3I5SA

Crystal structure of pi3k sh3
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
EGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphatidylinositol 3-kinase regulatory subunit alpha
publication title Structural studies of the phosphatidylinositol 3-kinase (PI3K) SH3 domain in complex with a peptide ligand: role of the anchor residue in ligand binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 20
structure length 77
sequence length 77
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3i5sA00
5I11A 4RTUA 4OMLA 1ARKA 4RTXA 1X43A 2EGAA 4RUGA 1Z9ZA 3M0QA 2AZSA 1U5SA 1WXUA 1WLPB 2D8JA 1ZUYA 2AKLA 2RPNA 2KXCA 1FMKA 1ZBJA 2DL7A 3RBBB 3KFVA 1QKWA 1SRLA 2CT4A 3UATA 4CC7A 1X6GA 1ZSGA 4RTYA 2KBTA 1H92A 4DEYA 4LE9A 3QWXX 2DM1A 2JS0A 2EBPA 3TVTA 1WI7A 4CC2A 2E5KA 1KSWA 2X3XD 2EYZA 3M0TA 2V1QA 1OPKA 2D8HA 2O2OA 2PNIA 2OI3A 3VS7A 1UHCA 1H3HA 2DA9A 2F2XA 4JZ3A 1E7OA 1K9AA 2ECZA 2HCKA 1VYUA 1YN8A 1OEBA 2F2WA 1UDLA 3GBQA 2JS2A 1WYXA 1JQQA 1PHTA 5IHKA 2DILA 3NMZC 5ECAA 1JEGA 2RQWA 1K0XA 2W0ZA 1NLOC 4ESRA 1E6GA 2JT4A 1CKAA 1ZX6A 3VS2A 2DL4A 4HVVA 2CT3A 2ROTA 3EG0A 4GBQA 1MUZA 3NGPA 2K7AA 1ABQA 1NG2A 2EPDA 1K1ZA 2VVKA 4F16A 1GBRA 4J9GA 1QCFA 2EGCA 2KYBA 2HBWA 4GLMA 2OAWA 1BK2A 4AG1C 2LMJA 4J9IA 2YUNA 3O5ZA 4J9BA 2MCNA 3H0FA 2JXBA 3NHNA 1WXTA 4RTTA 4F17A 3TSWA 2DL3A 2LZ6B 3ULRB 1WFWA 1ZLMA 1ZUKA 2CH4A 1UJ0A 1YCSB 1TUCA 4JJCA 2HEQA 2RNAA 2DYBA 1UE9A 1SSHA 2L3SA 1M3AA 2HSPA 4Z8AA 1UTIA 2JMAA 3I5RA 1VYVA 2EYWA 1NM7A 2DBKA 1MV0B 3FJ5A 3REBB 1BB9A 1PRMC 1LCKA 2KEAA 4KRTA 2YUOA 5I22A 1UJYA 2NUZA 4QT7A 1M27C 1KFZA 4JPBW 4OMMA 2ESWA 1AOJA 1WIEA 2EVRA 2QDLA 2J06A 4RTZA 3SEMA 1H8KA 2EYXA 1I0CA 2I0NA 1WXBA 2KROA 4RTVA 1RUWA 1N5ZA 1CSKA 4Y92A 5IXBA 4JJBA 1AWWA 2CDTA 2LP5A 2DRKA 1JXOA 1B3QA 4AFSC 1RLQC 4RTWA 3PVQA 5IHIA 2CSQA 5IHNA 2FEIA 4LUEA 2FG0A 1SEMA 2X3WD 2RQUA 3CQTA 2DNUA 2FPEA 2A08A 4J9CA 3UA6A 3I35A 3EHRA 2F2VA 2XMFA 2EW3A 1X6BA 2D1XA 1Y57A 2CSIA 1NLPC 2DX1A 1UG1A 1SPKA 1PNJA 4IIOA 5GJWB 2VWFA 2KRSA 3M0RA 2BZYA 2ED0A 1YNZA 2JTEA 4J9DA 4LNPA 2H8HA 4CC3A 3EG1A 1HD3A 1TUDA 2RN8A 1W70A 2JM9A 2B86A 3M0UA 4OMPA 2J6KA 2O9SA 4JZ4A 1A0NB 4AG2C 1RLPC 1FYNA 2L3PA 1UFFA 2KRMA 4HXJA 1HJDA 5EC7A 3M0PA 1GCQA 2LCSA 1AD5A 3R6NA 2AZVA 2SEMA 3M0SA 1U3OA 2J05A 1HSQA 2BTTA 2D0NA 3JV3A 4E6RA 3EG2A 4HVWA 2DVJA 2RF0A 2KR3A 1GFCA 5IH2A 2K3BA 2RMOA 1U06A 1PRLC 3H0HA 2JW4A 2LX7A 2CUDA 4ZNXA 1NYFA 5HCKA 2LJ1A 2K6DA 2GNCA 2V1RA 3VS1A 1YWOA 2A37A 2O88A 1AZGB 5FW9A 1M3CA 1UECA 2LJ3A 1K4US 1VYTA 1T0JA 3THKA 1X2KA 3EGUA 3QWYA 4LUDA 5L23A 1JO8A 1BBZA 2RQTA 3IQLA 1K0SA 2KT8A 2PTKA 4FSSA 3VS3A 1GFDA 2FPDA 2DLPA 3A98A 3VS0A 1SHFA 2SRCA 2CH4W 1UHFA 2KRNA 2C0IA 3VS5A 1B07A 3H0IA 3UA7A 2KNBB 1IO6A 1GCPA 4J9HA 1KJWA 5FWBA 3TSZA 1J3TA 3EHQA 3SHWA 1XOVA 1ZUUA 1NEGA 3I5SA 1EFNA 2HDAA 2J6OA 1T3SA 2FO0A 2J7IA 2DF6A 4D8KA 4DEXA 1ABOA 2AKKA 1K76A 3H41A 1T3LA 2K79A 1AWJA 4D8DA 2FRYA 4X1VA 2P4RA 1PKTA 2A28A 1E6HA 2G6FX 1X27A 2KGTA 1QKXA 1I07A 2MOXA 3UF4A 1YWPA 1OV3A 2J6FA 2EKHA 1OOTA 4OMQA 2ROLA 5FWCA 4EIKA 4J9EA 1I1JA 4K11A 1M30A 1SRMA 1WA7A 4AFZC 2YSQA 1VA7A 4Z88A 2YUQA 1S1NA 1OPLA 1JU5C 1SHGA 2DE0X 3VS4A 3NPFA 1WDXA 4LN2A 1M8MA 2DL5A 1W6XA 2GTJA 2OJ2A 4HVUA 2YUPA 2RQVA 2DBMA 2EGEA 1UUEA 1QLYA 4A63B 3U23A 2KYMA 4AFQC 1UGVA 3PE0A 4HCKA 3PVLA 1Z9QA 2C0OA 4ORZA 2DRMA 1AWOA 2A36A 2ENMA 1V1CA 2GTOA 2ABLA 4OMNA 1GCQC 1CKBA 1PWTA 5IXFA 2LQNA 2L0AA 2EQIA 2BZ8A 1BU1A 3VS6A 1MV3A 2K9GA 1AVZC 2M0YA 4Z89A 2YT6A 2JMCA 1NYGA 1JXMA 2GGRA 2KXDA 2L3QA 2VKNA 2C0TA 2CREA 4CC4B 3REAB 2GBQA 1GRIA 2ED1A 4AFUC 2O31A 2DJQA 1GL5A 4OMOA 2L2PA 1GBQA 2FPFA 3RNJA 3LH5A 4J9FA 1QWFA 1Y0MA 2JM8A 4WCIA 2LQWA 2K2MA 2AK5A 2DMOA 3I9QA 1X2QA 5GJVB 1TG0A 2RQRA 2M51A 2W10A 2NWMA 1WX6A 1W1FA 1PKSA 3VRYA 3C0CA 2GQIA 2KT1A 1AWXA 2LNHB 4F14A 1AEYA 4JJDA 1G83A 1RI9A 1T0HA 2EYYA 2CUBA 3EG3A 2PZ1A 2IIMA 1G2BA 3ZL7C 1NEBA 1AZEA 2LJ0A 2BZXA 1X69A 1KIKA 1M3BA 2MIOA 4IIMA 4R0KA 2FRWA 3VRZA 2YDLA 4M4ZA 2DL8A 1QWEA 2O9VA 2KE9A 1YP5A
chains in the Genus database with same CATH superfamily
5GAOq 4OMLA 1ARKA 3G71Q 3G6EQ 5IAYA 2EGAA 4RUGA 3I56A 2AZSA 1HYOA 3OSVA 4RCBA 1WLPB 3S3OA 1NJIC 2D8JA 3OW2P 1VQKQ 1LNXA 4M7AC 4XQ3A 3VKIA 2NUPA 3RBBB 1ZSGA 3CD6Q 4LE9A 1VQMQ 3QWXX 2YLCA 1TUGB 2DM1A 4JJNK 4LDYA 2Y4YA 1KC8R 3TVTA 4IUTA 4CC2A 2CZ7B 1D0XA 3EGDA 2E5KA 2P0QA 2X3XD 2HAXA 2QQAA 2EYZA 4XK8E 1OPKA 1VOMA 2O2OA 4QVDA 2OI3A 3JB9J 1VQ5A 3VS7A 4PFPA 1H3HA 3JCMQ 1VQ7T 2F2XA 3M59A 1QVGA 2A0FB 5GANf 2ECZA 1RABB 1KHCA 5CQYA 3P8BB 4M7DA 2V8IA 3NTIA 3GBQA 4C8QD 4M78A 4M77A 1JQQA 2F5KA 1YIJQ 1JEGA 4D6WA 1M90U 4O5VA 4ESRA 2XK0A 2JT4A 4PJJA 2CT3A 2VV5A 4C8QF 2ROTA 3EG0A 2K7AA 1ABQA 3QYHB 1VQNT 1B34A 4FIBA 4HCZA 3CCSA 4X34A 4GY5A 3I55Q 2E6ZA 1H641 1BI0A 4J9IA 1WQWA 3E2UA 3O5ZA 1U8RA 4M7DD 2ZZDA 2XG8D 1WXTA 3L1AA 2X4XA 3MEVA 1IGQA 3JB9I 4M78D 4PJMA 1LOJA 4M77D 2JUFA 1QVFA 3TSWA 1N8RR 2DL3A 1WHJA 2WSEE 2LZ6B 1W2BA 3CMET 4DBFA 1WFWA 2E3IA 2E70A 1G3SA 4JJCA 2L3SA 1EZZB 2QGGA 4PL6A 3QYGB 3H8ZA 4Z8AA 4F7UE 4LD6A 4HCCA 3CCUA 2EYWA 4LXCA 4NS5A 1TSFA 3CEYA 2DERA 2YHTA 1I8FA 2ZCFB 1LCKA 3ZFJA 2RI2A 1H3ZA 4KRTA 2E6NA 3PIOA 3CCRT 2NUZA 3SDZA 3DB4A 4QT7A 1MGQA 1M27C 2KVQG 3RDVA 2E5QA 4RTZA 3JCMc 1VQ9A 1WXBA 2KROA 5GMKl 4DA4A 1RAGB 1V29B 4RTVA 5HK0A 3CCQQ 4OB1B 1CSKA 1VQ6Q 5GMKh 2EJFA 3VU3C 5J39A 3OS1A 4KUIA 1AT1B 1M9SA 4JJBA 2DRKA 1JXOA 3GNFB 4AFSC 3WVEB 5CQXA 4RTWA 5IHIA 4LDWA 3CXCS 4ZGJB 3CPWA 3FJPA 3UT1A 5KYXA 3HRTA 3CQTA 3HFOA 4C5EA 4FYXB 2L5QA 3UA6A 4KUDK 2F2VA 2XMFA 1Q7YC 1G3YA 1Y57A 2CS7A 2F1LA 1UG1A 2DETA 1PNJA 5GJWB 1KD1U 3CC4Q 3OMCA 2KRSA 1OZ2A 2H8HA 4PKCC 3TCJA 4CC3A 3KBGA 3VV0A 2GFUA 2JM9A 2B86A 2J6KA 4XTYA 1FYNA 4M7DC 2EJGA 3LLRA 2DEUA 4M78C 4BE1A 2KAFA 4M77C 3R6OA 1HJDA 4IUVA 1GCQA 2EQKA 3E19A 3EAEA 2SEMA 2RJDA 2DD4A 2BTTA 2FL7A 3G71T 3VJPA 3JV3A 4OB2B 3G6ET 2YWWA 5DM7R 1D1CA 1LJOA 3OS0A 2RF0A 3BFMA 1M1KU 4ZGDB 2DTHA 2G3RA 2O4XB 1VQKT 3G4SA 4E7HA 3H0HA 2JW4A 4ZNXA 5HCKA 5GAMg 3OSSC 2GNCA 3VS1A 2A37A 3EFRA 1YITQ 2COZA 2OAUA 4PFZA 1IB8A 1M3CA 2PUKB 1UECA 1VYTA 4DBRA 2RHZA 3CD6T 1VQMT 1M1KR 1NBEB 2RQTA 1K0SA 1YJNQ 2DAQA 2JZ2A 4FSSA 