3I5XA

Structure of mss116p bound to ssrna and amp-pnp
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
509
structure length
509
Chain Sequence
SKLIHVPKEDNSKEVTLDSLLEEGVLDKEIHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLINTKFDSQYMVKAVIVAPTRDLALQIEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPNIVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKNSKSADNIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKFANSIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVRELEDAKNIVIAKQEKYEPSEEIKSEVLEAVTEEPEDISDIVISLISSYRSCIKEYRFSERRILPEIASTYGVLLNDPQLKIPVSRRFLDKLGLSRSPIGKAMFEIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Yeast DEAD box protein Mss116p reveals two wedges that crimp RNA
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
molecule keywords ATP-dependent RNA helicase MSS116
total genus 203
structure length 509
sequence length 509
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2009-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3i5xA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3i5xA02
2ZI5A 3Q7QA 2ORVA 5FTLA 1E3MA 1TADA 4JLAA 4QC2A 4OI1A 1JR3E 3G5UA 5FOUA 4EPRA 2J0UB 3LXXA 4ON9A 3VMFA 4BZXA 2WBLC 4A4DA 3U4QA 1KK1A 1JNYA 1PLJA 4LHWA 4PO9A 4Q4AA 4R71A 3K70C 4A92A 4LYHA 4KJZA 1KSFX 1WP9A 2F43A 3K9GA 4UKDA 3IO3A 1QG4A 2RH5A 4M9XA 1TMKA 4Z51A 5KNBA 1FP6A 3HYTA 2J59A 4NPHA 3NBYC 4EJSA 4RFSA 1NSFA 3MD0A 2BKEA 4J0QA 5D3MB 1JXMA 4P33A 1XXHB 1EK0A 2B92A 3MUFA 4NCKA 3HU2A 4DLWA 1IXZA 2GHIA 1XTQA 2WMNB 2FMXA 5ANRB 2Q9CA 3KJEA 2GJAA 3QF4A 2VHTA 1D2NA 4ESHA 3EA0A 1AKEA 2NG1A 4OQFA 1DPFA 1NMZA 1XPUA 3O8RA 4OQNA 3W3ZB 1XCMA 4B76A 2GF0A 3ND9A 1AGPA 5AK0A 1OT3A 1ZNWA 2EFHB 1ZNZA 1GAJA 1AGRA 2QG6A 4YONB 3UATA 3RAPR 1CS4C 3WHKA 1AKYA 2DWOA 2RAPA 1XTSA 1C9KA 2GRJA 3EIEA 4D80A 4D82A 4DRZA 1W36B 3QSYA 3CRRA 3DOEA 2ZJ2A 3BD9A 1YR9A 3DM5A 5SZHB 5GVRA 2FFAA 4Z8XA 2R6GA 2GEVA 3OFND 1ODFA 4B33A 3K0SA 3HU1A 4P31A 3FFBA 3V4RA 5J4KA 3THYB 3AVOA 2QBYB 4Q19A 4GFDA 1RJ9A 4PHFA 3OIYA 3SQXA 1GUAA 4OK3A 4R2IA 1G41A 4OI2A 1OE0A 1UFQA 1NG1A 2IYSA 3PITA 4XWKA 5B64A 5LDDC 3SJCA 1KJYA 1N5JA 3EWAA 4B6EA 1Z08A 1II9A 2J3EA 1OH8A 2VHUA 4MRNA 2EVWX 3WNBA 3C7KA 1ZIOA 4NKRA 3AVQA 1OV4A 1P2UA 4OKSA 3THWB 4LOAA 5G53C 5EP4A 3QVVA 2XB4A 4JL8A 2GVZC 1ZM7A 3SU8A 1KMHB 2VSXA 3Q3JB 2CHVA 2OCBA 3HR7A 4TZ0A 1KDRA 4TN1A 1SQ5A 5KSZA 4TYNA 1W4RA 4NL4H 3X1ZA 2H8KA 2C5LA 2WJYA 4HSEA 3GP8A 3VKGA 4D0GA 3B1YA 2NZJA 2WZQA 4JYCA 2GEDA 2QU8A 4ILEA 2NMVA 4B74A 2IF0A 3CR8A 2XNDD 4PPGA 3QPWA 5CK4A 2QPAA 4XH9B 2Z0MA 4HB3A 4URWR 3ZYCA 1VECA 5C46F 1W1WA 2QROA 3AKEA 3VHLB 3ZIAA 4CEJA 4RZ3A 4UNRA 5SZKB 3ZS8A 2IX3A 4UNPA 2ZRHA 3LW8A 2ZRLA 4QHTA 4C0AC 2IUUA 4Q4HA 2IBMA 2MMGA 1Q44A 3C5HA 4LV6A 1IOZA 3JVVA 1IN6A 5L3RA 1A2BA 1CXZA 2X77A 1G6HA 4Q4LA 5FTJA 4M1MA 2AD5A 1FZQA 1EFCA 1YZNA 2ZSDA 4UJ3A 3PVSA 3TUJC 2ZE7A 2QL6A 4B75A 1ZD8A 4Q7MB 4L5BA 5FBVB 4TZ6A 1SXJB 3OE7A 3W5JA 4XWOA 2QAGB 4JYBA 3KKNA 4LBWA 4FD2A 5E3HA 4XVRA 1NN1A 2ZPTX 3RRYA 4YMSA 4B35A 1NBMD 2I3BA 2JGNA 2D62A 4BFYA 4HAXA 2ZROA 1BIFA 2WIBA 1NF3A 3T61A 4RJLA 1CR1A 5BWMA 1G3RA 4D0LB 2O0JA 2BJWA 2BBWA 3CIOA 1KO4A 3EZ6A 3KQLA 1OXSC 1Z83A 4HAWA 2ZYUX 3UG7A 1MABB 1VG8A 1E9FA 2GILA 1QHHB 5JRJA 2HXSA 4JLOA 5CK5A 2R2AA 3A8TA 2VBCA 2Z43A 4EQ6B 2RGDA 2ZRAA 3C8UA 2WWGA 1XEXA 2PLFA 1Y3AA 1UPTA 5JWRA 1ZNXA 2O8FB 3NH9A 1DAEA 4HUTA 3CPJB 4CF7A 5G40A 1SZPA 4JVSB 4OI0A 2X1VA 3CF0A 5CLQA 5J47A 4D26A 1PJRA 3MSXA 1NLYA 1LS1A 4M1WA 3ZZTA 4PPQA 1SVWA 3FWYA 1AN0A 1YVDA 5LBIA 2F55A 4A2WA 1E2KA 2J1LA 1MABA 2VO1A 4HDCA 4QJ4A 5FPYA 3OESA 4DLXA 2G83A 1R10A 5KOYA 3CX8A 3RNLA 2XTZA 3N2EA 4ZI3A 3ZLJA 4URZR 5EE5B 2EW1A 1IXSB 2Q9AA 2RKOA 2OBMA 2XTNA 1XX6A 4IOKA 4LC0A 4DSUA 2TMKA 3KJIA 4WZBE 4BRUA 5IRCD 5FOXA 1ESNA 3MCAA 4QHYA 2IWHA 2JLUA 5CJ2A 2G77B 3F8TA 5JJLA 1J8MF 3M4YA 4KFRA 2CLSA 2D7CA 4HLQB 1YR8A 4B48A 5L3VA 1G3MA 1PLLA 2J46A 3LBNA 4Y0AA 4HYYA 3GJ0A 1G64A 1OF1A 1F2TB 1NVUQ 1Q1BA 2JA1A 1VCMA 2WKPA 4IXMA 4MA4A 2HXYA 3NC0C 4C0QC 4XTRA 3BRWD 2CL7X 1E0JA 4X8LA 5LB2A 2OILA 2WSMA 4GOJA 3W5IA 2DY1A 2WIAA 4D25A 4UXJA 4A0GA 1QVAA 2V4ZA 5HPYB 3PEWA 1WF3A 2PZFA 2WICA 1FFHA 2IYQA 2IS1A 4YMTA 2ERXA 1U90A 3QNUA 1CJTC 5JMTA 5CM8B 1TL7C 1MH1A 6Q21A 1XCGB 2VP9A 3FMIA 1D6JA 3EPHA 1WQ1R 1E2DA 