3I5SA

Crystal structure of pi3k sh3
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
b'EGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphatidylinositol 3-kinase regulatory subunit alpha
molecule tags Protein binding
source organism Homo sapiens
publication title Structural studies of the phosphatidylinositol 3-kinase (PI3K) SH3 domain in complex with a peptide ligand: role of the anchor residue in ligand binding.
pubmed doi rcsb
total genus 20
structure length 77
sequence length 77
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3i5sA00
1QKWA 1YWOA 3VRYA 4Y92A 1YCSB 1W70A 2KR3A 1UTIA 2ECZA 3VS1A 2O9VA 4CC2A 2FO0A 1PRMC 2DA9A 1JXMA 2DBKA 2LQWA 3JV3A 4JZ4A 1AWJA 3VS4A 1T3SA 2FRWA 1AVZC 2LX7A 1UG1A 2W0ZA 4EIKA 1M27C 2CH4W 1TUCA 4KRTA 4Z8AA 2LCSA 2DMOA 4J9FA 2AZSA 2O9SA 2EKHA 1Z9ZA 1AZEA 2K6DA 2RQWA 4CC3A 2HCKA 4AG2C 2GTOA 1NYGA 2FEIA 2RNAA 1WA7A 3GBQA 4AG1C 1AOJA 4RTTA 5I11A 1WI7A 3UA6A 2EYZA 2KRMA 2NWMA 2CT4A 2V1QA 3NGPA 1G2BA 2VWFA 1ZUKA 2ROTA 1NEBA 1VYUA 1E6HA 2L3SA 2DF6A 2FPDA 5FWCA 2KEAA 2ED1A 1GRIA 1ZBJA 3VS3A 1CSKA 2RPNA 2JT4A 1NG2A 2KNBB 3CQTA 4LNPA 4J9IA 3REAB 2PTKA 2RQVA 1UGVA 2DM1A 5FW9A 1K0SA 2DRKA 2P4RA 4OMNA 1WXUA 1UE9A 2J7IA 3O5ZA 2CT3A 2EBPA 2JS0A 2SEMA 5ECAA 1QKXA 4IIMA 1QCFA 2BZXA 2J06A 2DL7A 2K3BA 2YUOA 3I35A 1IO6A 3ULRB 3M0TA 1UFFA 2NUZA 4GLMA 2AK5A 3M0UA 2KXCA 1EFNA 1J3TA 3U23A 3H0FA 4OMLA 1PHTA 2A37A 2M51A 1GFDA 1PRLC 4HVWA 2JS2A 1KIKA 2X3WD 1SEMA 1B07A 2OI3A 4DEXA 1U3OA 1GCQA 1W1FA 3TSWA 1SPKA 1W6XA 5EC7A 1JXOA 1M3AA 4AFSC 5IH2A 4OMQA 1RUWA 2O2OA 2D1XA 4IIOA 5HCKA 4J9HA 3NPFA 2EVRA 2O31A 1H3HA 1VYVA 1GBRA 4DEYA 1OV3A 2FRYA 3PVQA 3PVLA 1SRLA 2AKLA 4OMPA 2JMCA 4JJBA 1AEYA 5I22A 1GL5A 2EGAA 4QT7A 2DL3A 2LJ0A 2MOXA 3REBB 4F14A 4RTUA 1RLQC 2HDAA 2JXBA 4J9GA 2PNIA 1QLYA 1ZX6A 1OOTA 3M0QA 1WIEA 2GGRA 2DBMA 2OAWA 5IHKA 1M3BA 3QWXX 3C0CA 2GBQA 4OMMA 1JO8A 1UUEA 5L23A 1VYTA 1AZGB 2AZVA 1H8KA 2A36A 4RTZA 1GCPA 2LP5A 3TSZA 1HD3A 3A98A 1NYFA 1LCKA 2LQNA 1WYXA 1TUDA 2D8HA 1PWTA 4M4ZA 4ZNXA 1Y57A 2RN8A 2I0NA 3EG1A 1K76A 2RQRA 2EW3A 2KT1A 2ESWA 5IHNA 1M3CA 4LUDA 4RUGA 4A63B 1UJ0A 4X1VA 4RTYA 1I0CA 2ENMA 2KXDA 3EG0A 1ZSGA 3SHWA 2KRNA 2ROLA 3PE0A 2JTEA 2DL8A 1ZUUA 4CC4B 3H0HA 2L2PA 4LUEA 3VRZA 3VS2A 2PZ1A 1E6GA 2KE9A 1SSHA 2CH4A 1ARKA 3EHQA 2DRMA 1WX6A 3H41A 1CKBA 2J6KA 3EHRA 2EYWA 1UHCA 1M30A 1YNZA 3SEMA 3EGUA 4R0KA 2J6OA 4JJCA 2CUBA 2FG0A 2FPEA 2DNUA 2DL5A 4K11A 3TVTA 2F2WA 3RBBB 4FSSA 1K1ZA 4JZ3A 1HJDA 1GBQA 2E5KA 1H92A 3RNJA 4Z89A 3UF4A 3M0SA 2L0AA 2DL4A 2OJ2A 2G6FX 1NLPC 1X6BA 3FJ5A 1OPKA 2C0IA 1JU5C 1X43A 3ZL7C 1X2KA 2HSPA 2K2MA 3EG2A 2KYBA 2RQUA 1S1NA 3VS5A 3IQLA 4F17A 2BZYA 1GFCA 2DVJA 3I5SA 1ZLMA 2GTJA 2KROA 3UA7A 1RI9A 1ABQA 2EQIA 2SRCA 4JJDA 4HVUA 2IIMA 2YT6A 1AWXA 2RQTA 1N5ZA 4AFZC 3VS6A 4D8DA 1YN8A 1FMKA 2FPFA 4Z88A 1MUZA 4RTVA 1RLPC 2EYXA 2XMFA 2A08A 2J05A 1I1JA 2K9GA 3M0RA 1ZUYA 4WCIA 1YP5A 2YUPA 1BU1A 5GJWB 1VA7A 4LN2A 1AWWA 2YUNA 1SHGA 2K7AA 2EYYA 4AFUC 4J9DA 2EGCA 2KT8A 2MIOA 2M0YA 4ORZA 1TG0A 2EPDA 1T0HA 3NMZC 2YUQA 4J9EA 2BTTA 1WDXA 1CKAA 2X3XD 1QWFA 2W10A 4F16A 2C0TA 2ABLA 1PKSA 3THKA 2JMAA 4LE9A 2CREA 2YSQA 1SRMA 1PNJA 3M0PA 2KGTA 1AWOA 1NLOC 2DILA 1WFWA 2L3PA 2KYMA 2O88A 3I9QA 2VVKA 4GBQA 1OEBA 2CSIA 2RMOA 2LNHB 1JEGA 2L3QA 1Y0MA 3LH5A 1Z9QA 4CC7A 1UECA 4RTXA 1T0JA 1OPLA 1T3LA 2F2XA 4HCKA 3NHNA 1B3QA 1UJYA 4ESRA 2GNCA 1KFZA 1BB9A 1ABOA 2LJ1A 1GCQC 5GJVB 2VKNA 3QWYA 2J6FA 3VS7A 2H8HA 1WXBA 2HEQA 1UDLA 2MCNA 5FWBA 4E6RA 2B86A 1QWEA 1X69A 3VS0A 2D0NA 4AFQC 2CUDA 1FYNA 4OMOA 5IXFA 1XOVA 3UATA 3EG3A 2C0OA 1MV0B 1G83A 1I07A 2DJQA 5IXBA 2CSQA 3R6NA 1NEGA 1BK2A 2KBTA 1U5SA 1X6GA 4RTWA 2GQIA 3KFVA 2DX1A 1MV3A 2QDLA 1X2QA 1E7OA 1V1CA 4HVVA 1M8MA 1NM7A 1K4US 1HSQA 1WXTA 1WLPB 2K79A 1X27A 2YDLA 2V1RA 5IHIA 1KSWA 1SHFA 2EGEA 1K9AA 2ED0A 2AKKA 4J9BA 2RF0A 1PKTA 2HBWA 1KJWA 1AD5A 2A28A 2DLPA 4JPBW 2BZ8A 4J9CA 2LMJA 1U06A 4HXJA 1A0NB 1UHFA 2DE0X 3I5RA 2JW4A 2LJ3A 2JM9A 2JM8A 3H0IA 2F2VA 2LZ6B 2D8JA 1YWPA 1JQQA 1K0XA 2DYBA 1BBZA 2CDTA 4D8KA 2KRSA
chains in the Genus database with same CATH superfamily
5LJ3e 3CC7Q 3META 1MHNA 2DKGA 1UTIA 1ACMB 2ECZA 3EFOA 3TCJA 1U1SA 2O9VA 2FO0A 3CCQQ 1Q81R 2EQKA 1JXMA 3OMCA 1JJ2P 4C92G 5DM7R 2DERA 4JZ4A 8AT1B 5I2MA 4DOWA 3SWNC 3CCRQ 2FRWA 2W0ZA 1UG1A 1YFNA 1I5LA 2QQSA 1BCMA 2X35A 5GAN4 3QDRB 2YLCA 2LCSA 1QVPA 3A1PA 2QQAA 5CR2A 1Z9ZA 2MI6A 2D9TA 4J7IA 2NUTB 2BIVA 2GTOA 2RNAA 1WA7A 3M5AA 2RHIA 3MPUB 1G3TA 2EYZA 4GY5A 2EKOA 2M16A 2NWMA 3NGPA 1KC8R 1ZUKA 1E6HA 1NJIU 2L3SA 4FYVB 5KH6A 1OX9A 1PG5B 1NZ9A 2NUTA 3G6ET 2DIQA 4J9IA 1FXXA 3REAB 2K4YA 1UGVA 3QZ9B 5FW9A 2MWPA 3UDCA 5GAOn 4M7AB 4C8QD 2XDDA 2QGFB 2E5QA 4FM4B 3URGA 3CXCA 4E7HA 4IIMA 1QCFA 5GAMg 4M7DC 2DL7A 2V8KA 3ULRB 3BDUA 1YHQQ 1VQKT 2NUZA 4GLMA 1Q81C 1HK9A 4AMCA 2QAZA 1Q86R 3H0FA 3RIRA 4KT0E 1PD1A 4OB2B 3VYHB 3TU4K 2DD4A 4DBRA 4R55A 2JS2A 4QQ6A 1KIKA 1Q82C 2X3WD 1SEMA 2OI3A 1VQ5T 3TSWA 4KGXB 5LJ3g 1SPKA 4RKUE 2D6FA 3E9FA 1QVGP 4ELZC 3CBPA 4OMQA 5GAOl 5GMKm 3VKIA 1RUWA 3KUFA 3G4ST 2MK5A 1VYVA 3P8BB 4DEYA 2QEXQ 5CAIA 2MPXC 3CMET 1WNLA 1AEYA 1G5VA 5I22A 2JNGA 4QT7A 4ZN3A 3OYIA 2MOXA 2MWOA 2JXBA 1G3YA 4BDYA 1BI3A 1OOTA 3HHTB 4IUUA 1WIEA 4Y91A 5L8RE 3NTIA 2DBMA 3S3MA 3L2ZA 1VQ6T 1M3BA 2M9UA 5GAMf 4KUIA 5KYWB 2ZGWA 2M0OA 4OMMA 3OS5A 2VGNA 3HPWA 1H8KA 2YRCA 3NFCA 4NOYA 2NYSA 3P8DA 1QVFA 5A0LA 1D1CA 3QSUA 2LQNA 3SD4A 2VGMA 5FRMA 2RO0A 5GAOq 4ZNXA 4M7AA 1VQ7Q 4XU3A 1WJQA 2EW3A 3VYGA 2KT1A 4LDYA 1UEBA 5AYFA 1EX4A 1ZSZB 5A0GA 1ZSGA 2E65A 2E64A 2KRNA 2JTEA 2DL8A 1ZUUA 3QO3A 2COWA 4BI3A 4CC4B 1YCYA 3CCLT 3VS2A 1E6GA 1C0MA 3CMAT 3QBYA 1YIJA 2DRMA 3CCJA 4TVRA 2J6KA 3E1SA 5C6SA 2QYZA 2EQJA 2J6OA 3RERA 2O4XA 3A8GB 4JJCA 3MJXA 5CKFA 4OGEA 1NPPA 4K11A 3TVTA 2F2WA 1HJDA 1GBQA 3LWHA 2RK2A 2E5KA 1B7TA 1H92A 3M55A 4O6JA 3UF4A 2X51A 2DYIA 2LC4A 1QMCA 3G4SA 2G6FX 4KGZB 1X6BA 2XD0A 1IHVA 2EQMA 2LT1A 2XG8D 1X2KA 2L5QA 1M8VA 2KYBA 1YJ9T 1NJIC 3CCET 1PSFA 4FW1A 4XU0A 4F17A 4OF1A 4JLGA 1GFCA 2GTJA 5J39A 2QA4A 1RAEB 4BACA 1KQSA 2QI2A 4PJLA 2EQIA 2QTXA 4JJDA 2VV5A 1N8RC 4M75D 4X9DA 2IIMA 3MP8A 1N5ZA 1VOMA 2YRDA 4B9WA 1I4K1 2HL5C 