2DM1 A;  4FSS A;  3VRZ A;  2DBK A;  4GLM A;  1QKX A;  2DA9 A;  2AK5 A;  1I0C A;  2F2W A;  1YWP A;  2BZX A;  1QKW A;  2HEQ A;  2RQV A;  5IH2 A;  1WX6 A;  1W70 A;  1HSQ A;  1W1F A;  2DL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...