4XOIA 1D2EA 2WOJA 4AKEA 4ABYA 4DDVA 1TU4A 3VKHA 1W48A 5BYJA 3PJRA 1SULA 1JR3A 2PX3A 1RRGA 1KK3A 4RFSB 3RSLA 1GTVA 1KI6A 5DHFA 4FMDB 1I4TD 2Q0HA 4FCVA 3QBTA 3LD9A 4AWXA 1ESMA 1EFUA 4S35A 1YHNA 3PUVA 2HF9A 2QE7D 1N6HA 2NO7A 1XU4A 3FKQA 1KY2A 3QEJA 4LHYA 4BRWA 3K70B 1G4UR 4O0MA 1D5CA 1W46A 3CH5A 2RGEA 2UKDA 5J5CA 3VR6A 3GLFB 1KDTA 4C30A 2C03A 4B3BA 1RRPA 1VIAA 2QP4A 3QI2A 1TQ6A 1ZUHA 3PR1A 4HB0A 2AK2A 3H86A 5FBLB 4XSHA 4L4UA 2A5DA 3WMEA 2DWPA 3TVTA 3T34A 2A5GA 1KI9A 2V54A 3DEFA 4M8NE 3T1OA 3VTKA 3B1ZA 4IEEA 1E9AA 4URVR 4M1TA 2WWFA 1JEEA 3AF0A 1KJZA 1X1RA 1X8LA 1Q1ZA 4BFTA 4QM6A 1TNDA 1F2UB 4NONA 4YLGA 1Q0UA 2F3RA 5HKKA 5KPDA 3CRQA 3GJXC 3IGFA 3R8CA 1OFUX 1ZM4A 1MOZA 1ONBA 3B9QA 1F6BA 1NSTA 2FH5B 2W6IA 3U4QB 1DO0A 3U3KA 3GCGA 1G8PA 2REXB 2R9VA 1OHHA 4LJ7A 2J7PA 1W36D 2V8OA 3WYGA 4HAUA 4LHZA 1M2OB 2P6NA 3BE4A 2JDIA 2AXNA 2E9SA 3ZVLA 3FVQA 3A1WA 1MKYA 1HH4A 3GEEA 1IBRA 4DLYA 3AVXA 2W2VA 2YYZA 5EP2A 3FHCB 4JJKA 3FPAA 1AZTA 1XTJA 3B5JA 1N3BA 4OL0A 1SKQA 1SXJC 1TQ2A 4AYTA 4NCJA 3U7FB 3DPUA 1OJLA 1GFIA 2YWFA 5UKDA 2WWYA 3RLFA 1JECA 3NEYA 3QF4B 2HJGA 2BKUA 1OHHD 2DHRA 3EARA 3UKDA 1EFHA 1EGAA 2FOLA 2ZXUA 1CLUA 4G5GA 4A8JA 1KNXA 2W6JD 1P62B 1KI2A 5KDDA 2PT5A 4WVFA 3JZAA 5LD2B 1SHKA 1QF9A 1TQDA 3LRPA 4Q9LA 4PAQA 4Q7KA 3BB3A 3DM9B 4GI7A 1IN7A 1TX4B 2OFOA 2ANCA 1E4VA 2G88A 3AKCA 1D2MA 4Q9JA 1S1CA 1SVKA 5TXGA 2OUKA 2QNRA 2HCBA 2CK3A 2IA5A 4M9SA 2QMEA 2WWXA 3QXJA 4QKQA 2J87A 1G17A 2J9RA 3ECCA 5CDFE 1UF9A 2J0VA 4PPFA 2BMFA 1VG0B 4TL7A 3AUYA 3A4MA 5CYOA 3QOFA 4X8OA 4PX9A 4V02A 1Z2AA 3RABA 4A8JB 3QQ5A 1NVWQ 3GLGA 3CM0A 4C0HA 4KVAA 2A5YB 5FPTA 4ZDJA 1QHHA 4D4MA 2FSHA 5JEEA 2O8DA 2RGAA 4ZPXA 2GF9A 2Z4SA 3IIJA 2OO7A 1W2HA 2PJZA 2FFQA 1G8FA 1DVRA 1GL9B 2GCOB 3MG9A 1OFIA 4IDQA 4U5XA 4I4LA 5CB6A 2A78A 1W0KA 4PC6A 1N25A 2BCGY 2CHQA 2PBRA 1DBSA 4JLVA 3TQCA 4ASUA 3LO5A 4HUQA 5L3QA 2WSSA 1N6PA 3I3SR 1EG7A 3QIAA 5FOWA 5BXQC 5L3SB 1PV4A 1GITA 4K81B 2OCPA 3FMPB 2A7QA 2IWRA 2F6RA 2REBA 2IYWA 3NBXX 3P1JA 1K8RA 1M7BA 1SVOA 4EIWA 3N70A 2N46A 4NH0A 2X2FA 1COWA 5DO9A 2GAAA 2XOKD 1Z6AA 4QNMA 4V0NA 4AG5A 4QBGB 3L0SA 2BMJA 2QN6A 2BM1A 1XEWX 1BMFD 3OAAA 3HPRA 3OIUA 4PQRA 1Z07A 5FTMA 4B73A 4JSTA 3R9XA 2ORWA 2G1JA 1ETUA 2QMHA 3BB1A 4G0NA 3QKRA 1WXQA 3JVUA 3LLUA 1NJFA 3AB3A 4EKDA 1S96A 3BERA 4UXHA 4URUR 1IY1A 5FL3A 4KLNA 3ZGXA 4DSTA 1WDTA 2V1XA 4DCNA 2ZRIA 2WHXA 4FN5A 1YRAA 4M0LA 4M1KA 2F9MA 2QRNA 4KYUA 5EXPA 4LV5B 2RMKA 4FWTA 1G16A 4D81A 3VAAA 4LYAA 4YDSA 1ZINA 4NYIQ 1HV8A 3P26A 4UQOA 1T0HB 2GVDC 4H1UA 621PA 5BN5A 1UKEA 1J2JA 5B30A 3PENA 1XMVA 1SXJA 4B2PA 1Q21A 1XJCA 3CNLA 1XNJA 2NIPA 1T5IA 2CCGA 5FOSA 1Z29A 2NO6A 3L82B 1UM8A 4DUGA 4PXAA 2D2FA 3RVBA 4YQFA 1KAOA 5IK2A 1GNPA 3CPHA 4IEIA 3RS7A 2OG2A 2YV5A 5DN6D 3NTUA 1FMLA 3LXRA 4EUNA 4BQSA 4PC3A 4BLRA 1VHTA 1GILA 2QP3A 4LGMA 4ESVA 5H68A 1R0YA 3A1SA 3R7WB 4QHSA 3D6TB 1P5ZB 4MRSA 1NNEA 2A2ZA 3AH8A 2QBYA 3CNNA 4B32A 4K8OA 3BJIC 4RZ2A 3AF3A 1KY3A 3RS4A 3P32A 3IIKA 4R9UC 2EYUA 4L8GA 4OQLA 1KMQA 4F91B 1XMIA 4WBSA 2ZSAA 5D3QA 2R6CA 1WB9A 4IFEA 2VPPA 4KFTA 4QGHA 1ZP6A 4FMDF 1JPNA 1L2TA 3ADDA 1EWRA 2GJKA 3R20A 1FX0A 3C15C 2BHRA 3CPEA 3Q5EA 2GNOA 3S1AB 4ZDKA 4B44A 3GJ7A 3PEVA 2F1RA 2ZANA 4M1SA 2QTVB 3SZRA 3G82C 2KJQA 4BFVA 1A82A 4A0RA 2BBSA 2PCLA 1T0JB 2V7QD 3ICQB 2XJ9A 3EPKA 3EG5A 1D9ZA 2HDNB 1E79A 1BMFA 2FSIA 3FMOB 3NEJA 3TW8B 4AYWA 3RC8A 1IJFA 1S9HA 1VYTA 2IEZA 4AK9A 5K8UA 4LJ9A 2EFEB 1HEIA 1Z2CA 4Q7LA 1FOEB 5EE0A 2A5FA 4ASUD 4PR0A 2AFIE 1NKTA 2G6BA 2ODEA 4HLUA 2GK7A 5B57C 1CR4A 2YZ2A 2C04A 4LRWA 3EPJA 1FQJA 4F93B 4GT1A 2GCNA 4LJ5A 3UMFA 1E9CA 4S2EA 2ZI9A 1R5BA 1CR2A 2RB4A 1G4AE 3IBYA 2R6DA 4NYMR 4QJ5A 3CLVA 4PAMA 1S1MA 2HUPA 4MGZR 4IFBA 2ZEJA 4TQ9A 3CZPA 3TUZC 3X1WA 4QBFA 1COWD 3FDIA 2N1BA 4JVMA 3PXGA 3VQTA 1W5SA 3DMNA 2QENA 1ZUIA 2CNWD 3CKLA 4TMTA 1UBEA 4WXRA 3PUZA 4BFXA 3NWJA 5IF9A 4MGYR 2O8BB 1TF7A 4JKYA 1YKSA 4W5HA 3C5CA 4IDHA 4DUGD 3GJ3A 1DG1G 1W0KD 4G01B 5BN3A 4B43A 5DYIA 5EE1A 3GMTA 2X8AA 1M74A 4M1YA 1IN8A 1SKYB 3THXB 3ICEA 2D7DA 1E94E 1II8B 5AR1A 1J7KA 4UNSA 3GJ6A 3BC1A 3DVLA 1LY1A 3EZ9A 4UNNA 1QHIA 5KSPA 1VTKA 4R98A 3KUDA 4MDEA 2BM0A 2OT3B 2UVQA 1M1YE 2CJWB 3ZJYA 1IN4A 4M9QA 5C1BA 1Z0FA 1Z0IA 4RCZA 4BASA 4OK6A 4Q1BA 4A9AA 5DI3B 3FGNA 2ZREA 4F92B 4PZZA 2A9KA 5FOVA 4N3NA 4EFLA 