3I5XA

Structure of mss116p bound to ssrna and amp-pnp
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
509
structure length
509
Chain Sequence
SKLIHVPKEDNSKEVTLDSLLEEGVLDKEIHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLINTKFDSQYMVKAVIVAPTRDLALQIEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPNIVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKNSKSADNIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKFANSIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVRELEDAKNIVIAKQEKYEPSEEIKSEVLEAVTEEPEDISDIVISLISSYRSCIKEYRFSERRILPEIASTYGVLLNDPQLKIPVSRRFLDKLGLSRSPIGKAMFEIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Yeast DEAD box protein Mss116p reveals two wedges that crimp RNA
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
molecule keywords ATP-dependent RNA helicase MSS116
total genus 203
structure length 509
sequence length 509
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2009-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3i5xA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3i5xA02
3UANA 3KJGA 3IILA 4JBXA 3OEHA 3LWNA 1XPRA 1ELOA 2MSEB 1S3GA 1Z8FA 1GFIA 2J46A 2IYRA 4KAXA 3OE7D 4MGIR 5TV2A 4NKRA 2Q0HA 1ZM4A 3K0FA 1YVDA 1P9NA 5F9FA 2ZRGA 1KAGA 3EIQA 4LYFA 4BFWA 4KCGA 1QZXA 3WRXC 3EPKA 5EP1A 2HF9A 4AURA 2NMVA 4KLNA 1IONA 3CH4B 5LD2C 4KV9A 4YLGA 1XRJA 1OB2A 1HA3A 4GFDA 4D80A 1FP7A 2YKGA 3DKPA 2WWGA 1SVWA 1ZMXA 2GK7A 3BORA 2XITA 2FSFA 1IN4A 3QXSA 3NXSA 1QHNA 2ZVQX 5ANRB 2QI9C 2ZRFA 4CT4B 2PMDA 2OCAA 3LBNA 4NYIR 2ZITA 3KKMA 2W6JA 1G8HA 2KWIA 1DOAA 4O3MA 4PPFA 1BOFA 2FN4A 1VHLA 4KYUA 2GBLC 4MGZR 3GJ8A 4QRHA 1MABB 4A2WA 1HUQA 1VCIA 3RLFA 1NVVR 4BLOA 2WHXA 4N1AA 5CYOA 5AUQA 4GZMA 1NI3A 1FP6A 2QPTA 3NBFA 5AJVB 3VTKA 1JXMA 4HB4A 4WZBE 2GXQA 1G64A 3FFAA 2JGNA 4CEJB 3RYTC 3PUZA 1Z08A 1E2PA 3D6TB 1FQJA 1TAGA 3A1UA 3DZDA 2CHGA 4QGHA 1I4LD 2GJ8A 2ZE7A 3EG5A 4F91B 4NCHA 4YMTA 1S4QA 2FFBA 3QPUA 4BRUA 1M2OB 2WJGA 3IHLA 4F4CA 4K8OA 3ASYA 4UXIA 4W5JA 3IEVA 4OJKA 1N6PA 4A8JA 1P6XA 4MQBA 2QQEA 4ILEA 5AK0A 1NJFA 4URXR 1ZM3A 2RCNA 2CEAA 1DELA 1IY1A 4B34A 1OJLA 1R4AA 4NE2A 3B13B 1E0KA 4MKGA 1KKMA 3QEJA 1V5WA 2QEQA 2XSZD 3K0AB 3WP1B 1VECA 5BYJA 5L3SB 4XH9B 2NGRA 3FMOB 4PO9A 1N0UA 4RSGA 3SU8A 5G3ZA 4NCJA 3QKTA 2OG2A 3AF2A 4Q9JA 4IDQA 4AI6A 5DLQC 2FGJA 4JLVA 5HE9A 1OLOA 2CNWA 5K8LA 1XMIA 3A37A 2ZUCA 1LFDB 1SZPA 1F2UA 4C2UA 4JL5A 3C16C 1SULA 2FZLA 2XTZA 5KTYA 5DSZA 1K8RA 3TK1A 1ZINA 1P75A 3WNCA 3NEJA 4R2IA 1N6HA 4EPWA 4CEJA 4IRUB 2V6JA 4IVPA 2CE2X 4TMTA 2WJVA 4DLUA 4P0TA 1E2HA 3CF0A 1WDTA 3K9NA 4EQ6B 2DCUA 4FMBB 3U7FB 5F3WB 1MV5A 2JASA 3CPHA 1Q21A 4GDFA 2QQ0A 3T5DA 1E3MA 2WVJA 2IX3A 4C0BA 1BS1A 4CDGA 2E9SA 2HJGA 3I4LA 1PUIA 1JQLB 3FMIA 5HR5A 3KXIA 2VP6A 1DAKA 1RJ9A 1S2MA 3I72A 4TL7A 3DEFA 5D3QA 3OHMA 3TLXA 4DCNA 4HZIA 1OKKD 2ZAOA 1FMJA 2IT1A 3SOPA 2RGNA 1XDBA 4TWZA 2QM8A 1FX0B 2BJWA 2WICA 5B64A 3UG7A 2GJSA 2VF8A 4M0LA 4JIMA 1TF2A 4QGAA 3P20A 5G40A 4BLTA 4R2HA 4V0OA 1YZLA 2WBLC 3U7EB 1WQ1R 3HJNA 5D3MA 4IFBA 4ESHA 2HLDD 5H8WA 1ESMA 4LSGA 3BH7A 1C1YA 3A58B 3K0FB 5GADl 3Q7QA 2J1LA 4BFUA 2NO0A 4MKIA 4Q00A 2ZM5A 1UKVY 2YC2C 4D0GA 2I1VB 3CUEF 3RS7A 3A4NA 2ZJ5A 5AUNB 1SVOA 5H68A 4A0HA 4NU0A 3IBGA 3CWZA 3TW4A 2BKEA 2QBYB 4Q9LA 3ICEA 2O8BA 4AG5A 5DI9A 1KJZA 1UADA 3LO5A 2JATA 3EZ9A 3V4RA 2FU5C 4IEEA 2CJWB 5DH9A 2A2ZA 1TF7A 1VCNA 5JI2E 3ZLJA 5FUYA 1G7RA 4QHYA 3SQXA 3EIEA 3NIBA 2GEVA 4CZ2A 3U44B 1E2LA 1GITA 2Z4RA 1CULC 4KSBA 5FTNA 1HEIA 4UQOA 2P67A 3WHKA 4B3FX 1W0KA 4PO8A 1IJFA 3RWMB 2HYIC 2OHFA 3KTAA 3NC1C 3CWQA 4G5QA 4O2LA 1GIAA 4B6EA 1F2TB 4JLDA 5KUTA 3ZQJA 2O8EB 1NSFA 3JZAA 5HPYB 1C4OA 1P2UA 3EC1A 3EW9A 1E4YA 4O0MA 3KUCA 3UWKA 2XB4A 4ZO4A 1WA5A 5BXQC 5LB4A 3QUSA 2AK3A 5FUWA 4V03A 4E22A 3GJ7A 4ARZA 4DLRA 3HR8A 4LV8B 4TMWA 3GPLA 1U99A 1M1YE 1A2KC 1VTKA 1CLUA 4XWKA 3U44A 4PQFA 5F98A 1XTJA 3IO5A 1Z0KA 3PUXA 4E07A 1UEIA 3I62A 4DVGA 1Q22A 4PSVA 3RS2A 5KOYA 3HDTA 3OAAA 2QBYA 1G18A 3SYNA 3TKLA 1E2KA 2CLSA 4PC1A 4Q1BA 2YWFA 4DBLC 2XB2A 3U61B 3C4JA 1Q44A 3DPUA 2ZROA 1WE2A 3P1JA 1E2FA 4FCTA 1RRPA 4BLQA 3TUZC 2WWIA 3U60B 4LYAA 1GL9B 1DG1G 1UF9A 1DADA 4Q7JB 1JR3E 1KJYA 2OBMA 5D3MB 1E2IA 4EDHA 3K70B 4N0DA 1R2QA 2QT0A 4XWOA 3LNCA 2UZ3A 1T4GA 3R8FA 1WCV1 3AQ4A 3ZVNA 5GVRA 2IS4A 2RMKA 1E2GA 1ZUNB 3PENA 1UKEA 2FEOA 2W6JD 4GP6A 2REOA 4LBWA 3V00A 2OBLA 2PLRA 1KMHA 2GJAA 2OFXA 4B73A 1GKIA 1JR3D 1W5SA 3K09C 3G82C 3H86A 4LJ4A 3LBHA 3CIOA 3IKJA 2O8DA 4Q9HA 2DBYA 2UKDA 2BEKA 2H8KA 1RC8A 4RKEA 4IOLA 2FH5B 4BQSA 1OXTA 1E69A 1FW6A 2GAOA 2XEXA 1G5PA 1ZM9A 3I8XA 5EP4A 4IDPA 5TY0A 3IUYA 2XNDD 4HAUA 4WA7A 3ND8A 3WNDA 3AP1A 3BH6A 2D2EA 3C41J 3PEYA 4GMDA 1W36C 2WSSD 5FL7D 2CCKA 2XGJA 2BMDA 4OI0A 4UXHA 4I99A 4DZZA 3SHWA 3KJHA 1LY1A 4X8LA 3TUJC 4LRWA 5BWMA 3GLGE 1VCMA 1N6NA 4WIAA 4D25A 3EPHA 3VQTA 1E0AA 1JEEA 1ZNYA 2ZJBA 4B2PA 2CCGA 1X8LA 1KI2A 1N3BA 4PHTA 3WY9A 1YRAA 4Q1FA 4EKDA 3EAQA 3KB1A 1EWRA 3GJ5A 4XVRA 3U3MA 3I5YA 3THYA 3KL4A 4JMPA 4KU4A 2RGBA 2EW1A 1HY3A 1SGWA 2A5JA 2CVFA 4FXPA 1GILA 2GCPA 4TYQA 5DO9A 5CITA 5DYGA 5J47A 4NYIQ 3D8BA 4LYHA 3B8HA 1N0WA 2Z4SA 3SJAA 2QY9A 3NH9A 1EGAA 4PAMA 1LV7A 4LY6A 4FN5A 