3CCMA 1GFDA 2FPDA 2QTXA 5CK9A 1M1FA 5GMKj 1SHFA 1M90C 2KI7A 4NOYA 3MKDA 5GAOn 3V8LA 2ZPEB 1B07A 2KNBB 1IO6A 3RMSA 2E65A 1RACB 5GANh 1J3TA 4C92B 1XOVA 2NYSA 3CMAQ 3I5SA 2VYTA 3OS2A 1NPRA 4PJOE 2DVEA 1TTHB 5A2QE 3L2QA 5IT9E 1G5VA 1T3SA 2FO0A 4ATOA 1IGUA 4OF1A 1PD1A 2RHIA 3VYGA 1K76A 3H41A 3E9GA 1QCNA 1D1BA 1RL2A 3S3NA 2R5MA 4X1VA 3OQ5A 1YIJT 1PKTA 1FMVA 1M4ZA 1Q81R 2OTLQ 1VQ8A 2JVVA 1G3WA 4M7AB 4BB7A 3A8HB 2X4WA 1QKXA 1PD0A 2KMTA 3A8LB 2QQ9A 3SB2A 3OYAA 1WHGA 2DZ9A 1SRMA 1WA7A 2PQWA 3PIPA 3C4SA 1VA7A 2HQXA 2MWOA 4Z88A 3M4YA 4AT1B 2YUQA 4PLIA 3OMGA 2DE0X 1WDXA 1M8MA 1JJ2S 2GTJA 2LQ8A 4J7IA 1SKUB 2RQVA 2DBMA 2EGEA 3JAME 1M5Q1 4M75G 1UGVA 1WJSA 3HHTB 4EMKC 3SD4A 1QVPA 2FVUA 2ENMA 1GCQC 1CKBA 5KCOA 1SG5A 3CCEA 1Q82C 3X25B 1BU1A 2VXFA 5GAOp 2M0YA 1VQ7A 1K73U 1NYGA 4JS4A 4QVCA 1JXMA 2ZPFB 5GANj 2GGRA 2VKNA 4EDUA 1Y07A 2GBQA 1UGRB 3NTKA 1W4SA 2R57A 4Y28E 3RESA 3CC2T 5GMKe 2HL3A 3RKYA 2OX7A 3S6WA 1OZ3A 2FPFA 2XI9A 3LH5A 4J9FA 1NJIU 3P8HA 3CCQT 2JM8A 2LQWA 1VQ6T 1PSFA 3I9QA 3OBYA 3META 1O75A 4Q5WA 3T9NA 1K73R 2M51A 4XTZA 1WX6A 2MI6A 3M4GA 2DXUA 4RCCA 2GQIA 2KT1A 4P5NA 4ME7A 1G2BA 3EGXB 5CKFA 3SWNA 2LJ0A 2HL5C 4CRIA 4IIMA 3CC4T 1B7TA 2QG9B 2FRWA 1C0MA 5CKHA 2DL8A 2AIRB 4RTUA 4FW1A 3JB9G 1QP2A 1Z9ZA 1U5SA 4NL3A 2DTIA 4J5YA 2ZAEA 1FX7A 5GAN6 4J7FA 2NUPB 1SRLA 3CXCP 4IURA 1X6GA 3JCMJ 4RTYA 3G7ZA 1H92A 4JRIA 3GPLA 4C8QB 1OU8A 2BUDA 5LJ5g 3CCLQ 2DKGA 1YITT 1K9MC 2EBPA 4E7SA 5A0DA 2DPPB 3M0TA 3EGDB 1VQPQ 1UB4A 2K5LA 2CP2A 3AT1B 1YJNT 1UHCA 4ANJA 3TQ7P 3HP9A 5D6XA 1K8AC 2HQHA 1TH7A 5GANe 2CKKA 4JZ3A 1WPYA 1K9AA 5D7UA 2QXFA 2HCKA 1YN8A 1M2VA 1OEBA 3KUFA 5LJ5d 1QVFP 5I2SA 1IREB 1UDLA 4M7DB 1WHLA 4BD3A 2JS2A 4C0FA 3CMAT 5FU6C 4M78B 4M77B 1JB0E 2P84A 5ECAA 5EG2A 2W0ZA 2RHYA 1CKAA 3VS2A 4OMFB 4GBQA 1NG2A 2EPDA 3CC7Q 4BI3A 2VVKA 4E7ZA 1BYMA 3GOXA 3X24B 1B34B 1QCFA 2EGCA 2OTLT 1PCXA 2HBWA 4C0GA 5KE2A 4AG1C 1S72Q 2QK0A 1R0CB 3NHNA 4RTTA 2Z0WA 2OTJA 1P92A 1ZA2B 1ZLMA 1UJ0A 1D0ZA 1TUCA 1YJWQ 2RJFA 4RG2A 3LWIA 2CP7A 2EKOA 1VQMA 3CPWP 2JMAA 3E1SA 3HFNA 1NM7A 2QEXQ 3BDUA 3CBOA 5LJ5f 1NE8A 3REBB 1Q7YU 3M58A 3QZ9B 4BE0A 4MMLA 2KEAA 3ZEHA 5I22A 1G3TA 1UJYA 3PMIA 2ESWA 3VUBA 1WIEA 2EVRA 2P4TA 4FU6A 2K5IA 2EYXA 4BACA 2I0NA 4WF2A 3CCVQ 1Q7YR 4Y92A 4B6MA 4R56A 4ZTJA 4PK4A 1YI2A 1AWWA 3G1JA 2K3YA 1TU0B 3PVQA 4ZTFA 3M5AA 3X26B 2E64A 4LUEA 2P0PA 2FG0A 5HKCA 4E7JA 1SEMA 1JJ2P 2DNUA 2FPEA 5KYXB 1KQ1A 2EAYA 4F7UG 1FWZA 1RAHB 5KYYA 2RB6A 2NUTA 2CSIA 1I81A 2DX1A 3I56Q 2PU9B 1OYXA 2DXCA 1U1TA 3JCMg 2JTEA 2HSEB 3QUIA 1HD3A 2RN8A 3GLXA 3UDCA 3CXCA 2O9SA 4JZ4A 1A0NB 3ME9A 2VGNA 2A7YA 1UFFA 2KRMA 3SFMA 2F5TX 3OY9A 5KYNA 2KDSA 3DKMA 1AD5A 1UGPB 3BY7A 4RG8A 3OA6A 1U3OA 1HSQA 2D0NA 1C6VX 3N5BB 4PJLA 4KULA 2DVJA 2KR3A 5IH2A 1WHHA 1XQHA 3JCMd 1BI1A 1PRLC 2H3EB 4M75A 4KH0B 1M90R 4LD9K 4C92G 2CZ6B 2IPOB 3H6ZA 2GFAA 4A4EA 5FW9A 4BY6C 5KYUA 4MZPA 1T0JA 2EQJA 4BE2A 1WHMA 3EGUA 5DY9A 1N27A 3CCJQ 5CO7A 2LX9A 4KGVB 4LUDA 3IQLA 3CC2A 3CCLT 1VQ4A 2EQMA 2XDBA 2GF7A 4M7DF 2DLPA 3L2WA 2BE9B 3VS0A 1V76A 1UHFA 4M78F 1R0BG 4M77F 1X75C 2C0IA 2RHUA 5KH6A 5FWBA 1VQPT 3TSZA 2CYZB 4A4GA 1NEGA 4M75D 1JBMA 1YCYA 1KQ2A 1EFNA 1KK7A 1VQOQ 2HDAA 1YJ9T 4QW2A 2MWPA 4FL6A 3OYMA 3OYBA 1ABOA 4MDXA 3CCSQ 1Y96A 2YRCA 1OX9A 2ZPGB 2K79A 3OS5A 3M55A 3JCMW 1PSEA 1E6HA 3RKXA 2R58A 3QJ6A 1IHWA 1Q82U 1O9SA 3E9FA 3URGA 3UF4A 4XTVA 3OYCA 2J6FA 4IUPA 1OOTA 4OMQA 2QDYB 4UC4A 3L2ZA 3CC7T 5FWCA 8AT1B 2YSQA 4O6JA 4C92E 5J26A 3CCUQ 2JTMA 1SHGA 3EFOA 2X9HA 1S72T 3MEAA 2JN0A 4LN2A 3EG9A 1Q82R 1W6XA 2QA4T 2LCCA 4PJOG 2MAMA 5GAMe 3U23A 4EMKA 2KYMA 2WACA 4HCKA 1VQLA 1Z9QA 2C0OA 5LJ5h 2DRMA 1YJWT 4KGXB 3V8JA 1AWOA 1VQ9Q 4M7AE 1IRXA 1QMCA 3HKSA 1BCOA 1KD1R 1PWTA 2HKQB 4MMKA 2QEXT 3J7AF 4E7KA 1JJ2A 1UGQB 2BZ8A 1WJRA 1MV3A 4QQDA 1AVZC 3JB9D 2YT6A 2HKNA 2JMCA 2X35A 4JS5A 2CREA 1X6OA 4M75C 5FU7B 2EJ9A 2QQBA 2O31A 4JRKA 2KSSA 4FYVB 4OMOA 1GBQA 2E41A 1LPLA 3UWNA 4C0ZA 2ZGWA 3CCVT 4QKUA 1Y0MA 4WCIA 1I4K1 2DXBA 4PJNA 2M0OA 3VRYA 4C5IA 2D0QB 2HD0A 1AEYA 4JJDA 2EYYA 2QI2A 5HY6A 4JRQA 2OTLA 2ATCB 3ZL7C 3TU4K 5GAMd 1AZEA 1X69A 2K5FA 2WSCE 3SWNB 3O8VA 5CCAA 5CKDA 2MIOA 3I56T 1K9MU 3NTHA 2H3JA 4PFOA 4R0KA 4HA8A 3VRZA 2BIVA 5KYWA 4B9XA 4BDZA 5GMKm 2FZKB 3L2UA 2KE9A 3TREA 3G4SQ 4C8QG 1X43A 2L8DA 2HNIA 2YRDA 3M0QA 2LDMA 2VB6A 1K8AU 2LNVA 3X20B 2AKLA 2RPNA 1FMKA 2X4YA 1K9MR 2VXEA 5C0MA 5LJ5j 2X51A 1RI0A 3L2VA 1QKWA 4CC7A 3CCMQ 2KBTA 3OW2S 1UGSB 4DEYA 3I55T 4XU1A 2CZ1B 3JCMX 3MP8A 1WI7A 4N4GA 5A0LA 1C1AA 1NPPA 1ZHIA 2V1QA 2DEQA 2XKOC 5GAMf 3CCJT 3D7SB 4OP0A 2V8KA 1WQ7A 3L2RA 5GAN8 1VYUA 1VQ8Q 2F2WA 2RH2A 1M2VB 2M16A 2XIDA 1YHQQ 1PHTA 5IHKA 3RR6A 3NMZC 2MYSA 1VQOT 4C8QE 1K0XA 4RKUE 4F7UA 3L42A 3JCMh 1ZX6A 3CCST 4HVVA 4L59A 3MHXA 3HRSA 1MUZA 3NGPA 5GAN4 4F16A 1GBRA 4DBHA 3LX7A 3RIRA 3GP8A 4GLMA 1BK2A 1VQNA 3MEWA 2K3XA 4F17A 3JCMP 3GF5A 4M7DE 1NJIR 1N9RA 3QKJA 2KK4A 2PVGB 3CCEQ 4M78E 4M77E 1ACMB 1ZUKA 1XJWB 2DYBA 1UE9A 1MNDA 1M3AA 2LC4A 4ZN3A 3LW5E 4FCYA 1UTIA 4KH1B 3I5RA 5LJ5e 1VYVA 3CMEA 2DBKA 5AYFA 1TOVA 4C92A 1MV0B 3FJ5A 1BB9A 2ZPIB 1LVKA 1VQ9T 1BI3A 1Q86U 5CR2A 1D0YA 2PVDB 1AOJA 2RJEA 3Q1JA 2QDLA 2J06A 3SEMA 1I0CA 3QIIA 4EMHA 4L5GA 4OB3B 5LL6S 3CCRA 1YJ9A 1RAFB 1D1AA 1R8OB 1RAAB 1RUWA 2E4HA 3DLLA 4Y91A 2LP5A 5FROA 1B3QA 2EIFA 1RLQC 2Y4XA 5IHNA 5GMKi 4C92D 1NZ9A 2A3LA 2RQUA 4IKFA 4XU0A 2EQUA 2DK3A 3PNWC 2RK2A 3J80E 3A8MB 1BCMA 2EW3A 4XTWA 1QW1A 2MF2A 2D1XA 2QAZA 4Z02A 4R55A 1NLPC 6AT1B 3J81E 5KYYB 3CC7A 4IIOA 1SPKA 4LDXA 3GIBA 3M0RA 2BZYA 2ED0A 4J9DA 4LNPA 1UEBA 1QQJA 1TUDA 1W70A 4AG2C 1S72A 1RLPC 2L3PA 3QZ5B 4HXJA 2QA4A 1X01A 3R6NA 2ZPHB 3M0SA 2J05A 1PG5B 3C12A 3P8DA 1KQSS 1M2OA 3EG2A 4OGCA 5M9OA 1YJWA 4HVWA 1GFCA 1TS9A 2K3BA 4PJOA 2YRVA 3V7RA 3JCMV 3G71A 3G6EA 3ER0A 2QEXA 1D3BA 4M75B 2LJ1A 2K6DA 2JNGA 2QASA 2CP5A 1VQKA 2QTVA 3CCMT 4KT0E 5KYUB 3TEEA 1PC0A 3THKA 1X2KA 4DOWA 3QHSA 1ZBXA 5L23A 1BBZA 5GAMh 2I2LA 1IHVA 4N0AA 3A98A 5I2MA 2O01E 2RM4A 3CD6A 3HPWA 5LJ3g 4ELZC 3VS5A 1OX8A 3H0IA 3UA7A 1GCPA 1YBYA 3OYNA 4N4HA 2M1HA 4PJOD 2CP0A 3SHWA 3FDRA 1ZUUA 1ZA1B 4C92C 3OYEA 2E1HA 2RK1A 1WNLA 2J7IA 5KCHA 4OGEA 2WSFE 4OVAA 2AT1B 1Y96B 1T3LA 1YFNA 