2IHYA 1LFDB 2WJHA 5AJWA 4IOLA 1E9BA 5IT5A 2WJVA 1CR0A 5KSYA 4B6FA 1CKEA 2JJ2A 4AD8A 2OCYC 5FOTA 4XD7A 3PCRB 5JZVA 1KSHA 1M7HA 2HF8A 1UEJA 1ZD1A 3LVRE 1WRBA 3K8YA 3GFPA 4URYR 3QJYA 1XEWY 2W6JA 3L8YA 1MR3F 3SC3A 5LPNA 2W6ID 5H70A 4RD3A 2BJVA 4YMUA 4Q1CA 2XOKA 5LD2C 3SOPA 4X8MA 4M22A 2IF2A 4P4TA 4D2IA 4D4KA 3H4MA 4QGGA 2Q3MA 5AJXA 2IXEA 4DDTA 5DI3A 4LPKA 5HKKD 2C9OA 3CX7A 2F1HA 2CLDX 2YINC 3CW2A 2AN9A 1TEVA 2P3SA 4HATA 3U3JA 1XD2A 2YKGA 5D3MA 3PFIA 4EPWA 4DCSA 2IW3A 1KSJA 2AHOA 1ZBDA 2IL1A 5K8LA 1RYFA 1EWQA 2CCKA 2VA8A 2QPOA 4HEJA 3X1XA 3EC1A 5FUVA 2QA5A 5JJKA 5FUYA 3WYFA 1QHGA 5C18A 4BLPA 2R44A 3LBHA 1G6OA 3QVUA 5EQTA 5HCNA 5TB5A 3LLMA 1B23P 2G9NA 1NY6A 3GPLA 4G5SA 1JJ7A 3WRXC 1H8HD 4HLUC 4DB4A 2MSEB 4V0OA 1NN0A 3F5FA 2REOA 1FP7A 5TDHA 5GJWC 5JSZA 3EAQA 5DSZA 3IKJA 1JALA 4ZCMA 3VR1A 3KZ1E 3BB4A 521PA 2ZJ5A 1ZM9A 3R9IA 4CGZA 5H8WA 2IYRA 2FPKA 2Z83A 4TL6A 2ZU0C 2NPIA 4B3GA 1XTIA 3O8BA 4FINA 2J5XA 1UAAA 2V1UA 4EAQA 2QGNA 1OIVA 1GNQA 2ZETA 1U0JA 4IVRA 3FKSD 2YWHA 4QNRA 1N6LA 4CEHB 2KWIA 3N5CA 1HTWA 1CRPA 2C98A 2G3YA 1E2FA 4EFNA 4JVNA 2PL3A 5L8VA 2IYLD 4LJ6A 5J40A 1E69A 5J4YA 2Z6VA 4IRUB 3AVVA 3DOFA 4DLUA 4PHHA 1R8SA 3ASZA 4BEBA 4DEYA 2AFHE 4US0R 1OH7A 2IT1A 3L43A 5AUQA 1LVGA 1G1MA 1NN3A 1MO5A 3A4NA 3ZD7A 5JBQA 2VF8A 1LB1B 3LV8A 4NYIR 1EX7A 1XXHA 1ZW6A 2ONKA 3TSZA 3ZDQA 3RWOA 4I1VA 3W8NA 3H2YA 5JCZA 5EUMA 4JS0A 3KQNA 3HP1A 3VR4A 2ZR9A 3A58B 2VF7A 4N1AA 4HLCA 3QPVA 1EX6A 2MSDB 3LX5A 2PX0A 1KO7A 2IYZA 1AS0A 4TMXA 2F7SA 2HT6A 2JLYA 4ARZA 5IDVA 4B3FX 1SXJE 1JQJC 3HWSA 2ZTSA 3OIVA 4ZI2A 1G8GA 3PIRA 3GLHB 4QFMA 1X86B 2JLZA 1BS1A 1RVDA 2QZ4A 3I4LA 4L9SA 3REGA 4LDJA 2ZM5A 1VG9B 2C9CA 1CBUA 3VX3A 3K09C 2MMCA 4YMWA 3LY5A 1S0UA 2WPDD 1P9NA 4DLZA 2G0NA 3KX2A 4OHVA 3B60A 4B3DA 2AXPA 1G5PA 1DTSA 1HQYE 3THYA 2HYDA 5E4FA 3QPUA 1UBFA 4E22A 2OLJA 2ZS8A 3Q7PA 4F4IA 1GL7A 5KU1A 2FDCA 2B7BA 1K5GA 1Z3IX 2O8EB 2GCOA 1JXOA 1W44A 1NRJB 1E9DA 3IQXA 1SVLA 1H8HA 4DXAA 1EESA 3D7MA 4KBFA 1R8QA 4CEIB 4R7ZA 3TUIC 1W4AA 4C2TA 3P27A 1OXTA 3QKSB 2XZLA 1R6BX 1U94A 1AK2A 2RGXA 2HLDD 4JMPA 4JJZA 4YXWD 3I72A 4Q00A 1GZSA 1KI4A 1UBGA 1ZCAA 2GJSA 5JSZB 4XVUA 1XTKA 4Q9IA 3BFVA 3LBIA 5TMPA 1K5DA 1G5TA 1E1RD 2IK8A 4EFMA 2ZRGA 3GLFA 2H17A 2ZVPX 2CLCX 3W3AA 2CL6X 1G5RA 1XB2A 4MYHA 2YOFA 2OE2A 5EP1A 3LWNA 3U44B 1VYUA 2FGKA 3ETLA 2ZRPA 2ORIA 1T3HA 3AP1A 1CIPA 3TH5A 2O8FA 1EXMA 1OKKA 3SE0A 5EUQB 1KMHA 3ZVRA 1N5KA 2ZQ5A 2GZHA 1GSIA 4Y0VA 5DISB 1Z6XA 4Z1MA 3T5GA 1OXVA 4NTZA 4TLDA 2WAXA 4CDGA 2OCAA 2FF7A 4PSAA 2FPMA 4PANA 4O2LA 1Q3HA 1FNMA 4I1SA 4LI0A 2WJGA 1T5LA 4AIIA 4DDWA 2QTFA 1A1VA 2ZJ8A 1F3OA 2VP6A 3M0EA 1KI3A 1LV7A 2GWHA 3EXAA 5M04A 2XGJA 4E09A 4GNKA 1N5LA 2DFLA 3CRMA 2NZ8A 3SYNA 1QHXA 1ZU4A 4TLBA 1P4SA 2RHDA 2JATA 4Q03A 2PZGA 4FMCB 2J41A 1TU3A 5KHOC 2AKYA 2FJUA 3NHBA 3IDQA 4CRWB 3TRFA 3MRSA 3NBZC 1GKIA 1T6NA 2PMKA 3PUWA 3QKTA 3KQKA 1U2RA 1ZCBA 4DJTA 2IHBA 3I61A 2VP5A 3GLGE 4D4JA 2V6IA 3KXLA 3TE6A 3RANA 1KO5A 3NG1A 5E7MA 4DZZA 3H1TA 1XZQA 3L0PA 3IUYA 4DLRA 4GZLA 1ZJ6A 1R0XA 1R4AA 2QT0A 2ZUBA 2C95A 3PUYA 3EASA 1KI7A 4QG7A 3T06B 5EE3A 3T15A 4C4PA 1XD8A 2O52A 4LBYA 3VFDA 5F9HA 2DFNA 1XD2B 3DO6A 3KQUA 2CE7A 1YRBA 3A1UA 1GIAA 3SDZA 1KYIA 3D3QA 1YR6A 1DE0A 5JFGA 2VTKA 1MO6A 2QQ0A 2QMUA 2CMKA 4LCBA 4DLTA 3TVDA 3SN6A 2QY9A 1FUUA 1P9RA 4Q1DA 821PA 3ZH9B 1BH2A 5AJVB 4QXAA 3DKVA 3SJAA 1ELOA 5FPSA 5B58C 4TLEA 1P6XA 4GDFA 3AVTA 2ZJBA 2ZI6A 2ZRBA 1W7AA 1WBBA 4A1FA 4Q02A 4WW0A 2H1LA 3HU3A 4H1VA 4MH0R 3CF6R 5EE9A 3KTAA 2ZI3A 3A1TA 3SHFA 1KAGA 3K70D 1T91A 2A5JA 3I32A 3IQWA 3U44A 3MLEA 3UIEA 2VEDA 1ZRHA 2LKCA 1OIXA 3LX8A 2CEAA 4NCIA 3KKOA 4CW7A 1RC8A 4DIEA 3K0CC 5TARA 2V7QA 3I62A 4HUQB 3C14C 4ZKDA 2J45A 2CE2X 1MO4A 2FZLA 2ZAOA 5SZJA 2W2TA 3TSOA 2LCFA 1L4UA 3DKPA 4URXR 4Q9HA 5AUPB 3WP1B 1YZGA 4MUAA 1Z6TA 2G0TA 4LY6A 3K9HA 3PEYA 1HT1E 1HE8B 2NO9A 1I2DA 1S3SA 1Q22A 2F1IA 3FB4A 3QXSA 3EX7C 4BPBA 2QAJA 4RD2A 3TMKA 3EZFA 4CT5A 5CIQA 1FTNA 2JIZA 4JKIA 4OHZA 2DR3A 4LSGA 3OZXA 1DAFA 3GJ4A 4W5WA 2JJ8A 3ZVNA 3IHWA 4LWZA 4ACBA 1A7JA 2P5SA 2EFGA 4YC7A 1H65A 2Z4RA 1QG2A 4U7DA 2ODNA 2XNDA 2EQBA 3CNOA 1RRCA 3B82A 2FFHA 1U0HC 1VMAA 1L8QA 1LNZA 4OQMA 4JIMA 1E2QA 1G3UA 1E4YA 4KLZA 5SZIA 1LF5A 2WJIA 3IO5A 3L8ZA 5J4VA 2ZSEA 1RFLA 2GBLC 2IYTA 2OZEA 1TEXA 1N6NA 3GLHA 4Q4HB 1M7GA 