1RLPC 2EYXA 1VQ4A 1Y96B 2RJEA 2K57A 4FT2A 3WXMB 2K5FA 2IPOB 2YUPA 1VQLT 1VA7A 2F69A 1AWWA 2YUNA 3A8OB 2KT8A 2MIOA 2DJZA 2JTMA 1TG0A 1XJWB 2EPDA 4JJNK 3NMZC 1OYXA 2A3LA 4M7DF 1VQKA 3J7AF 4F16A 1N8RR 2C0TA 1PKSA 3THKA 2JMAA 1BI2A 2CREA 3V8JA 1SRMA 3CC2T 1UB4A 1Q7YC 2QK0A 4M75A 1VQNQ 3CCSQ 2O88A 2DZ9A 2QEXA 2PUKB 3I9QA 4N4HA 4E7KA 4E7LA 2ZPGB 3CCUT 1OEBA 1WHMA 2QEXT 2LNHB 3BE3A 3CD6Q 5GAMd 2O4XB 2LRQA 1T0JA 3M9QA 1T3LA 4HCKA 2R58A 1B3QA 1K9MU 2GNCA 2FL7A 3FJPA 4PFZA 3M4GA 5GJVB 5KCOA 4N4IA 2GCXA 2K3YA 5LL6S 1H3ZA 1UDLA 3MP6A 3C12A 4LDUA 3CC4Q 3VUBA 2B86A 3VS0A 4B9XA 1FYNA 3EH2A 9ATCB 5CKEA 3UATA 3L1AA 2C0OA 4UC4A 1U8RA 2DJQA 4C92F 4C0DC 1NEGA 4C8QF 2HBPA 2OTJT 4PNOA 1U5SA 3M4YA 2FHDA 4RTWA 1X2QA 4LD6A 2P0KA 1WJSA 2AT1B 2PQWA 3P8HA 4XTYA 3QIIA 1BI0A 1HSQA 4NL3A 2K79A 3AHUA 1X27A 1YITQ 4FYYB 4HA8A 4OB3B 2V1RA 2VUBA 3CD6T 2EGEA 2F5TX 2QQRA 3VUZA 1PKTA 4PKCC 1B34A 4JS5A 4M75C 2BZ8A 1KC8C 4J9CA 4JUVA 4KGVB 1A0NB 3PIOA 2JW4A 1OZ3A 2JM8A 5GMKl 2P4TA 4OGCA 1ZSZA 4F7UG 2XICA 4JRKA 3OYDA 1K0XA 3LLRA 4C92C 4ANJA 1KD1R 4JRPA 4HCCA 3PFSA 1VQNA 2KR3A 2DVEA 4DBHA 1ZA2B 3CC4T 3OBYA 4OB1B 4J8OA 2DA9A 4JRQA 4N4GA 4RG2A 2LQWA 4FL6A 3JV3A 2L8DA 1IREB 4PJOC 3VS4A 3N5BB 1T3SA 5GMKe 1M90R 3JCMb 3CXCP 1M27C 4BE0A 1VQKQ 4QQGA 4DOVA 3OY9A 4M75E 1D3BB 2DMOA 1D1AA 4A4GA 2O9SA 4XQ3A 1AZEA 2HL3A 4ELYC 3PGGA 5GAOr 5GAOp 4AG2C 2FEIA 4MZPA 1BIBA 4AG1C 4J7FA 3C94A 2QGGA 4J83A 5CO7A 5FU7B 1JJ2A 3RR6A 3UA6A 3S6WA 1TU0B 1K73R 3L2UA 2NUPB 5FRNA 2V1QA 4EMKC 1G2BA 3JCMJ 2VWFA 5CQYA 4IUVA 2ROTA 3QJYA 4M7DD 1GRIA 1I81A 3VS3A 3CCMA 1QP2A 2V26A 5LJ5f 1M1KR 2QA4Q 1K0SA 2DRKA 4OMNA 3JB9H 2HNIA 1D0YA 2KDSA 3JB9G 1QKXA 4C8QE 2KQWA 2BZXA 4M75G 3PIPA 2K3BA 3UPUA 3WVDB 1MMGA 3JCMX 4M78E 2B8AA 3M0TA 4MZMA 2KXCA 1VQ7T 2OX7A 3X24B 3QYGB 4E7JA 2KK4A 1H641 2A37A 4DQ2A 4NL2A 2FVUA 3OYLA 1JB0E 2M51A 1YBYA 1MMDA 1YJWA 4PJMA 4NS5A 3RDVA 4BY6C 4DEXA 1MMNA 1U3OA 1GCQA 3I55A 1TS9A 1W6XA 5KYWA 1M3AA 3OB9A 1KG1A 3ZFJA 3CC4A 5D6YA 2R57A 2Y4XA 2O2OA 2XKOC 3JB9J 1QW1A 2EVRA 3DB4A 3OYKA 2LX9A 1OV3A 3PVLA 2JMCA 1K73C 3BY7A 2O01E 3EGXB 1R0CB 4XU2A 5I21A 2EGAA 2DL3A 2K2VA 4YTLA 2CP7A 3A8LB 4F14A 2E4HA 4RTUA 2QA4T 1N9SA 4ME7A 4BB7A 1YJ9A 2PNIA 1XQHA 4PJOE 1N6AA 3JCMQ 1R77A 2OAWA 4QQDA 3HFOA 5GANj 2ZPIB 5IHKA 4KH0B 3G4SQ 4XTWA 4J6WA 1JO8A 1WHGA 1VYTA 2AZVA 3CCRA 2CZ6B 4XAXB 2DTIA 3CCRT 1YJ9Q 5LJ3h 1RABB 4BE2A 5GAN6 2LP5A 4LDWA 1HD3A 2VXEA 1LCKA 3GNGA 2EJGA 4C92E 2D8HA 3SB2A 4PJJA 4IUTA 2RN8A 2BE7D 1RAGB 2EIFA 2EJFA 3EG1A 2RQRA 4C5GA 3JCMd 5IHNA 1M3CA 5AT1B 1XNIA 3CCJT 5IAYA 1VQ4Q 3KXTA 3EG9B 4RTYA 2KXDA 3EG0A 3SHWA 1M5Q1 1PSEA 1TH7A 2L2PA 3OYMA 1VQOT 2JZ2A 5KYYB 3VRZA 4BI4A 4M7DA 2PZ1A 3H9NA 2DXBA 3JB9I 2CH4A 3A5ZB 1WX6A 1CKBA 4C0GA 5LJ5j 1UHCA 2AIRB 1YNZA 4Y28E 3OYHA 2DPPB 5KE3A 3HL8A 3CCQA 3G1JA 3HKSA 1K1ZA 4KUDK 4PFOA 2E1HA 5CIUA 1TSFA 2Y90A 1S72Q 3RNJA 2LVMA 4Z89A 3UWNA 3L2VA 1UGSB 2FYKA 4M78A 4HT8A 4M77F 3QG1A 3QUIA 1IB8A 2GFAA 2WSCE 1V76A 2R5MA 1RAAB 1X43A 4CRIA 2HSPA 3CEYA 4A4HA 2RQUA 1UGQB 1S1NA 3LGFA 3CC7A 1BKBA 2ZPFB 1LVKA 2BZYA 3PNWC 2FB7A 3I5SA 2RHZA 1VIFA 2ZZDA 3CCJQ 3UA7A 1RI9A 2CZ7B 1N9RA 3F70A 2FZCB 3E2UA 3DLMA 4KULA 2DTOA 3QYHB 3TREA 4AFZC 1HXDA 1YN8A 4RTVA 3EGXA 3JCMW 3GF5A 2BE9B 4PLIA 4A4FA 1VQ8T 2K9GA 1YITA 1ZUYA 3CCVA 1VQ8A 4L59A 1BU1A 4QW2A 5GJWB 2GF7A 4M78D 4R56A 5LJ3f 3CC2A 1SHGA 3D7SB 2PUOB 4J9DA 1YJWQ 2M0YA 1M90U 1G8XA 1T0HA 4J9EA 1EIFA 3LX7A 1WDXA 1CKAA 2X3XD 1MMAA 2JJ9A 2ABLA 3BFMA 2E12A 5DLOA 2PVDB 1X75C 3OYAA 4MMLA 1PNJA 4II1A 1OU8A 4QKUA 4PJOG 1KQ1A 3MEVA 2E6ZA 4FIBA 2CSIA 2RMOA 2DTHA 4F7UF 4C92B 1VQMA 2YLBA 1Y0MA 1Z9QA 4CC7A 4C8QB 2F2XA 1UJYA 1KFZA 1R0BG 1BB9A 1VQLQ 1ABOA 4RCBA 4VUBA 4C92D 3JCMe 2XK0A 2J6FA 3VS7A 1WXBA 5EG2A 2HEQA 1VQMQ 4LD9K 1WQ7A 2MCNA 5HY6A 2EAYA 3G7ZA 4E6RA 1OX8A 2DEQA 3V8KA 2RI5A 1IRXA 2D0NA 5A2QE 4E7IA 3CPWP 4M7DE 3MEWA 4OMOA 1F1BB 3EG3A 1BI1A 4M78G 1MV0B 3RKYA 1I07A 1I8FA 1YJNQ 4FYXB 2CSQA 3I56Q 4PLLA 4OP0A 2XIDA 1M4ZA 3R6NA 5GANe 4EPCA 5GAN2 1BK2A 2KBTA 3G6EA 2Y4YA 3CMAQ 1NPRA 3CD6A 4FCYA 3KFVA 3GLXA 1WHHA 2DX1A 1V1CA 3FIFA 1M8MA 1K4US 3NTKA 1WXTA 3I56A 1VQPQ 1WLPB 5LJ5d 1VQOQ 2DK3A 2CGHA 4J5YA 3LH0A 3O8VA 2YDLA 3OW2A 1O9SA 3CXCS 3H8ZA 3M59A 1G3WA 3CMAA 4X9CA 1KSWA 2COYA 3CBMA 2ED0A 1G3SA 4Z02A 1O75A 1QP3A 4BE1A 2RF0A 4QVDA 2HBWA 1KJWA 3SDZA 1AD5A 2R5AA 4OMFB 2DLPA 4JPBW 2LQKA 1N8RU 1N27A 2LMJA 3QJ6A 3I5RA 3BW1A 2JM9A 3H0IA 2F2VA 4FT4A 2LZ6B 2D8JA 1JQQA 3J80E 2DYBA 3A8MB 3GIBA 2CDTA 1D3BA 1X6OA 1NJIR 2HKQB 1QKWA 1YWOA 2JVVA 2XI9A 4Y92A 1YCSB 3LW5E 5KYXB 2DEUA 3JCMP 4ZGJB 1PCXA 3M56A 4OVAA 1PRMC 3HRUA 3CPWS 1B34B 2DBKA 2A0FB 2V8JA 4BD3A 1QVGS 3EH1A 5KE2A 5FU6B 3CCMQ 1AWJA 5IT9E 1Y07A 3RUXA 3EFRA 2LX7A 4EDUA 1M1FA 4C92A 4IKFA 1FMVA 2KSSA 4KH1B 1VQ6Q 1TUCA 4KRTA 4Z8AA 4EMGA 4J9FA 4ZTFA 3CCVQ 2AZSA 1WHKA 4MDWA 5GMKi 4M78C 4CC3A 3OW2S 5CKBA 1OQKA 3CC2Q 1NYGA 4C8QC 4IUPA 3S3NA 1LOJA 4RTTA 4HCZA 2CT4A 1ZA1B 4P5NA 1NEBA 4C0FA 2K5LA 1WZOA 2FPDA 3CMEA 4M7AD 3OSSC 5FWCA 1FX7A 2ED1A 1ZBJA 1CSKA 2RPNA 1TUGB 2JT4A 3AT1B 1NG2A 2KNBB 2RHUA 3CQTA 3HSBA 3I55Q 2RQVA 5LJ5h 1VQ9A 2MAMA 2P4RA 2J7IA 2SEMA 2G3RA 2QG9B 2J06A 2YUOA 1SF9A 2LCCA 1IO6A 3QDFA 5J3BA 4MZTA 2DFUA 4XTXA 2MYSA 2NUPA 1VQOA 2AK5A 3PT9A 1EFNA 3CCEQ 4OMLA 3FEOA 3HP9A 1GFDA 3EFOB 3GOXA 1B07A 2P0QA 1SKUB 1W1FA 2QASA 1KC8U 5EC7A 1JXOA 2QTVA 3L2QA 1RL2A 3G71A 4AFSC 3CPFA 2K3XA 1ZQ1A 2HMAA 4JS4A 4E47A 3TQ7P 2CS7A 1RAHB 5HCKA 3ZBDA 3FRNA 1H3HA 3X26B 5CKHA 2FRYA 3PVQA 5IN1A 2AKLA 4OMPA 1WQWA 5CVIA 4JJBA 3C95A 3REBB 1K8AU 1ZBXA 2HDAA 1S72A 2YHTA 3OW2P 2E6NA 1QLYA 1ZX6A 3CC7T 2LQ8A 3RMQA 4PFPA 4XTZA 3QWXX 4F04B 2DD5A 3JCMf 4FW2A 5KYYA 5L23A 3CCST 1R8OB 2A36A 3CCSA 1GCPA 1Y7XA 3HFNA 3A98A 4C0ZA 1NYFA 1Y96A 4M78F 1WYXA 1IHWA 2A7YA 3E9GA 4M4ZA 4AT1B 1K8AC 3DB3A 2I0NA 4A4KA 2DETA 3CCUA 4RUGA 4A63B 1UJ0A 4X1VA 3L42A 3CCUQ 4M7AG 5FU6C 1YIJQ 1IXDA 3QZ5B 3OBWA 3H0HA 4M77B 4LUEA 2CP0A 3M57A 3DLLA 3QHSA 1Q7YU 3OS1A 2EWNA 2KE9A 3CBOA 3H41A 3ME9A 3EHRA 1MNDA 3FC3A 1M30A 3INZA 3SEMA 4R0KA 1YHQT 3ER0A 4XTVA 1YHQA 3KBGA 2FPEA 3RBBB 4FSSA 4JZ3A 2L89A 5A0DA 2ZPEB 1WHJA 5CQXA 2DXTA 4PJOF 3M0SA 2L0AA 5HK3A 1VQ5Q 2CZ0B 