3I5SA

Crystal structure of pi3k sh3
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
EGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies of the phosphatidylinositol 3-kinase (PI3K) SH3 domain in complex with a peptide ligand: role of the anchor residue in ligand binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Phosphatidylinositol 3-kinase regulatory subunit alpha
total genus 20
structure length 77
sequence length 77
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3i5sA00
2RN8A 5L23A 2NWMA 2X3XD 3H0IA 1WDXA 4LUDA 3JV3A 2BZXA 1HSQA 4OMQA 1IO6A 1UTIA 2RF0A 4J9GA 3NPFA 2LNHB 4CC2A 3CQTA 1JU5C 4RTXA 2F2XA 2FEIA 1UDLA 2DL4A 2W0ZA 3IQLA 4WCIA 3VRYA 2A37A 2LJ3A 4HVVA 1KFZA 2DL3A 1RUWA 4AFUC 3VS5A 2FPDA 1QLYA 2DA9A 3EG1A 2DF6A 2HBWA 2J06A 4E6RA 2CSQA 2FRYA 4DEYA 1SHFA 4OMLA 4ZNXA 2DBKA 3A98A 1X6GA 1T0JA 5FW9A 1OPKA 2OI3A 1I0CA 4CC7A 3M0PA 3C0CA 4J9CA 1Y0MA 4GLMA 1WXUA 2VKNA 2RQTA 2EYZA 4CC4B 2ECZA 1OV3A 3EHRA 5ECAA 2K2MA 5IXBA 4HVUA 2FPEA 2K7AA 2K79A 2AZSA 1AD5A 2A08A 1M8MA 2HDAA 1S1NA 4J9HA 1V1CA 1CKAA 2CUDA 2KXCA 2MCNA 3I9QA 1M30A 2K9GA 1AOJA 2YSQA 2DL5A 3VS1A 2GQIA 1GFCA 3H0HA 1VYTA 2ROLA 1QKWA 2ESWA 2F2VA 3H41A 3M0UA 2CUBA 1BB9A 1AWJA 4D8KA 4GBQA 3EGUA 2HCKA 2JS0A 2KROA 4F16A 2KRNA 2J6FA 2M51A 1BU1A 4IIOA 1JXOA 2L0AA 1AWXA 2VWFA 1JXMA 3EG0A 1H3HA 2HEQA 3PE0A 1NG2A 2AZVA 1B3QA 2KR3A 1I1JA 2SEMA 4LE9A 1E6HA 2H8HA 1UUEA 1MUZA 1ABOA 2YUQA 1GCQC 2KE9A 1X6BA 2YUOA 4Z88A 2M0YA 5IHKA 2EGCA 2YUNA 1U06A 4J9IA 4M4ZA 2RQVA 1GRIA 2RQRA 4RTWA 2EW3A 3M0TA 5FWBA 3U23A 2HSPA 1WFWA 1GBQA 2ABLA 1UHFA 2DYBA 2JTEA 2RPNA 4IIMA 3R6NA 1X2KA 2ED0A 2G6FX 1UG1A 1ZBJA 1BBZA 4J9EA 1G2BA 4JPBW 1ZX6A 2DJQA 5GJVB 1M3AA 1TUDA 3VS2A 1WIEA 2JM9A 3NGPA 4KRTA 5I22A 1TUCA 1Y57A 1FYNA 1QKXA 1EFNA 2YUPA 1KIKA 3M0SA 1HD3A 1PHTA 2DNUA 2LP5A 2RMOA 3M0RA 4HCKA 3EG2A 2GNCA 1ZUUA 2A36A 2C0IA 5IHIA 2O9VA 2ED1A 2JS2A 2MIOA 5FWCA 3QWYA 2ENMA 2CT4A 2DE0X 3RNJA 2LX7A 3FJ5A 2O88A 2PTKA 2JT4A 2O31A 1KSWA 4ESRA 2EGEA 1MV0B 1OOTA 5IXFA 2JW4A 3UF4A 1SHGA 1K0XA 2FRWA 1H8KA 1NM7A 4LUEA 4Y92A 2JMAA 1NYFA 2LMJA 2KT8A 2RQWA 2F2WA 3EG3A 2I0NA 5GJWB 3TSZA 3VS4A 2LZ6B 2CDTA 3NHNA 2PZ1A 2KXDA 2J6OA 1X27A 4JZ3A 1UFFA 4R0KA 3UATA 1M3CA 1Z9ZA 2L3PA 4K11A 2L3SA 4JJCA 2DLPA 1K0SA 1NEBA 3EHQA 3M0QA 2KRMA 1VYUA 1A0NB 4RTVA 1AZEA 2BZYA 3ZL7C 1GBRA 4J9DA 1PRMC 3I5SA 2EYYA 2RNAA 1OPLA 1YWPA 2DL8A 1SPKA 2J6KA 3I5RA 2KEAA 4DEXA 2D1XA 2KT1A 2DM1A 3TSWA 1T3SA 1XOVA 2DMOA 1I07A 1AWWA 2SRCA 2IIMA 3SEMA 2AKLA 2CH4A 2BZ8A 5HCKA 2K3BA 1QCFA 1SSHA 2C0OA 2O9SA 2LQNA 4ORZA 3PVLA 4OMPA 3KFVA 1YP5A 1JEGA 2JXBA 1SRLA 4X1VA 2OAWA 1ARKA 2L2PA 4JJBA 2EKHA 2VVKA 2PNIA 2EGAA 2KGTA 3SHWA 1QWEA 4F17A 1YN8A 2K6DA 1ZUKA 2DBMA 1WXBA 1X43A 1G83A 1RI9A 2CT3A 1NLPC 1Z9QA 2DX1A 1T3LA 4D8DA 1N5ZA 3LH5A 3VS0A 4HVWA 2EQIA 1NLOC 1QWFA 3H0FA 1UECA 4AG1C 2C0TA 1WI7A 1UJYA 2YT6A 2B86A 2P4RA 2RQUA 1NEGA 2MOXA 2D8HA 1AZGB 1RLPC 5IHNA 4CC3A 2KYBA 1YCSB 1M27C 4RTYA 4JJDA 2YDLA 2AKKA 2EYWA 4RTTA 4F14A 4FSSA 4OMNA 1SEMA 2V1RA 1GCQA 1ZUYA 1UGVA 2J05A 1ZLMA 3VS6A 1PKTA 1BK2A 2LQWA 1WYXA 5EC7A 3O5ZA 1TG0A 1W6XA 2QDLA 4RTUA 1ABQA 1MV3A 3VS3A 4A63B 3TVTA 1SRMA 3UA7A 2KRSA 2LJ1A 3RBBB 2J7IA 1AVZC 1K4US 2EVRA 1KJWA 3PVQA 1PWTA 1GL5A 1W1FA 1HJDA 1B07A 2CH4W 1M3BA 4EIKA 2D8JA 4LN2A 2EPDA 2XMFA 1RLQC 1UJ0A 3NMZC 3REAB 4RTZA 2A28A 1U5SA 2V1QA 1W70A 1GFDA 3REBB 4HXJA 1FMKA 3I35A 1AWOA 1X2QA 1J3TA 2FPFA 1E7OA 2GTJA 2O2OA 2LCSA 2ROTA 1CSKA 3THKA 1GCPA 1WXTA 1PNJA 1WX6A 4OMMA 1U3OA 3QWXX 1LCKA 1K9AA 2W10A 4RUGA 2L3QA 1AEYA 1JO8A 4Z89A 2KBTA 2FO0A 1UHCA 3VS7A 1PRLC 2DRMA 3VRZA 2CREA 1K76A 2JMCA 4QT7A 1CKBA 4JZ4A 4AG2C 2FG0A 2D0NA 4J9BA 1WLPB 3ULRB 1JQQA 5IH2A 2KNBB 4AFSC 1E6GA 1WA7A 2AK5A 2DRKA 3UA6A 2DL7A 2EBPA 1UE9A 1OEBA 2EYXA 2DVJA 2GBQA 1VYVA 1T0HA 2GGRA 2KYMA 2OJ2A 1YWOA 4J9FA 2X3WD 2GTOA 4Z8AA 2LJ0A 1NYGA 2BTTA 2CSIA 1PKSA 2DILA 4AFQC 1ZSGA 2JM8A 1VA7A 4AFZC 1X69A 4OMOA 4LNPA 3GBQA 2E5KA 2NUZA 1YNZA 5I11A 1H92A 1K1ZA
chains in the Genus database with same CATH superfamily
5L23A 2LDMA 3CCMQ 5A0GA 2NWMA 5GAOq 3H0IA 1BI1A 1WHGA 3JV3A 1W2BS 1YJNQ 1QP3A 2RHUA 1HSQA 4WTOB 2RF0A 4PFZA 2EQMA 5HK3A 1UDLA 3CMET 3JCMc 2AT1B 3IQLA 1VQOT 3VRYA 4L6V5 2LJ3A 4HVVA 5LJ5d 4NL2A 1VQKA 2FPDA 4OB3B 2IPOB 2EFIA 3EAEA 3M58A 4DEYA 3OBYA 4A4KA 1SHFA 5GAN3 2LQKA 1YJ9A 4OMLA 2DXUA 2O4XA 1OPKA 2OI3A 4CC7A 2DZ9A 2RI2A 3J80E 4QVDA 3I56A 4BI4A 1B7TA 3M53A 4GLMA 4C5IA 1WXUA 2FZKB 3JCMf 1G3WA 5LJ3g 1G3TA 1K8AR 4OMFB 3EHRA 4M78B 2K2MA 3VJPA 4IUQA 2AZSA 1TTHB 4FYVB 1V29B 2HDAA 4N0AA 1JRIA 1S1NA 1VQPQ 1MMNA 3CCUT 1O75A 3X25B 1AOJA 1TU0B 2A3LA 4KBMB 1FMWA 1GFCA 2XU8A 2DIQA 4J6XA 3H41A 1WJSA 1SF9A 4M7AD 4F16A 3I55T 2DTHA 2M51A 2CYZB 4XTXA 2JVVA 3C94A 1WHLA 2L0AA 2CS7A 3G4ST 4M7DE 1ZQ1A 3MP6A 1SG5A 3EG0A 1H3HA 3FC3A 2HEQA 1NG2A 2KR3A 3V7CA 4LE9A 1I4K1 1MHNA 2H8HA 1MUZA 1GCQC 4IUTA 4C5EA 1X6BA 4Z88A 4F7UE 2RO0A 2OTJQ 3LX7A 2YUNA 4MDWA 4J9IA 4KH1B 1I81A 2XG8D 4M7DG 2AHJB 4RTWA 2D0QB 4XU0A 4DA4A 3KBGA 3CXCA 2ED0A 2G6FX 4C92G 2K57A 3VUBA 1BBZA 3CCLQ 4C5HA 2WACA 4JPBW 4PJMA 5GAOm 2JM9A 2A7YA 4PJOG 5I22A 1I5OB 3MO8A 4C8QG 3CPWA 3HKSA 2YUPA 1KIKA 4FM4B 2LP5A 4LXCA 5J3BA 2X4YA 4PL6A 1ZUUA 2A36A 2F5KA 2ED1A 3CD6T 3RKWA 4KULA 3HRSA 5C0MA 5FWCA 2OAUA 1VOMA 3JB9J 2O88A 2JT4A 1VQKQ 1OOTA 2ZPHB 1H8KA 4Y92A 4RCCA 1NYFA 2LMJA 2KT8A 1YITT 2YHTA 1ACMB 3TSZA 3OS0A 2XHCA 2ZPGB 2KXDA 4MZPA 1UFFA 3UATA 1Z9ZA 4K11A 2JN0A 4MMKA 5GANj 2DLPA 1K0SA 3L2RA 3EHQA 3G4SQ 1VIFA 4QVCA 1VYUA 4BI3A 3TREA 4ZTJA 1PRMC 2EYYA 5KYUA 2IG0A 1OPLA 3I56T 2X4JA 1IZ6A 2K3XA 3CC4Q 2ZPEB 2J6KA 1SPKA 2M9UA 1U1SA 3I5RA 1QVGP 4PLLA 5CQXA 1AWWA 2SRCA 3SEMA 2LTOA 1VQNT 5HCKA 2HBPA 3QYHB 1QCNA 1QCFA 5FRNA 3R6OA 1SSHA 2O9SA 3JB9G 4M77D 2YRVA 5J39A 1OU8A 3RIRA 3G71A 4OMPA 1YP5A 1Q81U 2Y4XA 2XIDA 4ANJA 1ARKA 2L2PA 3T9NA 3FEOA 2PU9B 2XD0A 2EKHA 2VVKA 2EGAA 1K9MR 4F7UB 3HHTB 2K6DA 1K8AU 2VB6A 1MMGA 4M78F 1RADB 2DFUA 5LJ3h 2EJFA 1G83A 3EGXB 1YCYA 3J7AF 3MP8A 1NLPC 2RI5A 3OYKA 4C92E 1FXXA 3SWNB 4D8DA 3E19A 3LH5A 2OTLA 4C92F 2LVMA 4TVRA 3H0FA 1D1BA 4AG1C 4E7JA 2DAQA 2P4RA 1KD1C 3MEUA 2VC8A 4QQGA 3CD6Q 3M4YA 