3TW8B 5IK2D 1NVVQ 2YINC 2FFAA 2LKDA 4Q7LA 3MMPA 3BC1A 2AD5A 4A8JB 2J7KA 2WMOB 4I1VA 1US8A 2WJIA 1AGPA 4R98A 3IIJA 3PUVA 4BFTA 3U4QB 4M21A 1US8B 2GBLA 2FG5A 2GKSA 2QU8A 1IXZA 1WBDA 1H8HD 2VH5R 2B8TA 4D4JA 1A2BA 2J0VA 3LBIA 4M9QA 4B3GA 2GHIA 3FDIA 4MYCA 3CNLA 4RCZA 4ZDWA 3ZIAD 4MRPA 5ELXA 2G3YA 2IK8A 3QVUA 2QZ4A 4B32A 1S0UA 1G6OA 1W0JD 2RHDA 4C9BA 3W5JA 2F9LA 3BFXA 1W4RA 4YMSA 3IHWA 4V0LA 4IDNA 2QPOA 4IFEA 4LUCA 2OCYC 2A3RA 3A1SA 3NWJA 1XEWY 1OKKA 2AR7A 3AVOA 2QPAA 3RSLA 2VSXA 3HR7A 4TSFA 1XXHA 1E94E 5TARA 4YMWA 3T61A 2J7PA 4MRSA 4JSTA 3SZRA 1U98A 2CBZA 2GILA 1FUUA 1XBTA 2WOJA 3TQCA 2R62A 4K46A 1K5DA 2QMHA 4JZKA 4ZCLA 3EASA 3Q9LA 2O0JA 2Q3MA 1DE0A 3AVQA 3VR4A 4DIEA 1S1CA 3RANA 2VPPA 3QG1A 3GEHA 4L4UA 1OHHA 3KB2A 1KO7A 1TQ6A 3KDSE 4V0ME 4YMUA 4A2PA 3LAWA 1HE1C 3EPLA 4TT3D 2VP2A 4IXMA 4HI0E 5FOWA 3CR7A 4EIWA 2P6RA 2V7QA 1G17A 2QT1A 3B1WA 2F3TA 2CK3A 4C0KA 4DWJA 4IVQA 4AIIA 1ZD9A 1Z6TA 3I1FA 4AKHA 1GWNA 2VHJA 2UVQA 3B85A 3FHCB 1AJEA 3LQRA 3SQWA 1ZU4A 4JYCA 5KHOC 4BPBA 3AVYA 3OIUA 4WXRA 3H0KA 2CMKA 3BS4A 4BLPA 2O8DB 2R6CA 3FVQA 3FGNA 3X2SA 4M1KA 1SKYB 1D9ZA 1R5OA 3I92A 1YZGA 2CLDX 2JCSA 4AD8A 1J8MF 2ZSBA 3ZD6A 1KMHB 1Z47A 3GJ4A 2IW3A 4GT1A 1W1WA 2FWRA 4PR0A 5JLJA 4Z1MA 2GCNA 3KXLA 3BERA 3U5ZB 1P2VA 1P9RA 2FEMA 2J41A 2MMGA 2WAYA 3OFNA 5JS8A 3P4XA 1NSTA 4Q1DA 3HWSA 3OIYA 1N6OA 3PIRA 4DCTA 2DFKB 5EQTA 1E9CA 1KI1A 2QP9X 4AG6A 3T1VA 1DAFA 1KZGB 4PQYA 3B60A 2ZPTX 3QKSA 5FOSA 4D4KA 4MA4A 1D2EA 2RAPA 4S2EA 1HT2E 1CJVC 3AP2A 1W44A 1FNNA 4US0R 1E2QA 3OAAD 1T5LA 4JVMA 5GVSA 3LY5A 1Z6XA 1R6BX 3TGPA 4LHYA 2RH5A 4ACBA 2OT3B 1YR9A 1UBEA 2GESA 1HTWA 4OK5A 1E96A 4RD0A 2P2LA 5M04A 3U3KA 4HAYA 3ZVRA 5BN3A 1CRQA 2IYVA 2FX3A 2ZRBA 1OYYA 3B7GA 4P32A 1XMJA 4A0RA 1VYUA 4NP6A 5FR1A 4GSYA 4US1R 3TH5A 5B30A 2GWHA 2X1VA 1TQ4A 4EFLA 4DLSA 4FIDA 4LJ5A 4PC7A 4A1FA 4DHEA 1CF4A 3ADDA 4LCBA 1M8PA 3KKQA 1GRQA 4K81B 1GOTA 2NPIA 3O8BA 4LV5B 5DE3A 3RS5A 2IYSA 5KNBA 1FTNA 1XTIA 3PR1A 1CR2A 1JR3A 1P62B 4FCWA 2GF9A 4OK6A 1ANKA 2D2FA 1DAGA 3AVPA 3BB3A 1G41A 1E2NA 2B8WA 2J0UA 1M7HA 4QBHA 4V02A 3SFZA 4P33A 1W36D 2EFCB 2EQBA 2OLKA 3MFYA 4GNKA 4QXAA 5J4LA 4ZCMA 3IPYA 1N5JA 1CJTC 3KZ1E 1T9HA 4LI0A 1ZD8A 4F38A 1D2NA 2TMKA 5EP2A 3QENA 1NMZA 4Q4AA 1OFIA 1QG4A 2Q3FA 4C7OA 2GEUA 2E1RA 1QF9A 3IPXA 3EWAA 4AWXA 2C2HA 1ZNXA 3EZ2A 1OXXK 3VX4A 3W6PA 3BOSA 1LVGA 2ASEA 2H17A 2R2AA 3FB4A 4GMXA 4B2LA 4DLXA 1QDEA 4TLCA 3X1DA 5C2JB 4XSHA 1GKYA 4F4IA 3SFVA 2IUTA 2A7QA 3ADCA 1P2SA 4G01B 1NLFA 2XOKD 3EZ6A 3GLFB 1M7GA 2V6IA 3QXXA 2PX3A 2QUZA 4DCVA 1ZUIA 2Z83A 2XSZA 1ZD1A 2QL6A 1G5RA 1XCPA 2HT1A 1TQ2A 3PJRA 1Q57A 1VIAA 4FMCB 4TYPA 4KXFB 1GP2A 1N5IA 1A82A 2BBWA 3DKVA 3RRMA 1QHIA 3WMGA 4M2LA 3DL0A 1OFUX 1FQKA 5JSZA 5C18A 1BMFA 1U9IA 2HV8A 4M4SA 1GSIA 1RRGA 2H92A 5FBRB 4JVLA 4L5BA 4UNRA 3QSYA 2ATXA 5IT5A 2ZRMA 4HUQB 3CRW1 3SE0A 4POAA 5J4HA 1N0VC 4Q4JB 1NF3A 1XD2A 4S35A 1E32A 3CW2A 4O2RA 5IK2A 4M1YA 1Z0FA 4TLBA 1NVXQ 2NOAA 1JBKA 4OK3A 4Q18A 3LA6A 3KQNA 3K70C 2QP3A 4LJAA 4TMXA 3TNFA 2EYUA 5LBIA 3UMRA 1ODFA 3ADKA 1VG8A 2IS6A 1II8A 1VMAA 2DY1A 1X8KA 2GJ9A 1II9A 4R7ZA 5KNCA 4BFSA 1KNQA 1RW4A 2ZE5A 1IN7A 4DT1B 1YJ5A 3AF0A 3HU3A 5GJVC 2JEOA 1F2UB 1AKYA 1TUIA 2VBCA 2WWFA 2BKUA 3KUDA 1UKYA 1QHSA 3OEHD 2DR3A 3U3OA 3PXGA 3NTUA 2Z6VA 2QAGB 4ESVA 1ETUA 5KPDA 1I4TD 1VIYA 1OYWA 4PPNA 2WWXA 721PA 4NCNA 2HXSA 3TR5A 4LJ8A 3VX3A 2KB0A 1R0ZA 2J3EA 2AHOA 1W36B 3K0AA 3OESA 2P6UA 1IJEA 1XMSA 2FSIA 1KDOA 1ZCBA 3L82B 4M53A 4CEHA 1ZNZA 1AS2A 4U02A 2VRWA 2QRZA 4H9GA 1R7RA 4M1TA 1NLZA 2C95A 1KGDA 821PA 1C9KA 3EARA 3PVSA 4WAUA 4BECA 1KIMA 4MKHA 2D3WA 3GEIA 4HB2A 3SYLA 3DM9B 4KVGA 621PA 2EFHB 2ATVA 3K8YA 2F43A 2ZSFA 1KK0A 2BM1A 3DOEA 1E1RD 4ZDIA 2R65A 2ZSDA 4J0QA 3NKVA 4GP7A 1NVWQ 3K1JA 1XCGB 5EJEA 4NYJQ 2C77A 2CHVA 3T1QA 4CT5A 3ADBA 1NN1A 3A6PC 4QKQA 4Q7MB 2JAQA 1TF5A 3VMFA 2F9MA 3AUYA 4TQ9A 4LJ6A 2NPFA 3FHOA 3HPRA 4DB2A 5JBQA 3RS4A 1G291 1GL7A 1TQDA 1MABA 1DARA 2JLZA 2DFLA 3FMFA 4IJMA 4TTPA 2PT5A 3GMTA 5HKKA 3IIKA 1SXJC 3EXAA 2W2TA 4QJ5A 5KDDA 4KITB 3QIAA 4MYUA 3ZZUA 3B1VA 2IA5A 4JS0A 2IYXA 4C2TA 2G1KA 1EFRA 1MO6A 4URZR 2BC9A 2OXRA 1T3SA 2R44A 5G3YA 1R5BA 5FBLB 2GXAA 2JLVA 3PCRB 3TSZA 2NIPA 2CDNA 1QHXA 2ZI9A 3DO6A 1QVAA 3K53A 3N2EA 3Q3JB 4NL4H 5FUXA 5J40A 4M1SA 1F6BA 2FZ4A 2IXFA 2KSQA 3RHFA 3SBDA 4LX0A 4BZPA 3RRNA 2VLIA 3W9YA 1AS0A 3I32A 4QJ3A 2WWYA 3NC0C 1NVUQ 3BBPA 2ZRKA 2NO7A 2ZRDA 2C98A 2OFWA 3F5FA 1F48A 3AKYA 4Q1CA 4UJ5A 5B2ZA 4MDFA 4U5XA 2FFHA 3C14C 4NH0A 3W3ZB 4OHXA 4PHGA 5LPNA 2ZXUA 4P4TA 1KI6B 3RDPA 2XJ4A 2IXGA 2F7SA 4QJ4A 3VKHA 4M9XA 5FPYA 5L3VA 5AR1A 2H1LA 1UJ2A 1PV4A 1IM2A 2D7CA 2YOHA 2HLDA 2ZE8A 3Q5EA 5KSOA 4TYYA 2XJ9A 2ODNA 3Q8XB 1AIPA 1II0A 3KFXA 1PUJA 5JECA 1U90A 4A8JC 3HU1A 4JBYA 4BFVA 2RGXA 2B7CA 2GZDA 5EE3A 4HATA 1SVKA 2IYTA 3CRVA 2YOFA 4HB3A 1OSNA 1BYUA 1G7CA 1NBMD 1DEKA 1AKEA 4L9WA 3WNBA 3QNUA 4URYR 2P3SA 2DYKA 1RZ3A 1GM5A 3VNVA 4B48A 3M6AA 2ZRPA 3WP0A 1EX7A 4PZZA 1E79A 2I3BA 4JLBA 3MWKA 2GVZC 1Z06A 5P21A 3WYGA 2W0SA 2WJJA 1Q1ZA 5F2EA 1W0KD 3AVWA 4YDSA 1IOZA 3HPQA 3X1WA 1TUEA 3T12A 3DHWC 4QGGA 4M1WA 5IHPA 2VTKA 5EUQB 3WMFA 1AZTA 1VYVA 1ZJ6A 5KSZA 1T8UA 4TMZA 1LB1B 1TU4A 1OXVA 2JIZA 