2OTJA 2X4WA 3CMEQ 2OJ2A 2OTJQ 1NLPC 2RH2A 3FJ5A 1OPKA 1D09B 2C0IA 2CP3A 2RM4A 4GLKA 2RJCA 2K2MA 4C5IA 3VS5A 3IQLA 4J6XA 1JJ2S 1KK7A 4X34A 2DVJA 2YWWA 3MHXA 1ZLMA 3PTAA 1VQ9Q 2KROA 1AHJB 1EZZB 2HQHA 2IG0A 3H6ZA 1ABQA 3G71Q 1DJ7B 1Y71A 3VU3C 2OTLA 2SRCA 3DKMA 5I2SA 2PVOB 2X9HA 2RD1A 1X01A 2RQTA 3VS6A 4JDSA 4Z88A 1SG5A 2XMFA 1KQSS 2J05A 2MMPA 1I1JA 4XTUA 3LYIA 3M0RA 4WCIA 4F7UB 2P0PA 1LJOA 1YIJT 3PMTA 1S72T 5GAN8 4LN2A 2VXFA 2QQ9A 2LCLA 3JCMg 4ORZA 1JBMA 4ZTJA 5GAMh 2YUQA 4N0AA 2WSFE 3Q1JA 3OS0A 2E3HA 4DBFA 4PJNA 1QWFA 2JN0A 4M77G 2YSQA 3M0PA 2D0QB 3QXEB 2COZA 1TXQA 3RKWA 2VVKA 4GBQA 3GNFB 2JUFA 1TTHB 1JEGA 3OYJA 1OPLA 1M2VB 3NTHA 3NHNA 5GMKj 4PL6A 1VUBA 2DZCA 2RI2A 4QVZA 1VQ7A 2EQUA 2LJ1A 2VKNA 1Q81U 2RJFA 3QWYA 3X28B 2EYQA 1NE8A 5D7UA 3HRSA 3J81E 5FWBA 3L2WA 3HRTA 1OI1A 1VQ6A 5KYNA 1X69A 2CUDA 1VQ4T 4EMKA 1FWZA 4BDZA 2RHXA 4V2SA 4M77E 3LWIA 1G83A 3OQ5A 2RJDA 1U1TA 1VQPA 2LTOA 1OU9A 3MO8A 4C8QA 3JCMc 3CCMT 2H3JA 4BUGA 2BUDA 4PJOD 2ZAEA 2QDLA 1E7OA 2KMTA 2HD0A 1RACB 1OULA 5GMKh 1BCOA 1NM7A 1M2VA 4J6YA 2PVGB 5IHIA 4FSXA 1YJNT 4LDXA 1SHFA 1K9MR 1K9AA 3CCLA 2M1HA 5HKCA 3V7CA 3OYBA 1Q82R 2A28A 3EGDA 3OYFA 2EFIA 4WTOB 4ZN1A 1U06A 3CCQT 4HXJA 4N0AC 1UHFA 5J26A 5GAMj 1K8AR 2LJ3A 3I56T 3OYCA 3I55T 1YWPA 4M75B 4MDXA 1D0ZA 1BBZA 1Q86U 1QVFP 2KRSA 2YRVA 3OS2A 3A8HB 3MP1A 3VRYA 2GFUA 2HSEB 1W70A 1IGUA 3VS1A 4CC2A 1VQNT 2E3IA 1K9MC 1M1KU 4D6WA 1BYMA 1VQ5A 5LJ3j 1UGRB 3JRZA 4B6MA 4JLIA 2X4XA 1RAFB 2RHYA 4E7SA 1AVZC 4OB0B 4EIKA 1JRIA 2X4JA 3EGDB 2CH4W 8ATCB 3MKDA 4M7AE 3TEEA 3GP8A 2FZKB 4RG8A 2RA2A 2EKHA 2OTLQ 1W2BS 5KYUB 2K6DA 2RQWA 4ATOA 1RI0A 2HKNA 2HCKA 4F7UE 1KQ2A 4C5HA 3RKXA 3GBQA 1AOJA 2RK1A 5I11A 1WI7A 2HQEA 1PC0A 2HQXA 2KRMA 2AHJB 1D0XA 2CKKA 1VYUA 2DF6A 2M02A 1V29B 1I5OB 2KEAA 5GAN7 2BKDN 1QCNA 3FDRA 4LNPA 4L5GA 1C1AA 2PTKA 2DM1A 2E70A 3M58A 1LPLA 1VQMT 7AT1B 4M77A 1WXUA 1UGPB 1UE9A 3O5ZA 4M77C 2CT3A 4ZGEB 2EBPA 2JS0A 2DAQA 5ECAA 3CCVT 1D1BA 1M9SA 2VASA 3I35A 4RMOA 5LJ5e 1UFFA 3QKJA 5KYUA 3M0UA 4BY6B 1J3TA 3U23A 5D6XA 4DBQA 1PHTA 2IVWA 3VV0A 1PRLC 4HVWA 5GANd 1KD1C 5GAOm 4M7AF 2KAFA 2DO3A 5IH2A 2WACA 2XHCA 4CI0C 5D6WA 2D1XA 4IIOA 5CKDA 5GAN5 1AT1B 3C4SA 4J9HA 2VC8A 3NPFA 1ZSZC 2O31A 1GBRA 4MMKA 1TWBA 4EMHA 4M78B 3EG9A 5CCAA 1SRLA 3SWNA 3JSCA 2HZYA 3EFSA 5DY9A 4M7AC 2H3EB 4C8QG 1GL5A 4RCCA 3HTRA 4E2FB 2LJ0A 1WHLA 1RLQC 2JOYA 4J9GA 2LNVA 3M0QA 3G71T 3CCEA 3CCLQ 2GGRA 1MGQA 4PK4A 4LXCA 3OYNA 3C0CA 2E41A 2GBQA 4FYWB 4HKEA 1QQJA 1UUEA 1AZGB 3LGLA 5FU7C 1XTDA 2DXUA 1M90C 2K5IA 2CZ1B 3V7SA 4RTZA 1YJNA 3TSZA 1IGQA 2HAXA 1YI2T 1TUDA 3G6EQ 5KCHA 1PWTA 2XDBA 1Y57A 3JAME 1VQLA 4HT9A 1PM3A 4XU1A 1K76A 2KY9A 1M1GA 1C6VX 2ESWA 1YJWT 2LT4A 2ZPHB 4LUDA 2ZPBB 3SWNB 1I0CA 2ENMA 1HYOA 4M7DG 1BIAA 4PJOB 2ROLA 3PE0A 1SSFA 2LDMA 2RB6A 1W4SA 3V7RA 1SSHA 1ARKA 3EHQA 4FU6A 3FB9A 2EYWA 5FROA 3M54A 3EGUA 5GANg 3WVEB 2E10A 2Z0WA 2CUBA 2QQBA 2FG0A 3BDLA 2DNUA 2DL5A 1W2BA 1PD0A 3JB9D 5GANh 3OYGA 1VIEA 2ATCB 1KHCA 1Q82U 2DL4A 2JTFA 4IURA 3RESA 2KVQG 2OTLT 1JU5C 1M1KC 3ZL7C 1P92A 4Q5WA 3EG2A 2VYTA 3OA6A 5CK9A 3SFMA 3JB9F 3ASKA 2QXFA 3JCMh 4C5EA 2XDPA 3OYYA 3ZEHA 4C0DB 1YI2A 1OZ2A 3MCAB 1VQ8Q 4HVUA 5C0MA 1YI2Q 2YT6A 2CYZB 1AWXA 4D8DA 1FMKA 2FPFA 4XK8E 1MUZA 1KQSP 1WJRA 1W2BP 2A08A 5LJ5g 3CPWA 1YP5A 2PU9B 2L3RA 1WPYA 1VQ9T 2EJ9A 2K7AA 2EYYA 4AFUC 1QVFS 2EGCA 1TOVA 3S3OA 3FLGA 2F5KA 1RADB 2WSEE 3QPHA 2NLUA 2BTTA 1QCOA 5GAMe 4PJOA 2W10A 1Q86C 1RAIB 3PMIA 1Q7YR 4LE9A 2KGTA 1AWOA 1NLOC 2CP6A 4JRIA 4HCBA 2DILA 1WFWA 2L3PA 2KYMA 4EMKB 3OYEA 2CP2A 5DLQE 1KD1U 4WF2A 4F7UA 3GPLA 2L3QA 3LH5A 2MF2A 1UECA 4RTXA 4A4EA 4L6V5 4ESRA 3OMGA 4A54A 1GCQC 1Q95G 2OAUA 2YXYA 2VB6A 2H8HA 4M7DB 3MEAA 5GANf 2C06A 3X25B 1QWEA 3MEUA 3X20B 1GXIE 4AFQC 2RI3A 1NBEB 1YITT 5IXFA 5LJ3d 1XOVA 4KBMB 5M9OA 2X4YA 3RMSA 3JCMV 2I2LA 5FLXE 6AT1B 2P84A 5IXBA 2QDYB 4DA4A 3M53A 2V8IA 1X6GA 3E19A 2DXCA 2GQIA 2XU8A 2F1LA 1MV3A 4ZGDB 2KI7A 4M75F 1K73U 4HVVA 4M77D 1QVGA 1MNEA 4O5VA 4A53A 4BI8B 5GAN3 2DIGA 3VJPA 3EAEA 3T9NA 3UT1A 3R6OA 1VQPT 1WGSA 3V8LA 2AKKA 1FMWA 4J9BA 2FZGB 4LDVA 5HK0A 2GQVA 4QVCA 2ZCFB 4E7ZA 2DE0X 5KYXA 1M2OA 1ZHIA 3OSVA 2CP5A 4D8KA 4IUQA 1KHIA 1LNXA 3L2RA 1IZ6A
chains in the Genus database with same CATH topology
1QKWA 1YWOA 3VRYA 4Y92A 1YCSB 1W70A 2KR3A 1UTIA 2ECZA 3VS1A 2O9VA 4CC2A 2FO0A 1PRMC 2DA9A 1JXMA 2DBKA 2LQWA 3JV3A 4JZ4A 1AWJA 3VS4A 1T3SA 2FRWA 1AVZC 2LX7A 1UG1A 2W0ZA 4EIKA 1M27C 2CH4W 1TUCA 4KRTA 4Z8AA 2LCSA 2DMOA 4J9FA 2AZSA 2O9SA 2EKHA 1Z9ZA 1AZEA 2K6DA 2RQWA 4CC3A 2HCKA 4AG2C 2GTOA 1NYGA 2FEIA 2RNAA 1WA7A 3GBQA 4AG1C 1AOJA 4RTTA 5I11A 1WI7A 3UA6A 2EYZA 2KRMA 2NWMA 2CT4A 2V1QA 3NGPA 1G2BA 2VWFA 1ZUKA 2ROTA 1NEBA 1VYUA 1E6HA 2L3SA 2DF6A 2FPDA 5FWCA 2KEAA 2ED1A 1GRIA 1ZBJA 3VS3A 1CSKA 2RPNA 2JT4A 1NG2A 2KNBB 3CQTA 4LNPA 4J9IA 3REAB 2PTKA 2RQVA 1UGVA 2DM1A 5FW9A 1K0SA 2DRKA 2P4RA 4OMNA 1WXUA 1UE9A 2J7IA 3O5ZA 2CT3A 2EBPA 2JS0A 2SEMA 5ECAA 1QKXA 4IIMA 1QCFA 2BZXA 2J06A 2DL7A 2K3BA 2YUOA 3I35A 1IO6A 3ULRB 3M0TA 1UFFA 2NUZA 4GLMA 2AK5A 3M0UA 2KXCA 1EFNA 1J3TA 3U23A 3H0FA 4OMLA 1PHTA 2A37A 2M51A 1GFDA 1PRLC 4HVWA 2JS2A 1KIKA 2X3WD 1SEMA 1B07A 2OI3A 4DEXA 1U3OA 1GCQA 1W1FA 3TSWA 1SPKA 1W6XA 5EC7A 1JXOA 1M3AA 4AFSC 5IH2A 4OMQA 1RUWA 2O2OA 2D1XA 4IIOA 5HCKA 4J9HA 3NPFA 2EVRA 2O31A 1H3HA 1VYVA 1GBRA 4DEYA 1OV3A 2FRYA 3PVQA 3PVLA 1SRLA 2AKLA 4OMPA 2JMCA 4JJBA 1AEYA 5I22A 1GL5A 2EGAA 4QT7A 2DL3A 2LJ0A 2MOXA 3REBB 4F14A 4RTUA 1RLQC 2HDAA 2JXBA 4J9GA 2PNIA 1QLYA 1ZX6A 1OOTA 3M0QA 1WIEA 2GGRA 2DBMA 2OAWA 5IHKA 1M3BA 3QWXX 3C0CA 2GBQA 4OMMA 1JO8A 1UUEA 5L23A 1VYTA 1AZGB 2AZVA 1H8KA 2A36A 4RTZA 1GCPA 2LP5A 3TSZA 1HD3A 3A98A 1NYFA 1LCKA 2LQNA 1WYXA 1TUDA 2D8HA 1PWTA 4M4ZA 4ZNXA 1Y57A 2RN8A 2I0NA 3EG1A 1K76A 2RQRA 2EW3A 2KT1A 2ESWA 5IHNA 1M3CA 4LUDA 4RUGA 4A63B 1UJ0A 4X1VA 4RTYA 1I0CA 2ENMA 2KXDA 3EG0A 1ZSGA 3SHWA 2KRNA 2ROLA 3PE0A 2JTEA 2DL8A 1ZUUA 4CC4B 3H0HA 2L2PA 4LUEA 3VRZA 3VS2A 2PZ1A 1E6GA 2KE9A 1SSHA 2CH4A 1ARKA 3EHQA 2DRMA 1WX6A 3H41A 1CKBA 2J6KA 3EHRA 2EYWA 1UHCA 1M30A 1YNZA 3SEMA 3EGUA 4R0KA 2J6OA 4JJCA 2CUBA 2FG0A 2FPEA 2DNUA 2DL5A 4K11A 3TVTA 2F2WA 3RBBB 4FSSA 1K1ZA 4JZ3A 