1RLPC 1Q86U 4JJDA 5LL6S 4F14A 5CKHA 2V1RA 1GCQA 1ZA2B 2J05A 3VS6A 1N8RC 1WYXA 5EC7A 3META 1PC0A 1RAHB 2VV5A 1D0YA 2RHIA 3UDCA 4FSXA 3VS3A 3RDVA 1VQ9A 3CCLT 3OYAA 2KSSA 1SRMA 1X75C 2LJ1A 2J7IA 4DOVA 1OYXA 1YBYA 4ELZC 4OB1B 4AMCA 4EIKA 4PNOA 4DOWA 4GY5A 2E10A 1LOJA 3NMZC 1Q82U 2FZGB 1OZ2A 1Q95G 3QHSA 4FYXB 1VQNA 3MEVA 2CP5A 3H8ZA 4A4FA 5GMKe 4HXJA 1VQ5T 2BE7D 4A54A 5GMKh 2X9HA 3I35A 1AWOA 1WGSA 1J3TA 2LRQA 1E7OA 3G71Q 3JCMe 3LW5E 3JCMh 3CCMA 4E7HA 1LCKA 4M77E 2GFAA 2W10A 3CCQQ 2L3QA 2QA4T 2FO0A 4LD9K 1UHCA 2O4XB 4KH0B 1MNDA 1MNEA 4VUBA 3JSCA 1PG5B 4QT7A 1Q86C 1CKBA 4JZ4A 4J9BA 2D0NA 1WLPB 2QQSA 1C1AA 2JTFA 4D6WA 3CC7Q 2AIRB 5LJ3f 4AFSC 2DJZA 4M77G 2AK5A 3CCVA 5KCHA 2DRKA 2MPXC 2DL7A 1KQ1A 3QYGB 1D09B 2GBQA 4JLIA 1WJQA 1T0HA 2COWA 5CK9A 2OJ2A 1M1KR 4HCZA 2X3WD 3OW2S 4E7KA 3INZA 5FU6B 2GTOA 2DXCA 2DILA 5GAOp 1ZSGA 2VGNA 1OQKA 3JRZA 1I5LA 5GAN6 4M7AB 5DLOA 5KYWA 2HSEB 1RL2A 4EPCA 1UGRB 1D3BA 3GBQA 1IREB 1VQMQ 2NUZA 2DXBA 2GFUA 1H92A 2DIGA 3JB9F 1QP2A 1WDXA 4ZN3A 3BDUA 3CXCS 4F7UF 3RUXA 3E9GA 3NPFA 2LNHB 1TOVA 3CQTA 2XK0A 1M1FA 4XU3A 2F2XA 4M77A 4GLKA 4M7DB 2W0ZA 1VQKT 2L5QA 4WCIA 1X01A 1Y96A 2JTMA 2DXTA 1NPRA 1JJ2A 3C95A 2FHDA 3PNWC 1KD1U 2CSQA 4FT2A 4DBHA 1N27A 3OYDA 2EQKA 3F70A 7AT1B 4E7LA 2DBKA 3A98A 5FW9A 1IXDA 1I0CA 3DLMA 1XJWB 5HK0A 3C0CA 4J9CA 5D6XA 1FMVA 3ZFJA 2VGMA 1KD1R 3DB3A 3OQ5A 2VKNA 3OYCA 1QW1A 2EYZA 2MAMA 2ECZA 3BW1A 3G6EA 5ECAA 1VQ8A 1M5Q1 2JUFA 2K7AA 2K79A 1AD5A 2ZGWA 2E6ZA 1M8MA 2LT4A 1S72T 1H3ZA 3MHXA 3QZ5B 4OB0B 2CUDA 2KXCA 3D7SB 4BY6B 3CC4T 3WVEB 4F04B 2MF2A 4PJJA 2GQIA 3QJ6A 1OULA 5GAOn 4X9DA 3M0UA 2F69A 2DTOA 1WQWA 1AWJA 3JCMb 2JS0A 2KROA 2QYZA 3QDFA 3C12A 5LJ3e 3EH2A 1M1KC 2VWFA 4LDVA 1JXMA 4C92A 3CMAT 2QQBA 3G4SA 3PE0A 2AZVA 1B3QA 3DKMA 1MMAA 4M78G 1Y96B 1BI3A 2PUKB 2K3YA 3OYEA 4L5GA 1UUEA 4M7DC 2E1HA 5IHKA 3L2QA 3OSVA 1U06A 3G1JA 3EFRA 1Q86R 4C0DB 4C5GA 3X20B 4BE0A 3AT1B 3HPWA 3U23A 3QG1A 3TEEA 1GBQA 2ABLA 3RKYA 3LGLA 1YHQA 3CCUA 2E5QA 5CVIA 4PJOF 4IIMA 1LNXA 1BKBA 2WSCE 3LWHA 1G2BA 1TUDA 4LDYA 4BACA 4CI0C 1PD0A 3G6EQ 2NUPB 1FYNA 4LDWA 3NTIA 1QKXA 1YHQQ 1Y7XA 4NS5A 1RAAB 4KUIA 1TXQA 3L42A 1QQJA 1HD3A 3M54A 4ZN1A 4HCCA 3VYGA 1VQ8T 2I2LA 4J5YA 3L2UA 3M0RA 2C0IA 4M75D 5L8RE 2JS2A 4XTUA 1VQ4T 2CT4A 2DE0X 2KK4A 5GMKm 5GAOl 2ATCB 3ZBDA 2O31A 2QEXT 4EMKC 3RR6A 4KUDK 1KSWA 2M02A 4ESRA 1VQMT 2EGEA 1MV0B 3MP1A 4M78A 3JCMW 1XTDA 2JW4A 3UF4A 2EJ9A 2CZ7B 1FX7A 4LUEA 2RQWA 2F2WA 1TSFA 2RHZA 3EG3A 3PIPA 2P4TA 2I0NA 2LZ6B 3NHNA 2J6OA 1X27A 1OX9A 3OMGA 4R0KA 2L3SA 4C0ZA 1M1GA 3CCST 5KYWB 4E47A 2D6FA 2BZYA 4ZGDB 1TS9A 5GAMh 1GBRA 2C06A 5GANe 1KHCA 3EH1A 1D0ZA 3ZEHA 3CC7T 4E7IA 3G7ZA 2X51A 1XOVA 3A8OB 2DMOA 4IKFA 2CP0A 1VUBA 1Q81C 3QIIA 1WHKA 2BZ8A 3RKXA 4XU2A 1PSEA 1UGQB 3L1AA 2K3BA 3QUIA 1M4ZA 1R8OB 2XDDA 1GXIE 3A5ZB 5KYXB 3V8LA 1JEGA 2JXBA 8AT1B 1SRLA 3RMQA 2QI2A 2PVDB 2OAWA 2GQVA 2RHYA 2Y90A 3OBWA 3SHWA 1UB4A 3EG9A 1WHHA 3CMAA 5I2MA 2DBMA 1WXBA 1YJWA 1X43A 2ZAEA 1VQPT 1RI9A 1BYMA 2CT3A 1D1AA 2E3IA 4RG8A 4E7ZA 2OTJA 1PCXA 1VQ4Q 3EGDA 1N5ZA 2ZPFB 2EQIA 4MMLA 1UECA 3A8HB 2X35A 1BCMA 3OS5A 1UJYA 2YT6A 2B86A 3JB9D 2RQUA 1NEGA 2D8HA 1QMCA 1YJ9T 1VQ6T 1AZGB 5IHNA 3CCMT 1N8RR 1IGUA 3CC2Q 2YDLA 2AKKA 4FSSA 4OMNA 2XDPA 5CQYA 2CP6A 3ME9A 5D6YA 1VQ7Q 4N4HA 3CCSA 1S72Q 1YJNA 3JCMJ 3BDLA 3H9NA 4PJOD 3QKJA 4RTUA 4OF1A 2FZCB 2JOYA 4A63B 3TVTA 2RHXA 4DBQA 3JCMX 4ATOA 5KYUB 4LDUA 1UEBA 2EVRA 1GL5A 3CCEQ 3V7SA 1JJ2S 3QSUA 4JRKA 1AT1B 2RK2A 2VXFA 2YLBA 1UJ0A 1VQ7T 1VQLA 3OYGA 4RTZA 4DBFA 1VQLQ 4EMGA 3CCQA 1FMKA 3HFOA 5CO7A 1X2QA 3GPLA 2FPFA 1JBMA 4M75F 3SD4A 4J7IA 4DQ2A 2H3EB 4RMOA 2EYQA 4J7FA 4OMMA 4LD6A 3QWXX 4C8QE 1QVFP 2DRMA 4ZTFA 4PKCC 2D9TA 5GAMj 3CEYA 1K76A 1KC8U 1B34B 3KXTA 2FG0A 3MPUB 3P8DA 3ULRB 1VQNQ 3CC2A 1ZHIA 4JRPA 1OU9A 1OEBA 2DVJA 4RG2A 4PJOC 1VYVA 4J6WA 3LGFA 3JCMg 2GGRA 2IVWA 4FCYA 2F1LA 1VQ6A 4N4IA 1YWOA 1K9MC 4J9FA 3EFOB 2B8AA 2CSIA 1PKSA 2QTVA 2RJEA 1YJWQ 1VA7A 5I2SA 5CR2A 4J83A 2QDYB 5FU7C 2M16A 4OMOA 3CCEA 3LH0A 1QVFS 1Q81R 1WNLA 2LCLA 1WQ7A 1K1ZA 3L2ZA 3QXEB 2X3XD 2MWOA 2HD0A 2RI3A 3HTRA 3JCMd 4C92B 3CCSQ 1S72A 4OMQA 1IO6A 2V8IA 4J9GA 2OTLQ 4FW2A 4BDZA 4RTXA 4B6MA 2YRDA 4B9XA 3M5AA 2KDSA 1QVFA 3I55Q 5HKCA 1SKUB 1KFZA 2DL3A 1LPLA 1RUWA 3VS5A 1YI2Q 3EFOA 4QQDA 4KGZB 1NZ9A 1QLYA 3EG1A 2EAYA 2HBWA 2QEXQ 1OZ3A 1W2BA 1VQ5Q 3PGGA 4ZNXA 2KVQG 5LJ5g 3CCJQ 1T0JA 3HSBA 1ZSZA 3EGDB 3M0PA 3OSSC 5GAMe 5GAN2 2DK3A 2OX7A 4BE2A 2KQWA 2GCXA 4P5NA 5GAN8 2X4XA 3CPWS 4R55A 4WF2A 1WHMA 2RQTA 5A0LA 3FRNA 3CBOA 4EMHA 4CC4B 5IT9E 3OYFA 3DLLA 3Q1JA 5IXBA 4HVUA 2LX9A 5GMKl 4F7UG 4JJNK 3CD6A 3RERA 4IUVA 3NTKA 4HKEA 1V1CA 1CKAA 2MCNA 1WJRA 1NE8A 3I9QA 3M59A 1M30A 2YSQA 3M55A 2ZPBB 3CCJT 2DD4A 3H0HA 1VYTA 2ROLA 1EIFA 2ESWA 3PT9A 2CUBA 3SFMA 1Q7YR 1BB9A 2RJDA 3UT1A 3G71T 4D8KA 4PJOA 3DB4A 2E70A 3CXCP 3EGUA 5LJ5f 4M77B 2KRNA 1C6VX 2JJ9A 1UGPB 4IIOA 2HMAA 5GAMd 4A4HA 4KGVB 1NBEB 3WXMB 3CMEQ 2HQHA 1XQHA 1AWXA 3EGXA 3JCMP 2VYTA 2DERA 5KCOA 1H641 3HRUA 2MK5A 4M77C 3VYHB 2L3RA 4OVAA 2SEMA 1YJNT 1E6HA 1ABOA 1WPYA 2YUQA 5CKDA 1BIBA 3CBPA 4XTZA 5KYYA 2M0YA 4FIBA 4EMKB 3L2WA 4M4ZA 2RQVA 1G3YA 2G3RA 2EW3A 3M0TA 5FWBA 2DKGA 1YHQT 2K5FA 1UHFA 2DYBA 4M75A 3R6NA 4ZGJB 1X2KA 2P0QA 3HL8A 1VQPA 1G5VA 3EFSA 2HAXA 5KE2A 2DJQA 4N4GA 3A1PA 1D0XA 1M3AA 3VUZA 1QCOA 2HKQB 3NGPA 4EDUA 3RMSA 3CCET 1U1TA 1Y57A 2VASA 3NTHA 3FDRA 1EFNA 3CCRA 5D7UA 5LJ3j 3M0SA 1KQSS 2LC4A 2DNUA 3UPUA 2RMOA 2MYSA 2QA4Q 4HCKA 3EG2A 2GNCA 1BIAA 2O9VA 9ATCB 3QDRB 4DBRA 4E2FB 2MIOA 2PUOB 2H3JA 4C8QC 4PJOB 3RNJA 3FJ5A 1KQSA 8ATCB 3QO3A 1SHGA 1K0XA 1R0CB 2WSFE 2FRWA 4M7AF 2ZPIB 2JMAA 5FU6C 3GNGA 3S3MA 1G3SA 3VS4A 2PZ1A 4XTYA 4M75G 2NUPA 4X34A 2COZA 4FU6A 4JZ3A 2KI7A 2L3PA 5LJ5h 1VQLT 4PJOE 2YLCA 1NEBA 5LJ5e 1EZZB 2KRMA 2RK1A 2NUTB 3S6WA 1AZEA 4C8QA 3CCLA 4J9DA 1HXDA 3I5SA 2RNAA 4HA8A 3OYIA 2V8JA 2HZYA 3M9QA 1YWPA 2KEAA 4M75E 4DEXA 4R56A 4OP0A 3E9FA 1WHJA 3TSWA 1T3SA 2R58A 3GNFB 4KT0E 1VQ5A 2JZ2A 3S3NA 1VQ6Q 2QEXA 2C0OA 2LQNA 3N5BB 1M8VA 2LCCA 1KK7A 2LQ8A 2KY9A 3PMIA 3JAME 3CCJA 3BFMA 1YJ9Q 3KUFA 1RAFB 1IHVA 3HFNA 1M2OA 1QWEA 1M2VA 1YFNA 4F17A 1YN8A 3GOXA 2QASA 4XK8E 1Q82R 1Z9QA 