2K2VA 1YHQT 1AWJA 3JCMe 4D8DA 2CP3A 2P4RA 2A28A 5LJ3d 1X27A 3JSCA 4MDWA 4XTXA 1KC8U 3HSBA 1OV3A 5C6SA 3RMQA 3BW1A 2OTJQ 1YIJA 1WZOA 2XDDA 3FC3A 4EIKA 4E2FB 5GAOr 4PNOA 3JB9H 4J9EA 1I1JA 2LT1A 4C0DC 4AFZC 1TXQA 1ZSZA 4C8QA 5CKBA 4QQ6A 4FT4A 4B9WA 2R5AA 1JU5C 4X9DA 5D6YA 3EFOB 2C06A 5I21A 4C5HA 3DLMA 1QP3A 3PT9A 3QPHA 3EG9B 1Q86C 3I55A 1UUEA 1QLYA 4A63B 1MMNA 4AFQC 4A4FA 4EMKB 3CCET 3PVLA 4MZTA 4A54A 3QDRB 1V1CA 2GTOA 2ABLA 3GNGA 4JDSA 1FXXA 3CBMA 3CCJA 5GAMj 2L0AA 1YI2Q 1OULA 4XAXB 3VS6A 4WTOB 2K9GA 2FB7A 4EMGA 3EFSA 3FB9A 1I5OB 5LJ3f 1G8XA 2JOYA 4PJOC 2L3QA 2DD5A 4A53A 4CC4B 4II1A 4HT9A 2ED1A 4BUGA 1VQ5Q 4AFUC 5FRNA 2DJQA 1GL5A 2F69A 2L2PA 1N8RU 1VQOA 2ZPBB 1QWFA 2XD0A 4N4IA 3PTAA 2K2MA 5GJVB 1MMDA 2RQRA 3ASKA 1W1FA 1U1SA 2YXYA 2LNHB 3CCQA 1VQ6A 1G83A 1RI9A 4N0AC 2E10A 2QQRA 3EG3A 2PZ1A 2IIMA 3VYHB 4M7AG 3PFSA 1F1BB 1HK9A 1NEBA 2AHJB 2RHXA 3ZBDA 3OYGA 2LTOA 2K4YA 1MNEA 1AHJB 1WJQA 5HK3A 5AT1B 3JRZA 2LQKA 4M4ZA 4J6XA 5KYWB 1QWEA 1YP5A 5I11A 1EIFA 4RTXA 3MCAB 4M75F 1DJ7B 3CC4A 2BE7D 4ZGEB 3OYJA 1WXUA 4AMCA 3JCMf 2EYQA 2CZ0B 2PUOB 4A4KA 1ZUYA 2KXCA 3CPFA 1BIBA 3A5ZB 1ZBJA 3LH0A 2DL7A 3KFVA 1M1GA 3CC2Q 2CT4A 4J83A 3UATA 1VQ4Q 2IG0A 3QJYA 3RERA 2M02A 1RADB 1QCOA 5GAN7 3MP6A 1ZSZC 4C8QC 1QVGS 2JS0A 2XDPA 1OU9A 2LT4A 1KSWA 5GAN2 1XTDA 2KQWA 2PNIA 3QO3A 1YITA 1HXDA 2VC8A 3OW2A 3RKWA 1KHIA 2DA9A 5CIUA 1WGSA 4C5GA 1KC8C 3FEOA 1E7OA 4JUVA 1YJNA 3S3MA 5FU6B 5D6WA 2M9UA 4A4HA 1KQSP 2IVWA 1WYXA 5KE3A 2DILA 4HCBA 4YTLA 2RQWA 4J6YA 1XNIA 1NLOC 1E6GA 4F7UB 3CMAA 2DL4A 1QVFS 3JB9F 4CI0C 5FRMA 1Y71A 1K1ZA 1W2BS 2EWNA 2VUBA 4J9GA 1EX4A 1OQKA 4E7LA 3A8GB 2KYBA 1MHNA 2DIGA 4LDUA 3LYIA 3EH2A 2OAWA 4KGZB 2LMJA 2OTJT 2YUNA 4J9BA 5J3BA 3H0FA 2JXBA 4FT2A 2MCNA 1VQLQ 2DFUA 5GAN3 3X28B 2CP6A 1N6AA 2MPXC 2L89A 3OYYA 3ULRB 2PVOB 2DTOA 4JRPA 3OB9A 2CH4A 1YCSB 2HEQA 2RNAA 1SSFA 3V8KA 3V7CA 3M9QA 1SSHA 3MJXA 4FYWB 3BDLA 2HSPA 2RD1A 4OB0B 4E47A 2LVMA 2X4JA 3EH1A 4QVZA 1ZQ1A 1N8RC 2D6FA 3DB3A 1PRMC 3VUZA 1Q81U 5GAOl 2DXTA 2YUOA 2RJCA 3BE3A 1BI2A 4XTUA 3CPWS 2XHCA 4FM4B 4BI8B 4JPBW 1KFZA 4OMMA 3OYDA 5LJ3h 1YI2T 4V2SA 4GLKA 1H8KA 2RI5A 2FZCB 1MMGA 1N5ZA 5IXBA 2GCXA 2HQEA 1K8AR 3HTRA 2CDTA 4RMOA 2DYIA 2XU8A 5DLQE 2E12A 4MZMA 4M7DG 1VQ5T 1YHQA 1Y7XA 2CSQA 4J6WA 2FZGB 4M78G 2FEIA 4M77G 4JLGA 3C94A 2X3WD 2MMPA 2FHDA 2A08A 2CGHA 4C0DB 4J9CA 3I35A 3EHRA 2YLBA 2K57A 4NL2A 4XU2A 1X6BA 3F70A 2VWFA 8ATCB 4JLIA 1YNZA 1VIFA 2RO0A 5A0GA 3EG1A 4OMPA 3M0UA 3FIFA 2RA2A 4HT8A 4X9CA 4FYYB 1Q95G 1M8VA 3QSUA 2V8JA 5EC7A 3M0PA 4BI4A 2LCSA 2AZVA 4LDVA 2HBPA 4E6RA 1VIEA 4F04B 3H9NA 2O4XA 3M53A 2D9TA 3OBWA 2RMOA 1U06A 3M56A 4PJOB 2LCLA 4EPCA 2LX7A 2CUDA 1NYFA 9ATCB 1D3BB 2V1RA 1YWOA 2GQVA 3M54A 4BY6B 2O88A 1KD1C 1AZGB 4ZN1A 1VQ4T 3INZA 2NLUA 3OYKA 2LJ3A 1K4US 5LJ3j 4FSXA 3CBPA 3MO8A 1KQSA 2XICA 1BKBA 3QWYA 2RI3A 3CCUT 3AHUA 1JO8A 5CVIA 3RUXA 2KT8A 2PTKA 3VS3A 2QQSA 1WHKA 2L3RA 2SRCA 2CH4W 1VQ7Q 2KRNA 4PLLA 1RAIB 2JTFA 2LRQA 5GAOm 2Y90A 2B8AA 4J9HA 1KJWA 3CCLA 2DJZA 3FLGA 3EHQA 4F7UF 2COYA 1M1KC 3OYLA 2QGFB 1TWBA 2BKDN 1VQPA 2J6OA 4M75E 2E3HA 2DF6A 4D8KA 4QQGA 4DEXA 4DQ2A 2AKKA 1SF9A 2HZYA 3WVDB 1VQNQ 2FRYA 3QG1A 4M7AA 1IXDA 4E7IA 1GXIE 2G6FX 1KG1A 2KGTA 3UPUA 2VGMA 2FYKA 1I07A 2MOXA 3NFCA 1QVGP 1VUBA 1YWPA 5CAIA 1Q86R 2EKHA 3PMTA 3LWHA 3LGFA 2ROLA 3QXEB 2VASA 4K11A 1M30A 3C95A 2HMAA 2DO3A 1ZSZB 1JRIA 1R77A 3CMEQ 1Q81C 1S1NA 1OPLA 2NUTB 2COWA 4VUBA 3VS4A 3NPFA 4C92F 3JCMb 1MMAA 2DL5A 1RAEB 1VQLT 3OYIA 1PM3A 2V26A 2OJ2A 4HVUA 3MPUB 2YUPA 3A1PA 3FRNA 3MEUA 4M7AD 4J8OA 7AT1B 2JJ9A 2EFIA 4L6V5 3PE0A 3HRUA 3QBYA 1IZ6A 4ORZA 5GAN5 2A36A 3CCRQ 3V7SA 3PGGA 1YJ9Q 4OMNA 5CKEA 1BIAA 3KXTA 3G4ST 5IXFA 2LQNA 4M7AF 2EQIA 4Z89A 3WXMB 3LGLA 5LJ3e 1W2BP 2MK5A 2DIQA 2KXDA 2C0TA 4XU3A 3A8OB 3REAB 1GRIA 4KBMB 3QDFA 5FU7C 4FW2A 4TVRA 1OI1A 5DLOA 1I5LA 3RNJA 3M57A 4IUQA 4ELYC 3HL8A 5GANg 2AK5A 2DMOA 1X2QA 1TG0A 4IUUA 2W10A 4BDYA 2NWMA 1FMWA 1PKSA 3C0CA 1D09B 3CCVA 1AWXA 4F14A 1T0HA 5FLXE 3EGXA 2CUBA 2QYZA 2QA4Q 3OYHA 5L8RE 4DOVA 2BZXA 1KIKA 2DZCA 1M3BA 4HKEA 3SWNC 5IN1A 1N9SA 1K73C 2P0KA 3MP1A 2KY9A 2YDLA 5GANd 3OYFA 4DBQA 4PJOF 2O9VA 1VQ8T 2D8HA
chains in the Genus database with same CATH topology
5I11A 4RTUA 4OMLA 1ARKA 4RTXA 1X43A 2EGAA 4RUGA 1Z9ZA 3M0QA 2AZSA 1U5SA 1WXUA 1WLPB 2D8JA 1ZUYA 2AKLA 2RPNA 2KXCA 1FMKA 1ZBJA 2DL7A 3RBBB 3KFVA 1QKWA 1SRLA 2CT4A 3UATA 4CC7A 1X6GA 1ZSGA 4RTYA 2KBTA 1H92A 4DEYA 4LE9A 3QWXX 2DM1A 2JS0A 2EBPA 3TVTA 1WI7A 4CC2A 2E5KA 1KSWA 2X3XD 2EYZA 3M0TA 2V1QA 1OPKA 2D8HA 2O2OA 2PNIA 2OI3A 3VS7A 1UHCA 1H3HA 2DA9A 2F2XA 4JZ3A 1E7OA 1K9AA 2ECZA 2HCKA 1VYUA 1YN8A 1OEBA 2F2WA 1UDLA 3GBQA 2JS2A 1WYXA 1JQQA 1PHTA 5IHKA 2DILA 3NMZC 5ECAA 1JEGA 2RQWA 1K0XA 2W0ZA 1NLOC 4ESRA 1E6GA 2JT4A 1CKAA 1ZX6A 3VS2A 2DL4A 4HVVA 2CT3A 2ROTA 3EG0A 4GBQA 1MUZA 3NGPA 2K7AA 1ABQA 1NG2A 2EPDA 1K1ZA 2VVKA 4F16A 1GBRA 4J9GA 1QCFA 2EGCA 2KYBA 2HBWA 4GLMA 2OAWA 1BK2A 4AG1C 2LMJA 4J9IA 2YUNA 3O5ZA 4J9BA 2MCNA 3H0FA 2JXBA 3NHNA 1WXTA 4RTTA 4F17A 3TSWA 2DL3A 2LZ6B 3ULRB 1WFWA 1ZLMA 1ZUKA 2CH4A 1UJ0A 1YCSB 1TUCA 4JJCA 2HEQA 2RNAA 2DYBA 1UE9A 1SSHA 2L3SA 1M3AA 2HSPA 4Z8AA 1UTIA 2JMAA 3I5RA 1VYVA 2EYWA 1NM7A 2DBKA 1MV0B 3FJ5A 3REBB 1BB9A 1PRMC 1LCKA 2KEAA 4KRTA 2YUOA 5I22A 1UJYA 2NUZA 4QT7A 1M27C 1KFZA 4JPBW 4OMMA 2ESWA 1AOJA 1WIEA 2EVRA 2QDLA 2J06A 4RTZA 3SEMA 1H8KA 2EYXA 1I0CA 2I0NA 1WXBA 2KROA 4RTVA 1RUWA 1N5ZA 1CSKA 4Y92A 5IXBA 4JJBA 1AWWA 2CDTA 2LP5A 2DRKA 1JXOA 1B3QA 4AFSC 1RLQC 4RTWA 3PVQA 5IHIA 2CSQA 5IHNA 2FEIA 4LUEA 2FG0A 1SEMA 2X3WD 2RQUA 3CQTA 2DNUA 2FPEA 2A08A 4J9CA 3UA6A 3I35A 3EHRA 2F2VA 2XMFA 2EW3A 1X6BA 2D1XA 1Y57A 2CSIA 1NLPC 2DX1A 1UG1A 1SPKA 1PNJA 4IIOA 5GJWB 2VWFA 2KRSA 3M0RA 2BZYA 2ED0A 1YNZA 2JTEA 4J9DA 4LNPA 2H8HA 4CC3A 3EG1A 1HD3A 1TUDA 2RN8A 1W70A 2JM9A 2B86A 3M0UA 4OMPA 2J6KA 2O9SA 4JZ4A 1A0NB 4AG2C 1RLPC 1FYNA 2L3PA 1UFFA 2KRMA 4HXJA 1HJDA 5EC7A 3M0PA 1GCQA 2LCSA 1AD5A 3R6NA 2AZVA 2SEMA 3M0SA 1U3OA 2J05A 1HSQA 2BTTA 2D0NA 3JV3A 4E6RA 3EG2A 4HVWA 2DVJA 2RF0A 2KR3A 1GFCA 5IH2A 2K3BA 2RMOA 1U06A 1PRLC 3H0HA 2JW4A 2LX7A 2CUDA 4ZNXA 1NYFA 5HCKA 2LJ1A 2K6DA 2GNCA 2V1RA 3VS1A 