1HJDA 1GBQA 2E5KA 1H92A 3RNJA 4Z89A 3UF4A 3M0SA 2L0AA 2DL4A 2OJ2A 2G6FX 1NLPC 1X6BA 3FJ5A 1OPKA 2C0IA 1JU5C 1X43A 3ZL7C 1X2KA 2HSPA 2K2MA 3EG2A 2KYBA 2RQUA 1S1NA 3VS5A 3IQLA 4F17A 2BZYA 1GFCA 2DVJA 3I5SA 1ZLMA 2GTJA 2KROA 3UA7A 1RI9A 1ABQA 2EQIA 2SRCA 4JJDA 4HVUA 2IIMA 2YT6A 1AWXA 2RQTA 1N5ZA 4AFZC 3VS6A 4D8DA 1YN8A 1FMKA 2FPFA 4Z88A 1MUZA 4RTVA 1RLPC 2EYXA 2XMFA 2A08A 2J05A 1I1JA 2K9GA 3M0RA 1ZUYA 4WCIA 1YP5A 2YUPA 1BU1A 5GJWB 1VA7A 4LN2A 1AWWA 2YUNA 1SHGA 2K7AA 2EYYA 4AFUC 4J9DA 2EGCA 2KT8A 2MIOA 2M0YA 4ORZA 1TG0A 2EPDA 1T0HA 3NMZC 2YUQA 4J9EA 2BTTA 1WDXA 1CKAA 2X3XD 1QWFA 2W10A 4F16A 2C0TA 2ABLA 1PKSA 3THKA 2JMAA 4LE9A 2CREA 2YSQA 1SRMA 1PNJA 3M0PA 2KGTA 1AWOA 1NLOC 2DILA 1WFWA 2L3PA 2KYMA 2O88A 3I9QA 2VVKA 4GBQA 1OEBA 2CSIA 2RMOA 2LNHB 1JEGA 2L3QA 1Y0MA 3LH5A 1Z9QA 4CC7A 1UECA 4RTXA 1T0JA 1OPLA 1T3LA 2F2XA 4HCKA 3NHNA 1B3QA 1UJYA 4ESRA 2GNCA 1KFZA 1BB9A 1ABOA 2LJ1A 1GCQC 5GJVB 2VKNA 3QWYA 2J6FA 3VS7A 2H8HA 1WXBA 2HEQA 1UDLA 2MCNA 5FWBA 4E6RA 2B86A 1QWEA 1X69A 3VS0A 2D0NA 4AFQC 2CUDA 1FYNA 4OMOA 5IXFA 1XOVA 3UATA 3EG3A 2C0OA 1MV0B 1G83A 1I07A 2DJQA 5IXBA 2CSQA 3R6NA 1NEGA 1BK2A 2KBTA 1U5SA 1X6GA 4RTWA 2GQIA 3KFVA 2DX1A 1MV3A 2QDLA 1X2QA 1E7OA 1V1CA 4HVVA 1M8MA 1NM7A 1K4US 1HSQA 1WXTA 1WLPB 2K79A 1X27A 2YDLA 2V1RA 5IHIA 1KSWA 1SHFA 2EGEA 1K9AA 2ED0A 2AKKA 4J9BA 2RF0A 1PKTA 2HBWA 1KJWA 1AD5A 2A28A 2DLPA 4JPBW 2BZ8A 4J9CA 2LMJA 1U06A 4HXJA 1A0NB 1UHFA 2DE0X 3I5RA 2JW4A 2LJ3A 2JM9A 2JM8A 3H0IA 2F2VA 2LZ6B 2D8JA 1YWPA 1JQQA 1K0XA 2DYBA 1BBZA 2CDTA 4D8KA 2KRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QKW A;  1YWO A;  3VRY A;  4Y92 A;  1YCS B;  1W70 A;  2KR3 A;  1UTI A;  2ECZ A;  3VS1 A;  2O9V A;  4CC2 A;  2FO0 A;  1PRM C;  2DA9 A;  1JXM A;  2DBK A;  2LQW A;  3JV3 A;  4JZ4 A;  1AWJ A;  3VS4 A;  1T3S A;  2FRW A;  1AVZ C;  2LX7 A;  1UG1 A;  2W0Z A;  4EIK A;  1M27 C;  2CH4 W;  1TUC A;  4KRT A;  4Z8A A;  2LCS A;  2DMO A;  4J9F A;  2AZS A;  2O9S A;  2EKH A;  1Z9Z A;  1AZE A;  2K6D A;  2RQW A;  4CC3 A;  2HCK A;  4AG2 C;  2GTO A;  1NYG A;  2FEI A;  2RNA A;  1WA7 A;  3GBQ A;  4AG1 C;  1AOJ A;  4RTT A;  5I11 A;  1WI7 A;  3UA6 A;  2EYZ A;  2KRM A;  2NWM A;  2CT4 A;  2V1Q A;  3NGP A;  1G2B A;  2VWF A;  1ZUK A;  2ROT A;  1NEB A;  1VYU A;  1E6H A;  2L3S A;  2DF6 A;  2FPD A;  5FWC A;  2KEA A;  2ED1 A;  1GRI A;  1ZBJ A;  3VS3 A;  1CSK A;  2RPN A;  2JT4 A;  1NG2 A;  2KNB B;  3CQT A;  4LNP A;  4J9I A;  3REA B;  2PTK A;  2RQV A;  1UGV A;  2DM1 A;  5FW9 A;  1K0S A;  2DRK A;  2P4R A;  4OMN A;  1WXU A;  1UE9 A;  2J7I A;  3O5Z A;  2CT3 A;  2EBP A;  2JS0 A;  2SEM A;  5ECA A;  1QKX A;  4IIM A;  1QCF A;  2BZX A;  2J06 A;  2DL7 A;  2K3B A;  2YUO A;  3I35 A;  1IO6 A;  3ULR B;  3M0T A;  1UFF A;  2NUZ A;  4GLM A;  2AK5 A;  3M0U A;  2KXC A;  1EFN A;  1J3T A;  3U23 A;  3H0F A;  4OML A;  1PHT A;  2A37 A;  2M51 A;  1GFD A;  1PRL C;  4HVW A;  2JS2 A;  1KIK A;  2X3W D;  1SEM A;  1B07 A;  2OI3 A;  4DEX A;  1U3O A;  1GCQ A;  1W1F A;  3TSW A;  1SPK A;  1W6X A;  5EC7 A;  1JXO A;  1M3A A;  4AFS C;  5IH2 A;  4OMQ A;  1RUW A;  2O2O A;  2D1X A;  4IIO A;  5HCK A;  4J9H A;  3NPF A;  2EVR A;  2O31 A;  1H3H A;  1VYV A;  1GBR A;  4DEY A;  1OV3 A;  2FRY A;  3PVQ A;  3PVL A;  1SRL A;  2AKL A;  4OMP A;  2JMC A;  4JJB A;  1AEY A;  5I22 A;  1GL5 A;  2EGA A;  4QT7 A;  2DL3 A;  2LJ0 A;  2MOX A;  3REB B;  4F14 A;  4RTU A;  1RLQ C;  2HDA A;  2JXB A;  4J9G A;  2PNI A;  1QLY A;  1ZX6 A;  1OOT A;  3M0Q A;  1WIE A;  2GGR A;  2DBM A;  2OAW A;  5IHK A;  1M3B A;  3QWX X;  3C0C A;  2GBQ A;  4OMM A;  1JO8 A;  1UUE A;  5L23 A;  1VYT A;  1AZG B;  2AZV A;  1H8K A;  2A36 A;  4RTZ A;  1GCP A;  2LP5 A;  3TSZ A;  1HD3 A;  3A98 A;  1NYF A;  1LCK A;  2LQN A;  1WYX A;  1TUD A;  2D8H A;  1PWT A;  4M4Z A;  4ZNX A;  1Y57 A;  2RN8 A;  2I0N A;  3EG1 A;  1K76 A;  2RQR A;  2EW3 A;  2KT1 A;  2ESW A;  5IHN A;  1M3C A;  4LUD A;  4RUG A;  4A63 B;  1UJ0 A;  4X1V A;  4RTY A;  1I0C A;  2ENM A;  2KXD A;  3EG0 A;  1ZSG A;  3SHW A;  2KRN A;  2ROL A;  3PE0 A;  2JTE A;  2DL8 A;  1ZUU A;  4CC4 B;  3H0H A;  2L2P A;  4LUE A;  3VRZ A;  3VS2 A;  2PZ1 A;  1E6G A;  2KE9 A;  1SSH A;  2CH4 A;  1ARK A;  3EHQ A;  2DRM A;  1WX6 A;  3H41 A;  1CKB A;  2J6K A;  3EHR A;  2EYW A;  1UHC A;  1M30 A;  1YNZ A;  3SEM A;  3EGU A;  4R0K A;  2J6O A;  4JJC A;  2CUB A;  2FG0 A;  2FPE A;  2DNU A;  2DL5 A;  4K11 A;  3TVT A;  2F2W A;  3RBB B;  4FSS A;  1K1Z A;  4JZ3 A;  1HJD A;  1GBQ A;  2E5K A;  1H92 A;  3RNJ A;  4Z89 A;  3UF4 A;  3M0S A;  2L0A A;  2DL4 A;  2OJ2 A;  2G6F X;  1NLP C;  1X6B A;  3FJ5 A;  1OPK A;  2C0I A;  1JU5 C;  1X43 A;  3ZL7 C;  1X2K A;  2HSP A;  2K2M A;  3EG2 A;  2KYB A;  2RQU A;  1S1N A;  3VS5 A;  3IQL A;  4F17 A;  2BZY A;  1GFC A;  2DVJ A;  3I5S A;  1ZLM A;  2GTJ A;  2KRO A;  3UA7 A;  1RI9 A;  1ABQ A;  2EQI A;  2SRC A;  4JJD A;  4HVU A;  2IIM A;  2YT6 A;  1AWX A;  2RQT A;  1N5Z A;  4AFZ C;  3VS6 A;  4D8D A;  1YN8 A;  1FMK A;  2FPF A;  4Z88 A;  1MUZ A;  4RTV A;  1RLP C;  2EYX A;  2XMF A;  2A08 A;  2J05 A;  1I1J A;  2K9G A;  3M0R A;  1ZUY A;  4WCI A;  1YP5 A;  2YUP A;  1BU1 A;  5GJW B;  1VA7 A;  4LN2 A;  1AWW A;  2YUN A;  1SHG A;  2K7A A;  2EYY A;  4AFU C;  4J9D A;  2EGC A;  2KT8 A;  2MIO A;  2M0Y A;  4ORZ A;  1TG0 A;  2EPD A;  1T0H A;  3NMZ C;  2YUQ A;  4J9E A;  2BTT A;  1WDX A;  1CKA A;  2X3X D;  1QWF A;  2W10 A;  4F16 A;  2C0T A;  2ABL A;  1PKS A;  3THK A;  2JMA A;  4LE9 A;  2CRE A;  2YSQ A;  1SRM A;  1PNJ A;  3M0P A;  2KGT A;  1AWO A;  1NLO C;  2DIL A;  1WFW A;  2L3P A;  2KYM A;  2O88 A;  3I9Q A;  2VVK A;  4GBQ A;  1OEB A;  2CSI A;  2RMO A;  2LNH B;  1JEG A;  2L3Q A;  1Y0M A;  3LH5 A;  1Z9Q A;  4CC7 A;  1UEC A;  4RTX A;  1T0J A;  1OPL A;  1T3L A;  2F2X A;  4HCK A;  3NHN A;  1B3Q A;  1UJY A;  4ESR A;  2GNC A;  1KFZ A;  1BB9 A;  1ABO A;  2LJ1 A;  1GCQ C;  5GJV B;  2VKN A;  3QWY A;  2J6F A;  3VS7 A;  2H8H A;  1WXB A;  2HEQ A;  1UDL A;  2MCN A;  5FWB A;  4E6R A;  2B86 A;  1QWE A;  1X69 A;  3VS0 A;  2D0N A;  4AFQ C;  2CUD A;  1FYN A;  4OMO A;  5IXF A;  1XOV A;  3UAT A;  3EG3 A;  2C0O A;  1MV0 B;  1G83 A;  1I07 A;  2DJQ A;  5IXB A;  2CSQ A;  3R6N A;  1NEG A;  1BK2 A;  2KBT A;  1U5S A;  1X6G A;  4RTW A;  2GQI A;  3KFV A;  2DX1 A;  1MV3 A;  2QDL A;  1X2Q A;  1E7O A;  1V1C A;  4HVV A;  1M8M A;  1NM7 A;  1K4U S;  1HSQ A;  1WXT A;  1WLP B;  2K79 A;  1X27 A;  2YDL A;  2V1R A;  5IHI A;  1KSW A;  1SHF A;  2EGE A;  1K9A A;  2ED0 A;  2AKK A;  4J9B A;  2RF0 A;  1PKT A;  2HBW A;  1KJW A;  1AD5 A;  2A28 A;  2DLP A;  4JPB W;  2BZ8 A;  4J9C A;  2LMJ A;  1U06 A;  4HXJ A;  1A0N B;  1UHF A;  2DE0 X;  3I5R A;  2JW4 A;  2LJ3 A;  2JM9 A;  2JM8 A;  3H0I A;  2F2V A;  2LZ6 B;  2D8J A;  1YWP A;  1JQQ A;  1K0X A;  2DYB A;  1BBZ A;  2CDT A;  4D8K A;  2KRS A; 