2FYKA 4JRIA 1QVGA 2DX1A 1YJWT 1D1CA 2ZZDA 4OGCA 1UGSB 1K8AC 1T3LA 4FYYB 4HVWA 1NLOC 1QWFA 3X24B 1KHIA 2EQUA 1KC8C 1M90U 2MOXA 2QGFB 4A4EA 2KYBA 4HT8A 2XDBA 3A8LB 4B9WA 2K5IA 3OW2A 1SEMA 1ZUYA 1UGVA 2QK0A 4M7DA 2E6NA 1NPPA 1PKTA 4FYWB 4KGXB 4CRIA 1BK2A 2LQWA 1XNIA 2BKDN 2QQAA 2QDLA 4FL6A 1ABQA 3A8GB 1MV3A 2FL7A 3V7RA 3UA7A 2KRSA 3RBBB 6AT1B 1Q7YU 4BDYA 1AVZC 1K4US 4PFOA 1B07A 2CH4W 4HT9A 3FJPA 1MGQA 3P8BB 4C92D 5HY6A 4PK4A 4Q5WA 2D8JA 2XI9A 2EIFA 2KMTA 4C8QF 2EPDA 2XMFA 1RLQC 1D3BB 2DEQA 1M1KU 2A28A 2EQJA 2V1QA 1W70A 5GAMf 1R0BG 1GFDA 4FW1A 4BI8B 2QXFA 4M75C 2RJFA 4Z02A 1YIJT 2R57A 5IN1A 4JRQA 4C8QB 2O2OA 1PSFA 1CSKA 3THKA 4C92C 1GCPA 2E3HA 2RH2A 1WXTA 1PNJA 1K9AA 2Y4YA 2QQ9A 4RUGA 1YITA 1AEYA 4Z89A 5CAIA 1ZSZB 3OA6A 3E1SA 3M57A 2DVEA 3NFCA 1P92A 1RAGB 2CREA 5GANf 2JMCA 2PVGB 4II1A 4AG2C 5GMKi 1JQQA 2KNBB 3V8JA 1FWZA 1WA7A 2RJCA 1VQOA 3CC2T 1K73C 2EBPA 2DO3A 3LYIA 2EYXA 3FLGA 2M0OA 2YWWA 1W4SA 3URGA 2VUBA 1M90R 4MDXA 1VQ7A 2KYMA 5AT1B 5GANd 2FVUA 2F5TX 4NL3A 3CPWP 2X4WA 4Z8AA 3J81E 2LJ0A 3MEWA 2BTTA 3O8VA 1JJ2P 5FLXE 3VU3C 2JM8A 3P8HA 4AT1B 3LWIA 4QQ6A 4LNPA 2DD5A 3JB9H 3OS1A 5I11A 5IAYA 1LJOA 4XU1A 2WSEE 2RN8A 3VV0A 1NJIU 1X6OA 4C0FA 1YI2T 4J8OA 4LUDA 1N9RA 2NYSA 2BZXA 2QAZA 1YIJQ 1UTIA 2DTIA 3GIBA 3CCRQ 4CC2A 1JU5C 4HCBA 5KYYB 2BIVA 4X9CA 2DZCA 2FEIA 4JDSA 4BD3A 2DL4A 5LJ3d 2M1HA 2XICA 2DEUA 2A37A 1IGQA 3CCRT 3OYHA 4AFUC 3QBYA 2DA9A 2DF6A 4O5VA 2NUTA 2J06A 4E6RA 2FRYA 2VXEA 4QKUA 5CKFA 4M7AE 4XTVA 1X6GA 3SWNA 4O6JA 2NLUA 3OYNA 3MEAA 1Y0MA 5CCAA 3S3OA 4M78E 3OYYA 5KYNA 2QG9B 3V8KA 1OV3A 3ER0A 2FPEA 2MWPA 2E65A 3QJYA 3MCAB 2A08A 2P0KA 1OX8A 4J9HA 2EJGA 3FB9A 5DY9A 5AYFA 2K9GA 2CP2A 2O01E 5KYXA 2DL5A 3VS1A 3SB2A 2OTLT 2P84A 4XTWA 4FT4A 1BI0A 3GF5A 3SWNC 1QKWA 2F2VA 1NJIR 2A0FB 4GBQA 1PM3A 2HCKA 4Y28E 3CMAQ 2J6FA 2DYIA 4MZMA 2EKOA 1BU1A 3M56A 4MZTA 1JXOA 2CZ6B 4JUVA 4M77F 1PD1A 3FIFA 2E41A 3PFSA 3X28B 4F7UA 2HNIA 5GAMg 1I1JA 2E12A 2V8KA 5GANh 1G8XA 1K73U 1C0MA 2LNVA 2KE9A 1OI1A 2YUOA 1TUGB 4PJLA 2L89A 2EGCA 1GRIA 2HQXA 2RQRA 4XQ3A 4E7SA 4PFPA 4BE1A 1V76A 1KQSP 2HSPA 1WFWA 2JTEA 2RPNA 5FRMA 2CZ1B 1UG1A 1ZBJA 5CKEA 3QPHA 4J9EA 4M7DD 3CCUQ 3A8MB 3L2VA 5GAN7 1ZX6A 5GJVB 3VS2A 2L8DA 1WIEA 4KRTA 1NJIC 1TUCA 4RKUE 4L59A 4ELYC 1HYOA 4JLGA 2BE9B 3OB9A 1PHTA 3TU4K 1IHWA 4QW2A 1RACB 5IHIA 4RCBA 2XKOC 2RB6A 1RABB 1Y07A 4IUUA 3UWNA 4M7AG 3QWYA 4M78C 2ENMA 3CC4A 2LX7A 2K4YA 2PTKA 2QGGA 2RM4A 1TWBA 2PQWA 5DLQE 5IXFA 1KQ2A 2GF7A 1NM7A 3TCJA 2EWNA 2R5AA 5GJWB 3E2UA 2CDTA 1QVGS 4M7DF 4IURA 1M3CA 3I56Q 5FU7B 4JJCA 1DJ7B 1B34A 2DPPB 3M0QA 3CBMA 1A0NB 1RAEB 4RTVA 5GANg 2E64A 3ZL7C 1VQMA 3OYMA 3CMEA 3G6ET 2DL8A 4IUPA 2HL3A 2COYA 2D1XA 2KT1A 1N9SA 2DM1A 3BE3A 3MJXA 2CP7A 1ZSZC 1I07A 5GAN4 2IIMA 2QA4A 2AKLA 2CH4A 5KE3A 5I21A 1N6AA 2OTJT 4C0DC 4C0GA 4ORZA 3PVLA 3KFVA 4J6YA 2YXYA 2K2VA 1VQOQ 1HK9A 5J26A 4X1VA 5A2QE 1VQ9T 2HKNA 5CKBA 4M78D 3CC7A 2R5MA 2HL5C 4JJBA 1BI2A 2CP3A 2CKKA 3CPFA 2E4HA 4BUGA 2PNIA 2KGTA 2DETA 3JCMQ 2PVOB 4ME7A 1M90C 3MKDA 5GAOr 1JB0E 1ZUKA 5GAN5 2CGHA 3ASKA 4JS4A 1M2VB 4QVZA 3RESA 2QTXA 1TH7A 1IRXA 1R77A 3LLRA 1BCOA 3VS0A 4M7AC 1YIJA 3OW2P 1U8RA 1RI0A 3BY7A 1KG1A 2C0TA 4XAXB 4BY6C 1WI7A 2V26A 3OYLA 4N0AC 2ZCFB 3I55A 4CC3A 1YCSB 1M27C 4RTYA 1VQ8Q 1ZBXA 2RD1A 4RTTA 2EYWA 2KAFA 4PJNA 1ZLMA 2BUDA 5M9OA 2LT1A 3O5ZA 1TG0A 1W6XA 1KC8R 3PMTA 3JB9I 1MMDA 1M9SA 4M7AA 5GMKj 1WZOA 2MMPA 3H6ZA 5C6SA 4M75B 3EG9B 4A4GA 3OYJA 1KJWA 3PVQA 1PWTA 1HJDA 1W1FA 1M3BA 1F1BB 3OY9A 3C4SA 1K9MU 4LN2A 3OYBA 1RAIB 3CCVQ 1Q82C 5A0DA 1VIEA 3HRTA 1Y71A 1IB8A 2K5LA 3REAB 1U5SA 3REBB 2CZ0B 2FB7A 4JS5A 4A53A 4YTLA 2RA2A 2JNGA 3TQ7P 3OMCA 2GTJA 2LCSA 2ROTA 1W2BP 1YITQ 1ZA1B 3GLXA 4ZGEB 3PTAA 4EMKA 1WX6A 1U3OA 1N8RU 4OB2B 1AHJB 3M4GA 5LJ5j 1JO8A 5FROA 3WVDB 4OGEA 2KBTA 2QQRA 1YI2A 1SSFA 3VS7A 4Y91A 1PRLC 1K73R 3VRZA 4LDXA 4C8QD 3CCQT 3PIOA 3AHUA 4V2SA 2YRCA 3CCVT 5IH2A 3JCMV 3OS2A 1E6GA 1O9SA 1VQ9Q 3HP9A 3UA6A 5DM7R 1I8FA 1UE9A 4NOYA 1LVKA 4UC4A 3QZ9B 1VQ4A 2Z0WA 2MI6A 2HQEA 1NYGA 2P0PA 4AFQC 5CIUA 4PLIA 4AFZC 1Q7YC 1X69A 5EG2A 4BB7A 3VKIA 5KH6A 3SDZA 5D6WA 3X26B 1EX4A 2E5KA 1QVPA 1YNZA 3GP8A
chains in the Genus database with same CATH topology
2RN8A 5L23A 2NWMA 2X3XD 3H0IA 1WDXA 4LUDA 3JV3A 2BZXA 1HSQA 4OMQA 1IO6A 1UTIA 2RF0A 4J9GA 3NPFA 2LNHB 4CC2A 3CQTA 1JU5C 4RTXA 2F2XA 2FEIA 1UDLA 2DL4A 2W0ZA 3IQLA 4WCIA 3VRYA 2A37A 2LJ3A 4HVVA 1KFZA 2DL3A 1RUWA 4AFUC 3VS5A 2FPDA 1QLYA 2DA9A 3EG1A 2DF6A 2HBWA 2J06A 4E6RA 2CSQA 2FRYA 4DEYA 1SHFA 4OMLA 4ZNXA 2DBKA 3A98A 1X6GA 1T0JA 5FW9A 1OPKA 2OI3A 1I0CA 4CC7A 3M0PA 3C0CA 4J9CA 1Y0MA 4GLMA 1WXUA 2VKNA 2RQTA 2EYZA 4CC4B 2ECZA 1OV3A 3EHRA 5ECAA 2K2MA 5IXBA 4HVUA 2FPEA 2K7AA 2K79A 2AZSA 1AD5A 2A08A 1M8MA 2HDAA 1S1NA 4J9HA 1V1CA 1CKAA 2CUDA 2KXCA 2MCNA 3I9QA 1M30A 2K9GA 1AOJA 2YSQA 2DL5A 3VS1A 2GQIA 1GFCA 3H0HA 1VYTA 2ROLA 1QKWA 2ESWA 2F2VA 3H41A 3M0UA 2CUBA 1BB9A 1AWJA 4D8KA 4GBQA 3EGUA 2HCKA 2JS0A 2KROA 4F16A 2KRNA 2J6FA 2M51A 1BU1A 4IIOA 1JXOA 2L0AA 1AWXA 2VWFA 1JXMA 3EG0A 1H3HA 2HEQA 3PE0A 1NG2A 2AZVA 1B3QA 2KR3A 1I1JA 2SEMA 4LE9A 1E6HA 2H8HA 1UUEA 1MUZA 1ABOA 2YUQA 1GCQC 2KE9A 1X6BA 2YUOA 4Z88A 2M0YA 5IHKA 2EGCA 2YUNA 1U06A 4J9IA 4M4ZA 2RQVA 1GRIA 2RQRA 4RTWA 2EW3A 3M0TA 5FWBA 3U23A 2HSPA 1WFWA 1GBQA 2ABLA 1UHFA 2DYBA 2JTEA 2RPNA 4IIMA 3R6NA 1X2KA 2ED0A 2G6FX 1UG1A 1ZBJA 1BBZA 4J9EA 1G2BA 4JPBW 1ZX6A 2DJQA 5GJVB 1M3AA 1TUDA 3VS2A 1WIEA 2JM9A 3NGPA 4KRTA 5I22A 1TUCA 1Y57A 1FYNA 1QKXA 1EFNA 2YUPA 1KIKA 3M0SA 1HD3A 1PHTA 2DNUA 2LP5A 2RMOA 3M0RA 4HCKA 3EG2A 2GNCA 1ZUUA 2A36A 2C0IA 5IHIA 2O9VA 2ED1A 2JS2A 2MIOA 5FWCA 3QWYA 2ENMA 2CT4A 2DE0X 3RNJA 2LX7A 3FJ5A 2O88A 2PTKA 2JT4A 2O31A 1KSWA 4ESRA 2EGEA 1MV0B 1OOTA 5IXFA 2JW4A 3UF4A 1SHGA 1K0XA 2FRWA 1H8KA 1NM7A 4LUEA 4Y92A 2JMAA 1NYFA 2LMJA 2KT8A 2RQWA 2F2WA 3EG3A 2I0NA 5GJWB 3TSZA 3VS4A 2LZ6B 2CDTA 3NHNA 2PZ1A 2KXDA 2J6OA 1X27A 4JZ3A 1UFFA 4R0KA 3UATA 1M3CA 1Z9ZA 2L3PA 4K11A 2L3SA 4JJCA 2DLPA 1K0SA 1NEBA 3EHQA 3M0QA 2KRMA 1VYUA 1A0NB 4RTVA 1AZEA 2BZYA 3ZL7C 1GBRA 4J9DA 1PRMC 3I5SA 2EYYA 2RNAA 1OPLA 1YWPA 2DL8A 1SPKA 2J6KA 3I5RA 2KEAA 4DEXA 2D1XA 2KT1A 2DM1A 3TSWA 