1GVNB 1XX6A 3B78A 3K0CA 4YQFA 3K70D 5EE9A 5CIWA 1NNEA 1QBKC 2PEYA 3R9IA 2AK2A 4P3YA 1KSFX 2O5VA 3BD9A 3LW7A 4D82A 3OF5A 1S1MA 2JLQA 5J4KA 4M8NE 4Q4HA 2P65A 2ZUDA 4ZKDA 2ZJZA 3KQLA 2D7DA 4MGYR 4V0MA 4PZLA 1HH4A 3L0SA 3RRYA 1Z5ZA 4TMVA 4B33A 3A4LA 4B47A 4XD7D 5G53C 3GLHE 1E9AA 3M4YA 2XX3A 2QNRA 4YMVA 4JT2A 4MITA 3SJBA 4RVCA 3W8RA 2QSYA 3AM1A 2ZI5A 2ODBA 1I2DA 4NYJR 5FUVA 2AXNA 4DDVA 4AK9A 2FF7A 3LXRA 4FCVA 5K8TA 1S3SA 2FNAA 3TIFA 5FOUA 1Z28A 2CXXA 3QQ5A 4Q1AA 4RFSB 5TXGA 3DMNA 2EWVA 1J2JA 1P60A 1TX4B 2W0MA 3FHTA 1CKEA 3MSXA 3THWB 2H7VA 3AUXA 1H8HA 4LC1A 4OQLA 5FPKA 1Q1BA 1RIFA 4FMDB 3O8DA 3ZYCA 4PZYA 1RVDA 2VA8A 3U6KA 2KI5A 3HYRA 4KO8A 4L15A 4A82A 1TADA 1JB1A 2VHUA 4MRRA 2ZJOA 3SI7A 3I5XA 5LD2B 3FWYA 4LBYA 2XZLA 1HV8A 1ZCAA 2H57A 1RPZA 2ZJYA 3B1YA 4ASUD 1HQCA 4B3CA 1OH8A 1H8ED 2QTVB 2GEDA 4ERNA 2XAUA 2X77A 2XNDA 4A0FA 4TSFD 3AF3A 4DLVA 2NO1A 2QSZA 3L0OA 2P5TB 1U8ZA 3NHAA 4QG7A 4HZUA 1ZYUA 1A7JA 4BEBA 5L3RA 2ERXA 2A5DA 3NG1A 3QE0A 1YR8A 2F1JA 4HB0A 1MT0A 1KSHA 5BQ5A 5AUPB 4BLSA 3R8CA 2OBNA 4G3XA 1IN8A 1KYIA 2FE4A 3KXKA 4B6FA 3B2EA 1A1VA 2OE2A 1FUKA 4HAWA 1RRFA 4V0NA 4JJZA 5FOXA 4JLOA 2PX0A 4LHXA 2ZRJA 1OHHD 1UBFA 1AGRA 4IEIA 1COWD 5JHGB 4EJSC 3QF4B 2FDCA 4KFUA 2FMXA 4I1SA 4TT3A 4GL2A 3ZJYA 3QF4A 2ORWA 4QBIA 4WXPA 3KQKA 4NTZA 2BBTA 1G4AE 1DVRA 1R8SA 2WIBA 1E1RA 4W7SA 5FBQB 3MD0A 4HDCA 2JJ2D 5EE1A 1IY2A 2VF7A 1ZP6A 3PUWA 5DI3B 4BEJA 1LW7A 1G21E 5EE5B 2ZIAA 2IUSA 3CKLA 4B2IA 4Y0AA 1CTQA 1XEFA 4OQMA 2RGCA 5K8UA 1KO5A 4TZ6A 2QORA 4GOKA 4CVNA 3EPJA 3LW8A 1KDTA 4TYWA 2GZHA 1CXZA 3QKUA 2V9PA 3PV0A 2QROA 2QRNA 3CRMA 1TEXA 3QJYA 5FR2A 2C78A 1S9DA 2G0NA 2WKPA 1EXMA 4LBZA 1UBGA 1IXSB 4M1OA 4DEYA 4AYWA 3GLIA 4C0LA 1Z2CA 2H16A 2J5XA 2ZI7A 4PFSA 3NEYA 3PEWA 1MOZA 1N25A 1JQJC 1OH6A 5HKKD 2WSSA 3RVBA 3QEOA 4F92B 2OAP1 5A0FA 3NBZC 1EFRD 4DDUA 5B57C 3LVRE 2QENA 3E2IA 2C9CA 2LKCA 3ZIAA 2HYDA 5TB5A 2JLXA 4KFSA 2NZJA 5FTJA 2RHMA 3AH8A 4EAQA 2OFOA 1F60A 1W0JA 1TMKA 4XIGS 1Z63A 2GCOB 3R7WA 4OQFA 2ZRHA 1Z83A 4QHSA 4H1UA 2XXAA 1E0JA 5LB2A 1G5TA 2YC4C 4LPSA 3VR3A 1XPOA 2PLFA 4A92A 4OQNA 1CR0A 4UKDA 1SQ5A 2IEYA 2HT6A 1OIVA 2WV9A 1KSGA 2ODEA 2ZJAA 2ZJ2A 3WMEA 5JJIA 1XZPA 3IQWA 1PZNA 2ZR0A 5CYPA 3Q72A 4LOAA 4P31A 4IOMA 4G1UC 1T0JB 3GLFE 1AQYA 1W2GA 2J87A 2OESA 2AWOA 4DSOA 2EFEB 4F4JA 1KI8A 3P4YA 3QKRA 1DTSA 4Q4HB 1NKTA 2O0KA 5HCNA 3CZQA 3ECCA 1IAQA 1NG9A 3R9XA 2W2XA 3AKEA 1YKSA 4I4LA 3U3RA 2PEZA 4C0HA 1E0SA 4H1VA 2FPMA 2PJZA 5UKDA 1EFHA 4OBEA 2C8VA 5HZKA 1IBRA 1NG1A 4OHZA 1E98A 2KE5A 2QE7D 1D2MA 2JJ8A 4LJ9A 3AVTA 3GLIE 1P2TA 2CHQA 4UJ3A 3ZVMA 1ZIOA 1SKQA 2AKAB 4TLDA 2F1IA 1YU9A 1E9FA 4IXNA 5E4FA 3L2OB 1DO2A 4HAXA 4CGZA 3TE6A 5E7MA 3CB4A 1E99A 2A30A 1XFAA 3THXA 1Z22A 4RZ2A 3JVUA 1OPXA 3RS0A 2HCJB 1QHGA 1B23P 1G3IA 3X1YA 1GRNA 2CL7X 3AKDA 1AM4D 2BCGY 2Q6TA 2IYUA 2J7PD 1G3RA 2Z0MA 1U0LA 2QP4A 3DOFA 4BFZA 5FPHA 4HLDA 2A5FA 1CR4A 3MAAC 3NVAA 3T06B 3AGQA 2ZEJA 2YNMA 1UEJA 4U00A 1P3JA 3TAHA 1JEDA 3K9HA 5BN4A 1YR6A 3VHXA 1JPJA 5KNDA 2GETA 4US2R 1OXUA 1G19A 1YZQA 2VP4A 3LQQA 4C30A 1WF3A 3EZFA 4DCSA 2JLUA 4B43A 2G77B 2ZRIA 3CLVA 4LHWA 3AF1A 3W8NA 1XNJA 2BOVA 2IHBA 2G6BA 4KI0A 4PTLA 4KHZA 4C0QC 2QTHA 4N0EA 4M22A 2VO1A 4KVAA 4EPVA 3U6BA 2FPKA 1XTKA 1J70A 4NZYA 2OUKA 1BMFD 3QG5A 5E7IA 2WPDA 3BXZA 3DZ8A 3B9QA 2RGGA 3A36A 5FI1B 1P9WA 4TL6A 2EU8A 1Y63A 3WRYC 1I2MA 1EFCA 4A6PA 2Q3HA 5JWOA 2DWQA 1PLKA 4KBFA 2ECKA 3MUFA 2DWOA 3ZQ6A 1KY2A 2IYWA 1VKJA 2BDTA 1X3SA 2WWHA 2JDIA 3K0EA 2BV3A 4AKIA 1S8FA 4Z1MD 2BMFA 3EA5A 1TTTA 2YVUA 4OI2A 4UNQA 1E9BA 2QGZA 3NBXX 3AVUA 5B58C 5CJ2A 3HU2A 1KNXA 3AB3A 4OI1A 2BJVA 2R6FA 1ZC3A 3C7KA 4IOJA 4MRNA 3GLGA 1L2TA 2ANBA 4KJZA 1HT1E 3K09A 1K6MA 2N1BA 3VAAA 2ZRAA 1SVIA 4PAOA 2X2EA 3M0EA 1NN0A 1W5TA 3O47A 3W3AA 2DFTA 1KK2A 3X1XA 1E2EA 1XJ0A 2OILA 1X1SA 1AZSC 4BGDA 2IWHA 2W2VA 2RGEA 3AGPA 1E2DA 2AFHE 2UZIR 4YXWA 2WJYA 3HYTA 4ZKEA 2B7BA 3L43A 3CNNA 3KKOA 5JEDA 3K0SA 4LJ7A 1G6HA 4PHHA 1SHKA 2GJKA 3GD7A 1KO8A 4LYJA 4RD3A 3BRWD 1IHUA 3K9LA 5CIQA 4E5UA 4DCUA 3QVVA 1QG2A 1E9SA 3LLMA 5JHHB 1IN6A 1BIFA 4EJSA 1GRRA 3KKPA 5HCIA 2J9RA 4ZCIA 1CRPA 3LX5A 2WIAA 3RC3A 3VKGA 4TYNA 4LGMA 1IN5A 1JAIA 3A4MA 5DN6A 4YC7A 1N5KA 4OHWA 1U2RA 4HLCA 1G7TA 3CPJB 1AS3A 2F43B 4TMKA 2J59A 3MG9A 4PXAA 1W7AA 2Q9CA 2V8OA 3CH5A 2K5UA 4FINA 3L0IB 4EPTA 2MSCB 4AYTA 2VHCA 4BLRA 2ERYA 4Q48A 4AKGA 1WP9A 1U8YA 3I8SA 4II7A 1CR1A 1TL7C 2JJ2A 4P4SA 2D06A 3ZZ0A 2GK6A 1T91A 5FBVB 2GA8A 3P26A 3CRQA 3T5GA 3RC8A 2CL6X 2IYQA 3UXMA 4A36A 1MH1A 5F9HA 2PJRA 3GLHB 2JLWA 2O8FA 5C1BA 4Y0VA 1VG9B 1UDXA 3AVVA 4RD4A 3SR0A 1EG7A 5BYKA 1GNQA 2OCPA 3OZXA 1XU4A 2ZRNA 3H4MA 3CX7A 3GP8A 2JA1A 2YZ2A 1G16A 4L8GA 4URVR 2ZR9A 1L4UA 2QA5A 1Q0UA 2Q9AA 1SXJA 2FSGA 2RGAA 2LCFA 2ZSEA 2JJ1A 4PPQA 2P6NA 1SXJB 1XWIA 3TVTA 3REGA 3UATA 2VP9A 3C8UA 4B74A 1R8QA 3BB4A 1GNPA 1KY3A 2IYZA 3D3QA 2G83A 1NRJB 1UFQA 2O8CB 1YRBA 4Q21A 4RKFA 3SYKA 3MCAA 2ZE6A 3Q7PA 3SBEA 3E70C 4BFXA 4ZIRB 1T8TA 1W4AA 2ZREA 3MWYW 2YWHA 1Z0AA 2X2FA 5JMTA 3KJEA 4NCIA 1UPTA 4BZQA 2BIFA 3UPUA 4YONB 1TU3A 4P4SB 2OO7A 4G5GA 5TVKA 3BWDD 4OI4A 4ZV4A 5SZHB 2VSOA 4G5SA 4RZ3A 5C4GB 4DKXA 2ZYUX 4Q4JA 5A5GA 2W00A 4WW0A 3A1WA 1YZUA 4JL6A 4EPRA 