#chains in the Genus database with same CATH topology
 5LJ3 e;  3CC7 Q;  3MET A;  1MHN A;  2DKG A;  1UTI A;  1ACM B;  2ECZ A;  3EFO A;  3TCJ A;  1U1S A;  2O9V A;  2FO0 A;  3CCQ Q;  1Q81 R;  2EQK A;  1JXM A;  3OMC A;  1JJ2 P;  4C92 G;  5DM7 R;  2DER A;  4JZ4 A;  8AT1 B;  5I2M A;  4DOW A;  3SWN C;  3CCR Q;  2FRW A;  2W0Z A;  1UG1 A;  1YFN A;  1I5L A;  2QQS A;  1BCM A;  2X35 A;  5GAN 4;  3QDR B;  2YLC A;  2LCS A;  1QVP A;  3A1P A;  2QQA A;  5CR2 A;  1Z9Z A;  2MI6 A;  2D9T A;  4J7I A;  2NUT B;  2BIV A;  2GTO A;  2RNA A;  1WA7 A;  3M5A A;  2RHI A;  3MPU B;  1G3T A;  2EYZ A;  4GY5 A;  2EKO A;  2M16 A;  2NWM A;  3NGP A;  1KC8 R;  1ZUK A;  1E6H A;  1NJI U;  2L3S A;  4FYV B;  5KH6 A;  1OX9 A;  1PG5 B;  1NZ9 A;  2NUT A;  3G6E T;  2DIQ A;  4J9I A;  1FXX A;  3REA B;  2K4Y A;  1UGV A;  3QZ9 B;  5FW9 A;  2MWP A;  3UDC A;  5GAO n;  4M7A B;  4C8Q D;  2XDD A;  2QGF B;  2E5Q A;  4FM4 B;  3URG A;  3CXC A;  4E7H A;  4IIM A;  1QCF A;  5GAM g;  4M7D C;  2DL7 A;  2V8K A;  3ULR B;  3BDU A;  1YHQ Q;  1VQK T;  2NUZ A;  4GLM A;  1Q81 C;  1HK9 A;  4AMC A;  2QAZ A;  1Q86 R;  3H0F A;  3RIR A;  4KT0 E;  1PD1 A;  4OB2 B;  3VYH B;  3TU4 K;  2DD4 A;  4DBR A;  4R55 A;  2JS2 A;  4QQ6 A;  1KIK A;  1Q82 C;  2X3W D;  1SEM A;  2OI3 A;  1VQ5 T;  3TSW A;  4KGX B;  5LJ3 g;  1SPK A;  4RKU E;  2D6F A;  3E9F A;  1QVG P;  4ELZ C;  3CBP A;  4OMQ A;  5GAO l;  5GMK m;  3VKI A;  1RUW A;  3KUF A;  3G4S T;  2MK5 A;  1VYV A;  3P8B B;  4DEY A;  2QEX Q;  5CAI A;  2MPX C;  3CME T;  1WNL A;  1AEY A;  1G5V A;  5I22 A;  2JNG A;  4QT7 A;  4ZN3 A;  3OYI A;  2MOX A;  2MWO A;  2JXB A;  1G3Y A;  4BDY A;  1BI3 A;  1OOT A;  3HHT B;  4IUU A;  1WIE A;  4Y91 A;  5L8R E;  3NTI A;  2DBM A;  3S3M A;  3L2Z A;  1VQ6 T;  1M3B A;  2M9U A;  5GAM f;  4KUI A;  5KYW B;  2ZGW A;  2M0O A;  4OMM A;  3OS5 A;  2VGN A;  3HPW A;  1H8K A;  2YRC A;  3NFC A;  4NOY A;  2NYS A;  3P8D A;  1QVF A;  5A0L A;  1D1C A;  3QSU A;  2LQN A;  3SD4 A;  2VGM A;  5FRM A;  2RO0 A;  5GAO q;  4ZNX A;  4M7A A;  1VQ7 Q;  4XU3 A;  1WJQ A;  2EW3 A;  3VYG A;  2KT1 A;  4LDY A;  1UEB A;  5AYF A;  1EX4 A;  1ZSZ B;  5A0G A;  1ZSG A;  2E65 A;  2E64 A;  2KRN A;  2JTE A;  2DL8 A;  1ZUU A;  3QO3 A;  2COW A;  4BI3 A;  4CC4 B;  1YCY A;  3CCL T;  3VS2 A;  1E6G A;  1C0M A;  3CMA T;  3QBY A;  1YIJ A;  2DRM A;  3CCJ A;  4TVR A;  2J6K A;  3E1S A;  5C6S A;  2QYZ A;  2EQJ A;  2J6O A;  3RER A;  2O4X A;  3A8G B;  4JJC A;  3MJX A;  5CKF A;  4OGE A;  1NPP A;  4K11 A;  3TVT A;  2F2W A;  1HJD A;  1GBQ A;  3LWH A;  2RK2 A;  2E5K A;  1B7T A;  1H92 A;  3M55 A;  4O6J A;  3UF4 A;  2X51 A;  2DYI A;  2LC4 A;  1QMC A;  3G4S A;  2G6F X;  4KGZ B;  1X6B A;  2XD0 A;  1IHV A;  2EQM A;  2LT1 A;  2XG8 D;  1X2K A;  2L5Q A;  1M8V A;  2KYB A;  1YJ9 T;  1NJI C;  3CCE T;  1PSF A;  4FW1 A;  4XU0 A;  4F17 A;  4OF1 A;  4JLG A;  1GFC A;  2GTJ A;  5J39 A;  2QA4 A;  1RAE B;  4BAC A;  1KQS A;  2QI2 A;  4PJL A;  2EQI A;  2QTX A;  4JJD A;  2VV5 A;  1N8R C;  4M75 D;  4X9D A;  2IIM A;  3MP8 A;  1N5Z A;  1VOM A;  2YRD A;  4B9W A;  1I4K 1;  2HL5 C;  1RLP C;  2EYX A;  1VQ4 A;  1Y96 B;  2RJE A;  2K57 A;  4FT2 A;  3WXM B;  2K5F A;  2IPO B;  2YUP A;  1VQL T;  1VA7 A;  2F69 A;  1AWW A;  2YUN A;  3A8O B;  2KT8 A;  2MIO A;  2DJZ A;  2JTM A;  1TG0 A;  1XJW B;  2EPD A;  4JJN K;  3NMZ C;  1OYX A;  2A3L A;  4M7D F;  1VQK A;  3J7A F;  4F16 A;  1N8R R;  2C0T A;  1PKS A;  3THK A;  2JMA A;  1BI2 A;  2CRE A;  3V8J A;  1SRM A;  3CC2 T;  1UB4 A;  1Q7Y C;  2QK0 A;  4M75 A;  1VQN Q;  3CCS Q;  2O88 A;  2DZ9 A;  2QEX A;  2PUK B;  3I9Q A;  4N4H A;  4E7K A;  4E7L A;  2ZPG B;  3CCU T;  1OEB A;  1WHM A;  2QEX T;  2LNH B;  3BE3 A;  3CD6 Q;  5GAM d;  2O4X B;  2LRQ A;  1T0J A;  3M9Q A;  1T3L A;  4HCK A;  2R58 A;  1B3Q A;  1K9M U;  2GNC A;  2FL7 A;  3FJP A;  4PFZ A;  3M4G A;  5GJV B;  5KCO A;  4N4I A;  2GCX A;  2K3Y A;  5LL6 S;  1H3Z A;  1UDL A;  3MP6 A;  3C12 A;  4LDU A;  3CC4 Q;  3VUB A;  2B86 A;  3VS0 A;  4B9X A;  1FYN A;  3EH2 A;  9ATC B;  5CKE A;  3UAT A;  3L1A A;  2C0O A;  4UC4 A;  1U8R A;  2DJQ A;  4C92 F;  4C0D C;  1NEG A;  4C8Q F;  2HBP A;  2OTJ T;  4PNO A;  1U5S A;  3M4Y A;  2FHD A;  4RTW A;  1X2Q A;  4LD6 A;  2P0K A;  1WJS A;  2AT1 B;  2PQW A;  3P8H A;  4XTY A;  3QII A;  1BI0 A;  1HSQ A;  4NL3 A;  2K79 A;  3AHU A;  1X27 A;  1YIT Q;  4FYY B;  4HA8 A;  4OB3 B;  2V1R A;  2VUB A;  3CD6 T;  2EGE A;  2F5T X;  2QQR A;  3VUZ A;  1PKT A;  4PKC C;  1B34 A;  4JS5 A;  4M75 C;  2BZ8 A;  1KC8 C;  4J9C A;  4JUV A;  4KGV B;  1A0N B;  3PIO A;  2JW4 A;  1OZ3 A;  2JM8 A;  5GMK l;  2P4T A;  4OGC A;  1ZSZ A;  4F7U G;  2XIC A;  4JRK A;  3OYD A;  1K0X A;  3LLR A;  4C92 C;  4ANJ A;  1KD1 R;  4JRP A;  4HCC A;  3PFS A;  1VQN A;  2KR3 A;  2DVE A;  4DBH A;  1ZA2 B;  3CC4 T;  3OBY A;  4OB1 B;  4J8O A;  2DA9 A;  4JRQ A;  4N4G A;  4RG2 A;  2LQW A;  4FL6 A;  3JV3 A;  2L8D A;  1IRE B;  4PJO C;  3VS4 A;  3N5B B;  1T3S A;  5GMK e;  1M90 R;  3JCM b;  3CXC P;  1M27 C;  4BE0 A;  1VQK Q;  4QQG A;  4DOV A;  3OY9 A;  4M75 E;  1D3B B;  2DMO A;  1D1A A;  4A4G A;  2O9S A;  4XQ3 A;  1AZE A;  2HL3 A;  4ELY C;  3PGG A;  5GAO r;  5GAO p;  4AG2 C;  2FEI A;  4MZP A;  1BIB A;  4AG1 C;  4J7F A;  3C94 A;  2QGG A;  4J83 A;  5CO7 A;  5FU7 B;  1JJ2 A;  3RR6 A;  3UA6 A;  3S6W A;  1TU0 B;  1K73 R;  3L2U A;  2NUP B;  5FRN A;  2V1Q A;  4EMK C;  1G2B A;  3JCM J;  2VWF A;  5CQY A;  4IUV A;  2ROT A;  3QJY A;  4M7D D;  1GRI A;  1I81 A;  3VS3 