1T3SA 1XOVA 2DMOA 1I07A 1AWWA 2SRCA 2IIMA 3SEMA 2AKLA 2CH4A 2BZ8A 5HCKA 2K3BA 1QCFA 1SSHA 2C0OA 2O9SA 2LQNA 4ORZA 3PVLA 4OMPA 3KFVA 1YP5A 1JEGA 2JXBA 1SRLA 4X1VA 2OAWA 1ARKA 2L2PA 4JJBA 2EKHA 2VVKA 2PNIA 2EGAA 2KGTA 3SHWA 1QWEA 4F17A 1YN8A 2K6DA 1ZUKA 2DBMA 1WXBA 1X43A 1G83A 1RI9A 2CT3A 1NLPC 1Z9QA 2DX1A 1T3LA 4D8DA 1N5ZA 3LH5A 3VS0A 4HVWA 2EQIA 1NLOC 1QWFA 3H0FA 1UECA 4AG1C 2C0TA 1WI7A 1UJYA 2YT6A 2B86A 2P4RA 2RQUA 1NEGA 2MOXA 2D8HA 1AZGB 1RLPC 5IHNA 4CC3A 2KYBA 1YCSB 1M27C 4RTYA 4JJDA 2YDLA 2AKKA 2EYWA 4RTTA 4F14A 4FSSA 4OMNA 1SEMA 2V1RA 1GCQA 1ZUYA 1UGVA 2J05A 1ZLMA 3VS6A 1PKTA 1BK2A 2LQWA 1WYXA 5EC7A 3O5ZA 1TG0A 1W6XA 2QDLA 4RTUA 1ABQA 1MV3A 3VS3A 4A63B 3TVTA 1SRMA 3UA7A 2KRSA 2LJ1A 3RBBB 2J7IA 1AVZC 1K4US 2EVRA 1KJWA 3PVQA 1PWTA 1GL5A 1W1FA 1HJDA 1B07A 2CH4W 1M3BA 4EIKA 2D8JA 4LN2A 2EPDA 2XMFA 1RLQC 1UJ0A 3NMZC 3REAB 4RTZA 2A28A 1U5SA 2V1QA 1W70A 1GFDA 3REBB 4HXJA 1FMKA 3I35A 1AWOA 1X2QA 1J3TA 2FPFA 1E7OA 2GTJA 2O2OA 2LCSA 2ROTA 1CSKA 3THKA 1GCPA 1WXTA 1PNJA 1WX6A 4OMMA 1U3OA 3QWXX 1LCKA 1K9AA 2W10A 4RUGA 2L3QA 1AEYA 1JO8A 4Z89A 2KBTA 2FO0A 1UHCA 3VS7A 1PRLC 2DRMA 3VRZA 2CREA 1K76A 2JMCA 4QT7A 1CKBA 4JZ4A 4AG2C 2FG0A 2D0NA 4J9BA 1WLPB 3ULRB 1JQQA 5IH2A 2KNBB 4AFSC 1E6GA 1WA7A 2AK5A 2DRKA 3UA6A 2DL7A 2EBPA 1UE9A 1OEBA 2EYXA 2DVJA 2GBQA 1VYVA 1T0HA 2GGRA 2KYMA 2OJ2A 1YWOA 4J9FA 2X3WD 2GTOA 4Z8AA 2LJ0A 1NYGA 2BTTA 2CSIA 1PKSA 2DILA 4AFQC 1ZSGA 2JM8A 1VA7A 4AFZC 1X69A 4OMOA 4LNPA 3GBQA 2E5KA 2NUZA 1YNZA 5I11A 1H92A 1K1ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RN8 A;  5L23 A;  2NWM A;  2X3X D;  3H0I A;  1WDX A;  4LUD A;  3JV3 A;  2BZX A;  1HSQ A;  4OMQ A;  1IO6 A;  1UTI A;  2RF0 A;  4J9G A;  3NPF A;  2LNH B;  4CC2 A;  3CQT A;  1JU5 C;  4RTX A;  2F2X A;  2FEI A;  1UDL A;  2DL4 A;  2W0Z A;  3IQL A;  4WCI A;  3VRY A;  2A37 A;  2LJ3 A;  4HVV A;  1KFZ A;  2DL3 A;  1RUW A;  4AFU C;  3VS5 A;  2FPD A;  1QLY A;  2DA9 A;  3EG1 A;  2DF6 A;  2HBW A;  2J06 A;  4E6R A;  2CSQ A;  2FRY A;  4DEY A;  1SHF A;  4OML A;  4ZNX A;  2DBK A;  3A98 A;  1X6G A;  1T0J A;  5FW9 A;  1OPK A;  2OI3 A;  1I0C A;  4CC7 A;  3M0P A;  3C0C A;  4J9C A;  1Y0M A;  4GLM A;  1WXU A;  2VKN A;  2RQT A;  2EYZ A;  4CC4 B;  2ECZ A;  1OV3 A;  3EHR A;  5ECA A;  2K2M A;  5IXB A;  4HVU A;  2FPE A;  2K7A A;  2K79 A;  2AZS A;  1AD5 A;  2A08 A;  1M8M A;  2HDA A;  1S1N A;  4J9H A;  1V1C A;  1CKA A;  2CUD A;  2KXC A;  2MCN A;  3I9Q A;  1M30 A;  2K9G A;  1AOJ A;  2YSQ A;  2DL5 A;  3VS1 A;  2GQI A;  1GFC A;  3H0H A;  1VYT A;  2ROL A;  1QKW A;  2ESW A;  2F2V A;  3H41 A;  3M0U A;  2CUB A;  1BB9 A;  1AWJ A;  4D8K A;  4GBQ A;  3EGU A;  2HCK A;  2JS0 A;  2KRO A;  4F16 A;  2KRN A;  2J6F A;  2M51 A;  1BU1 A;  4IIO A;  1JXO A;  2L0A A;  1AWX A;  2VWF A;  1JXM A;  3EG0 A;  1H3H A;  2HEQ A;  3PE0 A;  1NG2 A;  2AZV A;  1B3Q A;  2KR3 A;  1I1J A;  2SEM A;  4LE9 A;  1E6H A;  2H8H A;  1UUE A;  1MUZ A;  1ABO A;  2YUQ A;  1GCQ C;  2KE9 A;  1X6B A;  2YUO A;  4Z88 A;  2M0Y A;  5IHK A;  2EGC A;  2YUN A;  1U06 A;  4J9I A;  4M4Z A;  2RQV A;  1GRI A;  2RQR A;  4RTW A;  2EW3 A;  3M0T A;  5FWB A;  3U23 A;  2HSP A;  1WFW A;  1GBQ A;  2ABL A;  1UHF A;  2DYB A;  2JTE A;  2RPN A;  4IIM A;  3R6N A;  1X2K A;  2ED0 A;  2G6F X;  1UG1 A;  1ZBJ A;  1BBZ A;  4J9E A;  1G2B A;  4JPB W;  1ZX6 A;  2DJQ A;  5GJV B;  1M3A A;  1TUD A;  3VS2 A;  1WIE A;  2JM9 A;  3NGP A;  4KRT A;  5I22 A;  1TUC A;  1Y57 A;  1FYN A;  1QKX A;  1EFN A;  2YUP A;  1KIK A;  3M0S A;  1HD3 A;  1PHT A;  2DNU A;  2LP5 A;  2RMO A;  3M0R A;  4HCK A;  3EG2 A;  2GNC A;  1ZUU A;  2A36 A;  2C0I A;  5IHI A;  2O9V A;  2ED1 A;  2JS2 A;  2MIO A;  5FWC A;  3QWY A;  2ENM A;  2CT4 A;  2DE0 X;  3RNJ A;  2LX7 A;  3FJ5 A;  2O88 A;  2PTK A;  2JT4 A;  2O31 A;  1KSW A;  4ESR A;  2EGE A;  1MV0 B;  1OOT A;  5IXF A;  2JW4 A;  3UF4 A;  1SHG A;  1K0X A;  2FRW A;  1H8K A;  1NM7 A;  4LUE A;  4Y92 A;  2JMA A;  1NYF A;  2LMJ A;  2KT8 A;  2RQW A;  2F2W A;  3EG3 A;  2I0N A;  5GJW B;  3TSZ A;  3VS4 A;  2LZ6 B;  2CDT A;  3NHN A;  2PZ1 A;  2KXD A;  2J6O A;  1X27 A;  4JZ3 A;  1UFF A;  4R0K A;  3UAT A;  1M3C A;  1Z9Z A;  2L3P A;  4K11 A;  2L3S A;  4JJC A;  2DLP A;  1K0S A;  1NEB A;  3EHQ A;  3M0Q A;  2KRM A;  1VYU A;  1A0N B;  4RTV A;  1AZE A;  2BZY A;  3ZL7 C;  1GBR A;  4J9D A;  1PRM C;  3I5S A;  2EYY A;  2RNA A;  1OPL A;  1YWP A;  2DL8 A;  1SPK A;  2J6K A;  3I5R A;  2KEA A;  4DEX A;  2D1X A;  2KT1 A;  2DM1 A;  3TSW A;  1T3S A;  1XOV A;  2DMO A;  1I07 A;  1AWW A;  2SRC A;  2IIM A;  3SEM A;  2AKL A;  2CH4 A;  2BZ8 A;  5HCK A;  2K3B A;  1QCF A;  1SSH A;  2C0O A;  2O9S A;  2LQN A;  4ORZ A;  3PVL A;  4OMP A;  3KFV A;  1YP5 A;  1JEG A;  2JXB A;  1SRL A;  4X1V A;  2OAW A;  1ARK A;  2L2P A;  4JJB A;  2EKH A;  2VVK A;  2PNI A;  2EGA A;  2KGT A;  3SHW A;  1QWE A;  4F17 A;  1YN8 A;  2K6D A;  1ZUK A;  2DBM A;  1WXB A;  1X43 A;  1G83 A;  1RI9 A;  2CT3 A;  1NLP C;  1Z9Q A;  2DX1 A;  1T3L A;  4D8D A;  1N5Z A;  3LH5 A;  3VS0 A;  4HVW A;  2EQI A;  1NLO C;  1QWF A;  3H0F A;  1UEC A;  4AG1 C;  2C0T A;  1WI7 A;  1UJY A;  2YT6 A;  2B86 A;  2P4R A;  2RQU A;  1NEG A;  2MOX A;  2D8H A;  1AZG B;  1RLP C;  5IHN A;  4CC3 A;  2KYB A;  1YCS B;  1M27 C;  4RTY A;  4JJD A;  2YDL A;  2AKK A;  2EYW A;  4RTT A;  4F14 A;  4FSS A;  4OMN A;  1SEM A;  2V1R A;  1GCQ A;  1ZUY A;  1UGV A;  2J05 A;  1ZLM A;  3VS6 A;  1PKT A;  1BK2 A;  2LQW A;  1WYX A;  5EC7 A;  3O5Z A;  1TG0 A;  1W6X A;  2QDL A;  4RTU A;  1ABQ A;  1MV3 A;  3VS3 A;  4A63 B;  3TVT A;  1SRM A;  3UA7 A;  2KRS A;  2LJ1 A;  3RBB B;  2J7I A;  1AVZ C;  1K4U S;  2EVR A;  1KJW A;  3PVQ A;  1PWT A;  1GL5 A;  1W1F A;  1HJD A;  1B07 A;  2CH4 W;  1M3B A;  4EIK A;  2D8J A;  4LN2 A;  2EPD A;  2XMF A;  1RLQ C;  1UJ0 A;  3NMZ C;  3REA B;  4RTZ A;  2A28 A;  1U5S A;  2V1Q A;  1W70 A;  1GFD A;  3REB B;  4HXJ A;  1FMK A;  3I35 A;  1AWO A;  1X2Q A;  1J3T A;  2FPF A;  1E7O A;  2GTJ A;  2O2O A;  2LCS A;  2ROT A;  1CSK A;  3THK A;  1GCP A;  1WXT A;  1PNJ A;  1WX6 A;  4OMM A;  1U3O A;  3QWX X;  1LCK A;  1K9A A;  2W10 A;  4RUG A;  2L3Q A;  1AEY A;  1JO8 A;  4Z89 A;  2KBT A;  2FO0 A;  1UHC A;  3VS7 A;  1PRL C;  2DRM A;  3VRZ A;  2CRE A;  1K76 A;  2JMC A;  4QT7 A;  1CKB A;  4JZ4 A;  4AG2 C;  2FG0 A;  2D0N A;  4J9B A;  1WLP B;  3ULR B;  1JQQ A;  5IH2 A;  2KNB B;  4AFS C;  1E6G A;  1WA7 A;  2AK5 A;  2DRK A;  3UA6 A;  2DL7 A;  2EBP A;  1UE9 A;  1OEB A;  2EYX A;  2DVJ A;  2GBQ A;  1VYV A;  1T0H A;  2GGR A;  2KYM A;  2OJ2 A;  1YWO A;  4J9F A;  2X3W D;  2GTO A;  4Z8A A;  2LJ0 A;  1NYG A;  2BTT A;  2CSI A;  1PKS A;  2DIL A;  4AFQ C;  1ZSG A;  2JM8 A;  1VA7 A;  4AFZ C;  1X69 A;  4OMO A;  4LNP A;  3GBQ A;  2E5K A;  2NUZ A;  1YNZ A;  5I11 A;  1H92 A;  1K1Z A; 