1E1QA 3WYAA 4DB4A 4JVNA 1FZQA 5CK4A 2EYQA 4LZZA 4C0AC 1GUAA 3SDZA 4G0NA 4RJLA 2R6GA 4JLPA 1GNRA 4URWR 2PH1A 2RGNC 3GJ6A 4DEXA 2DWPA 4EFNA 4CEIB 1E6CA 2BVNA 3MJHA 3VHLB 3QI2A 1JI0A 3E1SA 3I3SR 4HAVA 3IIMA 4EJSB 4CW7A 2AKYA 2G1JA 5FTKA 4Z51A 1NBMA 4TN1A 2ONJA 2VYFA 3CF2A 4D6PA 2RGDA 1GTVA 4LV6A 4KSCA 1IQPA 1G20E 1ZAKA 3GLFA 3RRZA 1YQTA 1XXHE 3ZDQA 1DS6A 1KOFA 3NH6A 121PA 5CDFA 2GZAA 4B3BA 4PSAA 3CONA 5JJKA 5DYIA 3BH0A 4DDTA 2BEJA 4QBFA 4NYMQ 2F3RA 4MUAA 1J90A 4XOIA 4DUGD 2ZRLA 1UAAA 3GLGB 1M6NA 4LK2A 2VQSA 4PO1A 5J5CA 3W34A 1AA9A 1JXOA 3R20A 2FFQA 2QMEA 2XZPA 2P0EA 2ZS9A 4GZLA 1A5TA 3S1AB 1BO6A 5CLLA 2A9KA 1E2MA 1V43A 2H5EA 2AXPA 2EFGA 3H84A 4NYMR 5KDLA 3D31A 3K0CC 3VU9A 2JLRA 2IYYA 1XTSA 3KX2A 1R5NA 2QG6A 2SHKA 5G41A 5L3QA 4PQRA 3TR0A 3JVVA 5EXSA 3REFA 1KO4A 2YWEA 5AJXA 2IXEA 1G1MA 1GG2A 1I4DD 5CM9C 3RAPR 3I61A 4IOKA 1DBSA 4JBWA 1XEXA 5SZIA 2W83A 3QBTA 1CEEA 1JAHA 1Q12A 1ONBA 4TQUS 2CE7A 5CLQA 4Q7KA 4F7WA 2AN9A 1DAMA 4LWZA 1CU1A 1DAIA 1YZTA 1R0WA 3KKNA 5FI0B 4XVUA 1P7CA 2V55B 3LV8A 2Z5FA 1YZNA 4RCYA 1L8QA 2NZ8A 5FBWB 2FOLA 1GAJA 2B6HA 1KTVA 1D9XA 1T0HB 1CJMA 1G3QA 5EXTA 2IS1A 4OKSA 1Z6AA 1G8PA 5CK5A 3A1VA 3QKSB 2G9NA 2GRJA 1L4YA 1YR7A 2WSMA 5A4JA 3CRRA 4HLUA 3FPAA 1O87A 5FL3A 1G3UA 4HYYA 4JT4A 4Q47A 3SN6A 3PEVA 3THXB 5KU1A 1CP2A 1NLYA 1XEWX 1G7SA 1Z0IA 3BK7A 3B82A 4OJQA 4UNSA 3RS3A 4JKYA 2BBOA 1E79D 2WZQA 1CIPA 2GVDC 1NIPA 2NG1A 1QVRA 1XJCA 1JR6A 2RB4A 3BIFA 1G3MA 3OE7A 1NY6A 3T35A 3FKSD 1LS1A 2KBFA 1WRBA 2PBRA 4YXWD 3DMDA 5EXXA 2V4ZA 3LLUA 5FPTA 1XEXB 5KDOA 4AY2A 3JZMA 1SVSA 2FA9A 3CO5A 1JNYA 4I81A 4JL8A 4LHVA 5HZHA 3BE4A 1WXQA 4E09A 4N3NA 2YWGA 3BFKA 3QKRB 1MKYA 4OYHA 4WOPA 1KI6A 5L3QB 4GBMA 4A2QA 1KDPA 3AP3A 2W58A 3GJ3A 1KDRA 3IEUA 3VU9B 5DN6D 5EXPA 1Q3TA 1ZBDA 3ZZTA 2ONKA 1SVMA 4B3DA 4QC2A 4X8MA 1M34E 4KFRA 1KO1A 4D26A 3Q5DA 1JECA 3B1ZA 3S1AA 1F3OA 1FPMA 3UK6A 4Q1EA 3VR2A 4E03A 5EUMA 3N70A 1CJKC 4PSKA 2FJUA 5H70A 3OEED 5LDDC 3G0HA 3QXHA 3TAUA 2PCJA 2XXAB 1KSJA 1SVLA 1RYFA 1EK0A 5HE8A 4DSTA 4D81A 4JSYA 4XTCS 4ZI2A 2WKRA 1KI3A 2CNWD 2QN6A 4FW9A 4QM6A 1R10A 3N5CA 1DO0A 1RE0A 5EZ6B 2NQ2C 3TQFA 3VFDA 2EFDB 2JLSA 5K8IA 2ZANA 5FOTA 3RWOA 3IDQA 1DG3A 3BAFA 5DNYB 2DHRA 5JCZA 3QPWA 1BH2A 2ODWA 2PZGA 3L0PA 5AJWA 5E95A 5HTKA 5E3HA 2QAJA 1XTQA 4Q19A 3U7GA 1HURA 2QMUA 3VKWA 5JCPA 3FKQA 2E87A 1ESNA 1RYHA 2JIZD 1FMLA 3A1TA 4MYHA 3GLIB 4CEIA 1XTRA 2OSBA 2OEPA 2FGKA 3N2IA 3Q85A 5JJLA 3L8YA 1J8YF 4JYBA 4QNRA 2LWIA 4NONA 1VCOA 1XD9A 4IHQA 4P4UA 4W5WA 1W4BA 3M1IA 4WZ6A 4UNPA 3NDPA 3EWSA 1UBCA 4MDEA 4ASUA 2BCJQ 1AK2A 1H8EA 3WXMA 4QHTA 1OIWA 2X19A 4CEHB 5L8VA 3BFVA 1CBUA 3LRPA 1L7VC 4XD7A 4BUJA 2GF0A 4ZIRA 2PL3A 3GFTA 1NMXA 4TLEA 3AF4A 2V1UA 2O8CA 1Z6YA 2L0XA 1OV4A 5DHAA 4HSEA 1KMQA 3A8TA 1Q3HA 2OV2A 1COWA 5J4VA 2QM7A 1ZM2A 2GAAA 2QAGA 4LJYA 2QAGC 4KBGA 1MRNA 4CIDA 1NJGA 4L16A 1ZM7A 1E4VA 4HZUB 5KSYA 1NL3A 5JI3E 4DT1A 2PZFA 4ZDJA 3WHLA 3B6EA 4KFTA 2VSFA 4C0SA 2AWNA 4PX9A 4RFVA 4NMMA 2O8FB 3LVQE 3U7HB 3GLHA 4PC3A 4U7DA 2V54A 1LF5A 2YOGA 2F55A 4FWTA 1XZQA 421PA 1NN5A 4Q9KA 2ORVA 4DUGA 2BWJA 2OCBA 4DRZA 1OH5A 3TUIC 2OM2A 5KYKA 1LNZA 4NBSA 3IGFA 1OFTA 4Q5IA 1IY0A 2WAXA 2C03A 3THWA 2C99A 3CX8A 3RSOA 5KO2A 1XPUA 1N6RA 3LFUA 4BFYA 1OT3A 3ONWA 5GJCA 2BBSA 2HJVA 4D4MA 5JSZB 1EX6A 2GXSA 3O8RA 3W5IA 4A9AA 2ZUBA 3EIHA 2F1HA 4AYXA 1WB9A 1Z6GA 5JWRA 4HDOB 1W46A 4DLTA 3LXXA 1OIXA 1M7BA 5JFGA 2Z43A 5H1YA 4OHVA 2IHYA 1TNDA 4Q66C 4D0LB 5CB6A 4RZUA 3VR6A 2W6ID 1T3LA 3CBQA 4FWIB 221PA 1ZUHA 2R9VA 5GJWC 2VIIA 2D4HA 2ZI4A 3KQUA 2ZU6A 3G5UA 3PG5A 3BGWA 4JKIA 1MRSA 3KFVA 2C9OA 2FPLA 2HUPA 1Z07A 3EA0A 4IDOA 3SC3A 3UMSA 4QGFA 4EPXA 2OLJA 4UXJA 4BRWA 3CNOA 1RFLA 4CYMA 1N5LA 4BASA 4Q4AB 3V4FA 4EPYA 2MSDB 1YE8A 3B9PA 2H18A 3LDAA 4KLZA 4AKEA 4Q4LA 2J0SA 4HLQB 3SJZA 1P73A 3MLEA 3GJ0A 1NP6A 1XP8A 3QPVA 4IKEA 2NTYC 5JRJA 2HF8A 2YJTD 3GQBA 4IW3B 4RD2A 4RD6A 4GOJA 4M9SA 1YZKA 2CVHA 2PCLA 2ZETA 2J0UB 2PZEA 2A5YB 5JZVA 5JS7A 3PITA 2X8AA 2O0HA 6Q21A 3P27A 1WMSA 1SXJE 3FMPB 4LBVA 1Q1EA 4DSUA 1SKYE 1ZIPA 3MJRA 2WWWA 4L9SA 1KHTA 5DISB 2B92A 3I73A 4QM7A 1TEVA 2NO6A 3KTAB 4B75A 1WBBA 1J99A 1VDZA 4FD2A 3SHFA 3WYFA 3DM5A 1LS6A 4TZ0A 3TRFA 1DAHA 4M1MA 3OIVA 2F6RA 2ZYVX 1DAEA 3F0TA 3T15A 1NIJA 2ZS7A 1E9RA 2AX4A 1OXSC 1O3YA 2R8RA 3IBYA 2IF0A 3K9GA 3CF6R 4R71A 4DLWA 3UWOA 5JRZA 2BMJA 3T1TA 2WMNB 1HQYE 8OHMA 4LHZA 1P4SA 2C9YA 4G5RA 5EZ5A 1D6JA 2HEIA 1Q20A 4DJTA 1NN3A 1GZSA 4UNNA 1GDDA 2WPDD 3BB1A 2QE7A 4M9ZA 3E5HA 3SJCA 4XJXA 1NBME 1H65A 1OE0A 1ZW6A 4W5HA 4WBSA 2J45A 2B21A 5DGXA 2VEDA 4ZI3A 1ZNWA 3HP1A 4TLAA 3THOA 3SNHA 1KI4A 4A6XA 2IL1A 1MR3F 2WTUA 2GNOA 1FX0A 2IS2A 5GJBA 3NHBA 4DLYA 1E2JA 3FTQA 2JDID 2V3CC 1G4UR 3ICQB 4NCKA 3CPEA 4BZXA 3AEZA 1RJ9B 4B76A 2JJ1D 2I4IA 4JLMA 2ZYWX 1KKLA 1U81A 4Q9IA 1VG1A 3NBYC 4HUTA 1NMYA 1G8YA 5CDFE 1LF0A 4JJKA 2Q9BA 2VL7A 4I1UA 2IC5A 3W90A 1Z29A 3GFOA 2A5GA 3DVLA 2P5SA 2GXUA 3MWLA 5DIFA 4NDZA 5SZKB 4JLJA 3CM0A 5TMPA 1JJVA 1KI9A 1W4CA 4FMCF 3QBVA 4PAQA 3PQCA 4B3XA 4EQ6A 5AUOB 3F3YA 1P61B 3ZS9A 4FMDF 1F5NA 2Q21A 1G9XA 4QNMA 2GTPA 4AC9A 4W9MC 1XJQA 1FL9A 2PMKA 2QGNA 3NDBB 1MO4A 1D5CA 3UIEA 4TTRA 4BWYA 2ZVPX 3GCGA 1X6VA 1Z0DA 5BN5A 