A;  3CCM A;  1QP2 A;  2V26 A;  5LJ5 f;  1M1K R;  2QA4 Q;  1K0S A;  2DRK A;  4OMN A;  3JB9 H;  2HNI A;  1D0Y A;  2KDS A;  3JB9 G;  1QKX A;  4C8Q E;  2KQW A;  2BZX A;  4M75 G;  3PIP A;  2K3B A;  3UPU A;  3WVD B;  1MMG A;  3JCM X;  4M78 E;  2B8A A;  3M0T A;  4MZM A;  2KXC A;  1VQ7 T;  2OX7 A;  3X24 B;  3QYG B;  4E7J A;  2KK4 A;  1H64 1;  2A37 A;  4DQ2 A;  4NL2 A;  2FVU A;  3OYL A;  1JB0 E;  2M51 A;  1YBY A;  1MMD A;  1YJW A;  4PJM A;  4NS5 A;  3RDV A;  4BY6 C;  4DEX A;  1MMN A;  1U3O A;  1GCQ A;  3I55 A;  1TS9 A;  1W6X A;  5KYW A;  1M3A A;  3OB9 A;  1KG1 A;  3ZFJ A;  3CC4 A;  5D6Y A;  2R57 A;  2Y4X A;  2O2O A;  2XKO C;  3JB9 J;  1QW1 A;  2EVR A;  3DB4 A;  3OYK A;  2LX9 A;  1OV3 A;  3PVL A;  2JMC A;  1K73 C;  3BY7 A;  2O01 E;  3EGX B;  1R0C B;  4XU2 A;  5I21 A;  2EGA A;  2DL3 A;  2K2V A;  4YTL A;  2CP7 A;  3A8L B;  4F14 A;  2E4H A;  4RTU A;  2QA4 T;  1N9S A;  4ME7 A;  4BB7 A;  1YJ9 A;  2PNI A;  1XQH A;  4PJO E;  1N6A A;  3JCM Q;  1R77 A;  2OAW A;  4QQD A;  3HFO A;  5GAN j;  2ZPI B;  5IHK A;  4KH0 B;  3G4S Q;  4XTW A;  4J6W A;  1JO8 A;  1WHG A;  1VYT A;  2AZV A;  3CCR A;  2CZ6 B;  4XAX B;  2DTI A;  3CCR T;  1YJ9 Q;  5LJ3 h;  1RAB B;  4BE2 A;  5GAN 6;  2LP5 A;  4LDW A;  1HD3 A;  2VXE A;  1LCK A;  3GNG A;  2EJG A;  4C92 E;  2D8H A;  3SB2 A;  4PJJ A;  4IUT A;  2RN8 A;  2BE7 D;  1RAG B;  2EIF A;  2EJF A;  3EG1 A;  2RQR A;  4C5G A;  3JCM d;  5IHN A;  1M3C A;  5AT1 B;  1XNI A;  3CCJ T;  5IAY A;  1VQ4 Q;  3KXT A;  3EG9 B;  4RTY A;  2KXD A;  3EG0 A;  3SHW A;  1M5Q 1;  1PSE A;  1TH7 A;  2L2P A;  3OYM A;  1VQO T;  2JZ2 A;  5KYY B;  3VRZ A;  4BI4 A;  4M7D A;  2PZ1 A;  3H9N A;  2DXB A;  3JB9 I;  2CH4 A;  3A5Z B;  1WX6 A;  1CKB A;  4C0G A;  5LJ5 j;  1UHC A;  2AIR B;  1YNZ A;  4Y28 E;  3OYH A;  2DPP B;  5KE3 A;  3HL8 A;  3CCQ A;  3G1J A;  3HKS A;  1K1Z A;  4KUD K;  4PFO A;  2E1H A;  5CIU A;  1TSF A;  2Y90 A;  1S72 Q;  3RNJ A;  2LVM A;  4Z89 A;  3UWN A;  3L2V A;  1UGS B;  2FYK A;  4M78 A;  4HT8 A;  4M77 F;  3QG1 A;  3QUI A;  1IB8 A;  2GFA A;  2WSC E;  1V76 A;  2R5M A;  1RAA B;  1X43 A;  4CRI A;  2HSP A;  3CEY A;  4A4H A;  2RQU A;  1UGQ B;  1S1N A;  3LGF A;  3CC7 A;  1BKB A;  2ZPF B;  1LVK A;  2BZY A;  3PNW C;  2FB7 A;  3I5S A;  2RHZ A;  1VIF A;  2ZZD A;  3CCJ Q;  3UA7 A;  1RI9 A;  2CZ7 B;  1N9R A;  3F70 A;  2FZC B;  3E2U A;  3DLM A;  4KUL A;  2DTO A;  3QYH B;  3TRE A;  4AFZ C;  1HXD A;  1YN8 A;  4RTV A;  3EGX A;  3JCM W;  3GF5 A;  2BE9 B;  4PLI A;  4A4F A;  1VQ8 T;  2K9G A;  1YIT A;  1ZUY A;  3CCV A;  1VQ8 A;  4L59 A;  1BU1 A;  4QW2 A;  5GJW B;  2GF7 A;  4M78 D;  4R56 A;  5LJ3 f;  3CC2 A;  1SHG A;  3D7S B;  2PUO B;  4J9D A;  1YJW Q;  2M0Y A;  1M90 U;  1G8X A;  1T0H A;  4J9E A;  1EIF A;  3LX7 A;  1WDX A;  1CKA A;  2X3X D;  1MMA A;  2JJ9 A;  2ABL A;  3BFM A;  2E12 A;  5DLO A;  2PVD B;  1X75 C;  3OYA A;  4MML A;  1PNJ A;  4II1 A;  1OU8 A;  4QKU A;  4PJO G;  1KQ1 A;  3MEV A;  2E6Z A;  4FIB A;  2CSI A;  2RMO A;  2DTH A;  4F7U F;  4C92 B;  1VQM A;  2YLB A;  1Y0M A;  1Z9Q A;  4CC7 A;  4C8Q B;  2F2X A;  1UJY A;  1KFZ A;  1R0B G;  1BB9 A;  1VQL Q;  1ABO A;  4RCB A;  4VUB A;  4C92 D;  3JCM e;  2XK0 A;  2J6F A;  3VS7 A;  1WXB A;  5EG2 A;  2HEQ A;  1VQM Q;  4LD9 K;  1WQ7 A;  2MCN A;  5HY6 A;  2EAY A;  3G7Z A;  4E6R A;  1OX8 A;  2DEQ A;  3V8K A;  2RI5 A;  1IRX A;  2D0N A;  5A2Q E;  4E7I A;  3CPW P;  4M7D E;  3MEW A;  4OMO A;  1F1B B;  3EG3 A;  1BI1 A;  4M78 G;  1MV0 B;  3RKY A;  1I07 A;  1I8F A;  1YJN Q;  4FYX B;  2CSQ A;  3I56 Q;  4PLL A;  4OP0 A;  2XID A;  1M4Z A;  3R6N A;  5GAN e;  4EPC A;  5GAN 2;  1BK2 A;  2KBT A;  3G6E A;  2Y4Y A;  3CMA Q;  1NPR A;  3CD6 A;  4FCY A;  3KFV A;  3GLX A;  1WHH A;  2DX1 A;  1V1C A;  3FIF A;  1M8M A;  1K4U S;  3NTK A;  1WXT A;  3I56 A;  1VQP Q;  1WLP B;  5LJ5 d;  1VQO Q;  2DK3 A;  2CGH A;  4J5Y A;  3LH0 A;  3O8V A;  2YDL A;  3OW2 A;  1O9S A;  3CXC S;  3H8Z A;  3M59 A;  1G3W A;  3CMA A;  4X9C A;  1KSW A;  2COY A;  3CBM A;  2ED0 A;  1G3S A;  4Z02 A;  1O75 A;  1QP3 A;  4BE1 A;  2RF0 A;  4QVD A;  2HBW A;  1KJW A;  3SDZ A;  1AD5 A;  2R5A A;  4OMF B;  2DLP A;  4JPB W;  2LQK A;  1N8R U;  1N27 A;  2LMJ A;  3QJ6 A;  3I5R A;  3BW1 A;  2JM9 A;  3H0I A;  2F2V A;  4FT4 A;  2LZ6 B;  2D8J A;  1JQQ A;  3J80 E;  2DYB A;  3A8M B;  3GIB A;  2CDT A;  1D3B A;  1X6O A;  1NJI R;  2HKQ B;  1QKW A;  1YWO A;  2JVV A;  2XI9 A;  4Y92 A;  1YCS B;  3LW5 E;  5KYX B;  2DEU A;  3JCM P;  4ZGJ B;  1PCX A;  3M56 A;  4OVA A;  1PRM C;  3HRU A;  3CPW S;  1B34 B;  2DBK A;  2A0F B;  2V8J A;  4BD3 A;  1QVG S;  3EH1 A;  5KE2 A;  5FU6 B;  3CCM Q;  1AWJ A;  5IT9 E;  1Y07 A;  3RUX A;  3EFR A;  2LX7 A;  4EDU A;  1M1F A;  4C92 A;  4IKF A;  1FMV A;  2KSS A;  4KH1 B;  1VQ6 Q;  1TUC A;  4KRT A;  4Z8A A;  4EMG A;  4J9F A;  4ZTF A;  3CCV Q;  2AZS A;  1WHK A;  4MDW A;  5GMK i;  4M78 C;  4CC3 A;  3OW2 S;  5CKB A;  1OQK A;  3CC2 Q;  1NYG A;  4C8Q C;  4IUP A;  3S3N A;  1LOJ A;  4RTT A;  4HCZ A;  2CT4 A;  1ZA1 B;  4P5N A;  1NEB A;  4C0F A;  2K5L A;  1WZO A;  2FPD A;  3CME A;  4M7A D;  3OSS C;  5FWC A;  1FX7 A;  2ED1 A;  1ZBJ A;  1CSK A;  2RPN A;  1TUG B;  2JT4 A;  3AT1 B;  1NG2 A;  2KNB B;  2RHU A;  3CQT A;  3HSB A;  3I55 Q;  2RQV A;  5LJ5 h;  1VQ9 A;  2MAM A;  2P4R A;  2J7I A;  2SEM A;  2G3R A;  2QG9 B;  2J06 A;  2YUO A;  1SF9 A;  2LCC A;  1IO6 A;  3QDF A;  5J3B A;  4MZT A;  2DFU A;  4XTX A;  2MYS A;  2NUP A;  1VQO A;  2AK5 A;  3PT9 A;  1EFN A;  3CCE Q;  4OML A;  3FEO A;  3HP9 A;  1GFD A;  3EFO B;  3GOX A;  1B07 A;  2P0Q A;  1SKU B;  1W1F A;  2QAS A;  1KC8 U;  5EC7 A;  1JXO A;  2QTV A;  3L2Q A;  1RL2 A;  3G71 A;  4AFS C;  3CPF A;  2K3X A;  1ZQ1 A;  2HMA A;  4JS4 A;  4E47 A;  3TQ7 P;  2CS7 A;  1RAH B;  5HCK A;  3ZBD A;  3FRN A;  1H3H A;  3X26 B;  5CKH A;  2FRY A;  3PVQ A;  5IN1 A;  2AKL A;  4OMP A;  1WQW A;  5CVI A;  4JJB A;  3C95 A;  3REB B;  1K8A U;  1ZBX A;  2HDA A;  1S72 A;  2YHT A;  3OW2 P;  2E6N A;  1QLY A;  1ZX6 A;  3CC7 T;  2LQ8 A;  3RMQ A;  4PFP A;  4XTZ A;  3QWX X;  4F04 B;  2DD5 A;  3JCM f;  4FW2 A;  5KYY A;  5L23 A;  3CCS T;  1R8O B;  2A36 A;  3CCS A;  