#chains in the Genus database with same CATH topology
 5L23 A;  2LDM A;  3CCM Q;  5A0G A;  2NWM A;  5GAO q;  3H0I A;  1BI1 A;  1WHG A;  3JV3 A;  1W2B S;  1YJN Q;  1QP3 A;  2RHU A;  1HSQ A;  4WTO B;  2RF0 A;  4PFZ A;  2EQM A;  5HK3 A;  1UDL A;  3CME T;  3JCM c;  2AT1 B;  3IQL A;  1VQO T;  3VRY A;  4L6V 5;  2LJ3 A;  4HVV A;  5LJ5 d;  4NL2 A;  1VQK A;  2FPD A;  4OB3 B;  2IPO B;  2EFI A;  3EAE A;  3M58 A;  4DEY A;  3OBY A;  4A4K A;  1SHF A;  5GAN 3;  2LQK A;  1YJ9 A;  4OML A;  2DXU A;  2O4X A;  1OPK A;  2OI3 A;  4CC7 A;  2DZ9 A;  2RI2 A;  3J80 E;  4QVD A;  3I56 A;  4BI4 A;  1B7T A;  3M53 A;  4GLM A;  4C5I A;  1WXU A;  2FZK B;  3JCM f;  1G3W A;  5LJ3 g;  1G3T A;  1K8A R;  4OMF B;  3EHR A;  4M78 B;  2K2M A;  3VJP A;  4IUQ A;  2AZS A;  1TTH B;  4FYV B;  1V29 B;  2HDA A;  4N0A A;  1JRI A;  1S1N A;  1VQP Q;  1MMN A;  3CCU T;  1O75 A;  3X25 B;  1AOJ A;  1TU0 B;  2A3L A;  4KBM B;  1FMW A;  1GFC A;  2XU8 A;  2DIQ A;  4J6X A;  3H41 A;  1WJS A;  1SF9 A;  4M7A D;  4F16 A;  3I55 T;  2DTH A;  2M51 A;  2CYZ B;  4XTX A;  2JVV A;  3C94 A;  1WHL A;  2L0A A;  2CS7 A;  3G4S T;  4M7D E;  1ZQ1 A;  3MP6 A;  1SG5 A;  3EG0 A;  1H3H A;  3FC3 A;  2HEQ A;  1NG2 A;  2KR3 A;  3V7C A;  4LE9 A;  1I4K 1;  1MHN A;  2H8H A;  1MUZ A;  1GCQ C;  4IUT A;  4C5E A;  1X6B A;  4Z88 A;  4F7U E;  2RO0 A;  2OTJ Q;  3LX7 A;  2YUN A;  4MDW A;  4J9I A;  4KH1 B;  1I81 A;  2XG8 D;  4M7D G;  2AHJ B;  4RTW A;  2D0Q B;  4XU0 A;  4DA4 A;  3KBG A;  3CXC A;  2ED0 A;  2G6F X;  4C92 G;  2K57 A;  3VUB A;  1BBZ A;  3CCL Q;  4C5H A;  2WAC A;  4JPB W;  4PJM A;  5GAO m;  2JM9 A;  2A7Y A;  4PJO G;  5I22 A;  1I5O B;  3MO8 A;  4C8Q G;  3CPW A;  3HKS A;  2YUP A;  1KIK A;  4FM4 B;  2LP5 A;  4LXC A;  5J3B A;  2X4Y A;  4PL6 A;  1ZUU A;  2A36 A;  2F5K A;  2ED1 A;  3CD6 T;  3RKW A;  4KUL A;  3HRS A;  5C0M A;  5FWC A;  2OAU A;  1VOM A;  3JB9 J;  2O88 A;  2JT4 A;  1VQK Q;  1OOT A;  2ZPH B;  1H8K A;  4Y92 A;  4RCC A;  1NYF A;  2LMJ A;  2KT8 A;  1YIT T;  2YHT A;  1ACM B;  3TSZ A;  3OS0 A;  2XHC A;  2ZPG B;  2KXD A;  4MZP A;  1UFF A;  3UAT A;  1Z9Z A;  4K11 A;  2JN0 A;  4MMK A;  5GAN j;  2DLP A;  1K0S A;  3L2R A;  3EHQ A;  3G4S Q;  1VIF A;  4QVC A;  1VYU A;  4BI3 A;  3TRE A;  4ZTJ A;  1PRM C;  2EYY A;  5KYU A;  2IG0 A;  1OPL A;  3I56 T;  2X4J A;  1IZ6 A;  2K3X A;  3CC4 Q;  2ZPE B;  2J6K A;  1SPK A;  2M9U A;  1U1S A;  3I5R A;  1QVG P;  4PLL A;  5CQX A;  1AWW A;  2SRC A;  3SEM A;  2LTO A;  1VQN T;  5HCK A;  2HBP A;  3QYH B;  1QCN A;  1QCF A;  5FRN A;  3R6O A;  1SSH A;  2O9S A;  3JB9 G;  4M77 D;  2YRV A;  5J39 A;  1OU8 A;  3RIR A;  3G71 A;  4OMP A;  1YP5 A;  1Q81 U;  2Y4X A;  2XID A;  4ANJ A;  1ARK A;  2L2P A;  3T9N A;  3FEO A;  2PU9 B;  2XD0 A;  2EKH A;  2VVK A;  2EGA A;  1K9M R;  4F7U B;  3HHT B;  2K6D A;  1K8A U;  2VB6 A;  1MMG A;  4M78 F;  1RAD B;  2DFU A;  5LJ3 h;  2EJF A;  1G83 A;  3EGX B;  1YCY A;  3J7A F;  3MP8 A;  1NLP C;  2RI5 A;  3OYK A;  4C92 E;  1FXX A;  3SWN B;  4D8D A;  3E19 A;  3LH5 A;  2OTL A;  4C92 F;  2LVM A;  4TVR A;  3H0F A;  1D1B A;  4AG1 C;  4E7J A;  2DAQ A;  2P4R A;  1KD1 C;  3MEU A;  2VC8 A;  4QQG A;  3CD6 Q;  3M4Y A;  1RLP C;  1Q86 U;  4JJD A;  5LL6 S;  4F14 A;  5CKH A;  2V1R A;  1GCQ A;  1ZA2 B;  2J05 A;  3VS6 A;  1N8R C;  1WYX A;  5EC7 A;  3MET A;  1PC0 A;  1RAH B;  2VV5 A;  1D0Y A;  2RHI A;  3UDC A;  4FSX A;  3VS3 A;  3RDV A;  1VQ9 A;  3CCL T;  3OYA A;  2KSS A;  1SRM A;  1X75 C;  2LJ1 A;  2J7I A;  4DOV A;  1OYX A;  1YBY A;  4ELZ C;  4OB1 B;  4AMC A;  4EIK A;  4PNO A;  4DOW A;  4GY5 A;  2E10 A;  1LOJ A;  3NMZ C;  1Q82 U;  2FZG B;  1OZ2 A;  1Q95 G;  3QHS A;  4FYX B;  1VQN A;  3MEV A;  2CP5 A;  3H8Z A;  4A4F A;  5GMK e;  4HXJ A;  1VQ5 T;  2BE7 D;  4A54 A;  5GMK h;  2X9H A;  3I35 A;  1AWO A;  1WGS A;  1J3T A;  2LRQ A;  1E7O A;  3G71 Q;  3JCM e;  3LW5 E;  3JCM h;  3CCM A;  4E7H A;  1LCK A;  4M77 E;  2GFA A;  2W10 A;  3CCQ Q;  2L3Q A;  2QA4 T;  2FO0 A;  4LD9 K;  1UHC A;  2O4X B;  4KH0 B;  1MND A;  1MNE A;  4VUB A;  3JSC A;  1PG5 B;  4QT7 A;  1Q86 C;  1CKB A;  4JZ4 A;  4J9B A;  2D0N A;  1WLP B;  2QQS A;  1C1A A;  2JTF A;  4D6W A;  3CC7 Q;  2AIR B;  5LJ3 f;  4AFS C;  2DJZ A;  4M77 G;  2AK5 A;  3CCV A;  5KCH A;  2DRK A;  2MPX C;  2DL7 A;  1KQ1 A;  3QYG B;  1D09 B;  2GBQ A;  4JLI A;  1WJQ A;  1T0H A;  2COW A;  5CK9 A;  2OJ2 A;  1M1K R;  4HCZ A;  2X3W D;  3OW2 S;  4E7K A;  3INZ A;  5FU6 B;  2GTO A;  2DXC A;  2DIL A;  5GAO p;  1ZSG A;  2VGN A;  1OQK A;  3JRZ A;  1I5L A;  5GAN 6;  4M7A B;  5DLO A;  5KYW A;  2HSE B;  1RL2 A;  4EPC A;  1UGR B;  1D3B A;  3GBQ A;  1IRE B;  1VQM Q;  2NUZ A;  2DXB A;  2GFU A;  1H92 A;  2DIG A;  3JB9 F;  1QP2 A;  1WDX A;  4ZN3 A;  3BDU A;  3CXC S;  4F7U F;  3RUX A;  3E9G A;  3NPF A;  2LNH B;  1TOV A;  3CQT A;  2XK0 A;  1M1F A;  4XU3 A;  2F2X A;  4M77 A;  4GLK A;  4M7D B;  2W0Z A;  1VQK T;  2L5Q A;  4WCI A;  1X01 A;  1Y96 A;  2JTM A;  2DXT A;  1NPR A;  1JJ2 A;  3C95 A;  2FHD A;  3PNW C;  1KD1 U;  2CSQ A;  4FT2 A;  4DBH A;  1N27 A;  3OYD A;  2EQK A;  3F70 A;  7AT1 B;  4E7L A;  2DBK A;  3A98 A;  5FW9 A;  1IXD A;  1I0C A;  3DLM A;  1XJW B;  5HK0 A;  3C0C A;  4J9C A;  5D6X A;  1FMV A;  3ZFJ A;  2VGM A;  1KD1 R;  3DB3 A;  3OQ5 A;  2VKN A;  3OYC A;  1QW1 A;  2EYZ A;  2MAM A;  2ECZ A;  3BW1 A;  3G6E A;  5ECA A;  1VQ8 A;  1M5Q 1;  2JUF A;  2K7A A;  2K79 A;  1AD5 A;  2ZGW A;  2E6Z A;  1M8M A;  2LT4 A;  1S72 T;  1H3Z A;  3MHX A;  3QZ5 B;  4OB0 B;  2CUD A;  2KXC