4ACAA 5TDHA 4CF7A 1CJUC 4JLAA 2BMEA 2WKQA 1Z0JA 3GFPA 1X8JA 2KJQA 2VHQA 3H1TA 4GI7A 4X8HA 2GCOA 3R7WB 1OFHA 4EFMA 1IXRC 1FFHA 1W49A 3CR8A 1RRCA 1XXHB 4IVRA 1OH7A 4HAZA 2C96A 4TQAA 2XTNA 1TPZA 3C5CA 4HEJA 4MKFA 3FOZA 2R6AA 3LH5A 5JWHA 4QBGB 5L3SA 3ZS8A 4URUR 2WJHA 1NY5A 2QTFA 2CCJA 2FSHA 4XWAA 3CZPA 2IYLD 3GJXC 2HCBA 3UKDA 1UDWA 3LX8A 1G8FA 5E7JA 3PUYA 3T34A 4TL9A 4DIDA 1W48A 1R0XA 3ETLA 1NKSA 1J7KA 2J0QA 2HXYA 5KPJA 4ZPXA 3V9PA 2ORIA 4DC9A 2VHTA 3ZGXA 3KQHA 1KK1A 1KZ7B 2EWWA 3U4QA 1KK3A 2ZI3A 1U0JA 4I1OA 4Z8XA 2ZS8A 3EZ7A 1ZRHA 3TVDA 4A0GA 2FV8A 1T6NA 4MYTA 5DI3A 3WBKA 3FE2A 4Q03A 3UG6A 1LTQA 3ND9A 3AV0B 4QOSA 2ZR7A 3B1XA 3AKCA 1FOEB 3EC2A 1II8B 3MRSA 4O25A 1KAOA 4Q02A 1S96A 2AD1A 3F8TA 4WVFA 3U3JA 4QFMA 2JLYA 2DB3A 4NPHA 1BKDR 3OFND 5FL7A 5FTMA 3BJIC 521PA 2G88A 3C15C 4TTQA 2PT7A 4DSNA 3X1ZA 2ZSAA 3RNLA 3THYB 2WM9B 3QF7A 3W6NA 2BHRA 4ITRC 4ON9A 3KJIA 4V0KA 1XD2B 4RD1A 3D7MA 4Z8YA 2Y8EA 2KBEA 5FPSA 2O52A 3L8ZA 1VYTA 1OB5A 3TSOA 3ZD7A 4HUQA 4D2IA 4HDQB 4MGKR 3H2YA 4GRAA 1D8TA 4OHYA 1X1RA 2V7QD 2CL0X 5C4MA 4DXAA 2W6IA 2CK3D 2YHSA 4DDWA 2YYZA 4ABYA 2IWRA 4R9UC 1XF9A 2ZTSA 4TL8A 1PJRA 4C0JA 2ZAMA 1ZVQA 3PFIA 5FH9A 4MH0R 1EWQA 4GPTA 1XB2A 4B71A 3AVXA 2REXB 2N46A 1KI7A 5KSPA 2IBMA 1AQUA 5FTLA 1MO3A 2ZRCA 2XTMA 1P5ZB 4B35A 1EFUA 1T5IA 1X86B 2VP5A 3TSWA 1Z3IX 4F93B 3TJZA 2ANCA 4GOXA 3FYHA 1YHNA 2XNSA 1A4RA 1T3HA 4IDHA 4PANA 4Z54A 5CM8B 2BM0A 1Q1QA 4OQXA 4A4DA 1BYIA 3GEEA 1M74A 1SXJD 2IEZA 3UMFA 3DDCA 2CLCX 3OIWA 4X8OA 4HLUC 1CS4C 4RFSA 2YV5A 3J81k 4WZAE 3P32A 1N6LA 3ZH9B 4A15A 4C7OB 3ZVLA 2G0TA 2C5LA 2WOOA 1U0HC 4PPGA 4EUNA 2EVWX 1VHTA 1VPLA 2C04A 2DPXA 3IQXA 2OXCA 3MGCA 5JEEA 1EESA 5CB8A 3VR5A 1XCMA 4LPKA 5IF9A 2ZI6A 4KODA 1JJ7A 3R9WA 4KYIB 3W6OA 2N42A 2XZOA 1GKUB 1ZC4A 1FTSA 2GDJA 5AJZA 3SS8A 3VNUA 3FKSA 3PEUA 5IRCD 4MUBA 2AFIE 1QHHA 5AJYA 3TMKA 4D4LA 1EFTA 2F1RA 1S9HA 4D0NA 1G8GA 3SEAA 2D62A 4LDJA 2VP0A 1E1QD 1GL6A 1DPFA 3O8CA 1E9DA 3C5HA 1N6KA 1QHYA 1SHZA 2RKOA 3TBKA 1N2CE 5EP3A 3U2QA 1U8AA 4CRWB 4C4PA 2QMOA 1N6IA 4NHOA 1HYQA 1RKBA 1UKZA 1VG0B 2A78A 4XTRA 5J4YA 1UM8A 4LC0A 3EX7C 5BW8A 1R0YA 3ASZA 5SZJA 5IDVA 3WBJA 4XVQA 4XSGA 1E9EA 2AL7A 4RZXA 1B0UA 4ARZB 4PC6A 4YDHB 4C3ZA 4RY2A 2IUUA 3OEEA 1Y3AA 1W47A 1U94A 1PLJA 4B44A 1U9IC 3IO3A 2ZU0C 4BE7B 5AWFC 4PHFA 1PLLA 3FFBA 3VR1A 3QOFA 3LD9A 2D74A 2OAQ1 2ZYTX 1XMVA 3B5JA 2O8EA 1MO5A 1QRAA 1W2HA 2DFNA 2IF2A 1F2TA 3RABA 3MWJA 1XD8A 3QY0A 1AN0A 4OL0A 1P72A 5DHFA 4JLKA 5EE0A 2V1XA 2MMCA 3QXJA 4JVSB 1QHHB 1JALA 2I1QA 1K5GA 2REBA 3T1OA 1FNMA 4ZDKA 4DLZA 5FOVA 2ZQ5A 4JLNA 5CJPA 4QL3A 1HE8B 1JPNA 5C46F 1PVOA 1Z2AA 2CJWA 2OZEA 2R6DA 4MRVA 5FFMA 3QXCA 2NO9A 4FI3C 1OW3B 2ZJ8A 1OF1A 2O8BB 2XOKA 4G5OA 4PC2A 1KJWA 3CX6A 4Q01A 1ZU5A 2HDNB
chains in the Genus database with same CATH superfamily
3DUFB 1BVRA 1PDOA 2Y76A 4HQ0A 2GBCA 3OEHA 5COBA 5ALFA 4EB6B 1KVSA 1DEAA 2G1PA 1S3GA 2I6SA 2L19A 3W7BA 2JGRA 1GFIA 2IYRA 1QX4A 2VJLA 5EQFA 4XDZA 2JCXA 3TOVA 1ZRMA 1KMCA 3MGKA 5DNUA 5KWEA 1P9NA 4I5FA 3WNQA 1U7HA 5F9FA 1KORA 4A7PA 4BFWA 1QGED 1T0IA 3DMYA 4PRLA 2AYZA 1QB7A 3A2LA 2QN2A 1E6MA 1QZXA 4J90A 3ZXSA 5HS6A 4BNVA 4CM4A 1JZTA 1GPBA 2DCMA 1KC1A 2BSAA 1GQ2A 1FRNA 2GZRA 4XPZA 3HJGA 5JNUA 1FBTA 4KG7A 1X77A 3W2IA 1U7UA 3FPJA 3O1HB 3CH4B 4N3CA 1SO8A 4YLGA 3KB8A 1HA3A 4PO3X 2EKBA 1U5AA 5LDGA 3HO6A 1P5HA 4Q82A 2CJFA 3BORA 2E89A 2BFDA 2IKQA 2FSFA 4H3KB 4CLDA 4CPDA 1AC5A 5CFLA 3NXSA 4ZYLA 3PWTA 3UUGA 2ZRFA 2WUVA 3EG9A 1BMTA 2PMDA 3A6GA 2OCAA 2AEEA 4KNVA 4NYIR 1ML4A 1ZUWA 1QP8A 1DOAA 4MULA 4N65A 2PMEA 1ORTA 3SBOA 2FN4A 4KVFA 5B37A 2EJBA 3LHKA 1VHLA 4A91A 2GBLC 4MGZR 4A2WA 3PXEA 1MABB 2P4QA 5CVVA 1VCIA 3KWJA 1QGYA 3A6KA 3M5CA 4BLOA 1MB3A 4D9JA 3B1KA 4RF4A 3ZY5A 3FWHA 4JNKA 4JJ8A 1R0CA 2QPTA 5AJVB 3THYB 4WZBE 2BW0A 3G6KA 3HSYA 2G8NA 3CNHA 1UZLA 1NF9A 5A5FA 2WDZA 3EVFA 3FFAA 3KVNA 1JIIA 2ZSJA 3W2GA 4CNBA 4O4IB 3ZGOA 1V6AA 1GDHA 2EG5A 2Z08A 3PUZA 4X6LA 3CGGA 3ETGA 2A67A 4J0FA 1QFZA 2B3TA 3D6TB 1FQJA 1DFGA 4ILKA 2B4KA 4QGHA 1JWAB 4KH1A 1ZCZA 3EVGA 2ZE7A 1YQDA 4UAGA 1RTKA 4NCHA 5E6UB 1IG0A 3BMNA 2FFBA 3PI6A 1M2OB 1QH1B 2P9ZA 4IMJB 1QMPA 3ASYA 4UXIA 4W5JA 4WX2B 4RMGA 3UJ9A 3ZTYA 4BJ3A 3U4CA 3VOSA 4MQBA 5FHQA 8ATCA 4XPIB 2CL5A 2RCNA 3HJTA 1A04A 1IY1A 3AU9A 3B1JA 1LVUA 5JAQA 1DL5A 1NTOA 2HRQA 3KV3O 1OJLA 4NE2A 1WZEA 4X9XA 5ERXA 5J63A 1PL7A 1ZH0A 3EIWA 4MKGA 3LDHA 4M99A 1LU9A 1AK9A 5KYWA 4HDKB 4PGMA 3V42A 4DXHA 2XSZD 3WP1B 4ZN6A 1X94A 1N5MA 2WTEA 1QDUA 2BKAA 3EXFB 3OX1A 4BYGA 3KYJB 1U3GA 2OAGA 3UH1A 2ZTLA 1T4BA 4U8GA 4XH9B 1RNLA 1FFSA 1YJ8A 1BG6A 3SU8A 5JVDA 2Q1SA 2XVXA 2ZTMA 3K20A 4LVOA 5G3ZA 3DZFA 2YWJA 1C81A 4Q9JA 4C87A 1DCKA 3FSJX 1J1ZA 2IVFA 3K5PA 4K88A 2FGJA 3FDJA 4IEFB 4LN1A 5DLQC 4JLVA 2PMBA 2ZUCA 1ZXBA 1SZPA 4PYKA 3EVZA 2EX1A 3C16C 4QBKA 4I5IA 3AY0A 3RSSA 4ZVTA 4J0EA 3WI7A 3IPLA 1ZINA 4K28A 1P75A 3WR5A 3PGXA 4JEMA 1EWYA 3LMKA 3NEJA 3LPMA 4XYBA 4UOZA 3D3EA 5KU7A 2XCSB 4CEJA 2V6JA 2PGAA 5FO1A 1S8OA 2X22A 4BQOA 4YJKA 1TTHA 2WJVA 4YEDA 4GMGA 2QIOA 3C8MA 2R7KA 3PTLA 3AFOA 3K9NA 1BWPA 2DCUA 3OLYA 4X54A 1MV5A 3QJ5A 4NNPA 2ZUVA 4RSRA 4GGOA 2YIVX 4JBIA 5ESXA 1E5VA 3N5KA 2WVJA 1G98A 2WB4A 4U7WA 4BYMA 2B35A 