1GCP A;  1Y7X A;  3HFN A;  3A98 A;  4C0Z A;  1NYF A;  1Y96 A;  4M78 F;  1WYX A;  1IHW A;  2A7Y A;  3E9G A;  4M4Z A;  4AT1 B;  1K8A C;  3DB3 A;  2I0N A;  4A4K A;  2DET A;  3CCU A;  4RUG A;  4A63 B;  1UJ0 A;  4X1V A;  3L42 A;  3CCU Q;  4M7A G;  5FU6 C;  1YIJ Q;  1IXD A;  3QZ5 B;  3OBW A;  3H0H A;  4M77 B;  4LUE A;  2CP0 A;  3M57 A;  3DLL A;  3QHS A;  1Q7Y U;  3OS1 A;  2EWN A;  2KE9 A;  3CBO A;  3H41 A;  3ME9 A;  3EHR A;  1MND A;  3FC3 A;  1M30 A;  3INZ A;  3SEM A;  4R0K A;  1YHQ T;  3ER0 A;  4XTV A;  1YHQ A;  3KBG A;  2FPE A;  3RBB B;  4FSS A;  4JZ3 A;  2L89 A;  5A0D A;  2ZPE B;  1WHJ A;  5CQX A;  2DXT A;  4PJO F;  3M0S A;  2L0A A;  5HK3 A;  1VQ5 Q;  2CZ0 B;  2OTJ A;  2X4W A;  3CME Q;  2OJ2 A;  2OTJ Q;  1NLP C;  2RH2 A;  3FJ5 A;  1OPK A;  1D09 B;  2C0I A;  2CP3 A;  2RM4 A;  4GLK A;  2RJC A;  2K2M A;  4C5I A;  3VS5 A;  3IQL A;  4J6X A;  1JJ2 S;  1KK7 A;  4X34 A;  2DVJ A;  2YWW A;  3MHX A;  1ZLM A;  3PTA A;  1VQ9 Q;  2KRO A;  1AHJ B;  1EZZ B;  2HQH A;  2IG0 A;  3H6Z A;  1ABQ A;  3G71 Q;  1DJ7 B;  1Y71 A;  3VU3 C;  2OTL A;  2SRC A;  3DKM A;  5I2S A;  2PVO B;  2X9H A;  2RD1 A;  1X01 A;  2RQT A;  3VS6 A;  4JDS A;  4Z88 A;  1SG5 A;  2XMF A;  1KQS S;  2J05 A;  2MMP A;  1I1J A;  4XTU A;  3LYI A;  3M0R A;  4WCI A;  4F7U B;  2P0P A;  1LJO A;  1YIJ T;  3PMT A;  1S72 T;  5GAN 8;  4LN2 A;  2VXF A;  2QQ9 A;  2LCL A;  3JCM g;  4ORZ A;  1JBM A;  4ZTJ A;  5GAM h;  2YUQ A;  4N0A A;  2WSF E;  3Q1J A;  3OS0 A;  2E3H A;  4DBF A;  4PJN A;  1QWF A;  2JN0 A;  4M77 G;  2YSQ A;  3M0P A;  2D0Q B;  3QXE B;  2COZ A;  1TXQ A;  3RKW A;  2VVK A;  4GBQ A;  3GNF B;  2JUF A;  1TTH B;  1JEG A;  3OYJ A;  1OPL A;  1M2V B;  3NTH A;  3NHN A;  5GMK j;  4PL6 A;  1VUB A;  2DZC A;  2RI2 A;  4QVZ A;  1VQ7 A;  2EQU A;  2LJ1 A;  2VKN A;  1Q81 U;  2RJF A;  3QWY A;  3X28 B;  2EYQ A;  1NE8 A;  5D7U A;  3HRS A;  3J81 E;  5FWB A;  3L2W A;  3HRT A;  1OI1 A;  1VQ6 A;  5KYN A;  1X69 A;  2CUD A;  1VQ4 T;  4EMK A;  1FWZ A;  4BDZ A;  2RHX A;  4V2S A;  4M77 E;  3LWI A;  1G83 A;  3OQ5 A;  2RJD A;  1U1T A;  1VQP A;  2LTO A;  1OU9 A;  3MO8 A;  4C8Q A;  3JCM c;  3CCM T;  2H3J A;  4BUG A;  2BUD A;  4PJO D;  2ZAE A;  2QDL A;  1E7O A;  2KMT A;  2HD0 A;  1RAC B;  1OUL A;  5GMK h;  1BCO A;  1NM7 A;  1M2V A;  4J6Y A;  2PVG B;  5IHI A;  4FSX A;  1YJN T;  4LDX A;  1SHF A;  1K9M R;  1K9A A;  3CCL A;  2M1H A;  5HKC A;  3V7C A;  3OYB A;  1Q82 R;  2A28 A;  3EGD A;  3OYF A;  2EFI A;  4WTO B;  4ZN1 A;  1U06 A;  3CCQ T;  4HXJ A;  4N0A C;  1UHF A;  5J26 A;  5GAM j;  1K8A R;  2LJ3 A;  3I56 T;  3OYC A;  3I55 T;  1YWP A;  4M75 B;  4MDX A;  1D0Z A;  1BBZ A;  1Q86 U;  1QVF P;  2KRS A;  2YRV A;  3OS2 A;  3A8H B;  3MP1 A;  3VRY A;  2GFU A;  2HSE B;  1W70 A;  1IGU A;  3VS1 A;  4CC2 A;  1VQN T;  2E3I A;  1K9M C;  1M1K U;  4D6W A;  1BYM A;  1VQ5 A;  5LJ3 j;  1UGR B;  3JRZ A;  4B6M A;  4JLI A;  2X4X A;  1RAF B;  2RHY A;  4E7S A;  1AVZ C;  4OB0 B;  4EIK A;  1JRI A;  2X4J A;  3EGD B;  2CH4 W;  8ATC B;  3MKD A;  4M7A E;  3TEE A;  3GP8 A;  2FZK B;  4RG8 A;  2RA2 A;  2EKH A;  2OTL Q;  1W2B S;  5KYU B;  2K6D A;  2RQW A;  4ATO A;  1RI0 A;  2HKN A;  2HCK A;  4F7U E;  1KQ2 A;  4C5H A;  3RKX A;  3GBQ A;  1AOJ A;  2RK1 A;  5I11 A;  1WI7 A;  2HQE A;  1PC0 A;  2HQX A;  2KRM A;  2AHJ B;  1D0X A;  2CKK A;  1VYU A;  2DF6 A;  2M02 A;  1V29 B;  1I5O B;  2KEA A;  5GAN 7;  2BKD N;  1QCN A;  3FDR A;  4LNP A;  4L5G A;  1C1A A;  2PTK A;  2DM1 A;  2E70 A;  3M58 A;  1LPL A;  1VQM T;  7AT1 B;  4M77 A;  1WXU A;  1UGP B;  1UE9 A;  3O5Z A;  4M77 C;  2CT3 A;  4ZGE B;  2EBP A;  2JS0 A;  2DAQ A;  5ECA A;  3CCV T;  1D1B A;  1M9S A;  2VAS A;  3I35 A;  4RMO A;  5LJ5 e;  1UFF A;  3QKJ A;  5KYU A;  3M0U A;  4BY6 B;  1J3T A;  3U23 A;  5D6X A;  4DBQ A;  1PHT A;  2IVW A;  3VV0 A;  1PRL C;  4HVW A;  5GAN d;  1KD1 C;  5GAO m;  4M7A F;  2KAF A;  2DO3 A;  5IH2 A;  2WAC A;  2XHC A;  4CI0 C;  5D6W A;  2D1X A;  4IIO A;  5CKD A;  5GAN 5;  1AT1 B;  3C4S A;  4J9H A;  2VC8 A;  3NPF A;  1ZSZ C;  2O31 A;  1GBR A;  4MMK A;  1TWB A;  4EMH A;  4M78 B;  3EG9 A;  5CCA A;  1SRL A;  3SWN A;  3JSC A;  2HZY A;  3EFS A;  5DY9 A;  4M7A C;  2H3E B;  4C8Q G;  1GL5 A;  4RCC A;  3HTR A;  4E2F B;  2LJ0 A;  1WHL A;  1RLQ C;  2JOY A;  4J9G A;  2LNV A;  3M0Q A;  3G71 T;  3CCE A;  3CCL Q;  2GGR A;  1MGQ A;  4PK4 A;  4LXC A;  3OYN A;  3C0C A;  2E41 A;  2GBQ A;  4FYW B;  4HKE A;  1QQJ A;  1UUE A;  1AZG B;  3LGL A;  5FU7 C;  1XTD A;  2DXU A;  1M90 C;  2K5I A;  2CZ1 B;  3V7S A;  4RTZ A;  1YJN A;  3TSZ A;  1IGQ A;  2HAX A;  1YI2 T;  1TUD A;  3G6E Q;  5KCH A;  1PWT A;  2XDB A;  1Y57 A;  3JAM E;  1VQL A;  4HT9 A;  1PM3 A;  4XU1 A;  1K76 A;  2KY9 A;  1M1G A;  1C6V X;  2ESW A;  1YJW T;  2LT4 A;  2ZPH B;  4LUD A;  2ZPB B;  3SWN B;  1I0C A;  2ENM A;  1HYO A;  4M7D G;  1BIA A;  4PJO B;  2ROL A;  3PE0 A;  1SSF A;  2LDM A;  2RB6 A;  1W4S A;  3V7R A;  1SSH A;  1ARK A;  3EHQ A;  4FU6 A;  3FB9 A;  2EYW A;  5FRO A;  3M54 A;  3EGU A;  5GAN g;  3WVE B;  2E10 A;  2Z0W A;  2CUB A;  2QQB A;  2FG0 A;  3BDL A;  2DNU A;  2DL5 A;  1W2B A;  1PD0 A;  3JB9 D;  5GAN h;  3OYG A;  1VIE A;  2ATC B;  1KHC A;  1Q82 U;  2DL4 A;  2JTF A;  4IUR A;  3RES A;  2KVQ G;  2OTL T;  1JU5 C;  1M1K C;  3ZL7 C;  1P92 A;  4Q5W A;  3EG2 A;  2VYT A;  3OA6 A;  5CK9 A;  3SFM A;  3JB9 F;  3ASK A;  2QXF A;  3JCM h;  4C5E A;  2XDP A;  3OYY A;  3ZEH A;  4C0D B;  1YI2 A;  1OZ2 A;  3MCA B;  1VQ8 Q;  4HVU A;  5C0M A;  1YI2 Q;  2YT6 A;  2CYZ B;  1AWX A;  4D8D A;  1FMK A;  2FPF A;  4XK8 E;  1MUZ A;  1KQS P;  1WJR A;  1W2B P;  2A08 A;  5LJ5 g;  3CPW A;  1YP5 A;  2PU9 B;  2L3R A;  1WPY A;  1VQ9 T;  2EJ9 A;  2K7A A;  2EYY A;  4AFU C;  1QVF S;  2EGC A;  1TOV A;  3S3O A;  3FLG A;  2F5K A;  1RAD B;  2WSE E;  3QPH A;  2NLU A;  2BTT A;  1QCO A;  5GAM e;  4PJO A;  2W10 A;  1Q86 C;  1RAI B;  3PMI A;  1Q7Y R;  4LE9 A;  2KGT A;  1AWO A;  1NLO C;  2CP6 A;  4JRI A;  4HCB A;  2DIL A;  1WFW A;  2L3P A;  2KYM A;  4EMK B;  3OYE A;  2CP2 A;  5DLQ E;  1KD1 U;  4WF2 A;  4F7U A;  3GPL A;  2L3Q A;  3LH5 A;  2MF2 A;  1UEC A;  4RTX A;  4A4E A;  4L6V 5;  4ESR A;  3OMG A;  4A54 A;  1GCQ C;  1Q95 G;  2OAU A;  2YXY A;  2VB6 A;  2H8H A;  4M7D B;  3MEA A;  5GAN f;  2C06 A;  3X25 B;  1QWE A;  3MEU A;  3X20 B;  1GXI E;  4AFQ C;  2RI3 A;  1NBE B;  1YIT T;  5IXF A;  5LJ3 d;  1XOV A;  4KBM B;  5M9O A;  2X4Y A;  3RMS A;  3JCM V;  2I2L A;  5FLX E;  6AT1 B;  2P84 A;  5IXB A;  2QDY B;  4DA4 A;  3M53 A;  2V8I A;  1X6G A;  3E19 A;  2DXC A;  2GQI A;  2XU8 A;  2F1L A;  1MV3 A;  4ZGD B;  2KI7 A;  4M75 F;  1K73 U;  4HVV A;  4M77 D;  1QVG A;  1MNE A;  4O5V A;  4A53 A;  4BI8 B;  5GAN 3;  2DIG A;  3VJP A;  3EAE A;  3T9N A;  3UT1 A;  3R6O A;  1VQP T;  1WGS A;  3V8L A;  2AKK A;  1FMW A;  4J9B A;  2FZG B;  4LDV A;  5HK0 A;  2GQV A;  4QVC A;  2ZCF B;  4E7Z A;  2DE0 X;  5KYX A;  1M2O A;  1ZHI A;  3OSV A;  2CP5 A;  4D8K A;  4IUQ A;  1KHI A;  1LNX A;  3L2R A;  1IZ6 A; 