4IOJA 4M21A 2ZYTX 2FGJA 1OFHA 3LH5A 1JPJA 3VR3A 1VYVA 3B8HA 2AD1A 4JBYA 1CEEA 2WV9A 3WHLA 1QHNA 1E32A 2YHSA 3OF5A 4I1OA 1E96A 2I1QA 1HA3A 1P61B 4PC1A 5HCIA 2VLIA 3PV0A 3Q9LA 1S4QA 3PUXA 3I5YA 4P4SB 3AM1A 2YOGA 5FPHA 2FE4A 4GOKA 4NZYA 4ZCIA 4JLPA 4MITA 2OLKA 4DBLC 1A2KC 1OPXA 1G7CA 3SEAA 1XJ0A 3BH7A 3ZZ0A 5GVSA 4JLBA 4TMWA 4BZQA 5A5GA 1G18A 2CCJA 4Q1AA 4EPXA 2OESA 3NH6A 4AG6A 3IIMA 4KFUA 3WMGA 1WE2A 1Z0AA 4QBHA 1DEKA 1VIYA 2HEIA 1Z22A 3EWSA 3QE0A 2RGNA 2SHKA 1TQ4A 4TTQA 1IQPA 1QDEA 4Q18A 1DAKA 3LNCA 1YE8A 2B8WA 2F1JA 4RKEA 3RRMA 2O8EA 4IVPA 4JLJA 4M53A 3B13B 5F98A 4MYCA 3GEIA 5E7JA 2F3TA 2FX3A 2IYYA 3K0FB 4V0LA 3MFYA 2OXCA 2WWIA 3C4JA 1SVMA 1CJVC 1KHTA 1UDXA 2XXAA 3D8BA 3W6PA 4B71A 5JEDA 4GSYA 1Z6GA 1YZLA 2OSBA 1IXRC 1FMJA 1IY0A 3BWDD 2D2EA 1G19A 221PA 4JL6A 3QEOA 4IW3B 4MQBA 3ZVMA 1ANKA 4A15A 1XEFA 4TYYA 1VCNA 2NGRA 2GXSA 1XFAA 3O8CA 1MO3A 2YWEA 5KYKA 1O87A 2C99A 4B3XA 5DN6A 1QRAA 1Q12A 1SXJD 3BBPA 3MGCA 4JT4A 4IXNA 5FL7D 1NL3A 4TT3A 1EFTA 1D8TA 1G7RA 2R6AA 5AJZA 4JLDA 2JJ1A 1E0SA 2GXQA 4G5RA 2ZYWX 3QENA 4TTRA 4XWAA 3TGPA 1AIPA 2QPTA 3AGQA 5F2EA 5F9FA 3EZ2A 3TSWA 3ADCA 2IEYA 1H8ED 3PEUA 4Q9KA 3B2EA 2VP0A 3U6BA 1J70A 4PZLA 1UJ2A 1JR6A 3QF7A 1W5TA 3BOSA 4HB4A 4IDPA 1O3YA 3W34A 2YNMA 3NKVA 3T1TA 2BCJQ 3UK6A 5CDFA 3GQBA 1Q20A 3GLIB 3CWZA 4UXIA 3NDPA 2QM8A 3VR5A 4BFWA 2WWHA 4HZUA 4V0MA 4FMCF 4PZYA 2XJ4A 4IDNA 3WNCA 3A6PC 1VCOA 5JS7A 2AK3A 2W00A 4TLAA 5HE9A 1V5WA 3VU9B 4PC2A 1BKDR 5BN4A 4PQFA 3QG5A 3A37A 4OK5A 3P20A 3UPUA 3C41J 2QSYA 4GOXA 4PTLA 4Q01A 4KITB 1OH5A 4TYWA 4C7OB 3W8RA 3N2IA 1P3JA 2FG5A 4FCTA 1TPZA 4P32A 3I8SA 4DB2A 4BEJA 4U00A 2QAGC 5TY0A 3GJ5A 4IJMA 4GMXA 1GP2A 3UANA 3WBJA 3KFVA 4HAYA 4IOMA 4EPYA 4DT1B 1KNQA 1GRRA 1JQLB 2ZRJA 4Q1FA 1WA5A 5TVKA 4YDHB 4AI6A 4G1UC 3RHFA 2VP2A 4US1R 3K9LA 1P7CA 3IILA 3KUCA 3WBKA 1E0KA 1C1YA 4UNQA 4GRAA 1BO6A 1HURA 5FH9A 2H7VA 4CZ2A 2EYQA 2RGNC 3K0AA 3AUXA 2RGCA 4W5JA 2Q3FA 3CO5A 2QRZA 4GBMA 4CEHA 1PLKA 1FW6A 4TLCA 2A30A 2O8CB 4NE2A 3VNVA 1QHYA 2QEQA 4KCGA 1F2UA 5FI1B 1Q1QA 1FTSA 2EWVA 3QXXA 5LB4A 2EWWA 2ZS7A 3QUSA 4PO8A 2R65A 2K5UA 3L2OB 2UZ3A 2XSZD 4M1OA 1T8TA 2VYFA 5DIFA 2JIZD 1X8KA 5F3WB 2GDJA 3AVUA 2FSGA 2XX3A 1RYHA 3V4FA 1Z0KA 4RD6A 2YJTD 1IAQA 4MRRA 1F5NA 1XBTA 1EFRD 3DZDA 5CITA 3SBDA 2BEKA 4PHTA 3H84A 5EXTA 2X19A 2LKDA 4MRVA 2NOAA 4OJKA 1DAGA 2IS6A 1Q3TA 2F9LA 1XWIA 2GJ8A 2PH1A 3CRW1 3OEED 3ZD6A 3U7EB 4IKEA 1X1SA 2BOVA 3R9WA 2HCJB 4BLOA 3ONWA 4C2UA 1F48A 1TUIA 4C3ZA 2GXAA 2BVNA 1U0LA 4DDUA 1BYUA 3MJRA 2ZS9A 1RPZA 3UG6A 2ZYVX 1E2NA 1A4RA 2D3WA 2GBLA 2QGZA 4OHXA 1IN5A 4KODA 3OEHA 1CTQA 1PUIA 3DZ8A 2YC4C 3GLIE 4L15A 1P60A 1IJEA 4MYTA 2P0EA 5AUOB 3TW4A 3EPLA 3ADKA 2XITA 1MRNA 3NDBB 1J8YF 2J7PD 2ZIAA 4Q47A 1AA9A 2ATXA 4A8JC 4H9GA 4ZKEA 5KUTA 4LJ8A 4ZIRA 3T5DA 2DFKB 3U2QA 5HZHA 1U8AA 1KSGA 3QBVA 2JDID 1FX0B 1IY2A 1N0VC 1G21E 4QM7A 1V43A 2CHGA 2CL0X 121PA 1G9XA 3M6AA 1P72A 1UKVY 2DWQA 2ZITA 4DT1A 2AX4A 2GEUA 3VX4A 3F3YA 4Q4JB 4FXPA 1DADA 1E2EA 1R2QA 421PA 3GLIA 5EZ5A 4AY2A 4M2LA 3BORA 4C0BA 4G5QA 4I1UA 5ELXA 5CYPA 1OYWA 4P4SA 2JLQA 4RCYA 2H92A 4C0JA 4ITRC 4PC7A 1UADA 3BH6A 3CBQA 4UJ5A 1BYIA 1LF0A 4B2LA 3LFUA 3A4LA 1OIWA 3AV0B 2XZOA 1Q57A 4Q66C 2O8CA 1VDZA 1ZM3A 3SJZA 2O5VA 1J90A 3HJNA 1KKMA 3LQQA 5FTNA 2QE7A 1UEIA 3CB4A 3ZS9A 2EU8A 1RJ9B 3EC2A 3AP3A 4TYPA 1N0UA 2HT1A 1U9IA 4G3XA 2BDTA 1Z28A 2PCJA 3RDPA 3SFVA 3FTQA 1OXUA 1E99A 1KZ7B 3E2IA 3X1DA 3A1VA 2EFCB 3X2SA 2MSCB 2P6UA 3Q72A 2WMOB 2GCPA 2QM7A 4L16A 2H5EA 3FHOA 3TNFA 1UKZA 2AKAB 4P4UA 5G3ZA 2E87A 1XD9A 1OW3B 4HB2A 5JI2E 1OKKD 3V9PA 2FN4A 3KDSE 4A0HA 3P4XA 4A82A 1MRSA 3THXA 1M6NA 1S2MA 3GEHA 4XTCS 5JWHA 2B8TA 2IUTA 4A0FA 4EDHA 4C0LA 3OE7D 3BGWA 1YR7A 3WY9A 3RS0A 3LQRA 5GJCA 2NPFA 1Z5ZA 3W90A 2JLXA 2VHQA 1GNRA 1NLFA 2ECKA 1N0WA 3FFAA 4LJ4A 4ZDIA 1NIPA 1AS3A 4W9MC 1H8EA 2V9PA 2WM9B 5E7IA 3ND8A 1GWNA 1P2VA 2FSFA 4D0NA 4CEJB 1QHSA 4FCWA 1JB1A 4ARZB 1E2MA 1IHUA 4JT2A 1Z0JA 2ZE5A 3CR7A 3RS3A 1VCIA 3RSOA 1GRNA 3RWMB 2WKQA 2ZUCA 1TF5A 3RC3A 3RS5A 4E03A 3I73A 4ERNA 5IHPA 3Q5DA 1NP6A 1YZKA 3V00A 2JCSA 4MKFA 2W0SA 3BFKA 1LS6A 4Q21A 3WXMA 2WAYA 3FOZA 5EXSA 4V0ME 4NYMQ 1XF9A 1E2HA 1P75A 3RRZA 1CRQA 4EPVA 3AKYA 4QOSA 3K0FA 1N6RA 4BLTA 4RFVA 1XPOA 4TWZA 5E95A 1J99A 3KXIA 3WP0A 2XXAB 3AVWA 4GZMA 4B34A 4M4SA 