1YWOA 2A37A 2O88A 1AZGB 5FW9A 1M3CA 1UECA 2LJ3A 1K4US 1VYTA 1T0JA 3THKA 1X2KA 3EGUA 3QWYA 4LUDA 5L23A 1JO8A 1BBZA 2RQTA 3IQLA 1K0SA 2KT8A 2PTKA 4FSSA 3VS3A 1GFDA 2FPDA 2DLPA 3A98A 3VS0A 1SHFA 2SRCA 2CH4W 1UHFA 2KRNA 2C0IA 3VS5A 1B07A 3H0IA 3UA7A 2KNBB 1IO6A 1GCPA 4J9HA 1KJWA 5FWBA 3TSZA 1J3TA 3EHQA 3SHWA 1XOVA 1ZUUA 1NEGA 3I5SA 1EFNA 2HDAA 2J6OA 1T3SA 2FO0A 2J7IA 2DF6A 4D8KA 4DEXA 1ABOA 2AKKA 1K76A 3H41A 1T3LA 2K79A 1AWJA 4D8DA 2FRYA 4X1VA 2P4RA 1PKTA 2A28A 1E6HA 2G6FX 1X27A 2KGTA 1QKXA 1I07A 2MOXA 3UF4A 1YWPA 1OV3A 2J6FA 2EKHA 1OOTA 4OMQA 2ROLA 5FWCA 4EIKA 4J9EA 1I1JA 4K11A 1M30A 1SRMA 1WA7A 4AFZC 2YSQA 1VA7A 4Z88A 2YUQA 1S1NA 1OPLA 1JU5C 1SHGA 2DE0X 3VS4A 3NPFA 1WDXA 4LN2A 1M8MA 2DL5A 1W6XA 2GTJA 2OJ2A 4HVUA 2YUPA 2RQVA 2DBMA 2EGEA 1UUEA 1QLYA 4A63B 3U23A 2KYMA 4AFQC 1UGVA 3PE0A 4HCKA 3PVLA 1Z9QA 2C0OA 4ORZA 2DRMA 1AWOA 2A36A 2ENMA 1V1CA 2GTOA 2ABLA 4OMNA 1GCQC 1CKBA 1PWTA 5IXFA 2LQNA 2L0AA 2EQIA 2BZ8A 1BU1A 3VS6A 1MV3A 2K9GA 1AVZC 2M0YA 4Z89A 2YT6A 2JMCA 1NYGA 1JXMA 2GGRA 2KXDA 2L3QA 2VKNA 2C0TA 2CREA 4CC4B 3REAB 2GBQA 1GRIA 2ED1A 4AFUC 2O31A 2DJQA 1GL5A 4OMOA 2L2PA 1GBQA 2FPFA 3RNJA 3LH5A 4J9FA 1QWFA 1Y0MA 2JM8A 4WCIA 2LQWA 2K2MA 2AK5A 2DMOA 3I9QA 1X2QA 5GJVB 1TG0A 2RQRA 2M51A 2W10A 2NWMA 1WX6A 1W1FA 1PKSA 3VRYA 3C0CA 2GQIA 2KT1A 1AWXA 2LNHB 4F14A 1AEYA 4JJDA 1G83A 1RI9A 1T0HA 2EYYA 2CUBA 3EG3A 2PZ1A 2IIMA 1G2BA 3ZL7C 1NEBA 1AZEA 2LJ0A 2BZXA 1X69A 1KIKA 1M3BA 2MIOA 4IIMA 4R0KA 2FRWA 3VRZA 2YDLA 4M4ZA 2DL8A 1QWEA 2O9VA 2KE9A 1YP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I11 A;  4RTU A;  4OML A;  1ARK A;  4RTX A;  1X43 A;  2EGA A;  4RUG A;  1Z9Z A;  3M0Q A;  2AZS A;  1U5S A;  1WXU A;  1WLP B;  2D8J A;  1ZUY A;  2AKL A;  2RPN A;  2KXC A;  1FMK A;  1ZBJ A;  2DL7 A;  3RBB B;  3KFV A;  1QKW A;  1SRL A;  2CT4 A;  3UAT A;  4CC7 A;  1X6G A;  1ZSG A;  4RTY A;  2KBT A;  1H92 A;  4DEY A;  4LE9 A;  3QWX X;  2DM1 A;  2JS0 A;  2EBP A;  3TVT A;  1WI7 A;  4CC2 A;  2E5K A;  1KSW A;  2X3X D;  2EYZ A;  3M0T A;  2V1Q A;  1OPK A;  2D8H A;  2O2O A;  2PNI A;  2OI3 A;  3VS7 A;  1UHC A;  1H3H A;  2DA9 A;  2F2X A;  4JZ3 A;  1E7O A;  1K9A A;  2ECZ A;  2HCK A;  1VYU A;  1YN8 A;  1OEB A;  2F2W A;  1UDL A;  3GBQ A;  2JS2 A;  1WYX A;  1JQQ A;  1PHT A;  5IHK A;  2DIL A;  3NMZ C;  5ECA A;  1JEG A;  2RQW A;  1K0X A;  2W0Z A;  1NLO C;  4ESR A;  1E6G A;  2JT4 A;  1CKA A;  1ZX6 A;  3VS2 A;  2DL4 A;  4HVV A;  2CT3 A;  2ROT A;  3EG0 A;  4GBQ A;  1MUZ A;  3NGP A;  2K7A A;  1ABQ A;  1NG2 A;  2EPD A;  1K1Z A;  2VVK A;  4F16 A;  1GBR A;  4J9G A;  1QCF A;  2EGC A;  2KYB A;  2HBW A;  4GLM A;  2OAW A;  1BK2 A;  4AG1 C;  2LMJ A;  4J9I A;  2YUN A;  3O5Z A;  4J9B A;  2MCN A;  3H0F A;  2JXB A;  3NHN A;  1WXT A;  4RTT A;  4F17 A;  3TSW A;  2DL3 A;  2LZ6 B;  3ULR B;  1WFW A;  1ZLM A;  1ZUK A;  2CH4 A;  1UJ0 A;  1YCS B;  1TUC A;  4JJC A;  2HEQ A;  2RNA A;  2DYB A;  1UE9 A;  1SSH A;  2L3S A;  1M3A A;  2HSP A;  4Z8A A;  1UTI A;  2JMA A;  3I5R A;  1VYV A;  2EYW A;  1NM7 A;  2DBK A;  1MV0 B;  3FJ5 A;  3REB B;  1BB9 A;  1PRM C;  1LCK A;  2KEA A;  4KRT A;  2YUO A;  5I22 A;  1UJY A;  2NUZ A;  4QT7 A;  1M27 C;  1KFZ A;  4JPB W;  4OMM A;  2ESW A;  1AOJ A;  1WIE A;  2EVR A;  2QDL A;  2J06 A;  4RTZ A;  3SEM A;  1H8K A;  2EYX A;  1I0C A;  2I0N A;  1WXB A;  2KRO A;  4RTV A;  1RUW A;  1N5Z A;  1CSK A;  4Y92 A;  5IXB A;  4JJB A;  1AWW A;  2CDT A;  2LP5 A;  2DRK A;  1JXO A;  1B3Q A;  4AFS C;  1RLQ C;  4RTW A;  3PVQ A;  5IHI A;  2CSQ A;  5IHN A;  2FEI A;  4LUE A;  2FG0 A;  1SEM A;  2X3W D;  2RQU A;  3CQT A;  2DNU A;  2FPE A;  2A08 A;  4J9C A;  3UA6 A;  3I35 A;  3EHR A;  2F2V A;  2XMF A;  2EW3 A;  1X6B A;  2D1X A;  1Y57 A;  2CSI A;  1NLP C;  2DX1 A;  1UG1 A;  1SPK A;  1PNJ A;  4IIO A;  5GJW B;  2VWF A;  2KRS A;  3M0R A;  2BZY A;  2ED0 A;  1YNZ A;  2JTE A;  4J9D A;  4LNP A;  2H8H A;  4CC3 A;  3EG1 A;  1HD3 A;  1TUD A;  2RN8 A;  1W70 A;  2JM9 A;  2B86 A;  3M0U A;  4OMP A;  2J6K A;  2O9S A;  4JZ4 A;  1A0N B;  4AG2 C;  1RLP C;  1FYN A;  2L3P A;  1UFF A;  2KRM A;  4HXJ A;  1HJD A;  5EC7 A;  3M0P A;  1GCQ A;  2LCS A;  1AD5 A;  3R6N A;  2AZV A;  2SEM A;  3M0S A;  1U3O A;  2J05 A;  1HSQ A;  2BTT A;  2D0N A;  3JV3 A;  4E6R A;  3EG2 A;  4HVW A;  2DVJ A;  2RF0 A;  2KR3 A;  1GFC A;  5IH2 A;  2K3B A;  2RMO A;  1U06 A;  1PRL C;  3H0H A;  2JW4 A;  2LX7 A;  2CUD A;  4ZNX A;  1NYF A;  5HCK A;  2LJ1 A;  2K6D A;  2GNC A;  2V1R A;  3VS1 A;  1YWO A;  2A37 A;  2O88 A;  1AZG B;  5FW9 A;  1M3C A;  1UEC A;  2LJ3 A;  1K4U S;  1VYT A;  1T0J A;  3THK A;  1X2K A;  3EGU A;  3QWY A;  4LUD A;  5L23 A;  1JO8 A;  1BBZ A;  2RQT A;  3IQL A;  1K0S A;  2KT8 A;  2PTK A;  4FSS A;  3VS3 A;  1GFD A;  2FPD A;  2DLP A;  3A98 A;  3VS0 A;  1SHF A;  2SRC A;  2CH4 W;  1UHF A;  2KRN A;  2C0I A;  3VS5 A;  1B07 A;  3H0I A;  3UA7 A;  2KNB B;  1IO6 A;  1GCP A;  4J9H A;  1KJW A;  5FWB A;  3TSZ A;  1J3T A;  3EHQ A;  3SHW A;  1XOV A;  1ZUU A;  1NEG A;  3I5S A;  1EFN A;  2HDA A;  2J6O A;  1T3S A;  2FO0 A;  2J7I A;  2DF6 A;  4D8K A;  4DEX A;  1ABO A;  2AKK A;  1K76 A;  3H41 A;  1T3L A;  2K79 A;  1AWJ A;  4D8D A;  2FRY A;  4X1V A;  2P4R A;  1PKT A;  2A28 A;  1E6H A;  2G6F X;  1X27 A;  2KGT A;  1QKX A;  1I07 A;  2MOX A;  3UF4 A;  1YWP A;  1OV3 A;  2J6F A;  2EKH A;  1OOT A;  4OMQ A;  2ROL A;  5FWC A;  4EIK A;  4J9E A;  1I1J A;  4K11 A;  1M30 A;  1SRM A;  1WA7 A;  4AFZ C;  2YSQ A;  1VA7 A;  4Z88 A;  2YUQ A;  1S1N A;  1OPL A;  1JU5 C;  1SHG A;  2DE0 X;  3VS4 A;  3NPF A;  1WDX A;  4LN2 A;  1M8M A;  2DL5 A;  1W6X A;  2GTJ A;  2OJ2 A;  4HVU A;  2YUP A;  2RQV A;  2DBM A;  2EGE A;  1UUE A;  1QLY A;  4A63 B;  3U23 A;  2KYM A;  4AFQ C;  1UGV A;  3PE0 A;  4HCK A;  3PVL A;  1Z9Q A;  2C0O A;  4ORZ A;  2DRM A;  1AWO A;  2A36 A;  2ENM A;  1V1C A;  2GTO A;  2ABL A;  4OMN A;  1GCQ C;  1CKB A;  1PWT A;  5IXF A;  2LQN A;  2L0A A;  2EQI A;  2BZ8 A;  1BU1 A;  3VS6 A;  1MV3 A;  2K9G A;  1AVZ C;  2M0Y A;  4Z89 A;  2YT6 A;  2JMC A;  1NYG A;  1JXM A;  2GGR A;  2KXD A;  2L3Q A;  2VKN A;  2C0T A;  2CRE A;  4CC4 B;  3REA B;  2GBQ A;  1GRI A;  2ED1 A;  4AFU C;  2O31 A;  2DJQ A;  1GL5 A;  4OMO A;  2L2P A;  1GBQ A;  2FPF A;  3RNJ A;  3LH5 A;  4J9F A;  1QWF A;  1Y0M A;  2JM8 A;  4WCI A;  2LQW A;  2K2M A;  2AK5 A;  2DMO A;  3I9Q A;  1X2Q A;  5GJV B;  1TG0 A;  2RQR A;  2M51 A;  2W10 A;  2NWM A;  1WX6 A;  1W1F A;  1PKS A;  3VRY A;  3C0C A;  2GQI A;  2KT1 A;  1AWX A;  2LNH B;  4F14 A;  1AEY A;  4JJD A;  1G83 A;  1RI9 A;  1T0H A;  2EYY A;  2CUB A;  3EG3 A;  2PZ1 A;  2IIM A;  1G2B A;  3ZL7 C;  1NEB A;  1AZE A;  2LJ0 A;  2BZX A;  1X69 A;  1KIK A;  1M3B A;  2MIO A;  4IIM A;  4R0K A;  2FRW A;  3VRZ A;  2YDL A;  4M4Z A;  2DL8 A;  1QWE A;  2O9V A;  2KE9 A;  1YP5 A; 