#chains in the Genus database with same CATH homology
 1QKW A;  1YWO A;  3VRY A;  4Y92 A;  1YCS B;  1W70 A;  2KR3 A;  1UTI A;  2ECZ A;  3VS1 A;  2O9V A;  4CC2 A;  2FO0 A;  1PRM C;  2DA9 A;  1JXM A;  2DBK A;  2LQW A;  3JV3 A;  4JZ4 A;  1AWJ A;  3VS4 A;  1T3S A;  2FRW A;  1AVZ C;  2LX7 A;  1UG1 A;  2W0Z A;  4EIK A;  1M27 C;  2CH4 W;  1TUC A;  4KRT A;  4Z8A A;  2LCS A;  2DMO A;  4J9F A;  2AZS A;  2O9S A;  2EKH A;  1Z9Z A;  1AZE A;  2K6D A;  2RQW A;  4CC3 A;  2HCK A;  4AG2 C;  2GTO A;  1NYG A;  2FEI A;  2RNA A;  1WA7 A;  3GBQ A;  4AG1 C;  1AOJ A;  4RTT A;  5I11 A;  1WI7 A;  3UA6 A;  2EYZ A;  2KRM A;  2NWM A;  2CT4 A;  2V1Q A;  3NGP A;  1G2B A;  2VWF A;  1ZUK A;  2ROT A;  1NEB A;  1VYU A;  1E6H A;  2L3S A;  2DF6 A;  2FPD A;  5FWC A;  2KEA A;  2ED1 A;  1GRI A;  1ZBJ A;  3VS3 A;  1CSK A;  2RPN A;  2JT4 A;  1NG2 A;  2KNB B;  3CQT A;  4LNP A;  4J9I A;  3REA B;  2PTK A;  2RQV A;  1UGV A;  2DM1 A;  5FW9 A;  1K0S A;  2DRK A;  2P4R A;  4OMN A;  1WXU A;  1UE9 A;  2J7I A;  3O5Z A;  2CT3 A;  2EBP A;  2JS0 A;  2SEM A;  5ECA A;  1QKX A;  4IIM A;  1QCF A;  2BZX A;  2J06 A;  2DL7 A;  2K3B A;  2YUO A;  3I35 A;  1IO6 A;  3ULR B;  3M0T A;  1UFF A;  2NUZ A;  4GLM A;  2AK5 A;  3M0U A;  2KXC A;  1EFN A;  1J3T A;  3U23 A;  3H0F A;  4OML A;  1PHT A;  2A37 A;  2M51 A;  1GFD A;  1PRL C;  4HVW A;  2JS2 A;  1KIK A;  2X3W D;  1SEM A;  1B07 A;  2OI3 A;  4DEX A;  1U3O A;  1GCQ A;  1W1F A;  3TSW A;  1SPK A;  1W6X A;  5EC7 A;  1JXO A;  1M3A A;  4AFS C;  5IH2 A;  4OMQ A;  1RUW A;  2O2O A;  2D1X A;  4IIO A;  5HCK A;  4J9H A;  3NPF A;  2EVR A;  2O31 A;  1H3H A;  1VYV A;  1GBR A;  4DEY A;  1OV3 A;  2FRY A;  3PVQ A;  3PVL A;  1SRL A;  2AKL A;  4OMP A;  2JMC A;  4JJB A;  1AEY A;  5I22 A;  1GL5 A;  2EGA A;  4QT7 A;  2DL3 A;  2LJ0 A;  2MOX A;  3REB B;  4F14 A;  4RTU A;  1RLQ C;  2HDA A;  2JXB A;  4J9G A;  2PNI A;  1QLY A;  1ZX6 A;  1OOT A;  3M0Q A;  1WIE A;  2GGR A;  2DBM A;  2OAW A;  5IHK A;  1M3B A;  3QWX X;  3C0C A;  2GBQ A;  4OMM A;  1JO8 A;  1UUE A;  5L23 A;  1VYT A;  1AZG B;  2AZV A;  1H8K A;  2A36 A;  4RTZ A;  1GCP A;  2LP5 A;  3TSZ A;  1HD3 A;  3A98 A;  1NYF A;  1LCK A;  2LQN A;  1WYX A;  1TUD A;  2D8H A;  1PWT A;  4M4Z A;  4ZNX A;  1Y57 A;  2RN8 A;  2I0N A;  3EG1 A;  1K76 A;  2RQR A;  2EW3 A;  2KT1 A;  2ESW A;  5IHN A;  1M3C A;  4LUD A;  4RUG A;  4A63 B;  1UJ0 A;  4X1V A;  4RTY A;  1I0C A;  2ENM A;  2KXD A;  3EG0 A;  1ZSG A;  3SHW A;  2KRN A;  2ROL A;  3PE0 A;  2JTE A;  2DL8 A;  1ZUU A;  4CC4 B;  3H0H A;  2L2P A;  4LUE A;  3VRZ A;  3VS2 A;  2PZ1 A;  1E6G A;  2KE9 A;  1SSH A;  2CH4 A;  1ARK A;  3EHQ A;  2DRM A;  1WX6 A;  3H41 A;  1CKB A;  2J6K A;  3EHR A;  2EYW A;  1UHC A;  1M30 A;  1YNZ A;  3SEM A;  3EGU A;  4R0K A;  2J6O A;  4JJC A;  2CUB A;  2FG0 A;  2FPE A;  2DNU A;  2DL5 A;  4K11 A;  3TVT A;  2F2W A;  3RBB B;  4FSS A;  1K1Z A;  4JZ3 A;  1HJD A;  1GBQ A;  2E5K A;  1H92 A;  3RNJ A;  4Z89 A;  3UF4 A;  3M0S A;  2L0A A;  2DL4 A;  2OJ2 A;  2G6F X;  1NLP C;  1X6B A;  3FJ5 A;  1OPK A;  2C0I A;  1JU5 C;  1X43 A;  3ZL7 C;  1X2K A;  2HSP A;  2K2M A;  3EG2 A;  2KYB A;  2RQU A;  1S1N A;  3VS5 A;  3IQL A;  4F17 A;  2BZY A;  1GFC A;  2DVJ A;  3I5S A;  1ZLM A;  2GTJ A;  2KRO A;  3UA7 A;  1RI9 A;  1ABQ A;  2EQI A;  2SRC A;  4JJD A;  4HVU A;  2IIM A;  2YT6 A;  1AWX A;  2RQT A;  1N5Z A;  4AFZ C;  3VS6 A;  4D8D A;  1YN8 A;  1FMK A;  2FPF A;  4Z88 A;  1MUZ A;  4RTV A;  1RLP C;  2EYX A;  2XMF A;  2A08 A;  2J05 A;  1I1J A;  2K9G A;  3M0R A;  1ZUY A;  4WCI A;  1YP5 A;  2YUP A;  1BU1 A;  5GJW B;  1VA7 A;  4LN2 A;  1AWW A;  2YUN A;  1SHG A;  2K7A A;  2EYY A;  4AFU C;  4J9D A;  2EGC A;  2KT8 A;  2MIO A;  2M0Y A;  4ORZ A;  1TG0 A;  2EPD A;  1T0H A;  3NMZ C;  2YUQ A;  4J9E A;  2BTT A;  1WDX A;  1CKA A;  2X3X D;  1QWF A;  2W10 A;  4F16 A;  2C0T A;  2ABL A;  1PKS A;  3THK A;  2JMA A;  4LE9 A;  2CRE A;  2YSQ A;  1SRM A;  1PNJ A;  3M0P A;  2KGT A;  1AWO A;  1NLO C;  2DIL A;  1WFW A;  2L3P A;  2KYM A;  2O88 A;  3I9Q A;  2VVK A;  4GBQ A;  1OEB A;  2CSI A;  2RMO A;  2LNH B;  1JEG A;  2L3Q A;  1Y0M A;  3LH5 A;  1Z9Q A;  4CC7 A;  1UEC A;  4RTX A;  1T0J A;  1OPL A;  1T3L A;  2F2X A;  4HCK A;  3NHN A;  1B3Q A;  1UJY A;  4ESR A;  2GNC A;  1KFZ A;  1BB9 A;  1ABO A;  2LJ1 A;  1GCQ C;  5GJV B;  2VKN A;  3QWY A;  2J6F A;  3VS7 A;  2H8H A;  1WXB A;  2HEQ A;  1UDL A;  2MCN A;  5FWB A;  4E6R A;  2B86 A;  1QWE A;  1X69 A;  3VS0 A;  2D0N A;  4AFQ C;  2CUD A;  1FYN A;  4OMO A;  5IXF A;  1XOV A;  3UAT A;  3EG3 A;  2C0O A;  1MV0 B;  1G83 A;  1I07 A;  2DJQ A;  5IXB A;  2CSQ A;  3R6N A;  1NEG A;  1BK2 A;  2KBT A;  1U5S A;  1X6G A;  4RTW A;  2GQI A;  3KFV A;  2DX1 A;  1MV3 A;  2QDL A;  1X2Q A;  1E7O A;  1V1C A;  4HVV A;  1M8M A;  1NM7 A;  1K4U S;  1HSQ A;  1WXT A;  1WLP B;  2K79 A;  1X27 A;  2YDL A;  2V1R A;  5IHI A;  1KSW A;  1SHF A;  2EGE A;  1K9A A;  2ED0 A;  2AKK A;  4J9B A;  2RF0 A;  1PKT A;  2HBW A;  1KJW A;  1AD5 A;  2A28 A;  2DLP A;  4JPB W;  2BZ8 A;  4J9C A;  2LMJ A;  1U06 A;  4HXJ A;  1A0N B;  1UHF A;  2DE0 X;  3I5R A;  2JW4 A;  2LJ3 A;  2JM9 A;  2JM8 A;  3H0I A;  2F2V A;  2LZ6 B;  2D8J A;  1YWP A;  1JQQ A;  1K0X A;  2DYB A;  1BBZ A;  2CDT A;  4D8K A;  2KRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...