3T12A 4WZAE 1W0JD 4B3CA 3HPQA 5JRZA 2D4HA 5C2JB 1XMJA 1NVVR 3S1AA 2CBZA 5JJIA 1M8PA 3QY0A 1GKUB 1E6CA 4QL3A 3MJHA 4QRHA 3CUEF 2D74A 1M34E 2ZRCA 2FV8A 3KJHA 2O8BA 1ZU5A 2FPLA 4CT4B 1CF4A 2IYVA 1MT0A 3HYRA 2ATVA 3U7HB 1XRJA 3R8FA 4JVLA 1GM5A 4HLDA 3B7GA 4I99A 2C77A 3AP2A 4Q4JA 1HE1C 4A6XA 4DKXA 1NBME 4E5UA 2J7KA 1E0AA 4C9BA 3CRVA 2ZRDA 4BFZA 2O0KA 3KQHA 4LPSA 1U9IC 3GD7A 1KIMA 3U3RA 5JI3E 4BFUA 1TF2A 5L3QB 3OHMA 1NG9A 4NMMA 2UZIR 3OEEA 3MMPA 4TSFA 1RE0A 5CB8A 1G7TA 1XCPA 3EZ7A 2R8RA 1E9RA 1Z47A 1ZD9A 3LDAA 1IM2A 3FKSA 3VHXA 3SQWA 1XXHE 3P4YA 1G3IA 3WNDA 1I4DD 4MYUA 1R7RA 2Z5FA 3IEVA 2O0HA 2GETA 2Q9BA 5KDLA 2LWIA 3W6NA 4ZDWA 2GTPA 4MKIA 1QZXA 3M1IA 3VKWA 4LBZA 1GRQA 1N6IA 3EW9A 2QUZA 1E9SA 2XSZA 4WIAA 2ONJA 3A36A 1JBKA 3TR0A 5J4LA 2KB0A 1OH6A 3ZQJA 2ZJOA 5H1YA 2W2XA 4A6PA 2DCUA 3FMFA 1W4BA 2NTYC 2C78A 4MGIR 1DG3A 4NYJR 2BBTA 2VQSA 1F2TA 2V55B 1KDPA 4V0KA 5HR5A 4GL2A 3DMDA 4Z54A 2QMOA 3KKMA 2QP9X 3TQFA 4DCTA 2L0XA 4KV9A 4PHGA 3W6OA 3KKPA 4F4CA 1Q1EA 2ZE6A 1GOTA 1S8FA 3AVYA 2BV3A 1G8HA 2RGGA 5FPKA 1VHLA 3GLGB 1HUQA 2VRWA 4KO8A 4AKIA 1E2GA 3AEZA 4AC9A 2YVUA 2XEXA 1NMYA 3GLHE 5K8TA 3KJGA 4NDZA 2ZRMA 1E79D 1UKYA 4O25A 4WOPA 2BEJA 4TSFD 1YQTA 1Z8FA 4CVNA 2IS4A 3UWOA 3HDTA 4ZV4A 3PG5A 3REFA 1X8JA 4QGFA 4LV8B 5EXXA 3SFZA 4B47A 5KTYA 2C96A 4DVGA 3I92A 2OBNA 5B2ZA 3IPXA 3SI7A 2W0MA 3I1FA 3UXMA 3GLFE 4DWJA 2GAOA 3IPYA 4XD7D 3VR2A 5BW8A 2WVJA 2C8VA 3U3OA 1WMSA 3TR5A 2WWWA 2VH5R 5G3YA 2PZEA 2WTUA 4XSGA 2GJ9A 2OAP1 2B6HA 2AR7A 4TL9A 4KI0A 2IXGA 3U60B 1E2IA 1LTQA 5C4GB 1T3SA 4HDQB 2JLVA 4TMZA 3SJBA 3B85A 4KSCA 4IVQA 5A4JA 1Z63A 4US2R 4NYJQ 4P0TA 3TIFA 1W0JA 3QKRB 4X8HA 2JASA 3CH4B 2O8DB 2HJVA 4ZCLA 4D4LA 1KDOA 3JZMA 4OBEA 2ZJZA 2QORA 4CIDA 2AWNA 4OJQA 1WCV1 1NVVQ 3TLXA 1B0UA 2FFBA 4KBGA 4Q48A 1HY3A 5G41A 2IUSA 4BUJA 2NQ2C 4RKFA 5DNYB 1PUJA 1KI8A 2JJ1D 2OHFA 4G5OA 4GP7A 1NKSA 2ZR7A 3B9PA 3VNUA 3KXKA 5DH9A 4N0DA 5JS8A 3IHLA 4R2HA 1KO8A 2P65A 4BFSA 3MWYW 1OSNA 4RSGA 4HAZA 5FFMA 4K46A 5DYGA 1Y63A 1R0WA 2H57A 5JHGB 4HZUB 4NP6A 3LA6A 2CNWA 4JLMA 5FBWB 4WA7A 4O3MA 4JLNA 3FHTA 1RKBA 2H16A 3BH0A 4NCNA 2VP4A 4FI3C 1K6MA 2Y8EA 4CYMA 2A3RA 2Q6TA 2JLWA 1DELA 4DCVA 1N6KA 3O8DA 3THWA 2IS2A 4MGKR 3DL0A 1SVSA 3H0KA 5JLJA 3EA5A 1E2PA 4C0KA 1KO1A 5AJYA 2FA9A 5FBQB 2WPDA 2R62A 3L0OA 1FL9A 1Z0DA 3NIBA 3NHAA 1AJEA 4FIDA 5KNDA 1WBDA 2FNAA 2GK6A 3BAFA 4DC9A 4DHEA 2ERYA 3T1QA 4BGDA 3GFTA 4LYFA 1VKJA 2KI5A 1QVRA 1VPLA 1YZTA 4TMVA 2WOOA 3T1VA 1GG2A 2HV8A 1E2JA 2I1VB 4KAXA 2IC5A 4DCUA 2C9YA 1XJQA 3RRNA 3B1XA 1KI1A 3TJZA 1YZUA 3QG1A 4DIDA 2P2LA 1OXXK 3LAWA 4TL8A 1KZGB 1ZUNB 1I4LD 1W49A 4IHQA 2GESA 2QTHA 3KB2A 1PZNA 5GJBA 1KGDA 4Q1EA 4RD1A 4HAVA 1I2MA 2BMEA 3I5XA 1E1RA 1KI6B 1JAIA 3FE2A 3E5HA 1GVNB 4OYHA 3K0CA 1ZM2A 3KFXA 1AS2A 4Q5IA 5BQ5A 4RVCA 2HYIC 1SHZA 4N0EA 1OFTA 1UBCA 1NMXA 4XIGS 1XMSA 4M9ZA 1OLOA 3SYKA 3WRYC 4B2IA 1II0A 3VU9A 2PMDA 4FWIB 1P73A 2PEZA 1GDDA 2JLSA 1YJ5A 4HDOB 3CX6A 1W2GA 1X6VA 4OQXA 4GMDA 4W7SA 4XVQA 1ZVQA 1RRFA 2ZUDA 3K09A 5P21A 4JZKA 3B1WA 4EJSC 1NN5A 5JHHB 3UWKA 1L4YA 4IDOA 4PQYA 5FTKA 4AKGA 1XP8A 1TAGA 4F4JA 3K53A 1P9WA 1YU9A 1RIFA 4DSNA 1N6OA 2ZR0A 3BIFA 1FQKA 4RZXA 3IEUA 5AUNB 2N42A 1JAHA 1HYQA 4YXWA 3U6KA 3TAUA 1U81A 1T4GA 1NIJA 2OXRA 3F0TA 3TKLA 4A2QA 3U5ZB 4JBXA 4QJ3A 3ADBA 1GL6A 2CVHA 4LX0A 2KBFA 4OHYA 3ASYA 5HZKA 2ZRNA 2J0SA 2QT1A 2ODBA 4TYQA 3D31A 5EP3A 5KDOA 2EFDB 4JBWA 1XTRA 5FI0B 2ZJYA 5FR1A 2FEOA 3SBEA 1KK0A 3RS2A 1C4OA 3LVQE 1Z06A 2V6JA 4NHOA 1TTTA 1KJWA 2VL7A 2YOHA 2XB2A 1U99A 2GA8A 2JAQA 2YC2C 1JI0A 1E9EA 4BLQA 4AURA 2W83A 2DB3A 1JEDA 2CXXA 1XZPA 3OAAD 5FUXA 5BYKA 4EJSB 1T8UA 2XZPA 1Z6YA 1N5IA 2FU5C 4BE7B 3U61B 1E1QA 2P6RA 4V03A 1A5TA 1E2LA 1YZQA 2PEYA 1ZNYA 2OV2A 3R7WA 1MV5A 1NI3A 5DE3A 4DLSA 2CVFA 2ZVQX 1U8YA 4KSBA 1S3GA 2C2HA 4GP6A 2OM2A 3KL4A 4PO1A 4Z8YA 2JJ2D 1G8YA 1CJMA 1CJUC 2IXFA 4LHXA 2X2EA 2V3CC 2ZE8A 2ZJAA 3X1YA 3BK7A 2WSSD 2WKRA 2OFWA 4C0SA 3AKDA 1II8A 2OBLA 3TBKA 3TAHA 2XAUA 1OB5A 1NVXQ 1L7VC 1U8ZA 4DEXA 2PLRA 3Q8XB 4MRPA 4F7WA 1RZ3A 1G7SA 2JEOA 3UMSA 5HE8A 4TMKA 4KU4A 1W47A 5JWOA 5CIWA 4DSOA 1GKYA 1T9HA 3HR8A 4Q7JB 3B6EA 2B21A 2QSZA 1IONA 2RHMA 3KKQA 1EFRA 4EPTA 4RZUA 3CZQA 4LJYA 1PVOA 3MAAC 1HQCA 2GXUA 1ZC3A 4P3YA 1R5NA 1AM4D 1G20E 4ZIRB 4NBSA 3AGPA 2RGBA 2CK3D 3ZQ6A 4PPNA 