#chains in the Genus database with same CATH topology
 5GAO q;  4OML A;  1ARK A;  3G71 Q;  3G6E Q;  5IAY A;  2EGA A;  4RUG A;  3I56 A;  2AZS A;  1HYO A;  3OSV A;  4RCB A;  1WLP B;  3S3O A;  1NJI C;  2D8J A;  3OW2 P;  1VQK Q;  1LNX A;  4M7A C;  4XQ3 A;  3VKI A;  2NUP A;  3RBB B;  1ZSG A;  3CD6 Q;  4LE9 A;  1VQM Q;  3QWX X;  2YLC A;  1TUG B;  2DM1 A;  4JJN K;  4LDY A;  2Y4Y A;  1KC8 R;  3TVT A;  4IUT A;  4CC2 A;  2CZ7 B;  1D0X A;  3EGD A;  2E5K A;  2P0Q A;  2X3X D;  2HAX A;  2QQA A;  2EYZ A;  4XK8 E;  1OPK A;  1VOM A;  2O2O A;  4QVD A;  2OI3 A;  3JB9 J;  1VQ5 A;  3VS7 A;  4PFP A;  1H3H A;  3JCM Q;  1VQ7 T;  2F2X A;  3M59 A;  1QVG A;  2A0F B;  5GAN f;  2ECZ A;  1RAB B;  1KHC A;  5CQY A;  3P8B B;  4M7D A;  2V8I A;  3NTI A;  3GBQ A;  4C8Q D;  4M78 A;  4M77 A;  1JQQ A;  2F5K A;  1YIJ Q;  1JEG A;  4D6W A;  1M90 U;  4O5V A;  4ESR A;  2XK0 A;  2JT4 A;  4PJJ A;  2CT3 A;  2VV5 A;  4C8Q F;  2ROT A;  3EG0 A;  2K7A A;  1ABQ A;  3QYH B;  1VQN T;  1B34 A;  4FIB A;  4HCZ A;  3CCS A;  4X34 A;  4GY5 A;  3I55 Q;  2E6Z A;  1H64 1;  1BI0 A;  4J9I A;  1WQW A;  3E2U A;  3O5Z A;  1U8R A;  4M7D D;  2ZZD A;  2XG8 D;  1WXT A;  3L1A A;  2X4X A;  3MEV A;  1IGQ A;  3JB9 I;  4M78 D;  4PJM A;  1LOJ A;  4M77 D;  2JUF A;  1QVF A;  3TSW A;  1N8R R;  2DL3 A;  1WHJ A;  2WSE E;  2LZ6 B;  1W2B A;  3CME T;  4DBF A;  1WFW A;  2E3I A;  2E70 A;  1G3S A;  4JJC A;  2L3S A;  1EZZ B;  2QGG A;  4PL6 A;  3QYG B;  3H8Z A;  4Z8A A;  4F7U E;  4LD6 A;  4HCC A;  3CCU A;  2EYW A;  4LXC A;  4NS5 A;  1TSF A;  3CEY A;  2DER A;  2YHT A;  1I8F A;  2ZCF B;  1LCK A;  3ZFJ A;  2RI2 A;  1H3Z A;  4KRT A;  2E6N A;  3PIO A;  3CCR T;  2NUZ A;  3SDZ A;  3DB4 A;  4QT7 A;  1MGQ A;  1M27 C;  2KVQ G;  3RDV A;  2E5Q A;  4RTZ A;  3JCM c;  1VQ9 A;  1WXB A;  2KRO A;  5GMK l;  4DA4 A;  1RAG B;  1V29 B;  4RTV A;  5HK0 A;  3CCQ Q;  4OB1 B;  1CSK A;  1VQ6 Q;  5GMK h;  2EJF A;  3VU3 C;  5J39 A;  3OS1 A;  4KUI A;  1AT1 B;  1M9S A;  4JJB A;  2DRK A;  1JXO A;  3GNF B;  4AFS C;  3WVE B;  5CQX A;  4RTW A;  5IHI A;  4LDW A;  3CXC S;  4ZGJ B;  3CPW A;  3FJP A;  3UT1 A;  5KYX A;  3HRT A;  3CQT A;  3HFO A;  4C5E A;  4FYX B;  2L5Q A;  3UA6 A;  4KUD K;  2F2V A;  2XMF A;  1Q7Y C;  1G3Y A;  1Y57 A;  2CS7 A;  2F1L A;  1UG1 A;  2DET A;  1PNJ A;  5GJW B;  1KD1 U;  3CC4 Q;  3OMC A;  2KRS A;  1OZ2 A;  2H8H A;  4PKC C;  3TCJ A;  4CC3 A;  3KBG A;  3VV0 A;  2GFU A;  2JM9 A;  2B86 A;  2J6K A;  4XTY A;  1FYN A;  4M7D C;  2EJG A;  3LLR A;  2DEU A;  4M78 C;  4BE1 A;  2KAF A;  4M77 C;  3R6O A;  1HJD A;  4IUV A;  1GCQ A;  2EQK A;  3E19 A;  3EAE A;  2SEM A;  2RJD A;  2DD4 A;  2BTT A;  2FL7 A;  3G71 T;  3VJP A;  3JV3 A;  4OB2 B;  3G6E T;  2YWW A;  5DM7 R;  1D1C A;  1LJO A;  3OS0 A;  2RF0 A;  3BFM A;  1M1K U;  4ZGD B;  2DTH A;  2G3R A;  2O4X B;  1VQK T;  3G4S A;  4E7H A;  3H0H A;  2JW4 A;  4ZNX A;  5HCK A;  5GAM g;  3OSS C;  2GNC A;  3VS1 A;  2A37 A;  3EFR A;  1YIT Q;  2COZ A;  2OAU A;  4PFZ A;  1IB8 A;  1M3C A;  2PUK B;  1UEC A;  1VYT A;  4DBR A;  2RHZ A;  3CD6 T;  1VQM T;  1M1K R;  1NBE B;  2RQT A;  1K0S A;  1YJN Q;  2DAQ A;  2JZ2 A;  4FSS A;  3CCM A;  1GFD A;  2FPD A;  2QTX A;  5CK9 A;  1M1F A;  5GMK j;  1SHF A;  1M90 C;  2KI7 A;  4NOY A;  3MKD A;  5GAO n;  3V8L A;  2ZPE B;  1B07 A;  2KNB B;  1IO6 A;  3RMS A;  2E65 A;  1RAC B;  5GAN h;  1J3T A;  4C92 B;  1XOV A;  2NYS A;  3CMA Q;  3I5S A;  2VYT A;  3OS2 A;  1NPR A;  4PJO E;  2DVE A;  1TTH B;  5A2Q E;  3L2Q A;  5IT9 E;  1G5V A;  1T3S A;  2FO0 A;  4ATO A;  1IGU A;  4OF1 A;  1PD1 A;  2RHI A;  3VYG A;  1K76 A;  3H41 A;  3E9G A;  1QCN A;  1D1B A;  1RL2 A;  3S3N A;  2R5M A;  4X1V A;  3OQ5 A;  1YIJ T;  1PKT A;  1FMV A;  1M4Z A;  1Q81 R;  2OTL Q;  1VQ8 A;  2JVV A;  1G3W A;  4M7A B;  4BB7 A;  3A8H B;  2X4W A;  1QKX A;  1PD0 A;  2KMT A;  3A8L B;  2QQ9 A;  3SB2 A;  3OYA A;  1WHG A;  2DZ9 A;  1SRM A;  1WA7 A;  2PQW A;  3PIP A;  3C4S A;  1VA7 A;  2HQX A;  2MWO A;  4Z88 A;  3M4Y A;  4AT1 B;  2YUQ A;  4PLI A;  3OMG A;  2DE0 X;  1WDX A;  1M8M A;  1JJ2 S;  2GTJ A;  2LQ8 A;  4J7I A;  1SKU B;  2RQV A;  2DBM A;  2EGE A;  3JAM E;  1M5Q 1;  4M75 G;  1UGV A;  1WJS A;  3HHT B;  4EMK C;  3SD4 A;  1QVP A;  2FVU A;  2ENM A;  1GCQ C;  1CKB A;  5KCO A;  1SG5 A;  3CCE A;  1Q82 C;  3X25 B;  1BU1 A;  2VXF A;  5GAO p;  2M0Y A;  1VQ7 A;  1K73 U;  1NYG A;  4JS4 A;  4QVC A;  1JXM A;  2ZPF B;  5GAN j;  2GGR A;  2VKN A;  4EDU A;  1Y07 A;  2GBQ A;  1UGR B;  3NTK A;  1W4S A;  2R57 A;  4Y28 E;  3RES A;  3CC2 T;  5GMK e;  2HL3 A;  3RKY A;  2OX7 A;  3S6W A;  1OZ3 A;  2FPF A;  2XI9 A;  3LH5 A;  4J9F A;  1NJI U;  3P8H A;  3CCQ T;  2JM8 A;  2LQW A;  1VQ6 T;  1PSF A;  3I9Q A;  3OBY A;  3MET A;  1O75 A;  4Q5W A;  3T9N A;  1K73 R;  2M51 A;  4XTZ A;  1WX6 A;  2MI6 A;  3M4G A;  2DXU A;  4RCC A;  2GQI A;  2KT1 A;  4P5N A;  4ME7 A;  1G2B A;  3EGX B;  5CKF A;  3SWN A;  2LJ0 A;  2HL5 C;  4CRI A;  4IIM A;  3CC4 T;  1B7T A;  2QG9 B;  2FRW A;  1C0M A;  5CKH A;  2DL8 A;  2AIR B;  4RTU A;  4FW1 A;  3JB9 G;  1QP2 A;  1Z9Z A;  1U5S A;  4NL3 A;  2DTI A;  4J5Y A;  2ZAE A;  1FX7 A;  5GAN 6;  4J7F A;  2NUP B;  1SRL A;  3CXC P;  4IUR A;  1X6G A;  3JCM J;  4RTY A;  3G7Z A;  1H92 A;  4JRI A;  3GPL A;  4C8Q B;  1OU8 A;  2BUD A;  5LJ5 g;  3CCL Q;  2DKG A;  1YIT T;  1K9M C;  2EBP A;  4E7S A;  5A0D A;  2DPP B;  3M0T A;  3EGD B;  1VQP Q;  1UB4 A;  2K5L A;  2CP2 A;  3AT1 B;  1YJN T;  1UHC A;  4ANJ A;  3TQ7 P;  3HP9 A;  5D6X A;  1K8A C;  