1BS1A 3I4LA 2HJGA 3DEAA 3FMIA 4BU0A 3KXIA 1DAKA 3NGMA 5BVHA 3I72A 4XLLA 1JSXA 1EE1A 3AO0B 1THZA 2NADA 3GGOA 1O6ZA 5ICFA 4P3NA 1JN0A 2ZAOA 4TWZA 2QM8A 2BJWA 3M4NA 1ZGHA 1EGHA 1V95A 3V97A 1PJLA 1FMCA 3AXSA 2PKEA 3UG7A 5ALUA 1E3DA 1Y5NA 3CT6A 4JIMA 1TF2A 3EGIA 4TXNA 2VJMB 2R84A 3F47A 4QTZA 1IY8A 1IZ8A 3NWBA 2GZ1A 4BNMA 4U8HA 2WBLC 2PPLA 4FFRA 3HJNA 1E6EA 1MTZA 1NXTA 4IFBA 1F12A 3DYVA 1SKBA 2JI7A 3KC2A 4X41A 2PMFA 3BREA 4CCSA 3BH7A 1C1YA 4ZI7F 4N54A 1YI0A 5J43A 1NBWB 5GADl 1SPBS 3IT0A 1VKZA 2NO0A 1ZK3A 3CMCO 1AKUA 2JI4A 3N0TA 4KOAA 4MV4A 4ODIA 5DDIP 1UKVY 4AJEA 4BNDB 4KPUA 5JQWA 2ZIUB 4KVZA 1B8OA 1OWPA 2I1VB 4GD3Q 4PIMA 3A4NA 3FPHA 4GQBA 3RS7A 4FB4A 4YBZA 4POOA 2X7HA 4BNWA 1EVIA 3JATA 4RDIA 1EVJA 4EY4A 3IBGA 3QUQA 3PUKA 3TW4A 3DWGA 4Q9LA 2O8BA 1ISSA 4GPIB 1YSCA 2GN4A 4K9QA 4AG5A 4BUCA 2JATA 3EZ9A 3CJQA 4UZEA 3DT8A 4RIFA 4FR2A 3K2IA 2F64A 4IEEA 1ATIA 3G0IA 2CJWB 3S2SA 4MR8A 2IKSA 1KFKB 3P2EA 1L5YA 3TEFA 5JI2E 1SUEA 3BJMA 1YS9A 2GEVA 3LDGA 3ZGYA 4CF4A 5C7OO 3REQA 1A8QA 5JPDA 4KSBA 5H3CA 4MP3A 5D5HA 4ZVKA 2DU8A 1GN8A 4N40A 2G72A 2CNBA 5BQOA 1WTCA 2HYIC 4J1SA 2WK1A 1DKUA 3HV0A 4QNNA 1WPGA 1IUPA 3QTBA 1QHFA 2Y1OA 3OOSA 3C7TA 4P7BA 1P2BA 4JLDA 2QN1A 5B2FA 3TLBA 1NSFA 2J07A 1RI2A 1W93A 2RHLA 5K8VA 2D4AA 5K5EA 3CB2A 3DDHA 5FQNA 2BGTA 3KSUA 3ZWBA 3EW9A 2WD9A 4ENRA 1JEYB 2OYSA 4GX2A 1H2BA 4YJ3A 3UWKA 4ZO4A 5BXQC 2ZTUA 1XU7A 3PUIA 2O1EA 5I4CA 5LQAA 3RT9A 3G9QA 1QGAA 4JI8B 5DHUA 4CU2A 1V35A 4DBVO 4PZ9A 1Y1LA 1G9TA 4FYJA 3SZOA 3L4EA 2CBGA 1BS2A 4ETIA 4IIEA 1WW3A 3WGKA 1XTJA 3BHIA 3FZGA 4RE5A 4RZIA 1XI2A 4C04A 4OXIA 5JLAA 1GUFA 1Q22A 5FWXA 2ZWAA 3ZHTA 5IJWA 1XPUA 3UH0A 2XBLA 3R0JA 3MELA 5IVPA 1QH9A 1V37A 1X87A 3HDTA 1LSOA 3KP1A 1G18A 4MB0A 4RQUA 1QCYA 3TKLA 2QBYA 3A3OA 2F48A 4Q1BA 4LE0A 3D02A 4UM9B 5L7YA 3QNWA 3CZMA 4PSCA 5LMNB 1I3KA 3Q8WA 4L6AA 4RDHA 3GF4A 3ZEAA 3DPUA 4JR1A 6REQA 2NO4A 2ZROA 1ZEMA 4FCTA 1G0OA 5AVVA 1I51A 1RWXA 1B1CA 3K30A 3LS2A 1ODKA 3ZIDA 2IIPA 1DRWA 3D6VA 3ZDCA 4U2EA 5K8JB 1NX9A 1WDKA 4Q7JB 3DAPA 4BMXA 4V38A 3C97A 1NPYA 1KAMA 3ACCA 3I5AA 3RI3A 2HWYA 1FYDA 3OIGA 5A03A 2IIQA 1C9YA 5IKOA 1U1GA 2BYTA 4NFHA 2XRYA 2YZKA 3W0LB 4EX6A 2X6QA 4M8LA 3FI0A 1WCV1 1WABA 2GBPA 3PENA 1ZUNB 4NR0A 4HNHA 2RHBA 4GP6A 4LBWA 3V00A 1MEOA 2PLRA 4MLDA 1DC8A 3KXDA 3U80A 2A6PA 5FKJA 1GHTA 1JR3D 4RA9A 1JLMA 1K66A 2HTFA 1U4NA 2F1OA 4JQOA 2DLDA 4FJ2A 4LJ4A 3CWCA 1MX1A 2IEBA 3DXXA 4XR9A 3IKJA 4DOMA 2XVMA 3M3HA 3FUXA 1P44A 2H8KA 1RC8A 5EIBC 4N03A 3V9AA 4RKEA 2IYAA 4CT5A 5JPCA 1JNXX 2FZGA 2UYCA 3VTAA 4D4IA 1G5PA 4D1YA 2AJBA 3FH0A 4Y6RA 5FYDA 4BX0A 5C9ZA 4OKIA 4CUKA 4FE7A 2IP4A 4PLGA 1SU6A 4HAUA 4KQMA 2A7XA 3EH1A 3A27A 3I3OA 1EKXA 3MWDA 2I6TA 4MWZA 1ZVVA 2CXNA 3IMFA 2BMDA 4JDPA 4WKGA 4DQVA 4K8RB 2FWNA 1VLMA 1P5RA 5DRYA 4F72A 3S99A 4H27A 1OQAA 4X8LA 4ZOEA 3C8DA 3PHBE 1C7IA 1VCMA 5G2OA 3T3HA 4HZGA 1QJCA 3P96A 3EPHA 1GY8A 3K5WA 3UAVA 3I5UA 1ZNYA 2GPAA 3IDZA 1NPDA 2A3NA 1SBIA 2CCGA 4KIFA 5FNZA 3PPIA 3TLYA 2WNIA 3TOCA 3ZHUA 4RPGA 1JXAA 1PSZA 2OD7A 2XUHA 3EGXA 3T1NA 3HRIA 3UMMA 3KB1A 3T3NA 6GPBA 3RV4A 3H5VA 2FP3A 2K7ZA 2DKOA 4IF4A 3AB8A 2OENG 2LTAA 4K9LA 5ED0A 5EVJA 4JMPA 5IT0A 3THYA 2VT2A 2RGBA 3LKZA 4FFWA 5FNVF 2QRMA 2A5JA 1LLUA 2ZRQA 4ND5A 5K0LA 4TYQA 1GAEO 2PNJA 5KYTA 5CT5A 5KTRA 5DYGA 1AXEA 3O90A 2ADFA 2HX1A 4G4IA 4W9NC 1L1QA 1N0WA 3O4JA 4V1CI 5IS2A 3SICE 3PFCA 3V1NA 3QE9Y 1PJSA 4HVTA 2P69A 2P9EA 1GFZA 3N05A 2QVBA 1LV7A 1KDYA 4LY6A 3GFQA 5AK3A 3KCNA 3OBIA 5GM2A 3AJRA 3O1LA 4HDSB 3TW8B 3UAXA 5IK2D 2YINC 1KH3A 5F78A 2WFMA 4JASB 5IARA 4Q7LA 4AZ0A 4XM0A 3BC1A 2AD5A 4A8JB 1Q7BA 2J7KA 4YRGA 1X7DA 2WMOB 4G97A 4I1VA 2WJIA 4ZZ3A 3HSKA 1H9BA 4U39A 3U4QB 3B36A 4M21A 3C3DA 2QU8A 2FG5A 2Z2KA 4X24A 1X92A 4FMPA 4MQLA 5FR1A 2IZ1A 1ECGA 1A2BA 2J0VA 4EW3A 1P8AA 1E63A 1O03A 1ZGBA 3FDIA 4MZXA 4MYCA 4B3GA 5AKYA 1EK6A 2JF0A 2G3YA 4NBLA 4CN8A 2AVNA 2QZ4A 3VPSA 1NXPA 1S0UA 2XB6A 2WUDA 3QELB 4C9BA 1UPFA 1PR5A 4CQMA 2QOEA 3DLHA 1Z5WA 1KYYA 5TGTA 4W5NA 2J9FA 1Y1SA 2JGDB 3KD2A 3OJWA 4R6WA 2QM0A 4PICA 1C29B 1BTOA 1HLDA 4YMSA 3SY8A 4V0LA 3C8HA 4IDNA 3WO0A 4C6TA 3O73A 5JNVA 3CKYA 1WLSA 1T5TA 3ZK9A 3W5CA 1Q77A 1UXKA 5C1IA 1XEWY 2RH9B 1A8PA 3AI2A 3AVOA 2CYCA 1AF7A 1O08A 3DFMA 3HR7A 5HBRA 3KYCA 4HWKA 1E94E 5TARA 3WV5A 4YMWA 2JRCA 2PJDA 1OAKA 2Z4TA 4JSTA 2GLTA 4KQKA 1RXIA 4XIYA 3ZLBA 5TT1A 5BN1A 4WSOA 3EB9A 1U98A 4PIPA 1E5QA 1OXKB 2O6LA 3V4SA 3KKZA 4UM9D 3TQCA 4IGEA 2IVZA 4K46A 1K5DA 2QMHA 5BN5B 3CPSA 4OFBA 4Z3KA 3W5DA 4FEAA 1SMKA 2FCRA 3NTOA 2JFHA 1MB9A 2Q3MA 1DE0A 1S2OA 2H9AA 2Z1NA 3FCEA 3LJKA 4OMFG 4REQA 1VXRA 2C2WA 4NHEA 5JNLA 2HMYB 2GKGA 5JSKA 1TQ6A 3KDSE 4YMUA 1X7ZB 3L77A 2VPIA 3LAWA 5CVCA 1HE1C 1TJPB 4FDTA 5DHSA 2QVGA 1LNSA 3VSCA 4D44A 3EPLA 4HI0E 5KYGA 2XKAA 2OK8A 1ZR4A 2OD9A 1OZFA 4HGOA 2VZ8A 4DWJA 4C0KA 1CZRA 1QFJA 4FX5A 3I1FA 3Q7EA 1GWNA 5JO0A 4RHUA 1A7KA 4OBWA 1TJ3A 2DVMA 4JYCA 3AR8A 4BPBA 3A6LA 5H81A 3GCDA 1HT0A 3RIGA 3ZHCA 3H0KA 2NUTB 4QSHA 4AB1A 3I6BA 4GBED 2ZAIA 4ML3A 2R6CA 3X2SA 4M1KA 1SKYB 4RMHA 4DC1A 4B5LA 4K9PA 6LDHA 3I92A 4HG2A 4N7MA 3IR7A 1QAOA 2CLDX 1KJQA 4FZJA 4AD8A 2VZEA 4H08A 4KWTA 3CVJA 1UDBA 1KMHB 5TEWA 5T64A 1O0CA 3ZBPA 4Y6OA 1I14A 