5EZ6B 2AL7A 3B78A 4KXFB 3L0IB 4C7OA 4WXPA 2GZDA 1DAMA 3AVPA 4KFSA 3THOA 4LYJA 3SNHA 5C4MA 2OFXA 4KVGA 2J0UA 2VIIA 3TK1A 1E1QD 2BMDA 1X3SA 1W36C 4LK2A 4XJXA 2NO0A 3DHWC 1QBKC 2BIFA 2KE5A 1FNNA 4POAA 1XDBA 4A2PA 2QQEA 2F43B 4MKHA 1P2SA 4TTPA 5KO2A 2B7CA 3MWLA 1OYYA 4RY2A 4KYIB 1DO2A 1KTVA 1JR3D 2DFTA 3Q85A 3OEHD 4Z1MD 4ZO4A 1DAHA 5EJEA 1US8A 1NY5A 1AQUA 2QI9C 4HZIA 1S9DA 1VG1A 2ANBA 5HTKA 5KPJA 5JECA 3CWQA 1SVIA 4NCHA 5CLLA 4PFSA 4TQUS 3AF1A 3PQCA 5A0FA 5K8IA 3DDCA 3E70C 3OFNA 1BOFA 1U98A 2CJWA 4OHWA 4AYXA 4D6PA 5DLQC 3AQ4A 3WYAA 1TUEA 2WJJA 3ZZUA 2W58A 5FR2A 2JLRA 3E1SA 3U7GA 2YWGA 4F38A 2PJRA 4MDFA 2KBEA 5DHAA 1NLZA 4DLVA 2P5TB 3CONA 2KSQA 3EIHA 3NC1C 2P67A 2HLDA 1ZIPA 4GPTA 1CJKC 1KOFA 2GZAA 2Q21A 2QAGA 3O47A 4Q4AB 1US8B 5FL7A 2ASEA 4JSYA 3NXSA 4PAOA 1XPRA 1HT2E 4LJAA 3B1VA 4WAUA 3K0EA 3J81k 1E98A 3K1JA 3SYLA 2CDNA 2E1RA 3SHWA 1FUKA 3WMFA 4L9WA 5KSOA 2ZSFA 721PA 4AKHA 3GFOA 2H18A 4LBVA 3MWKA 3T35A 3G0HA 1W4CA 3QKUA 2FWRA 4LUCA 2PT7A 2ZAMA 1CP2A 2DYKA 2BC9A 4MKGA 3MWJA 2RCNA 4RD0A 5FUWA 3UMRA 1CULC 1F60A 1G3QA 2FEMA 2IYUA 3KTAB 4FW9A 3SR0A 1ZC4A 5CJPA 4MUBA 2J0QA 5IK2D 5FBRB 3QXCA 4ACAA 5J4HA 1SKYE 4HI0E 3W9YA 2OEPA 1DS6A 3EIQA 1UDWA 4OI4A 2R6FA 4BZPA 3BS4A 1SGWA 3IBGA 4E07A 4TT3D 5TV2A 5JCPA 1N2CE 2I4IA 4CEIA 1R0ZA 2NO1A 1KK2A 2AWOA 3QKSA 4LC1A 1OB2A 3U3MA 3K0AB 3K9NA 5DGXA 4PSVA 3LW7A 3OIWA 4BWYA 2ZI4A 5GADl 2DPXA 4PSKA 4I81A 1ZYUA 4FMBB 1P2TA 4LHVA 5AWFC 3BXZA 2FZ4A 4II7A 4EQ6A 1D9XA 3FYHA 1RW4A 1DARA 4BLSA 3SS8A 1XEXB 2XNSA 3QXHA 5GJVC 4LZZA 1KKLA 1AQYA 2IYXA 1DAIA 3I8XA 4KHZA 5CM9C 2ZU6A 4RD4A 2BBOA 2XTMA 1DOAA 3BFXA 1R5OA 2D06A 3RYTC 2VHJA 2ZI7A 3C16C 2OAQ1 8OHMA 1T3LA 4WZ6A 5L3SA 1NJGA 5DI9A 2G1KA 3NVAA 1NBMA 4QBIA 2DBYA 4U02A 2VSFA 1ZMXA 1AZSC 2GKSA 1LW7A 1FPMA 1G291 2VSOA 2BWJA 2ODWA 3ZIAD 3GJ8A 2Q3HA 2ZSBA 5KNCA 2VHCA 4JLKA 4QGAA 1CU1A 2ZRKA 4YMVA 1ZAKA 3AF2A 1JJVA 4JL5A 2ZRFA 4A36A 4TQAA 3KB1A 4BECA 4NU0A 3AF4A 4O2RA 3CF2A 3NBFA
chains in the Genus database with same CATH superfamily
5FTLA 3MTEA 2ORVA 5D3ZA 1E3MA 2KMLA 1PVDA 2PLNA 3H0CA 4HDNA 1Y1TA 1D7OA 3LXXA 4QOHA 4P81A 1LI7A 3REQB 4A4DA 2E7ZA 3B3AA 1KK1A 2VYQA 3A0RB 3R3SA 2YTZA 4PO9A 1XAHA 1JIKA 4R71A 3JPYA 5D6OA 1PFQA 4A92A 1ZGGA 3FNHA 1OXBB 4MJ7A 4LF4B 2Y27A 4KJZA 1KSFX 1WP9A 2F43A 1SUAA 2C42A 4UKDA 5DSTA 2QTAA 2PGAA 3IO3A 4RAQA 5F35A 2RH5A 4OQPA 4Z51A 1FP6A 3HYTA 2NXJA 2FZWA 4RFSA 1F4PA 3TCNA 3RC1A 2BKEA 1VLVA 2WJAA 4P33A 1EK0A 4RVUA 5JS2A 4FZ5A 2ORED 4GOLD 2PLWA 1XTQA 2OO5A 2FMXA 1Z2PX 3DQQA 3ILYA 3KJEA 4RHEA 2WWRA 3DBVO 5F3DA 1Y8QB 4QTZA 1F0NA 1JLLB 1D2NA 4C5CA 4NMLA 1ZFNA 1YZYA 2Q6LA 2NG1A 4KQKA 4BX8A 5LYJA 5C37A 4Q93A 2IEIA 2XQFA 1XPUA 2I7XA 3EPRA 1H2AS 4OQNA 2BHNA 3HACA 4B76A 3EFEA 1XJWA 3GNTA 3SXUB 1AGPA 3JQRA 1QV7A 3C39A 4V1CB 1GAJA 1AGRA 4TX1A 3UATA 1AGYA 1XTSA 1C9KA 4CWAA 1IZ0A 1OI2A 1B76A 3QSYA 4G56A 2DFDA 2ZJ2A 3NHJA 5GVRA 1BS2A 4I5GA 3UB2A 3G1UA 5K20A 1ISPA 4RQAA 4B33A 2PV7A 1M2EA 2OAGA 3HABA 3A2NA 1XGKA 1JEOA 2A7XA 2ZW9A 4KXWA 5BV7A 1NDUA 3R5XA 4K03A 1N33B 2JHPA 4RQBA 4WERA 1WZNA 2NP7A 2HC9A 3AVOA 4OU5A 4Q19A 4CQLB 4KK3A 3OIYA 2X4IA 2D59A 1U8XX 3OU7A 1GKLA 4S1WA 1LDGA 2MYTA 1A98A 5DTQA 4B4OA 1GTRA 3RAEC 1IBLB 4XWKA 3EOBI 1UFQA 3M49A 1IATA 2ZK7A 2Q5QA 1BVUA 2E85A 1UMDA 4B6EA 5I5EA 4DM7A 4GBJA 8ATCA 5A2GA 1FDOA 1JDTA 1II9A 4OHPA 4LAFA 3QU9A 4IZ6A 4U6QA 2OO3A 2C59A 2QNBA 2DFPA 3DOHA 3BHNA 4MV7A 4LWPA 1DOZA 1JWAB 4H60A 4J9VA 3C4VA 4XLLA 1I4OA 4NKRA 4GUAA 1OV4A 2DHEA 3I4CA 4RTJA 1SB9A 2Y1GA 3SF0A 4LOAA 2J6CA 1FYFA 5G53C 4BRSA 2PS3A 4M7RA 1W5FA 4JL8A 3UJHA 3HM2A 1WTCA 2GVZC 5PGMA 3RU2A 1MOQA 1WDWB 4Y2XA 3QEMB 4AWBA 1F1BA 1X7WA 3MK31 1KEVA 4L51A 4QFBA 3VKFA 1GUYA 1SQ5A 3O9MA 5BVHB 5KOIA 3CUYA 1WX1A 3X1ZA 5LP1A 2ON6A 5EJAA 2B37A 2C5LA 5LBUA 1KJQA 1M8FA 1ZJJA 3KE9A 2HWUA 3L49A 3P0FA 4R68A 5AOBA 2PX2A 2QU8A 2GSDA 3IURA 3WC4A 2XNDD 3GUCA 3D6MA 4HMQA 4OAPA 3RJMA 3BMQA 4AG6A 2QPAA 4A27A 2OSVA 2Z0MA 3MM4A 2XEDA 2B5OA 4LE1A 1VECA 3ZYCA 3DE0X 4QFCA 5DM4A 1L6IA 4JXXA 1SBYA 4UNRA 4ZJZA 5MGNA 2GM3A 1T2VA 1P0CA 2GX6A 2HSEA 4OLFA 3UK0A 3ZS8A 2OL4A 4R41A 3UCFA 1VPTA 2ZRLA 1GGNA 4FFDA 5CAEB 4QHTA 2IUUA 1DMSA 4O2BA 1I7LA 2IBMA 3M4JA 2F48A 4EEXA 2MMGA 1NW6A 5KYNA 4DEVA 1CUXA 3IVXA 1WSAA 4G0WA 4ZO7A 4NRDA 2XMZA 1B16A 3MWGA 5L3RA 