A;  3D7S B;  4BY6 B;  3CC4 T;  3WVE B;  4F04 B;  2MF2 A;  4PJJ A;  2GQI A;  3QJ6 A;  1OUL A;  5GAO n;  4X9D A;  3M0U A;  2F69 A;  2DTO A;  1WQW A;  1AWJ A;  3JCM b;  2JS0 A;  2KRO A;  2QYZ A;  3QDF A;  3C12 A;  5LJ3 e;  3EH2 A;  1M1K C;  2VWF A;  4LDV A;  1JXM A;  4C92 A;  3CMA T;  2QQB A;  3G4S A;  3PE0 A;  2AZV A;  1B3Q A;  3DKM A;  1MMA A;  4M78 G;  1Y96 B;  1BI3 A;  2PUK B;  2K3Y A;  3OYE A;  4L5G A;  1UUE A;  4M7D C;  2E1H A;  5IHK A;  3L2Q A;  3OSV A;  1U06 A;  3G1J A;  3EFR A;  1Q86 R;  4C0D B;  4C5G A;  3X20 B;  4BE0 A;  3AT1 B;  3HPW A;  3U23 A;  3QG1 A;  3TEE A;  1GBQ A;  2ABL A;  3RKY A;  3LGL A;  1YHQ A;  3CCU A;  2E5Q A;  5CVI A;  4PJO F;  4IIM A;  1LNX A;  1BKB A;  2WSC E;  3LWH A;  1G2B A;  1TUD A;  4LDY A;  4BAC A;  4CI0 C;  1PD0 A;  3G6E Q;  2NUP B;  1FYN A;  4LDW A;  3NTI A;  1QKX A;  1YHQ Q;  1Y7X A;  4NS5 A;  1RAA B;  4KUI A;  1TXQ A;  3L42 A;  1QQJ A;  1HD3 A;  3M54 A;  4ZN1 A;  4HCC A;  3VYG A;  1VQ8 T;  2I2L A;  4J5Y A;  3L2U A;  3M0R A;  2C0I A;  4M75 D;  5L8R E;  2JS2 A;  4XTU A;  1VQ4 T;  2CT4 A;  2DE0 X;  2KK4 A;  5GMK m;  5GAO l;  2ATC B;  3ZBD A;  2O31 A;  2QEX T;  4EMK C;  3RR6 A;  4KUD K;  1KSW A;  2M02 A;  4ESR A;  1VQM T;  2EGE A;  1MV0 B;  3MP1 A;  4M78 A;  3JCM W;  1XTD A;  2JW4 A;  3UF4 A;  2EJ9 A;  2CZ7 B;  1FX7 A;  4LUE A;  2RQW A;  2F2W A;  1TSF A;  2RHZ A;  3EG3 A;  3PIP A;  2P4T A;  2I0N A;  2LZ6 B;  3NHN A;  2J6O A;  1X27 A;  1OX9 A;  3OMG A;  4R0K A;  2L3S A;  4C0Z A;  1M1G A;  3CCS T;  5KYW B;  4E47 A;  2D6F A;  2BZY A;  4ZGD B;  1TS9 A;  5GAM h;  1GBR A;  2C06 A;  5GAN e;  1KHC A;  3EH1 A;  1D0Z A;  3ZEH A;  3CC7 T;  4E7I A;  3G7Z A;  2X51 A;  1XOV A;  3A8O B;  2DMO A;  4IKF A;  2CP0 A;  1VUB A;  1Q81 C;  3QII A;  1WHK A;  2BZ8 A;  3RKX A;  4XU2 A;  1PSE A;  1UGQ B;  3L1A A;  2K3B A;  3QUI A;  1M4Z A;  1R8O B;  2XDD A;  1GXI E;  3A5Z B;  5KYX B;  3V8L A;  1JEG A;  2JXB A;  8AT1 B;  1SRL A;  3RMQ A;  2QI2 A;  2PVD B;  2OAW A;  2GQV A;  2RHY A;  2Y90 A;  3OBW A;  3SHW A;  1UB4 A;  3EG9 A;  1WHH A;  3CMA A;  5I2M A;  2DBM A;  1WXB A;  1YJW A;  1X43 A;  2ZAE A;  1VQP T;  1RI9 A;  1BYM A;  2CT3 A;  1D1A A;  2E3I A;  4RG8 A;  4E7Z A;  2OTJ A;  1PCX A;  1VQ4 Q;  3EGD A;  1N5Z A;  2ZPF B;  2EQI A;  4MML A;  1UEC A;  3A8H B;  2X35 A;  1BCM A;  3OS5 A;  1UJY A;  2YT6 A;  2B86 A;  3JB9 D;  2RQU A;  1NEG A;  2D8H A;  1QMC A;  1YJ9 T;  1VQ6 T;  1AZG B;  5IHN A;  3CCM T;  1N8R R;  1IGU A;  3CC2 Q;  2YDL A;  2AKK A;  4FSS A;  4OMN A;  2XDP A;  5CQY A;  2CP6 A;  3ME9 A;  5D6Y A;  1VQ7 Q;  4N4H A;  3CCS A;  1S72 Q;  1YJN A;  3JCM J;  3BDL A;  3H9N A;  4PJO D;  3QKJ A;  4RTU A;  4OF1 A;  2FZC B;  2JOY A;  4A63 B;  3TVT A;  2RHX A;  4DBQ A;  3JCM X;  4ATO A;  5KYU B;  4LDU A;  1UEB A;  2EVR A;  1GL5 A;  3CCE Q;  3V7S A;  1JJ2 S;  3QSU A;  4JRK A;  1AT1 B;  2RK2 A;  2VXF A;  2YLB A;  1UJ0 A;  1VQ7 T;  1VQL A;  3OYG A;  4RTZ A;  4DBF A;  1VQL Q;  4EMG A;  3CCQ A;  1FMK A;  3HFO A;  5CO7 A;  1X2Q A;  3GPL A;  2FPF A;  1JBM A;  4M75 F;  3SD4 A;  4J7I A;  4DQ2 A;  2H3E B;  4RMO A;  2EYQ A;  4J7F A;  4OMM A;  4LD6 A;  3QWX X;  4C8Q E;  1QVF P;  2DRM A;  4ZTF A;  4PKC C;  2D9T A;  5GAM j;  3CEY A;  1K76 A;  1KC8 U;  1B34 B;  3KXT A;  2FG0 A;  3MPU B;  3P8D A;  3ULR B;  1VQN Q;  3CC2 A;  1ZHI A;  4JRP A;  1OU9 A;  1OEB A;  2DVJ A;  4RG2 A;  4PJO C;  1VYV A;  4J6W A;  3LGF A;  3JCM g;  2GGR A;  2IVW A;  4FCY A;  2F1L A;  1VQ6 A;  4N4I A;  1YWO A;  1K9M C;  4J9F A;  3EFO B;  2B8A A;  2CSI A;  1PKS A;  2QTV A;  2RJE A;  1YJW Q;  1VA7 A;  5I2S A;  5CR2 A;  4J83 A;  2QDY B;  5FU7 C;  2M16 A;  4OMO A;  3CCE A;  3LH0 A;  1QVF S;  1Q81 R;  1WNL A;  2LCL A;  1WQ7 A;  1K1Z A;  3L2Z A;  3QXE B;  2X3X D;  2MWO A;  2HD0 A;  2RI3 A;  3HTR A;  3JCM d;  4C92 B;  3CCS Q;  1S72 A;  4OMQ A;  1IO6 A;  2V8I A;  4J9G A;  2OTL Q;  4FW2 A;  4BDZ A;  4RTX A;  4B6M A;  2YRD A;  4B9X A;  3M5A A;  2KDS A;  1QVF A;  3I55 Q;  5HKC A;  1SKU B;  1KFZ A;  2DL3 A;  1LPL A;  1RUW A;  3VS5 A;  1YI2 Q;  3EFO A;  4QQD A;  4KGZ B;  1NZ9 A;  1QLY A;  3EG1 A;  2EAY A;  2HBW A;  2QEX Q;  1OZ3 A;  1W2B A;  1VQ5 Q;  3PGG A;  4ZNX A;  2KVQ G;  5LJ5 g;  3CCJ Q;  1T0J A;  3HSB A;  1ZSZ A;  3EGD B;  3M0P A;  3OSS C;  5GAM e;  5GAN 2;  2DK3 A;  2OX7 A;  4BE2 A;  2KQW A;  2GCX A;  4P5N A;  5GAN 8;  2X4X A;  3CPW S;  4R55 A;  4WF2 A;  1WHM A;  2RQT A;  5A0L A;  3FRN A;  3CBO A;  4EMH A;  4CC4 B;  5IT9 E;  3OYF A;  3DLL A;  3Q1J A;  5IXB A;  4HVU A;  2LX9 A;  5GMK l;  4F7U G;  4JJN K;  3CD6 A;  3RER A;  4IUV A;  3NTK A;  4HKE A;  1V1C A;  1CKA A;  2MCN A;  1WJR A;  1NE8 A;  3I9Q A;  3M59 A;  1M30 A;  2YSQ A;  3M55 A;  2ZPB B;  3CCJ T;  2DD4 A;  3H0H A;  1VYT A;  2ROL A;  1EIF A;  2ESW A;  3PT9 A;  2CUB A;  3SFM A;  1Q7Y R;  1BB9 A;  2RJD A;  3UT1 A;  3G71 T;  4D8K A;  4PJO A;  3DB4 A;  2E70 A;  3CXC P;  3EGU A;  5LJ5 f;  4M77 B;  2KRN A;  1C6V X;  2JJ9 A;  1UGP B;  4IIO A;  2HMA A;  5GAM d;  4A4H A;  4KGV B;  1NBE B;  3WXM B;  3CME Q;  2HQH A;  1XQH A;  1AWX A;  3EGX A;  3JCM P;  2VYT A;  2DER A;  5KCO A;  1H64 1;  3HRU A;  2MK5 A;  4M77 C;  3VYH B;  2L3R A;  4OVA A;  2SEM A;  1YJN T;  1E6H A;  1ABO A;  1WPY A;  2YUQ A;  5CKD A;  1BIB A;  3CBP A;  4XTZ A;  5KYY A;  2M0Y A;  4FIB A;  4EMK B;  3L2W A;  4M4Z A;  2RQV A;  1G3Y A;  2G3R A;  2EW3 A;  3M0T A;  5FWB A;  2DKG A;  1YHQ T;  2K5F A;  1UHF A;  2DYB A;  4M75 A;  3R6N A;  4ZGJ B;  1X2K A;  2P0Q A;  3HL8 A;  1VQP A;  1G5V A;  3EFS A;  2HAX A;  5KE2 A;  2DJQ A;  4N4G A;  3A1P A;  1D0X A;  1M3A A;  3VUZ A;  1QCO A;  2HKQ B;  3NGP A;  4EDU A;  3RMS A;  3CCE T;  1U1T A;  1Y57 A;  2VAS A;  3NTH A;  3FDR A;  1EFN A;  3CCR A;  5D7U A;  5LJ3 j;  3M0S A;  1KQS S;  2LC4 A;  2DNU A;  3UPU A;  2RMO A;  2MYS A;  2QA4 Q;  4HCK A;  3EG2 A;  2GNC A;  1BIA A;  2O9V A;  9ATC B;  3QDR B;  4DBR A;  4E2F B;  2MIO A;  2PUO B;  2H3J A;  4C8Q C;  4PJO B;  3RNJ A;  3FJ5 A;  1KQS A;  8ATC B;  3QO3 A;  1SHG A;  1K0X A;  1R0C B;  2WSF E;  2FRW A;  4M7A F;  2ZPI B;  2JMA A;  5FU6 C;  3GNG A;  3S3M A;  1G3S A;  3VS4 