2P2ZA 4PM4A 5FEMA 3SZMA 3HN6A 4HEHA 1WUYA 3KXLA 3U5ZB 3ZBTA 3B12A 1P2VA 4DV0B 5CG2A 5CDTA 4MIKA 2ID7A 4DA0A 5ITZB 3OQNA 3SLKA 2QN7A 1O7JA 3AOGA 3MRXA 1XWWA 3T4XA 4FILA 2AI2A 1N6OA 2FR8A 2R8ZA 3IJRA 4K2HA 1YL6A 3PP8A 2H1HA 1H22A 2VTEA 1ZN7A 4WKOA 4UTOA 5EJFA 3UW1A 3WBFA 1QRTA 2B94A 2HBYA 4BCDA 2HNBA 4GUDA 1Y7HA 2C9ZA 3PGVA 4AO7A 2AZMA 1KI1A 4LNUB 3T0FA 3KTOA 3T1VA 3OU2A 2DKFA 3HFRA 4FGZA 5CCBA 4RMJA 1RQXA 1LSUA 3OO0A 3R5FA 4MA4A 4E51A 3NEAA 4CLEA 1B3RA 2QTLA 4X1OA 3CLRC 4HS4A 3A1DA 1SK8A 4S2EA 1HT2E 4E2ZA 3AP2A 5HEKA 4US0R 3WWPA 2J6BA 1E2QA 4JOBA 1UM9A 4MP6A 4DR5B 1ABEA 1ZISA 2I6GA 2QNIA 4JVMA 1OI4A 3B52X 4CMCA 5A5VA 5GVSA 1R6BX 3LUDA 4YT4A 2GCEA 3F78A 3RVKA 4YV0A 3H6KA 4JGGA 3FOAA 1E92A 2YJ4A 4ACBA 5KJFA 2G17A 3QA3E 4HDNA 1MIOB 1E96A 1TOAA 2PSJA 3I2KA 3OC0A 4RD0A 5DHRA 3E3LA 3VR0A 1JDBC 1U3TA 4EB8A 1TD1A 3P7MA 1CRQA 2FRDA 3G49A 4L22A 2C94A 5LWQA 2CMGA 5LJIA 5IM5A 3MWGA 1X1EA 4KZKA 1JLSA 3BDIA 2GWHA 2X1VA 4PTZA 3T9BA 3L93A 3OT1A 5AKXA 5TQJA 1M8PA 1X7GA 1Q83A 2PFSA 2X76A 4GGPA 4Y2QA 1GRQA 3FM9A 4K81B 1QO7A 3GH3A 4JNCA 3H4TA 3PT9A 2PIAA 2IYSA 3ON5A 4FJ1A 5KNBA 1E3SA 1CR2A 1S2IA 5CH3A 1YTUA 5A2GA 1KH2A 5BSMA 3S2FA 3IAFA 4J2HA 1ANKA 1ZY2A 4QBHA 3S68A 3MAGA 1DKQA 3SFZA 3KR2A 3WVNA 2EQBA 4UBNA 1B4DA 3V4LA 2ZIFA 1HYBA 4MWOA 4HBGA 3VYSB 3LQYA 2JIQA 4ZCMA 1N5JA 1X19A 3ZCTA 2HIAA 5FJJA 1CETA 5LKRA 3EEOA 3GT3A 3W04A 2C3OA 3TZEA 1GT91 2JFWA 5DP2A 5EP2A 3QENA 1NMZA 1YBVA 3AK4A 4FBMA 5AHWA 3O8NA 2E1RA 1QTRA 1QF9A 2MT9A 3AR6A 3BCSA 3IPXA 4H4CA 2LCQA 3EVDA 3HADA 3EWAA 3OLXA 1T8PA 1R3DA 1JUDA 2NZXA 3VX4A 1B8UA 2X6TA 3FB4A 4AWXA 2H17A 4GMXA 4QAJA 4L6CA 1JDJA 1HRDA 4B2LA 4G67A 1QOQB 4IDDA 4XSHA 4AF6A 4DQDA 3SFVA 3PQEA 1JTFA 4DIKA 2GQ0A 1P2SA 4CL3A 2EZ9A 1M7GA 2V6IA 1U63A 4L4YA 2QUZA 1PYDA 3ICPA 4KQEA 4AY5A 4Z86A 3SZLA 2FWMX 1KBQA 4N5NA 1P0CA 4LSMA 1G5RA 5JZSA 4TSRA 1Q57A 3GDOA 4OAPA 1XNQB 1C7JA 3L02A 4FMCB 4ND4A 4TYPA 3H0EA 1KZ1A 1GP2A 1QE3A 2JFVA 2JFGA 2QLBA 1M72A 3DKVA 4CFYA 3JYPA 1LDGA 2CZQA 3DL0A 3TRDA 4C20A 3C6YA 4EJFA 3ZEIA 2QZSA 3RBXA 1GSIA 5E9QA 4JVLA 1U2DA 2A33A 3OQIA 2PL9A 4HUQB 3D7KA 4M1QA 2CFIA 3GMIA 3D8TA 3IESA 4Q4JB 5ERYA 1PHRA 1XD2A 2WU3A 3QNMA 1WPRA 2PH3A 3PNBA 3Q3HA 2XGGA 4O2RA 5IK2A 3TM4A 4RJIA 2LCIA 4MARA 4CM1A 2JHGA 2BRUC 4TLBA 1U9ZA 4MYDA 2M6LA 2IYFA 4RLFA 4LJAA 1Y1KE 3UXYA 4LF7B 1U7WA 1VG8A 1N7IA 1YK0A 4HSGA 3H9JA 4BN5A 1TVEA 1II8A 4M86A 1TLFA 5EFZA 2GJ9A 1FFWA 1OLUB 1X8KA 1II9A 4WECA 3EPPA 5F1OA 5GWXA 4BFSA 1KNQA 3QLVC 4JEHA 3JD1A 3BUSA 2JIBA 2EATA 4MDYA 4MQ5A 4R9RA 5K1ZA 4AS2A 2E6UX 1JL3A 1OUMA 2VBCA 4EUHA 1TYZA 3BIOA 4F3TA 3OPNA 3TOZA 1QHSA 3ZWNA 3OEHD 3JZIA 1ZX1A 1SQFA 4OXXA 5CFNA 3ZVKA 3NTUA 4QU8A 2H4FA 4CL2A 2V7VA 1A9QA 3QBEA 2OGWA 3OQBA 1OYWA 3PFHA 2HJ9A 5CA0B 5K0CA 1JIQA 4QJIA 1XTBA 2JHPA 1YR1A 721PA 1O57A 3FIJA 3TS1A 2XDAA 2R8YA 1AUXA 3WGTA 4NCNA 4N6NA 3T5BA 4Q93A 3WNZA 2PR7A 4BJ6A 2J3EA 3ZE7A 4WOKA 2ZVJA 4OH7A 4MI9A 1AURA 3H5AA 3K0AA 1Z2NX 3Q12A 4RHFA 4RLSA 2P6UA 3BD8A 4CL8A 1MN6A 1IJEA 2FQWA 4C7BA 1N8SA 2QRUA 2AEJA 4DIBA 3RADC 2IH5A 1REQA 2BTOA 3BE6A 4BTEA 1PRYA 2EW8A 1H9AA 4KXYA 4URHA 1FS4A 4UBKA 1QP4A 1KR2A 1QO0D 1SUSA 1FUYB 5SICE 3BXHA 3JWEA 3Q7SA 1L1EA 4WAUA 4BECA 4EGFA 5CDYA 2D3WA 1WDMA 5IFKA 4O4JF 3R6WA 2FEKA 3KYIB 1G21B 2EFHB 5CJJA 3K8YA 4AJOA 1KAQA 3EXG1 4MKXA 4X00A 3RTGA 2XY4A 3JWIA 5A3SA 4J0QA 1ZH4A 4G8JA 5C7YA 3K1JA 4J0DA 3SMQA 4C7KA 4NYJQ 2C77A 2AR0A 3I0NA 3QX9A 4LXGA 1T3TA 3HKDB 3W4JA 1Q6ZA 4WPGA 3AOEC 4EFKA 4QKQA 3A6PC 3N0XA 4RVFA 5ULLA 1MP0A 3DNPA 2JAQA 5HZGA 4RTSA 2PKWA 2F9MA 2H48A 1CUCA 2LP4Y 1SCKA 1G55A 4Z0NA 5HF5A 4A16A 3KWFA 4ZJYA 2ZXFA 2BZSA 3ITNA 3JQGA 1GV0A 2OHXA 5NULA 3R5TA 2GM5A 4LTDA 3R74A 2VXYA 3F5MA 1DARA 2IPNA 4DR2B 4J94A 1B42A 2DFLA 2C3MA 4U3JB 3QE4A 3QEBZ 1QYXA 1EFPB 4LOJA 2GN1A 3SEFA 4RTJA 3FNIA 4QJ5A 1FJHA 4EECA 1JHUA 1XZEA 3QIAA 1KC3A 1BCSA 1GGVA 3OQHA 4JS0A 4NV1A 2FZKA 4R8KA 5F12A 1EFRA 1MO6A 5F3RA 3DBIA 5ER9A 4LK3A 2IV3A 2MR5A 2OXRA 1T3SA 2PQMA 2VCYA 5G3YA 3ZU4A 4DMCA 5FBLB 2IYNA 1CUJA 3EBOA 4RMNA 2ZI9A 4Y6GB 5FUXA 1QVAA 2OGZA 2GD6A 4PINA 2DQSA 1F6BA 3I6QA 1LEHA 1DX6A 3W2FA 1JMVA 4E46A 4X7PA 3ICCA 4YP5A 2IOYA 3LL4A 3D1VA 3SWWA 3ZE0B 3EYAA 2AUTA 2JB9A 3F7NA 4UE2A 2V7PA 3H2JA 3IB3A 3NC0C 1M1YA 3I37X 1NA5A 3HG7A 3DDZX 2HO4A 1I6WA 3R5JA 3MQ2A 1IB6A 3GY0A 4FKBA 2ZUEA 1EAMA 4KO4S 4MDFA 1Z0ZA 3DNMA 1E3IA 3C14C 3DV0B 4LZLA 1V48A 3AFIA 3CLUD 4PHGA 4I6EA 1O58A 4LOIA 1Q7TA 4OB7A 4P4TA 3M5DA 2XJ4A 3TYXA 2IXGA 4F0JA 2VJKA 1X42A 5FPYA 3F49S 3GUZA 1E1KA 3N58A 5DHTA 5FP0A 5JDIC 5JXWA 3ROFA 1OA1A 2A9FA 1BGWA 5CURA 1IM2A 2YOHA 5KSOA 2HLDA 2I76A 1JSLA 4RTKA 1GPDG 2ODNA 2QVCA 3CS3A 3P5SA 3Q8XB 4F4DA 4KWHA 2IE0A 3F3MA 5AI6A 5HIIA 3L1HA 5JQGA 1GGMA 2FWIA 3NTXA 4A8JC 1FFDA 2FK8A 3HU1A 4MB6A 3V1TC 5BV0A 3HBNA 2B7CA 3UB3A 2GZDA 2JCBA 3BMQB 2FRVA 4ARAA 1U7PA 1LZLA 1QKJA 1YDHA 1YQUA 2X3UA 1ISRA 1ZMTA 2JAUA 3BMXA 3WNBA 1G38A 1H4TA 3ED5A 1CUFA 2P3SA 3D6UA 5I9MA 4R5HA 4B48A 2OQIA 1R9GA 3ABSB 5KNBD 1K63A 5BOVA 1XTTA 3ENNA 3VPGA 4B4KA 5A6SB 1MJHA 2P4EA 4KX3A 1E79A 4MEBA 13PKA 2YICA 1NQAO 1Z4JA 3ROEA 3W8EA 4LZPA 1O95C 2GVZC 3ER8A 1GQOA 5I45A 4J2TA 1VRCA 5KNDH 4Z4FA 5ARDA 1SKMA 5DM70 