1CXZA 1QIMA 3EBPA 3ETDA 1F20A 3V1TC 4YHHB 5JOQA 4N3GA 2YFYA 2C9DA 3PXAA 1IN1A 2WF9A 1Z25A 3ENQA 2UZAA 3DA8A 5DM2A 4Z2AA 2GM9A 3TUJC 1JDVA 1RPNA 1YZHA 2ODPA 4MV6A 4N8DA 2ADOA 1VJTA 2XKBA 3VOAA 1ZA2A 1U3TA 3FAZA 3CA8A 4B75A 4Q7MB 1ZONA 4BNTA 5FBVB 2PXAA 3OT1B 2JD2A 3CCCA 3P5BA 4U6NA 4BB0A 5F1YA 4XWOA 3E0QA 3ZGZA 1OGYA 3ICPA 2WD8A 5LKAA 4D74A 2G0AA 4XVRA 4LE0A 1V6AA 1UQRA 2ZPTX 3LLVA 5TQ0B 3IOEA 4XQEA 4B35A 2JGNA 3NWEA 4RE6A 2H8GA 1XTUA 4DM4A 4R1SA 3MW8A 4EHHA 1P33A 1CR1A 2C5AA 3EODA 3E6AA 4PEVA 4BMOB 2MCFA 4D0LB 2WB2A 3W1VA 1JXAA 2DPLA 3ANMA 4WOJA 1TW3A 3JQBC 4MPPA 3KQLA 2EGUA 4HAWA 1JRLA 3STUA 1AKMA 1C9DB 1DHRA 1WP4A 3BFPA 4Z9FA 1ZVJA 4MB2A 3HGMA 3U3XA 5JRJA 1XVAA 2YUIA 2ZIUB 2R2AA 4R7TA 2VBCA 5JZMA 2ZYIA 3LL4A 5EZSA 5HZGA 4D44A 3RF6A 1UJCA 2QQ5A 3A9WA 3WK4A 2ZT7A 3T9AA 2ZRAA 1RWVA 3HDVA 3G9QA 2WWGA 3LG2A 3SKXA 2Y92A 5FAKA 4GXQA 2AJCA 2VVTA 1UPTA 3DR5A 1RXIA 4KUEA 1C7ZA 3PU6A 5IJ9B 3BT7A 2NU7A 2XDQA 4HUTA 4CL8A 4CF7A 5IVKA 1R66A 1THTA 2MOKA 4OI0A 1X7DA 3UHOA 2X1VA 3WLKX 5J47A 5CLQA 1JHAA 2PBZA 3EMBA 1E92A 5EIWA 3UT6A 3NAMA 4PG6A 2YDYA 1NLYA 3TFOA 4CKZA 3GQVA 2GH1A 2BZ1A 4FEEA 3WLQA 5CA0B 3D7RA 3V97A 1JKXA 3HB4X 1PR2A 3G2PA 1GZDA 4UUNA 1PR5A 3OESA 2HY7A 4LXTA 3R5FA 4U2EA 2IHJA 3E8XA 1Z2OX 3FOFC 5JCXA 1IXSB 2Y0DA 2Q9AA 1NNUA 7REQA 1BMQA 4YRQA 4RPGA 4UUQA 3O9ZA 1MZVA 2TMKA 3PPIA 1T0PA 2OGWA 1E63A 2BMAA 2HCRA 3F1KA 3KJIA 4G84A 3GU3A 2QLNA 4L6IA 4C6HA 1YL7A 5BY2A 2WLTA 4TTJA 5IJAA 1PT6A 2YQ5A 2IWHA 5TMDA 5JQGA 4XUGB 1Z4JA 2C4KA 4P7FA 4ZI7B 4KFRA 2ACVA 2P2GA 1KARA 1QH1B 3EDOA 4B48A 3HL4A 2FXIA 1G3MA 1ACJA 4Y0AA 3GJ0A 3ZDYB 2GJ4A 4M99A 5B2EA 1NVUQ 2A1TR 2JA1A 1VCMA 2UUOA 4IXMA 4RPCA 4PGHA 2ZCUA 2OCLA 1GQ2A 3CF4G 4H3HB 2IYFA 3ASUA 4PS0A 1F8GA 2PQ6A 4X8LA 2BHLA 1N9GB 2WSMA 4G07A 3N2GB 4GOJA 2DY1A 3WGKA 5B3LA 1TZMA 2B25A 3FFWA 4F12A 3VHQA 3MHTA 4UXJA 5HGXA 2V7XA 3RNOA 5DW0A 5HPYB 2O3RA 1X0VA 3K1TA 4I55B 2FRVA 4ND4A 1X1CA 3PD7A 4LXQA 2WICA 1O94A 2POQX 1I24A 1BMTA 2G6TA 4ZV9A 2IS1A 4YMTA 2ERXA 4DCPA 1CJTC 3ZC3A 1T4DA 1XRPA 4XGKA 3UH1A 3TTWA 5CM8B 2JFFA 2FXVA 3ABOB 4Y30A 1CQWA 1MENA 2VP9A 3LC7O 2P2ZA 2F4NA 4JNKA 4D9FA 3PFNA 4IF4A 5LLDA 2X1LA 4PSCA 3EPHA 1P7PA 5BQPA 2JH3A 5L4LA 2H31A 2I71A 2WOJA 3VKHA 3EB9A 4H3SA 1TU4A 4MVJF 3U7QA 6NULA 3OOYA 2TECE 1WCWA 3V2IA 3W5BA 3VTAA 1GPDG 2CGEA 4RFSB 3RSLA 3HCAA 3SR3A 1KI6A 2I2WA 5J2UA 1V7PC 2Q0HA 2G71A 3FYUC 4FCVA 4YCMA 1ESMA 3R3JA 2R2GA 4CM3A 3OJOA 3H99A 1TLLA 2DP4E 5BSUA 1I7QB 3BRWA 4BRWA 2H48A 5FX2A 2RFLA 1EFDN 1H0HA 5BV0A 2BR4A 1L7PA 5AW5A 3LZCA 1R6VA 1JYFA 4AX8A 3DKRA 2M6LA 1AUQA 4YO8A 4UU8A 5DNCA 4B3BA 1GGHA 4V1CA 1RAEA 4L7QA 2A5LA 3PNKA 5I7FA 2JD1A 3OZFA 1Z73A 4MAAA 2IZ1A 3TZQA 1ITZA 2VUIB 1N2BA 3T34A 2BKAA 1OX6A 2FP4B 3CLUC 3T1OA 2EBWA 3VTKA 5JZBA 1ZSVA 3UAVA 4ZWNA 4I4TF 1ESZA 1PR0A 2MSKA 4IIXA 2DUUA 1T0BA 2FHSA 3HB7A 4PXYA 1X1RA 1SUWA 1BA3A 1Q1ZA 2CSUA 2VH2A 2V0CA 3HWX1 4LDZA 1RE1A 1TNDA 2WUGA 3N0RA 3MQ4A 4YLGA 5FWXA 3IUPA 5CG2A 4XJTA 5HKKA 3KALA 2XVZA 4HNAA 3BJRA 2PKWA 3ET4A 4Z4QA 4QOIA 5H4GA 5DM70 2GLUA 3H9BA 3R44A 3PQ7A 1OFUX 4O4HB 2HWWA 3RWBA 2A0UA 1IEVA 1BGWA 4WOBA 1VPWA 2YXBA 1QF6A 1NSTA 1JXQA 1VBMA 2W6IA 1DO0A 2AF3C 5EWMA 4HDSA 3U3KA 3U4QB 1G8PA 2REXB 2R9VA 1OHHA 3P0HA 4LJ7A 1QGDA 2XDAA 5K09A 1W36D 4N3BA 4C7JA 3UGJA 2IHUA 3RSHA 4COKA 1V6SA 2QU7A 4C89A 2P6NA 1FP4A 1BVHA 1CUBA 3DFKA 1LDEA 2Y9MB 2B69A 3ZVLA 2GBPA 3A1WA 3E03A 1GTMA 3D8UA 5GV8A 3TOVA 1HH4A 3RUHA 3H4IA 1IBRA 5CVDA 4DLYA 5KX5F 2W2VA 2YYZA 3QMVA 4AQYB 3UKOA 1N3BA 4OL0A 1Y7PA 3BCHA 4UHKA 5CNKA 3O4RA 2WFLB 4MV8A 4AYTA 4NCJA 3U7FB 1E6EA 4J16C 2YWFA 3WGUA 2WWYA 3HRKA 1DIGA 3KEFA 4ALLA 3HQ4O 3NEYA 3WGLA 4BO5A 2DHRA 1OHHD 1PJCA 5DM60 1EFHA 4R3WA 2DR0A 4G5GA 4INPA 3WDSA 2ZUFA 4Q9AA 2R60A 1KNXA 4F2PA 1KI2A 1JG6A 2XB8A 4WVFA 3PVZA 1X1QA 4XUCA 3S68A 1EWTA 5C5CA 3LRPA 3GZJA 1TQDA 4X90A 3I52A 2H2HA 4Q7KA 3DM9B 4GI7A 3I2GA 4KE9A 4HS9A 2OFOA 1NNI1 1ZRNA 2B7LA 3WNQA 2H06A 4BO6A 1D2MA 2BE9A 3S8YA 5CG1A 1D5WA 2G63A 3G49A 4IM7A 1ZZGA 2PY6A 3DDWA 5JC8A 1ODTC 5K1ZA 2QMEA 1J22A 1IYZA 1YRLA 2J87A 3HMQA 3TCXB 1E62A 1NYRA 4GYJA 1UF9A 1N2JA 1VG0B 2BMFA 2O2IA 1BROA 2IPMA 3F6EX 2X5XA 4RV4A 1F6WA 3QOFA 4V02A 3TQIA 3OO0A 1NPDA 3HNPA 2GN4A 5BNZA 3KYDB 2UYGA 4QEKA 4A8JB 2D0OB 1UT6A 3GLGA 1GN9A 2P27A 3KDPA 1S2NA 