2HQH A;  1TH7 A;  5GAN e;  2CKK A;  4JZ3 A;  1WPY A;  1K9A A;  5D7U A;  2QXF A;  2HCK A;  1YN8 A;  1M2V A;  1OEB A;  3KUF A;  5LJ5 d;  1QVF P;  5I2S A;  1IRE B;  1UDL A;  4M7D B;  1WHL A;  4BD3 A;  2JS2 A;  4C0F A;  3CMA T;  5FU6 C;  4M78 B;  4M77 B;  1JB0 E;  2P84 A;  5ECA A;  5EG2 A;  2W0Z A;  2RHY A;  1CKA A;  3VS2 A;  4OMF B;  4GBQ A;  1NG2 A;  2EPD A;  3CC7 Q;  4BI3 A;  2VVK A;  4E7Z A;  1BYM A;  3GOX A;  3X24 B;  1B34 B;  1QCF A;  2EGC A;  2OTL T;  1PCX A;  2HBW A;  4C0G A;  5KE2 A;  4AG1 C;  1S72 Q;  2QK0 A;  1R0C B;  3NHN A;  4RTT A;  2Z0W A;  2OTJ A;  1P92 A;  1ZA2 B;  1ZLM A;  1UJ0 A;  1D0Z A;  1TUC A;  1YJW Q;  2RJF A;  4RG2 A;  3LWI A;  2CP7 A;  2EKO A;  1VQM A;  3CPW P;  2JMA A;  3E1S A;  3HFN A;  1NM7 A;  2QEX Q;  3BDU A;  3CBO A;  5LJ5 f;  1NE8 A;  3REB B;  1Q7Y U;  3M58 A;  3QZ9 B;  4BE0 A;  4MML A;  2KEA A;  3ZEH A;  5I22 A;  1G3T A;  1UJY A;  3PMI A;  2ESW A;  3VUB A;  1WIE A;  2EVR A;  2P4T A;  4FU6 A;  2K5I A;  2EYX A;  4BAC A;  2I0N A;  4WF2 A;  3CCV Q;  1Q7Y R;  4Y92 A;  4B6M A;  4R56 A;  4ZTJ A;  4PK4 A;  1YI2 A;  1AWW A;  3G1J A;  2K3Y A;  1TU0 B;  3PVQ A;  4ZTF A;  3M5A A;  3X26 B;  2E64 A;  4LUE A;  2P0P A;  2FG0 A;  5HKC A;  4E7J A;  1SEM A;  1JJ2 P;  2DNU A;  2FPE A;  5KYX B;  1KQ1 A;  2EAY A;  4F7U G;  1FWZ A;  1RAH B;  5KYY A;  2RB6 A;  2NUT A;  2CSI A;  1I81 A;  2DX1 A;  3I56 Q;  2PU9 B;  1OYX A;  2DXC A;  1U1T A;  3JCM g;  2JTE A;  2HSE B;  3QUI A;  1HD3 A;  2RN8 A;  3GLX A;  3UDC A;  3CXC A;  2O9S A;  4JZ4 A;  1A0N B;  3ME9 A;  2VGN A;  2A7Y A;  1UFF A;  2KRM A;  3SFM A;  2F5T X;  3OY9 A;  5KYN A;  2KDS A;  3DKM A;  1AD5 A;  1UGP B;  3BY7 A;  4RG8 A;  3OA6 A;  1U3O A;  1HSQ A;  2D0N A;  1C6V X;  3N5B B;  4PJL A;  4KUL A;  2DVJ A;  2KR3 A;  5IH2 A;  1WHH A;  1XQH A;  3JCM d;  1BI1 A;  1PRL C;  2H3E B;  4M75 A;  4KH0 B;  1M90 R;  4LD9 K;  4C92 G;  2CZ6 B;  2IPO B;  3H6Z A;  2GFA A;  4A4E A;  5FW9 A;  4BY6 C;  5KYU A;  4MZP A;  1T0J A;  2EQJ A;  4BE2 A;  1WHM A;  3EGU A;  5DY9 A;  1N27 A;  3CCJ Q;  5CO7 A;  2LX9 A;  4KGV B;  4LUD A;  3IQL A;  3CC2 A;  3CCL T;  1VQ4 A;  2EQM A;  2XDB A;  2GF7 A;  4M7D F;  2DLP A;  3L2W A;  2BE9 B;  3VS0 A;  1V76 A;  1UHF A;  4M78 F;  1R0B G;  4M77 F;  1X75 C;  2C0I A;  2RHU A;  5KH6 A;  5FWB A;  1VQP T;  3TSZ A;  2CYZ B;  4A4G A;  1NEG A;  4M75 D;  1JBM A;  1YCY A;  1KQ2 A;  1EFN A;  1KK7 A;  1VQO Q;  2HDA A;  1YJ9 T;  4QW2 A;  2MWP A;  4FL6 A;  3OYM A;  3OYB A;  1ABO A;  4MDX A;  3CCS Q;  1Y96 A;  2YRC A;  1OX9 A;  2ZPG B;  2K79 A;  3OS5 A;  3M55 A;  3JCM W;  1PSE A;  1E6H A;  3RKX A;  2R58 A;  3QJ6 A;  1IHW A;  1Q82 U;  1O9S A;  3E9F A;  3URG A;  3UF4 A;  4XTV A;  3OYC A;  2J6F A;  4IUP A;  1OOT A;  4OMQ A;  2QDY B;  4UC4 A;  3L2Z A;  3CC7 T;  5FWC A;  8AT1 B;  2YSQ A;  4O6J A;  4C92 E;  5J26 A;  3CCU Q;  2JTM A;  1SHG A;  3EFO A;  2X9H A;  1S72 T;  3MEA A;  2JN0 A;  4LN2 A;  3EG9 A;  1Q82 R;  1W6X A;  2QA4 T;  2LCC A;  4PJO G;  2MAM A;  5GAM e;  3U23 A;  4EMK A;  2KYM A;  2WAC A;  4HCK A;  1VQL A;  1Z9Q A;  2C0O A;  5LJ5 h;  2DRM A;  1YJW T;  4KGX B;  3V8J A;  1AWO A;  1VQ9 Q;  4M7A E;  1IRX A;  1QMC A;  3HKS A;  1BCO A;  1KD1 R;  1PWT A;  2HKQ B;  4MMK A;  2QEX T;  3J7A F;  4E7K A;  1JJ2 A;  1UGQ B;  2BZ8 A;  1WJR A;  1MV3 A;  4QQD A;  1AVZ C;  3JB9 D;  2YT6 A;  2HKN A;  2JMC A;  2X35 A;  4JS5 A;  2CRE A;  1X6O A;  4M75 C;  5FU7 B;  2EJ9 A;  2QQB A;  2O31 A;  4JRK A;  2KSS A;  4FYV B;  4OMO A;  1GBQ A;  2E41 A;  1LPL A;  3UWN A;  4C0Z A;  2ZGW A;  3CCV T;  4QKU A;  1Y0M A;  4WCI A;  1I4K 1;  2DXB A;  4PJN A;  2M0O A;  3VRY A;  4C5I A;  2D0Q B;  2HD0 A;  1AEY A;  4JJD A;  2EYY A;  2QI2 A;  5HY6 A;  4JRQ A;  2OTL A;  2ATC B;  3ZL7 C;  3TU4 K;  5GAM d;  1AZE A;  1X69 A;  2K5F A;  2WSC E;  3SWN B;  3O8V A;  5CCA A;  5CKD A;  2MIO A;  3I56 T;  1K9M U;  3NTH A;  2H3J A;  4PFO A;  4R0K A;  4HA8 A;  3VRZ A;  2BIV A;  5KYW A;  4B9X A;  4BDZ A;  5GMK m;  2FZK B;  3L2U A;  2KE9 A;  3TRE A;  3G4S Q;  4C8Q G;  1X43 A;  2L8D A;  2HNI A;  2YRD A;  3M0Q A;  2LDM A;  2VB6 A;  1K8A U;  2LNV A;  3X20 B;  2AKL A;  2RPN A;  1FMK A;  2X4Y A;  1K9M R;  2VXE A;  5C0M A;  5LJ5 j;  2X51 A;  1RI0 A;  3L2V A;  1QKW A;  4CC7 A;  3CCM Q;  2KBT A;  3OW2 S;  1UGS B;  4DEY A;  3I55 T;  4XU1 A;  2CZ1 B;  3JCM X;  3MP8 A;  1WI7 A;  4N4G A;  5A0L A;  1C1A A;  1NPP A;  1ZHI A;  2V1Q A;  2DEQ A;  2XKO C;  5GAM f;  3CCJ T;  3D7S B;  4OP0 A;  2V8K A;  1WQ7 A;  3L2R A;  5GAN 8;  1VYU A;  1VQ8 Q;  2F2W A;  2RH2 A;  1M2V B;  2M16 A;  2XID A;  1YHQ Q;  1PHT A;  5IHK A;  3RR6 A;  3NMZ C;  2MYS A;  1VQO T;  4C8Q E;  1K0X A;  4RKU E;  4F7U A;  3L42 A;  3JCM h;  1ZX6 A;  3CCS T;  4HVV A;  4L59 A;  3MHX A;  3HRS A;  1MUZ A;  3NGP A;  5GAN 4;  4F16 A;  1GBR A;  4DBH A;  3LX7 A;  3RIR A;  3GP8 A;  4GLM A;  1BK2 A;  1VQN A;  3MEW A;  2K3X A;  4F17 A;  3JCM P;  3GF5 A;  4M7D E;  1NJI R;  1N9R A;  3QKJ A;  2KK4 A;  2PVG B;  3CCE Q;  4M78 E;  4M77 E;  1ACM B;  1ZUK A;  1XJW B;  2DYB A;  1UE9 A;  1MND A;  1M3A A;  2LC4 A;  4ZN3 A;  3LW5 E;  4FCY A;  1UTI A;  4KH1 B;  3I5R A;  5LJ5 e;  1VYV A;  3CME A;  2DBK A;  5AYF A;  1TOV A;  4C92 A;  1MV0 B;  3FJ5 A;  1BB9 A;  2ZPI B;  1LVK A;  1VQ9 T;  1BI3 A;  1Q86 U;  5CR2 A;  1D0Y A;  2PVD B;  1AOJ A;  2RJE A;  3Q1J A;  2QDL A;  2J06 A;  3SEM A;  1I0C A;  3QII A;  4EMH A;  4L5G A;  4OB3 B;  5LL6 S;  3CCR A;  1YJ9 A;  1RAF B;  1D1A A;  1R8O B;  1RAA B;  1RUW A;  2E4H A;  3DLL A;  4Y91 A;  2LP5 A;  5FRO A;  1B3Q A;  2EIF A;  1RLQ C;  2Y4X A;  5IHN A;  5GMK i;  4C92 D;  1NZ9 A;  2A3L A;  2RQU A;  4IKF A;  4XU0 A;  2EQU A;  2DK3 A;  3PNW C;  2RK2 A;  3J80 E;  3A8M B;  1BCM A;  2EW3 A;  4XTW A;  1QW1 A;  2MF2 A;  2D1X A;  2QAZ A;  4Z02 A;  4R55 A;  1NLP C;  6AT1 B;  3J81 E;  5KYY B;  3CC7 A;  4IIO A;  1SPK A;  4LDX A;  3GIB A;  3M0R A;  2BZY A;  2ED0 A;  4J9D A;  4LNP A;  1UEB A;  1QQJ A;  1TUD A;  1W70 A;  4AG2 C;  1S72 A;  1RLP C;  2L3P A;  3QZ5 B;  4HXJ A;  2QA4 A;  1X01 A;  3R6N A;  2ZPH B;  3M0S A;  2J05 A;  1PG5 B;  3C12 A;  3P8D A;  1KQS S;  1M2O A;  