A;  2PZ1 A;  4XTY A;  4M75 G;  2NUP A;  4X34 A;  2COZ A;  4FU6 A;  4JZ3 A;  2KI7 A;  2L3P A;  5LJ5 h;  1VQL T;  4PJO E;  2YLC A;  1NEB A;  5LJ5 e;  1EZZ B;  2KRM A;  2RK1 A;  2NUT B;  3S6W A;  1AZE A;  4C8Q A;  3CCL A;  4J9D A;  1HXD A;  3I5S A;  2RNA A;  4HA8 A;  3OYI A;  2V8J A;  2HZY A;  3M9Q A;  1YWP A;  2KEA A;  4M75 E;  4DEX A;  4R56 A;  4OP0 A;  3E9F A;  1WHJ A;  3TSW A;  1T3S A;  2R58 A;  3GNF B;  4KT0 E;  1VQ5 A;  2JZ2 A;  3S3N A;  1VQ6 Q;  2QEX A;  2C0O A;  2LQN A;  3N5B B;  1M8V A;  2LCC A;  1KK7 A;  2LQ8 A;  2KY9 A;  3PMI A;  3JAM E;  3CCJ A;  3BFM A;  1YJ9 Q;  3KUF A;  1RAF B;  1IHV A;  3HFN A;  1M2O A;  1QWE A;  1M2V A;  1YFN A;  4F17 A;  1YN8 A;  3GOX A;  2QAS A;  4XK8 E;  1Q82 R;  1Z9Q A;  2FYK A;  4JRI A;  1QVG A;  2DX1 A;  1YJW T;  1D1C A;  2ZZD A;  4OGC A;  1UGS B;  1K8A C;  1T3L A;  4FYY B;  4HVW A;  1NLO C;  1QWF A;  3X24 B;  1KHI A;  2EQU A;  1KC8 C;  1M90 U;  2MOX A;  2QGF B;  4A4E A;  2KYB A;  4HT8 A;  2XDB A;  3A8L B;  4B9W A;  2K5I A;  3OW2 A;  1SEM A;  1ZUY A;  1UGV A;  2QK0 A;  4M7D A;  2E6N A;  1NPP A;  1PKT A;  4FYW B;  4KGX B;  4CRI A;  1BK2 A;  2LQW A;  1XNI A;  2BKD N;  2QQA A;  2QDL A;  4FL6 A;  1ABQ A;  3A8G B;  1MV3 A;  2FL7 A;  3V7R A;  3UA7 A;  2KRS A;  3RBB B;  6AT1 B;  1Q7Y U;  4BDY A;  1AVZ C;  1K4U S;  4PFO A;  1B07 A;  2CH4 W;  4HT9 A;  3FJP A;  1MGQ A;  3P8B B;  4C92 D;  5HY6 A;  4PK4 A;  4Q5W A;  2D8J A;  2XI9 A;  2EIF A;  2KMT A;  4C8Q F;  2EPD A;  2XMF A;  1RLQ C;  1D3B B;  2DEQ A;  1M1K U;  2A28 A;  2EQJ A;  2V1Q A;  1W70 A;  5GAM f;  1R0B G;  1GFD A;  4FW1 A;  4BI8 B;  2QXF A;  4M75 C;  2RJF A;  4Z02 A;  1YIJ T;  2R57 A;  5IN1 A;  4JRQ A;  4C8Q B;  2O2O A;  1PSF A;  1CSK A;  3THK A;  4C92 C;  1GCP A;  2E3H A;  2RH2 A;  1WXT A;  1PNJ A;  1K9A A;  2Y4Y A;  2QQ9 A;  4RUG A;  1YIT A;  1AEY A;  4Z89 A;  5CAI A;  1ZSZ B;  3OA6 A;  3E1S A;  3M57 A;  2DVE A;  3NFC A;  1P92 A;  1RAG B;  2CRE A;  5GAN f;  2JMC A;  2PVG B;  4II1 A;  4AG2 C;  5GMK i;  1JQQ A;  2KNB B;  3V8J A;  1FWZ A;  1WA7 A;  2RJC A;  1VQO A;  3CC2 T;  1K73 C;  2EBP A;  2DO3 A;  3LYI A;  2EYX A;  3FLG A;  2M0O A;  2YWW A;  1W4S A;  3URG A;  2VUB A;  1M90 R;  4MDX A;  1VQ7 A;  2KYM A;  5AT1 B;  5GAN d;  2FVU A;  2F5T X;  4NL3 A;  3CPW P;  2X4W A;  4Z8A A;  3J81 E;  2LJ0 A;  3MEW A;  2BTT A;  3O8V A;  1JJ2 P;  5FLX E;  3VU3 C;  2JM8 A;  3P8H A;  4AT1 B;  3LWI A;  4QQ6 A;  4LNP A;  2DD5 A;  3JB9 H;  3OS1 A;  5I11 A;  5IAY A;  1LJO A;  4XU1 A;  2WSE E;  2RN8 A;  3VV0 A;  1NJI U;  1X6O A;  4C0F A;  1YI2 T;  4J8O A;  4LUD A;  1N9R A;  2NYS A;  2BZX A;  2QAZ A;  1YIJ Q;  1UTI A;  2DTI A;  3GIB A;  3CCR Q;  4CC2 A;  1JU5 C;  4HCB A;  5KYY B;  2BIV A;  4X9C A;  2DZC A;  2FEI A;  4JDS A;  4BD3 A;  2DL4 A;  5LJ3 d;  2M1H A;  2XIC A;  2DEU A;  2A37 A;  1IGQ A;  3CCR T;  3OYH A;  4AFU C;  3QBY A;  2DA9 A;  2DF6 A;  4O5V A;  2NUT A;  2J06 A;  4E6R A;  2FRY A;  2VXE A;  4QKU A;  5CKF A;  4M7A E;  4XTV A;  1X6G A;  3SWN A;  4O6J A;  2NLU A;  3OYN A;  3MEA A;  1Y0M A;  5CCA A;  3S3O A;  4M78 E;  3OYY A;  5KYN A;  2QG9 B;  3V8K A;  1OV3 A;  3ER0 A;  2FPE A;  2MWP A;  2E65 A;  3QJY A;  3MCA B;  2A08 A;  2P0K A;  1OX8 A;  4J9H A;  2EJG A;  3FB9 A;  5DY9 A;  5AYF A;  2K9G A;  2CP2 A;  2O01 E;  5KYX A;  2DL5 A;  3VS1 A;  3SB2 A;  2OTL T;  2P84 A;  4XTW A;  4FT4 A;  1BI0 A;  3GF5 A;  3SWN C;  1QKW A;  2F2V A;  1NJI R;  2A0F B;  4GBQ A;  1PM3 A;  2HCK A;  4Y28 E;  3CMA Q;  2J6F A;  2DYI A;  4MZM A;  2EKO A;  1BU1 A;  3M56 A;  4MZT A;  1JXO A;  2CZ6 B;  4JUV A;  4M77 F;  1PD1 A;  3FIF A;  2E41 A;  3PFS A;  3X28 B;  4F7U A;  2HNI A;  5GAM g;  1I1J A;  2E12 A;  2V8K A;  5GAN h;  1G8X A;  1K73 U;  1C0M A;  2LNV A;  2KE9 A;  1OI1 A;  2YUO A;  1TUG B;  4PJL A;  2L89 A;  2EGC A;  1GRI A;  2HQX A;  2RQR A;  4XQ3 A;  4E7S A;  4PFP A;  4BE1 A;  1V76 A;  1KQS P;  2HSP A;  1WFW A;  2JTE A;  2RPN A;  5FRM A;  2CZ1 B;  1UG1 A;  1ZBJ A;  5CKE A;  3QPH A;  4J9E A;  4M7D D;  3CCU Q;  3A8M B;  3L2V A;  5GAN 7;  1ZX6 A;  5GJV B;  3VS2 A;  2L8D A;  1WIE A;  4KRT A;  1NJI C;  1TUC A;  4RKU E;  4L59 A;  4ELY C;  1HYO A;  4JLG A;  2BE9 B;  3OB9 A;  1PHT A;  3TU4 K;  1IHW A;  4QW2 A;  1RAC B;  5IHI A;  4RCB A;  2XKO C;  2RB6 A;  1RAB B;  1Y07 A;  4IUU A;  3UWN A;  4M7A G;  3QWY A;  4M78 C;  2ENM A;  3CC4 A;  2LX7 A;  2K4Y A;  2PTK A;  2QGG A;  2RM4 A;  1TWB A;  2PQW A;  5DLQ E;  5IXF A;  1KQ2 A;  2GF7 A;  1NM7 A;  3TCJ A;  2EWN A;  2R5A A;  5GJW B;  3E2U A;  2CDT A;  1QVG S;  4M7D F;  4IUR A;  1M3C A;  3I56 Q;  5FU7 B;  4JJC A;  1DJ7 B;  1B34 A;  2DPP B;  3M0Q A;  3CBM A;  1A0N B;  1RAE B;  4RTV A;  5GAN g;  2E64 A;  3ZL7 C;  1VQM A;  3OYM A;  3CME A;  3G6E T;  2DL8 A;  4IUP A;  2HL3 A;  2COY A;  2D1X A;  2KT1 A;  1N9S A;  2DM1 A;  3BE3 A;  3MJX A;  2CP7 A;  1ZSZ C;  1I07 A;  5GAN 4;  2IIM A;  2QA4 A;  2AKL A;  2CH4 A;  5KE3 A;  5I21 A;  1N6A A;  2OTJ T;  4C0D C;  4C0G A;  4ORZ A;  3PVL A;  3KFV A;  4J6Y A;  2YXY A;  2K2V A;  1VQO Q;  1HK9 A;  5J26 A;  4X1V A;  5A2Q E;  1VQ9 T;  2HKN A;  5CKB A;  4M78 D;  3CC7 A;  2R5M A;  2HL5 C;  4JJB A;  1BI2 A;  2CP3 A;  2CKK A;  3CPF A;  2E4H A;  4BUG A;  2PNI A;  2KGT A;  2DET A;  3JCM Q;  2PVO B;  4ME7 A;  1M90 C;  3MKD A;  5GAO r;  1JB0 E;  1ZUK A;  5GAN 5;  2CGH A;  3ASK A;  4JS4 A;  1M2V B;  4QVZ A;  3RES A;  2QTX A;  1TH7 A;  1IRX A;  1R77 A;  3LLR A;  1BCO A;  3VS0 A;  4M7A C;  1YIJ A;  3OW2 P;  1U8R A;  1RI0 A;  3BY7 A;  1KG1 A;  2C0T A;  4XAX B;  4BY6 C;  1WI7 A;  2V26 A;  3OYL A;  4N0A C;  2ZCF B;  3I55 A;  4CC3 A;  1YCS B;  1M27 C;  4RTY A;  1VQ8 Q;  1ZBX A;  2RD1 A;  4RTT A;  2EYW A;  2KAF A;  4PJN A;  1ZLM A;  2BUD A;  5M9O A;  2LT1 A;  3O5Z A;  1TG0 A;  1W6X A;  1KC8 R;  3PMT A;  3JB9 I;  1MMD A;  1M9S A;  4M7A A;  5GMK j;  1WZO A;  2MMP A;  3H6Z A;  5C6S A;  4M75 B;  3EG9 B;  4A4G A;  3OYJ A;  1KJW A;  3PVQ A;  1PWT A;  1HJD A;  1W1F A;  1M3B A;  1F1B B;  3OY9 A;  3C4S A;  1K9M U;  4LN2 A;  3OYB A;  1RAI B;  3CCV Q;  1Q82 C;  5A0D A;  1VIE A;  3HRT A;  1Y71 A;  1IB8 A;  2K5L A;  3REA B;  1U5S A;  3REB B;  2CZ0 B;  2FB7 A;  4JS5 A;  4A53 A;  4YTL A;  2RA2 A;  2JNG A;  3TQ7 P;  3OMC A;  2GTJ A;  2LCS A;  2ROT A;  1W2B P;  1YIT Q;  1ZA1 B;  3GLX A;  4ZGE B;  3PTA A;  4EMK A;  1WX6 A;  1U3O A;  1N8R U;  4OB2 B;  1AHJ B;  3M4G A;  5LJ5 j;  1JO8 A;  5FRO A;  3WVD B;  4OGE A;  2KBT A;  2QQR A;  1YI2 A;  1SSF A;  3VS7 A;  4Y91 A;  1PRL C;  1K73 R;  3VRZ A;  4LDX A;  4C8Q D;  3CCQ T;  3PIO A;  3AHU A;  4V2S A;  2YRC A;  3CCV T;  5IH2 A;  3JCM V;  3OS2 A;  1E6G A;  1O9S A;  1VQ9 Q;  3HP9 A;  3UA6 A;  5DM7 R;  1I8F A;  1UE9 A;  4NOY A;  1LVK A;  4UC4 A;  3QZ9 B;  1VQ4 A;  2Z0W A;  2MI6 A;  2HQE A;  1NYG A;  2P0P A;  4AFQ C;  5CIU A;  4PLI A;  4AFZ C;  1Q7Y C;  1X69 A;  5EG2 A;  4BB7 A;  3VKI A;  5KH6 A;  3SDZ A;  5D6W A;  3X26 B;  1EX4 A;  2E5K A;  1QVP A;  1YNZ A;  3GP8 A; 