1IOZA 3WLOA 3PE6A 2HIGA 4RQBA 3NETA 3CVVA 4Y6SA 3HCFA 4FEEA 3WWYA 5DASA 4EARA 1TUEA 3AERA 3T12A 5HOEA 1J20A 2G9ZA 1M3SA 4QGGA 3UB4A 3WMFA 1YE3A 3BGVA 5BMVB 1AZTA 1VYVA 1JYSA 2ONZA 2ZWVA 1C7ZA 4FN4A 3TTXA 1CRLA 3A9SA 4XD2A 3FSRA 1T2FA 2VPTA 1T8UA 3FYCA 4BBPA 1E60A 5J2TB 1LB1B 3UCXA 2DSTA 1SJ9A 1GVNB 2X15A 3GAZA 2OZVA 3GROA 3GZNA 4LE2A 4MINA 2PS3A 5EE9A 3ZCSA 4WUVA 4CM9D 1K2WA 1THGA 5KYYA 3H65A 2FP4B 4GPBA 4L28A 2PEYA 3R9IA 3NASA 3V7UA 1QG6A 1V3UA 3TLKA 1BMQA 3ETCA 1PW7A 1KSFX 2JH9A 4ZEVA 3CKKA 4JR0A 1UDRA 3C45A 4R8RA 4WCFB 2P8SA 4WNYA 3FKJA 3OF5A 3IAAA 4PS0A 4QEZA 1LC0A 1UJBA 4BX8A 4II2A 2A0KA 2V7UA 3GGGA 3ZDYB 4CF6A 5I9TA 1RWPA 1D2GA 4MJXA 2ZJZA 1KIAA 4ZKDA 2G06A 1NUPA 3DL4A 3HU5A 1HH4A 2ZP1A 5BWOA 3JU3A 1PX2A 4TMVA 2IJGX 3OM0A 2II6A 5DPMA 2ZIWB 2IYPA 2OD2A 4BATA 4BNTA 3PX7A 4BV8A 2HW8A 1IOVA 1TA9A 2XX3A 3M4YA 4YMVA 2PKQO 4EZEA 3N8HA 3N2LA 2QR5A 1LX6A 3W8RA 2H0RA 2ZI5A 3TG8A 2W6MA 4N5IX 4DDVA 2QKYA 2FF7A 2H2GA 4XX0A 4TVSA 3VNQA 3QBDA 1PJAA 1Q84A 1Z28A 5ILOA 3QQ5A 4PG8A 3NFYA 3DMNA 5GONA 2NTNA 3E8MA 1X2EA 3LP6A 4OGWA 1V7PC 3EZXA 3RT7A 4YJ2A 3HXLA 2C7RA 1H8HA 2WYUA 1R1DA 1HZJA 5LZ7A 2JGKA 3OZRA 1RIFA 5F1YA 2A94A 3IPRA 4NU5A 2ZB4A 5C7LO 3PXUA 4J75A 1NVBA 3ZYCA 2PX4A 4PZYA 2VA8A 3RC1A 3PE3A 4R8LA 5IAEA 3U6KA 2XZTA 2KI5A 4L15A 1FVXA 1P0IA 3L7CA 3DBHB 3LUPA 1TADA 5DVZA 3IOBA 3WLNA 4DADA 1SOAA 4IX9A 5BOSA 3U7IA 5KNBH 1YOBA 4PN7A 1PWXA 4H1TA 4C78A 5BPHA 1GTG1 2XZLA 1ESCA 4D46A 2BEUB 3DF9A 3MCVA 4M8SA 1RPZA 2C4TA 2ZJYA 3PNSA 1WXEA 3QVTA 4GYKA 4OXQA 3V7NA 5BWNA 5L6MB 4YRSA 3T5AA 2PNFA 4ERNA 2GEKA 3T3IA 4KQIA 2X77A 4CI9A 2RGUA 2QZJA 3C43A 4M55A 4M37A 1G8AA 2FRDC 3AF3A 4TSFD 5CH5A 1NC3A 5LYJA 4DLVA 5LDHA 5LLTA 3L0OA 1U8ZA 1EIWA 1SURA 1A7JA 3SVZA 3Q41A 4BEBA 3H5WA 3B6ZA 5L3RA 2FMIA 5SY6A 2ERXA 2X8JB 4UM5A 3C48A 1LSSA 3GT0A 5B3AA 5KVCA 4CQLB 1PR6A 2F1JA 1K3TA 4YLYA 3MN1A 1KSHA 5AKGA 2AEMA 1J22A 4DR6B 2WHEA 4G3XA 1IN8A 2G0AA 3KXKA 4B6FA 1A1VA 5ENDA 3PFWO 2FOIA 2WF8A 3UC9A 4B4UA 4KHPB 1RHMA 2PVSA 2QSJA 2P3QA 4WLOA 1I30A 3ZQUA 4TXHA 3CVWA 1HX7A 2OFPA 5AVXA 1RFGE 1R0KA 2H2HA 3IUJA 1ZDMA 3GD5A 3X44A 5DSXA 3ZJYA 4WXPA 1R0LA 1TM4E 3ZDZB 1YVRA 1EFLA 2ZYDA 3RUAA 4NTZA 4XARA 2V65A 4W7SA 3ULKA 5EE1A 2VF7A 1ZP6A 3IOCA 4J3JA 3LDFA 4NBNA 4WKNA 4YT8A 2IEAA 2ZQZA 3CKLA 3TIXB 4B2IA 2Q4RA 4EG3A 3AETB 4FNAA 4HNVA 3PC3A 4OQMA 5K8UA 3LY7A 2RGCA 2PRYA 1KO5A 2N1MA 4WZZA 3ZNOA 4GOKA 1RLOA 3EPJA 3U49A 5ED4A 1PSDA 1CUZA 1I3NA 1RJGA 1NTRA 2V9PA 3SD7A 5JH7A 3ECSA 5LYJB 4J0JA 4J7AA 1P45A 3WDKA 2O2IA 3EQZA 2WKPA 4LBZA 3V34A 1G2OA 4NWIA 3GLIA 4C0LA 1A9PA 2J5XA 2ZI7A 5TPZD 1QK5A 2QPLA 1NURA 5JTTA 2H4XA 4EGQA 4F92B 1Y7LA 2B34A 1YRHA 5A0FA 2GCGA 3NBZC 5I9IA 1ZLXA 3DO5A 3N75A 1DO8A 1I4WA 3AESB 2C9CA 4FHGA 3P71T 1ISPA 4LFCB 4QTTB 5HIAA 4QELA 3PDWA 3C7DB 1GNSA 4TTTS 1B2RA 4Y2TA 4BP1A 2JLXA 4IH1A 3ESDA 3AH8A 4H3VA 3RT1A 1F60A 3ET4A 1I7NA 1TMKA 5JMPA 1YB4A 2CC2A 1QV9A 2FLVA 3PLAE 2IV2X 2XVAA 3A3YA 3DULA 1VKRA 4DIMA 2CHUA 1Z83A 2YJNA 4QHSA 2IZZA 4H1UA 1RKXA 4XX0B 2J4CA 3MHPA 4A1OA 4AMYA 3ITKA 5LB2A 3PF9A 1G5TA 1QIMA 2QXTA 2E37A 1YL5A 4F2WA 4CIWA 2GM3A 2VFAA 4GMKA 4ZQHA 4JC8A 2Q46A 4YCNA 4ALKA 3E7DA 3IHKA 3IMEA 4RNCA 1YI8A 2WV9A 1KSGA 1WTAA 4C08A 4EA7A 1UL1X 4TWIA 2VOEA 5JJIA 1XZPA 4Y67A 3BSWA 1JHZA 3LT0A 5CYPA 3JD0A 3Q72A 4MS1A 3FX2A 2OHIA 4BQQA 3ELWA 3GLFE 1ISMA 5FD8A 3VR4D 1AQYA 4PLYA 3UUWA 4YRMA 2J87A 4GKBA 3TN7A 1XHEA 5LA6A 3EXEB 2GN8A 1C3OB 3RC7A 1RAFA 1PJ2A 2QX6A 5CA1B 4MUYA 5B1YA 1J07A 4XQGA 3CZQA 1V11A 5DTEA 3DVAA 2NWQA 1QGOA 1YKSA 2YFKA 4EI2A 3F46A 3K6SA 3OCWA 2HPHA 1Z2PX 1M8FA 3RFTA 3BQ9A 4XDGA 1EFHA 5BWLA 1IBRA 5GGYA 4H3HB 3IV9A 4OHZA 5HK9A 5KYYB 4U9IS 3AVTA 4LJ9A 4HPWA 3L7JA 3ZVMA 3GZNB 4MRAA 1SKQA 4PGGA 5IKEA 4P54A 2DM6A 1E9FA 4MQEB 3F4KA 3UZUA 3QE3A 1EZZA 3L2OB 5E4FA 2XMRA 1WOMA 4LGYA 3NM6B 3RFXA 2HDWA 3E7WA 3ZXXA 5I8PA 2P3LA 5FWDA 4A2CA 2RE8A 4NAVA 3KYDA 3C6MA 3AERB 5GPBA 1E99A 1I7QB 1R88A 3THXA 1ZHOA 1VKNA 1Z22A 1XXLA 3EXHA 1OPXA 3OPYB 3PXBA 1X80B 4RZ2A 2C82A 5AOBA 3CUYA 5TX7A 3C3XA 2J7PD 3RS9A 3T1HB 4DCJA 4L0CA 1G3RA 2D8AA 2ISSD 2Z0MA 3ENVA 4R1LA 5TVGA 5ETJA 2BE9A 2WTAA 1JIJA 2ZGVA 4F2PA 1ZQ9A 3QMPA 4K05A 2C97A 2WW8A 4MI3A 4JI5B 5C1PA 2DR0A 5K09A 1UEJA 1VLHA 2YXDA 1LLDA 3EVTA 3PKJA 1JEDA 2D1RA 4RWEA 5IHXA 3K9HA 1J25A 4NEGA 2J4DA 2RK6A 1JPJA 2ID9A 1GCIA 1WEKA 4OSOA 5L51A 2ZBFA 2O19A 1G19A 1YZQA 5LMZA 1XJ5A 3LQQA 3EZFA 1XRQA 1DJMA 1K8YB 1RWKA 2E49A 2IHUA 1OMOA 4X97A 1XN1A 1JEAA 2IHBA 3W8NA 5I4BA 4WK2B 2XADA 1IFXA 1V5GA 3PNOA 4X90A 3VR6D 2VO1A 3HL0A 4KVAA 4EPVA 3U6BA 2FPKA 3R41A 1XLTA 1XALA 1J70A 1WNTA 2Q7OE 2X0JA 5E7IA 5JJ5A 1AOXA 3JARB 3JPYA 3WB0A 4AP6A 1YULA 4JP8A 1DWQA 3A36A 5FI1B 4DF3A 3I2FA 2EU8A 2PUAA 4D9KA 3BVPA 3FNHA 1NW6A 2PUTA 4HT3B 3QVOA 2AZXA 3G13A 3D6MA 4PFQA 4TWRA 3ZQ6A 4LZJA 2PZMA 1COZA 2FTKE 4IIJF 5I9NA 5J2UB 4BTLA 3T7CA 3VSDA 2P35A 2P2YA 2BV3A 1GSHA 3B20A 1YASA 3B53X 4GL4A 3EK2A 3EA5A 3EZLA 4FSDA 4WN9A 2REQA 4OI2A 1C8VB 4UNQA 1E9BA 2QGZA 4I5EA 3TJRA 4DDKA 4RKRA 2DUUA 1DIRA 4KAAA 4CCAA 4TKUB 3DBLA 5JH7F 4B31A 3HO8A 5MFZA 1ZC3A 1C7RA 1GGHA 2DMRA 2FEWB 1D3AA 2IZOA 3A0RB 1K6MA 3CCCA 4D3SA 2CFCA 3OCYA 4YUZA 2FDRA 3M0EA 2X5NA