3EG2 A;  4OGC A;  5M9O A;  1YJW A;  4HVW A;  1GFC A;  1TS9 A;  2K3B A;  4PJO A;  2YRV A;  3V7R A;  3JCM V;  3G71 A;  3G6E A;  3ER0 A;  2QEX A;  1D3B A;  4M75 B;  2LJ1 A;  2K6D A;  2JNG A;  2QAS A;  2CP5 A;  1VQK A;  2QTV A;  3CCM T;  4KT0 E;  5KYU B;  3TEE A;  1PC0 A;  3THK A;  1X2K A;  4DOW A;  3QHS A;  1ZBX A;  5L23 A;  1BBZ A;  5GAM h;  2I2L A;  1IHV A;  4N0A A;  3A98 A;  5I2M A;  2O01 E;  2RM4 A;  3CD6 A;  3HPW A;  5LJ3 g;  4ELZ C;  3VS5 A;  1OX8 A;  3H0I A;  3UA7 A;  1GCP A;  1YBY A;  3OYN A;  4N4H A;  2M1H A;  4PJO D;  2CP0 A;  3SHW A;  3FDR A;  1ZUU A;  1ZA1 B;  4C92 C;  3OYE A;  2E1H A;  2RK1 A;  1WNL A;  2J7I A;  5KCH A;  4OGE A;  2WSF E;  4OVA A;  2AT1 B;  1Y96 B;  1T3L A;  1YFN A;  2K2V A;  1YHQ T;  1AWJ A;  3JCM e;  4D8D A;  2CP3 A;  2P4R A;  2A28 A;  5LJ3 d;  1X27 A;  3JSC A;  4MDW A;  4XTX A;  1KC8 U;  3HSB A;  1OV3 A;  5C6S A;  3RMQ A;  3BW1 A;  2OTJ Q;  1YIJ A;  1WZO A;  2XDD A;  3FC3 A;  4EIK A;  4E2F B;  5GAO r;  4PNO A;  3JB9 H;  4J9E A;  1I1J A;  2LT1 A;  4C0D C;  4AFZ C;  1TXQ A;  1ZSZ A;  4C8Q A;  5CKB A;  4QQ6 A;  4FT4 A;  4B9W A;  2R5A A;  1JU5 C;  4X9D A;  5D6Y A;  3EFO B;  2C06 A;  5I21 A;  4C5H A;  3DLM A;  1QP3 A;  3PT9 A;  3QPH A;  3EG9 B;  1Q86 C;  3I55 A;  1UUE A;  1QLY A;  4A63 B;  1MMN A;  4AFQ C;  4A4F A;  4EMK B;  3CCE T;  3PVL A;  4MZT A;  4A54 A;  3QDR B;  1V1C A;  2GTO A;  2ABL A;  3GNG A;  4JDS A;  1FXX A;  3CBM A;  3CCJ A;  5GAM j;  2L0A A;  1YI2 Q;  1OUL A;  4XAX B;  3VS6 A;  4WTO B;  2K9G A;  2FB7 A;  4EMG A;  3EFS A;  3FB9 A;  1I5O B;  5LJ3 f;  1G8X A;  2JOY A;  4PJO C;  2L3Q A;  2DD5 A;  4A53 A;  4CC4 B;  4II1 A;  4HT9 A;  2ED1 A;  4BUG A;  1VQ5 Q;  4AFU C;  5FRN A;  2DJQ A;  1GL5 A;  2F69 A;  2L2P A;  1N8R U;  1VQO A;  2ZPB B;  1QWF A;  2XD0 A;  4N4I A;  3PTA A;  2K2M A;  5GJV B;  1MMD A;  2RQR A;  3ASK A;  1W1F A;  1U1S A;  2YXY A;  2LNH B;  3CCQ A;  1VQ6 A;  1G83 A;  1RI9 A;  4N0A C;  2E10 A;  2QQR A;  3EG3 A;  2PZ1 A;  2IIM A;  3VYH B;  4M7A G;  3PFS A;  1F1B B;  1HK9 A;  1NEB A;  2AHJ B;  2RHX A;  3ZBD A;  3OYG A;  2LTO A;  2K4Y A;  1MNE A;  1AHJ B;  1WJQ A;  5HK3 A;  5AT1 B;  3JRZ A;  2LQK A;  4M4Z A;  4J6X A;  5KYW B;  1QWE A;  1YP5 A;  5I11 A;  1EIF A;  4RTX A;  3MCA B;  4M75 F;  1DJ7 B;  3CC4 A;  2BE7 D;  4ZGE B;  3OYJ A;  1WXU A;  4AMC A;  3JCM f;  2EYQ A;  2CZ0 B;  2PUO B;  4A4K A;  1ZUY A;  2KXC A;  3CPF A;  1BIB A;  3A5Z B;  1ZBJ A;  3LH0 A;  2DL7 A;  3KFV A;  1M1G A;  3CC2 Q;  2CT4 A;  4J83 A;  3UAT A;  1VQ4 Q;  2IG0 A;  3QJY A;  3RER A;  2M02 A;  1RAD B;  1QCO A;  5GAN 7;  3MP6 A;  1ZSZ C;  4C8Q C;  1QVG S;  2JS0 A;  2XDP A;  1OU9 A;  2LT4 A;  1KSW A;  5GAN 2;  1XTD A;  2KQW A;  2PNI A;  3QO3 A;  1YIT A;  1HXD A;  2VC8 A;  3OW2 A;  3RKW A;  1KHI A;  2DA9 A;  5CIU A;  1WGS A;  4C5G A;  1KC8 C;  3FEO A;  1E7O A;  4JUV A;  1YJN A;  3S3M A;  5FU6 B;  5D6W A;  2M9U A;  4A4H A;  1KQS P;  2IVW A;  1WYX A;  5KE3 A;  2DIL A;  4HCB A;  4YTL A;  2RQW A;  4J6Y A;  1XNI A;  1NLO C;  1E6G A;  4F7U B;  3CMA A;  2DL4 A;  1QVF S;  3JB9 F;  4CI0 C;  5FRM A;  1Y71 A;  1K1Z A;  1W2B S;  2EWN A;  2VUB A;  4J9G A;  1EX4 A;  1OQK A;  4E7L A;  3A8G B;  2KYB A;  1MHN A;  2DIG A;  4LDU A;  3LYI A;  3EH2 A;  2OAW A;  4KGZ B;  2LMJ A;  2OTJ T;  2YUN A;  4J9B A;  5J3B A;  3H0F A;  2JXB A;  4FT2 A;  2MCN A;  1VQL Q;  2DFU A;  5GAN 3;  3X28 B;  2CP6 A;  1N6A A;  2MPX C;  2L89 A;  3OYY A;  3ULR B;  2PVO B;  2DTO A;  4JRP A;  3OB9 A;  2CH4 A;  1YCS B;  2HEQ A;  2RNA A;  1SSF A;  3V8K A;  3V7C A;  3M9Q A;  1SSH A;  3MJX A;  4FYW B;  3BDL A;  2HSP A;  2RD1 A;  4OB0 B;  4E47 A;  2LVM A;  2X4J A;  3EH1 A;  4QVZ A;  1ZQ1 A;  1N8R C;  2D6F A;  3DB3 A;  1PRM C;  3VUZ A;  1Q81 U;  5GAO l;  2DXT A;  2YUO A;  2RJC A;  3BE3 A;  1BI2 A;  4XTU A;  3CPW S;  2XHC A;  4FM4 B;  4BI8 B;  4JPB W;  1KFZ A;  4OMM A;  3OYD A;  5LJ3 h;  1YI2 T;  4V2S A;  4GLK A;  1H8K A;  2RI5 A;  2FZC B;  1MMG A;  1N5Z A;  5IXB A;  2GCX A;  2HQE A;  1K8A R;  3HTR A;  2CDT A;  4RMO A;  2DYI A;  2XU8 A;  5DLQ E;  2E12 A;  4MZM A;  4M7D G;  1VQ5 T;  1YHQ A;  1Y7X A;  2CSQ A;  4J6W A;  2FZG B;  4M78 G;  2FEI A;  4M77 G;  4JLG A;  3C94 A;  2X3W D;  2MMP A;  2FHD A;  2A08 A;  2CGH A;  4C0D B;  4J9C A;  3I35 A;  3EHR A;  2YLB A;  2K57 A;  4NL2 A;  4XU2 A;  1X6B A;  3F70 A;  2VWF A;  8ATC B;  4JLI A;  1YNZ A;  1VIF A;  2RO0 A;  5A0G A;  3EG1 A;  4OMP A;  3M0U A;  3FIF A;  2RA2 A;  4HT8 A;  4X9C A;  4FYY B;  1Q95 G;  1M8V A;  3QSU A;  2V8J A;  5EC7 A;  3M0P A;  4BI4 A;  2LCS A;  2AZV A;  4LDV A;  2HBP A;  4E6R A;  1VIE A;  4F04 B;  3H9N A;  2O4X A;  3M53 A;  2D9T A;  3OBW A;  2RMO A;  1U06 A;  3M56 A;  4PJO B;  2LCL A;  4EPC A;  2LX7 A;  2CUD A;  1NYF A;  9ATC B;  1D3B B;  2V1R A;  1YWO A;  2GQV A;  3M54 A;  4BY6 B;  2O88 A;  1KD1 C;  1AZG B;  4ZN1 A;  1VQ4 T;  3INZ A;  2NLU A;  3OYK A;  2LJ3 A;  1K4U S;  5LJ3 j;  4FSX A;  3CBP A;  3MO8 A;  1KQS A;  2XIC A;  1BKB A;  3QWY A;  2RI3 A;  3CCU T;  3AHU A;  1JO8 A;  5CVI A;  3RUX A;  2KT8 A;  2PTK A;  3VS3 A;  2QQS A;  1WHK A;  2L3R A;  2SRC A;  2CH4 W;  1VQ7 Q;  2KRN A;  4PLL A;  1RAI B;  2JTF A;  2LRQ A;  5GAO m;  2Y90 A;  2B8A A;  4J9H A;  1KJW A;  3CCL A;  2DJZ A;  3FLG A;  3EHQ A;  4F7U F;  2COY A;  1M1K C;  3OYL A;  2QGF B;  1TWB A;  2BKD N;  1VQP A;  2J6O A;  4M75 E;  2E3H A;  2DF6 A;  4D8K A;  4QQG A;  4DEX A;  4DQ2 A;  2AKK A;  1SF9 A;  2HZY A;  3WVD B;  1VQN Q;  2FRY A;  3QG1 A;  4M7A A;  1IXD A;  4E7I A;  1GXI E;  2G6F X;  1KG1 A;  2KGT A;  3UPU A;  2VGM A;  2FYK A;  1I07 A;  2MOX A;  3NFC A;  1QVG P;  1VUB A;  1YWP A;  5CAI A;  1Q86 R;  2EKH A;  3PMT A;  3LWH A;  3LGF A;  2ROL A;  3QXE B;  2VAS A;  4K11 A;  1M30 A;  3C95 A;  2HMA A;  2DO3 A;  1ZSZ B;  1JRI A;  1R77 A;  3CME Q;  1Q81 C;  1S1N A;  1OPL A;  2NUT B;  2COW A;  4VUB A;  3VS4 A;  3NPF A;  4C92 F;  3JCM b;  1MMA A;  2DL5 A;  1RAE B;  1VQL T;  3OYI A;  1PM3 A;  2V26 A;  2OJ2 A;  4HVU A;  3MPU B;  2YUP A;  3A1P A;  3FRN A;  3MEU A;  4M7A D;  4J8O A;  7AT1 B;  2JJ9 A;  2EFI A;  4L6V 5;  3PE0 A;  3HRU A;  3QBY A;  1IZ6 A;  4ORZ A;  5GAN 5;  2A36 A;  3CCR Q;  3V7S A;  3PGG A;  1YJ9 Q;  4OMN A;  5CKE A;  1BIA A;  3KXT A;  3G4S T;  5IXF A;  2LQN A;  4M7A F;  2EQI A;  4Z89 A;  3WXM B;  3LGL A;  5LJ3 e;  1W2B P;  2MK5 A;  2DIQ A;  2KXD A;  2C0T A;  4XU3 A;  3A8O B;  3REA B;  1GRI A;  4KBM B;  3QDF A;  5FU7 C;  4FW2 A;  4TVR A;  1OI1 A;  5DLO A;  1I5L A;  3RNJ A;  3M57 A;  4IUQ A;  4ELY C;  3HL8 A;  5GAN g;  2AK5 A;  2DMO A;  1X2Q A;  1TG0 A;  4IUU A;  2W10 A;  4BDY A;  2NWM A;  1FMW A;  1PKS A;  3C0C A;  1D09 B;  3CCV A;  1AWX A;  4F14 A;  1T0H A;  5FLX E;  3EGX A;  2CUB A;  2QYZ A;  2QA4 Q;  3OYH A;  5L8R E;  4DOV A;  2BZX A;  1KIK A;  2DZC A;  1M3B A;  4HKE A;  3SWN C;  5IN1 A;  1N9S A;  1K73 C;  2P0K A;  3MP1 A;  2KY9 A;  2YDL A;  5GAN d;  3OYF A;  4DBQ A;  4PJO F;  2O9V A;  1VQ8 T;  2D8H A; 