#chains in the Genus database with same CATH homology
 2RN8 A;  5L23 A;  2NWM A;  2X3X D;  3H0I A;  1WDX A;  4LUD A;  3JV3 A;  2BZX A;  1HSQ A;  4OMQ A;  1IO6 A;  1UTI A;  2RF0 A;  4J9G A;  3NPF A;  2LNH B;  4CC2 A;  3CQT A;  1JU5 C;  4RTX A;  2F2X A;  2FEI A;  1UDL A;  2DL4 A;  2W0Z A;  3IQL A;  4WCI A;  3VRY A;  2A37 A;  2LJ3 A;  4HVV A;  1KFZ A;  2DL3 A;  1RUW A;  4AFU C;  3VS5 A;  2FPD A;  1QLY A;  2DA9 A;  3EG1 A;  2DF6 A;  2HBW A;  2J06 A;  4E6R A;  2CSQ A;  2FRY A;  4DEY A;  1SHF A;  4OML A;  4ZNX A;  2DBK A;  3A98 A;  1X6G A;  1T0J A;  5FW9 A;  1OPK A;  2OI3 A;  1I0C A;  4CC7 A;  3M0P A;  3C0C A;  4J9C A;  1Y0M A;  4GLM A;  1WXU A;  2VKN A;  2RQT A;  2EYZ A;  4CC4 B;  2ECZ A;  1OV3 A;  3EHR A;  5ECA A;  2K2M A;  5IXB A;  4HVU A;  2FPE A;  2K7A A;  2K79 A;  2AZS A;  1AD5 A;  2A08 A;  1M8M A;  2HDA A;  1S1N A;  4J9H A;  1V1C A;  1CKA A;  2CUD A;  2KXC A;  2MCN A;  3I9Q A;  1M30 A;  2K9G A;  1AOJ A;  2YSQ A;  2DL5 A;  3VS1 A;  2GQI A;  1GFC A;  3H0H A;  1VYT A;  2ROL A;  1QKW A;  2ESW A;  2F2V A;  3H41 A;  3M0U A;  2CUB A;  1BB9 A;  1AWJ A;  4D8K A;  4GBQ A;  3EGU A;  2HCK A;  2JS0 A;  2KRO A;  4F16 A;  2KRN A;  2J6F A;  2M51 A;  1BU1 A;  4IIO A;  1JXO A;  2L0A A;  1AWX A;  2VWF A;  1JXM A;  3EG0 A;  1H3H A;  2HEQ A;  3PE0 A;  1NG2 A;  2AZV A;  1B3Q A;  2KR3 A;  1I1J A;  2SEM A;  4LE9 A;  1E6H A;  2H8H A;  1UUE A;  1MUZ A;  1ABO A;  2YUQ A;  1GCQ C;  2KE9 A;  1X6B A;  2YUO A;  4Z88 A;  2M0Y A;  5IHK A;  2EGC A;  2YUN A;  1U06 A;  4J9I A;  4M4Z A;  2RQV A;  1GRI A;  2RQR A;  4RTW A;  2EW3 A;  3M0T A;  5FWB A;  3U23 A;  2HSP A;  1WFW A;  1GBQ A;  2ABL A;  1UHF A;  2DYB A;  2JTE A;  2RPN A;  4IIM A;  3R6N A;  1X2K A;  2ED0 A;  2G6F X;  1UG1 A;  1ZBJ A;  1BBZ A;  4J9E A;  1G2B A;  4JPB W;  1ZX6 A;  2DJQ A;  5GJV B;  1M3A A;  1TUD A;  3VS2 A;  1WIE A;  2JM9 A;  3NGP A;  4KRT A;  5I22 A;  1TUC A;  1Y57 A;  1FYN A;  1QKX A;  1EFN A;  2YUP A;  1KIK A;  3M0S A;  1HD3 A;  1PHT A;  2DNU A;  2LP5 A;  2RMO A;  3M0R A;  4HCK A;  3EG2 A;  2GNC A;  1ZUU A;  2A36 A;  2C0I A;  5IHI A;  2O9V A;  2ED1 A;  2JS2 A;  2MIO A;  5FWC A;  3QWY A;  2ENM A;  2CT4 A;  2DE0 X;  3RNJ A;  2LX7 A;  3FJ5 A;  2O88 A;  2PTK A;  2JT4 A;  2O31 A;  1KSW A;  4ESR A;  2EGE A;  1MV0 B;  1OOT A;  5IXF A;  2JW4 A;  3UF4 A;  1SHG A;  1K0X A;  2FRW A;  1H8K A;  1NM7 A;  4LUE A;  4Y92 A;  2JMA A;  1NYF A;  2LMJ A;  2KT8 A;  2RQW A;  2F2W A;  3EG3 A;  2I0N A;  5GJW B;  3TSZ A;  3VS4 A;  2LZ6 B;  2CDT A;  3NHN A;  2PZ1 A;  2KXD A;  2J6O A;  1X27 A;  4JZ3 A;  1UFF A;  4R0K A;  3UAT A;  1M3C A;  1Z9Z A;  2L3P A;  4K11 A;  2L3S A;  4JJC A;  2DLP A;  1K0S A;  1NEB A;  3EHQ A;  3M0Q A;  2KRM A;  1VYU A;  1A0N B;  4RTV A;  1AZE A;  2BZY A;  3ZL7 C;  1GBR A;  4J9D A;  1PRM C;  3I5S A;  2EYY A;  2RNA A;  1OPL A;  1YWP A;  2DL8 A;  1SPK A;  2J6K A;  3I5R A;  2KEA A;  4DEX A;  2D1X A;  2KT1 A;  2DM1 A;  3TSW A;  1T3S A;  1XOV A;  2DMO A;  1I07 A;  1AWW A;  2SRC A;  2IIM A;  3SEM A;  2AKL A;  2CH4 A;  2BZ8 A;  5HCK A;  2K3B A;  1QCF A;  1SSH A;  2C0O A;  2O9S A;  2LQN A;  4ORZ A;  3PVL A;  4OMP A;  3KFV A;  1YP5 A;  1JEG A;  2JXB A;  1SRL A;  4X1V A;  2OAW A;  1ARK A;  2L2P A;  4JJB A;  2EKH A;  2VVK A;  2PNI A;  2EGA A;  2KGT A;  3SHW A;  1QWE A;  4F17 A;  1YN8 A;  2K6D A;  1ZUK A;  2DBM A;  1WXB A;  1X43 A;  1G83 A;  1RI9 A;  2CT3 A;  1NLP C;  1Z9Q A;  2DX1 A;  1T3L A;  4D8D A;  1N5Z A;  3LH5 A;  3VS0 A;  4HVW A;  2EQI A;  1NLO C;  1QWF A;  3H0F A;  1UEC A;  4AG1 C;  2C0T A;  1WI7 A;  1UJY A;  2YT6 A;  2B86 A;  2P4R A;  2RQU A;  1NEG A;  2MOX A;  2D8H A;  1AZG B;  1RLP C;  5IHN A;  4CC3 A;  2KYB A;  1YCS B;  1M27 C;  4RTY A;  4JJD A;  2YDL A;  2AKK A;  2EYW A;  4RTT A;  4F14 A;  4FSS A;  4OMN A;  1SEM A;  2V1R A;  1GCQ A;  1ZUY A;  1UGV A;  2J05 A;  1ZLM A;  3VS6 A;  1PKT A;  1BK2 A;  2LQW A;  1WYX A;  5EC7 A;  3O5Z A;  1TG0 A;  1W6X A;  2QDL A;  4RTU A;  1ABQ A;  1MV3 A;  3VS3 A;  4A63 B;  3TVT A;  1SRM A;  3UA7 A;  2KRS A;  2LJ1 A;  3RBB B;  2J7I A;  1AVZ C;  1K4U S;  2EVR A;  1KJW A;  3PVQ A;  1PWT A;  1GL5 A;  1W1F A;  1HJD A;  1B07 A;  2CH4 W;  1M3B A;  4EIK A;  2D8J A;  4LN2 A;  2EPD A;  2XMF A;  1RLQ C;  1UJ0 A;  3NMZ C;  3REA B;  4RTZ A;  2A28 A;  1U5S A;  2V1Q A;  1W70 A;  1GFD A;  3REB B;  4HXJ A;  1FMK A;  3I35 A;  1AWO A;  1X2Q A;  1J3T A;  2FPF A;  1E7O A;  2GTJ A;  2O2O A;  2LCS A;  2ROT A;  1CSK A;  3THK A;  1GCP A;  1WXT A;  1PNJ A;  1WX6 A;  4OMM A;  1U3O A;  3QWX X;  1LCK A;  1K9A A;  2W10 A;  4RUG A;  2L3Q A;  1AEY A;  1JO8 A;  4Z89 A;  2KBT A;  2FO0 A;  1UHC A;  3VS7 A;  1PRL C;  2DRM A;  3VRZ A;  2CRE A;  1K76 A;  2JMC A;  4QT7 A;  1CKB A;  4JZ4 A;  4AG2 C;  2FG0 A;  2D0N A;  4J9B A;  1WLP B;  3ULR B;  1JQQ A;  5IH2 A;  2KNB B;  4AFS C;  1E6G A;  1WA7 A;  2AK5 A;  2DRK A;  3UA6 A;  2DL7 A;  2EBP A;  1UE9 A;  1OEB A;  2EYX A;  2DVJ A;  2GBQ A;  1VYV A;  1T0H A;  2GGR A;  2KYM A;  2OJ2 A;  1YWO A;  4J9F A;  2X3W D;  2GTO A;  4Z8A A;  2LJ0 A;  1NYG A;  2BTT A;  2CSI A;  1PKS A;  2DIL A;  4AFQ C;  1ZSG A;  2JM8 A;  1VA7 A;  4AFZ C;  1X69 A;  4OMO A;  4LNP A;  3GBQ A;  2E5K A;  2NUZ A;  1YNZ A;  5I11 A;  1H92 A;  1K1Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...