#chains in the Genus database with same CATH homology
 5I11 A;  4RTU A;  4OML A;  1ARK A;  4RTX A;  1X43 A;  2EGA A;  4RUG A;  1Z9Z A;  3M0Q A;  2AZS A;  1U5S A;  1WXU A;  1WLP B;  2D8J A;  1ZUY A;  2AKL A;  2RPN A;  2KXC A;  1FMK A;  1ZBJ A;  2DL7 A;  3RBB B;  3KFV A;  1QKW A;  1SRL A;  2CT4 A;  3UAT A;  4CC7 A;  1X6G A;  1ZSG A;  4RTY A;  2KBT A;  1H92 A;  4DEY A;  4LE9 A;  3QWX X;  2DM1 A;  2JS0 A;  2EBP A;  3TVT A;  1WI7 A;  4CC2 A;  2E5K A;  1KSW A;  2X3X D;  2EYZ A;  3M0T A;  2V1Q A;  1OPK A;  2D8H A;  2O2O A;  2PNI A;  2OI3 A;  3VS7 A;  1UHC A;  1H3H A;  2DA9 A;  2F2X A;  4JZ3 A;  1E7O A;  1K9A A;  2ECZ A;  2HCK A;  1VYU A;  1YN8 A;  1OEB A;  2F2W A;  1UDL A;  3GBQ A;  2JS2 A;  1WYX A;  1JQQ A;  1PHT A;  5IHK A;  2DIL A;  3NMZ C;  5ECA A;  1JEG A;  2RQW A;  1K0X A;  2W0Z A;  1NLO C;  4ESR A;  1E6G A;  2JT4 A;  1CKA A;  1ZX6 A;  3VS2 A;  2DL4 A;  4HVV A;  2CT3 A;  2ROT A;  3EG0 A;  4GBQ A;  1MUZ A;  3NGP A;  2K7A A;  1ABQ A;  1NG2 A;  2EPD A;  1K1Z A;  2VVK A;  4F16 A;  1GBR A;  4J9G A;  1QCF A;  2EGC A;  2KYB A;  2HBW A;  4GLM A;  2OAW A;  1BK2 A;  4AG1 C;  2LMJ A;  4J9I A;  2YUN A;  3O5Z A;  4J9B A;  2MCN A;  3H0F A;  2JXB A;  3NHN A;  1WXT A;  4RTT A;  4F17 A;  3TSW A;  2DL3 A;  2LZ6 B;  3ULR B;  1WFW A;  1ZLM A;  1ZUK A;  2CH4 A;  1UJ0 A;  1YCS B;  1TUC A;  4JJC A;  2HEQ A;  2RNA A;  2DYB A;  1UE9 A;  1SSH A;  2L3S A;  1M3A A;  2HSP A;  4Z8A A;  1UTI A;  2JMA A;  3I5R A;  1VYV A;  2EYW A;  1NM7 A;  2DBK A;  1MV0 B;  3FJ5 A;  3REB B;  1BB9 A;  1PRM C;  1LCK A;  2KEA A;  4KRT A;  2YUO A;  5I22 A;  1UJY A;  2NUZ A;  4QT7 A;  1M27 C;  1KFZ A;  4JPB W;  4OMM A;  2ESW A;  1AOJ A;  1WIE A;  2EVR A;  2QDL A;  2J06 A;  4RTZ A;  3SEM A;  1H8K A;  2EYX A;  1I0C A;  2I0N A;  1WXB A;  2KRO A;  4RTV A;  1RUW A;  1N5Z A;  1CSK A;  4Y92 A;  5IXB A;  4JJB A;  1AWW A;  2CDT A;  2LP5 A;  2DRK A;  1JXO A;  1B3Q A;  4AFS C;  1RLQ C;  4RTW A;  3PVQ A;  5IHI A;  2CSQ A;  5IHN A;  2FEI A;  4LUE A;  2FG0 A;  1SEM A;  2X3W D;  2RQU A;  3CQT A;  2DNU A;  2FPE A;  2A08 A;  4J9C A;  3UA6 A;  3I35 A;  3EHR A;  2F2V A;  2XMF A;  2EW3 A;  1X6B A;  2D1X A;  1Y57 A;  2CSI A;  1NLP C;  2DX1 A;  1UG1 A;  1SPK A;  1PNJ A;  4IIO A;  5GJW B;  2VWF A;  2KRS A;  3M0R A;  2BZY A;  2ED0 A;  1YNZ A;  2JTE A;  4J9D A;  4LNP A;  2H8H A;  4CC3 A;  3EG1 A;  1HD3 A;  1TUD A;  2RN8 A;  1W70 A;  2JM9 A;  2B86 A;  3M0U A;  4OMP A;  2J6K A;  2O9S A;  4JZ4 A;  1A0N B;  4AG2 C;  1RLP C;  1FYN A;  2L3P A;  1UFF A;  2KRM A;  4HXJ A;  1HJD A;  5EC7 A;  3M0P A;  1GCQ A;  2LCS A;  1AD5 A;  3R6N A;  2AZV A;  2SEM A;  3M0S A;  1U3O A;  2J05 A;  1HSQ A;  2BTT A;  2D0N A;  3JV3 A;  4E6R A;  3EG2 A;  4HVW A;  2DVJ A;  2RF0 A;  2KR3 A;  1GFC A;  5IH2 A;  2K3B A;  2RMO A;  1U06 A;  1PRL C;  3H0H A;  2JW4 A;  2LX7 A;  2CUD A;  4ZNX A;  1NYF A;  5HCK A;  2LJ1 A;  2K6D A;  2GNC A;  2V1R A;  3VS1 A;  1YWO A;  2A37 A;  2O88 A;  1AZG B;  5FW9 A;  1M3C A;  1UEC A;  2LJ3 A;  1K4U S;  1VYT A;  1T0J A;  3THK A;  1X2K A;  3EGU A;  3QWY A;  4LUD A;  5L23 A;  1JO8 A;  1BBZ A;  2RQT A;  3IQL A;  1K0S A;  2KT8 A;  2PTK A;  4FSS A;  3VS3 A;  1GFD A;  2FPD A;  2DLP A;  3A98 A;  3VS0 A;  1SHF A;  2SRC A;  2CH4 W;  1UHF A;  2KRN A;  2C0I A;  3VS5 A;  1B07 A;  3H0I A;  3UA7 A;  2KNB B;  1IO6 A;  1GCP A;  4J9H A;  1KJW A;  5FWB A;  3TSZ A;  1J3T A;  3EHQ A;  3SHW A;  1XOV A;  1ZUU A;  1NEG A;  3I5S A;  1EFN A;  2HDA A;  2J6O A;  1T3S A;  2FO0 A;  2J7I A;  2DF6 A;  4D8K A;  4DEX A;  1ABO A;  2AKK A;  1K76 A;  3H41 A;  1T3L A;  2K79 A;  1AWJ A;  4D8D A;  2FRY A;  4X1V A;  2P4R A;  1PKT A;  2A28 A;  1E6H A;  2G6F X;  1X27 A;  2KGT A;  1QKX A;  1I07 A;  2MOX A;  3UF4 A;  1YWP A;  1OV3 A;  2J6F A;  2EKH A;  1OOT A;  4OMQ A;  2ROL A;  5FWC A;  4EIK A;  4J9E A;  1I1J A;  4K11 A;  1M30 A;  1SRM A;  1WA7 A;  4AFZ C;  2YSQ A;  1VA7 A;  4Z88 A;  2YUQ A;  1S1N A;  1OPL A;  1JU5 C;  1SHG A;  2DE0 X;  3VS4 A;  3NPF A;  1WDX A;  4LN2 A;  1M8M A;  2DL5 A;  1W6X A;  2GTJ A;  2OJ2 A;  4HVU A;  2YUP A;  2RQV A;  2DBM A;  2EGE A;  1UUE A;  1QLY A;  4A63 B;  3U23 A;  2KYM A;  4AFQ C;  1UGV A;  3PE0 A;  4HCK A;  3PVL A;  1Z9Q A;  2C0O A;  4ORZ A;  2DRM A;  1AWO A;  2A36 A;  2ENM A;  1V1C A;  2GTO A;  2ABL A;  4OMN A;  1GCQ C;  1CKB A;  1PWT A;  5IXF A;  2LQN A;  2L0A A;  2EQI A;  2BZ8 A;  1BU1 A;  3VS6 A;  1MV3 A;  2K9G A;  1AVZ C;  2M0Y A;  4Z89 A;  2YT6 A;  2JMC A;  1NYG A;  1JXM A;  2GGR A;  2KXD A;  2L3Q A;  2VKN A;  2C0T A;  2CRE A;  4CC4 B;  3REA B;  2GBQ A;  1GRI A;  2ED1 A;  4AFU C;  2O31 A;  2DJQ A;  1GL5 A;  4OMO A;  2L2P A;  1GBQ A;  2FPF A;  3RNJ A;  3LH5 A;  4J9F A;  1QWF A;  1Y0M A;  2JM8 A;  4WCI A;  2LQW A;  2K2M A;  2AK5 A;  2DMO A;  3I9Q A;  1X2Q A;  5GJV B;  1TG0 A;  2RQR A;  2M51 A;  2W10 A;  2NWM A;  1WX6 A;  1W1F A;  1PKS A;  3VRY A;  3C0C A;  2GQI A;  2KT1 A;  1AWX A;  2LNH B;  4F14 A;  1AEY A;  4JJD A;  1G83 A;  1RI9 A;  1T0H A;  2EYY A;  2CUB A;  3EG3 A;  2PZ1 A;  2IIM A;  1G2B A;  3ZL7 C;  1NEB A;  1AZE A;  2LJ0 A;  2BZX A;  1X69 A;  1KIK A;  1M3B A;  2MIO A;  4IIM A;  4R0K A;  2FRW A;  3VRZ A;  2YDL A;  4M4Z A;  2DL8 A;  1QWE A;  2O9V A;  2KE9 A;  1YP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...