1RYZA 4KXYA 1KR2A 1XXLA 1X15A 4EYSA 2PX6A 1EDOA 4D4MA 5D5PA 3L8HA 1W2HA 2VCEA 2YNMC 3AUJB 3IQDB 3PT5A 5ICMA 3UZUA 1OFIA 4MZXA 1T36A 3WL3A 1QZZA 2XNJA 3LGXA 2VZ0A 3OQHA 3TDNA 2BCGY 2CHQA 3P8ZA 3PGLA 4WNAB 4F45A 5C0OE 4JJ7A 2I1WA 1N6PA 1NNSA 3G0OA 3I3SR 4FS8A 4EHDA 5J2UF 2QR2A 2DZDA 3QVTA 4O4JF 4PONA 4R0NA 5EWLA 1JN0A 1RWWA 3FMPB 3E7WA 2IWRA 3PX7A 3C1TA 4L4ZA 2REBA 1SBZA 1K8YB 2G9VA 3EXIA 4AW9A 1XNGA 5LP6B 3DAFA 3E5NA 1K8RA 2Y1CA 1PE0A 2N46A 3GWZA 3NTVA 4LYGA 4MPDA 1RACA 2X2FA 4NH0A 4XB1A 2ADMA 5C31A 3TIVA 3E4CA 3JQAD 2XKKA 2P6RA 4XM2A 4CG0A 4G0OA 1SBIA 2CDAA 3PRJA 4IAOA 3OI7A 1ODSA 1OXKB 4D3SA 2OR3A 1BHO1 4UHFA 2BMJA 2QN6A 4QDJA 2NUTA 1MW9X 4QODA 4UATA 3ZEAA 1PJZA 2NYRA 3B7PA 1N9KA 1OVGA 3OIUA 3M9XA 2P40A 3LPMA 3PNSA 2AG6A 3R9XA 1M1YB 3JAMA 2ORWA 3OTHA 1BQEA 1ETUA 1WXQA 1ULTA 1NJFA 3FCEA 5DHTA 4EKDA 3DDOA 5E3JA 2GMWA 3RROA 3DD1A 1JIUA 1LI5A 1P1JA 4IGIA 4UEQA 5I9NA 4J1TA 1XLWA 4DCNA 4M1KA 3CEPB 4PLPA 3E9NA 4OHBA 5ESXA 3Q4GA 2NACA 1B2RA 1R0SA 1PV1A 2R1UA 3KSUA 3O8NA 4KYUA 2RMKA 4LV5B 4XAQA 4G1EB 4FNAA 1J9EA 4D81A 5E2AA 3WAGA 1LSUA 1EB8A 2GT1A 1CFJA 3I42A 1TEHA 3V3TA 2YWJA 4EW2A 3ASVA 1FMCA 3RAFC 2CF5A 1ML4A 2EF1A 1Y8ZA 1Z56C 1H6DA 1OBFO 1T6BY 1FTGA 1QJ4A 1XC7A 621PA 1O7JA 5AVZA 4G5XA 1J2JA 1SY7A 1TXGA 4Y2JA 2I33A 1CZKA 4R2XA 4B2PA 4N6GA 2JAXA 2GPTA 5DHPA 1XJCA 3CNLA 3WFZA 4OHMA 1YKFA 2NIPA 3C4QA 1KHHA 3DVAA 3EGXB 3OFJA 4GD3Q 3KPUA 3HYCA 2NO6A 1VBNA 4QBKA 3L8FA 2GASA 1NQTA 1RT9A 4PXAA 4PG4A 1L3BA 2Y1LA 3O90A 4W9NC 3NPMA 1RWQA 3RVBA 3FPBA 4LFBB 4K9OA 4BNGA 3ETGA 4Q3KA 4IJVA 3QEBZ 1GNPA 1RD4A 2QG9A 2X5JO 3CPHA 1NULA 3EG9A 2YV5A 4IEIA 3RS7A 4AJOA 5HWSA 3A9VA 2JH9A 4BO3A 1XZCA 4DA7A 4EUNA 4PC3A 4DBVO 1IHXA 4IGEA 2XMGA 4IWXA 4RKRA 1HETA 2CYCA 4BLRA 5KYYB 4HLNA 5LMCA 3ROQA 2WG0A 1GILA 4BMDA 4GS5A 4HQFA 4M0DA 2V3WA 4ZOLB 4RA6A 4DLNA 3A1SA 1Y37A 3TOZA 3R7WB 2HDOA 2IVFA 3D6TB 4IO1A 3ZK9A 1OV6A 3IV9A 3AH8A 4H1WA 4JXZA 3CNNA 3F5MA 4L5JA 4NH4A 3AI1A 3FGZA 1KY3A 2A0FA 3REQA 3RS4A 3GCDA 3F9IA 4ZCPA 3SOZA 3HSKA 1GRVA 2EYUA 4L8GA 4COOA 1KMQA 2VJMA 1Y4SA 3MTBA 3HEBA 4GEKA 3LLSA 3UAYA 4IFEA 4A6EA 3MJDA 4DV0B 3TRDA 4EW1A 3C8MA 4ZT4A 5KKCA 1TKBA 3E82A 3ZV7A 4JBLA 4YT2A 4U39A 1FX0A 4E5DA 1XTTA 3CPEA 3G0GA 1IZYA 2GNOA 3Q5EA 4UAJA 4D9NA 1JGTA 3GJ7A 2VJKA 2AN4A 3L9XA 3PEVA 3SNKA 5IEJA 3RTDA 4CM4A 1X80A 2KJQA 1QGUB 3GVCA 3PQDA 3R7FA 1A82A 1YR2A 1L5RA 3TQSA 2PO5A 5AJTA 2XJ9A 4M9UA 1N8TA 1U0GA 2HDNB 2OOSA 1P0QA 4R51A 4CFSA 3FMOB 3IT3A 4X1KB 1FTWA 1WMBA 2WINI 1VYTA 1F8XA 2BL4A 2VJYA 1Q6ZA 3RC8A 2IEZA 5FT9A 2F1KA 1WZCA 3T52A 4LJ9A 1KPHA 1IVYA 2WSYB 4BE4A 2ID8A 2L17A 3KT6A 3SIPA 2GBCA 2O3JA 3U62A 4Q7LA 1FOEB 2AFIE 3BMNA 2ODEA 2PR7A 5BWOA 4TWBA 1CZLA 3EQ7A 4F93B 4GT1A 4AF8A 2Z6QA 1W85B 3DXXA 4GVPA 3KZOA 3HUEA 2QRVA 4DAEA 2ZI9A 1R5BA 1CR2A 1SOUA 4W6QA 1U0EA 2FZEA 1KWGA 4AVYA 1QO7A 3FXAA 3SZ3A 2ZEJA 3FVVA 1LPBB 3CZPA 3TUZC 4G4IA 4QBFA 5BUSA 4UHDA 4JBIA 3FDIA 1NM5A 2V96A 2GZ3A 4Y9SA 3PXGA 1W5SA 5ALSA 1V16A 1XRLA 1UBEA 1RR6A 3LP5A 4FNOA 4Q3BA 3QVJA 2C2WA 3UK1A 3VO8A 4ARBA 3GN2A 5IF9A 5U4QA 1TF7A 3DMTA 3F90A 4N3CA 2NNWB 2OY0A 4K6KA 2HZBA 1Y5MA 4IDHA 3GELA 5A7GA 1W0KD 3KSBC 1UK9A 5BN3A 2QTWB 1V71A 2QW0X 2VEOA 4MEAA 1C8VB 1ZKMA 4PCLA 1RQNA 3BD8A 3EEOA 1BDIA 2VQFB 4LFCB 1M74A 2IXAA 4F5ZA 2YUTA 5EXDA 5IC4A 1B74A 4RK4A 1H94A 3VDRA 1E2BA 2WFLA 2W7TA 3K20A 3EFBA 3UAWA 3OLYA 2J0EA 3DVRX 3K3PA 1LY1A 4UNNA 2QVYX 2YR0A 3KR1A 3KUDA 1KE2A 3NTLA 5H5JA 1V9LA 2UVQA 1VXOA 3D59A 3HN6A 1T4MA 1EBUA 2BP7A 3MCTA 4UFOA 4IJ5A 1IN4A 3L3BA 4M9QA 3T54A 4I5FA 5C1BA 1Z0IA 4BASA 2PZLA 4A9AA 4W1RA 3ZHUA 2X58A 4N3NA 5G4LA 4Z3DA 2XBMA 1UAGA 4AN1A 5F64A 2RHOA 2WJHA 5AQ1A 4R1UA 4IOLA 4KDFA 2BT4A 3JRNA 4LDNA 4UBLA 4FYHA 5TMBA 2Y1OA 5DBEX 1MAVA 1CKEA 2JK0A 3BIJA 5FUQA 1W0CA 4GLBA 2NWQA 3RUIA 3ZHVA 1L1RA 3BIXA 1BXRA 1K3TA 4CMIA 3DKIA 3PNMA 1M7HA 4TN5A 2HF8A 3AEUA 3D5EA 3QYJA 3K8YA 4HVAA 1L7OA 1O58A 2OA0A 2W6JA 3L8YA 1MR3F 5JC1A 4X0EA 4FKBA 3AY3A 4RD3A 4UTZA 1B73A 1QQ6A 4IYJA 4K2AA 2XOKA 1WXDA 3L1UA 4OGFA 5J2UB 4LF7B 4PYRA 3W4JA 4M22A 4RJKA 5D2CA 5K2OA 2IF2A 1VKNA 4D2IA 4D4KA 4BO7A 1DQRA 3TW0A 5AJXA 3MGGA 2VZ8A 4CEJB 1U9YA 3KQYA 4HQ6A 4HATA 4IDBA 5D3MA 4DCSA 2A9RA 4OFBA 4EB0A 4LI3X 1C7IA 1RQGA 1W75A 4GQIA 4DWWA 3UA3A 3Q0EA 2AHOA 5HX7A 1SAYA 2YXDA 1RYFA 3H4TA 2SCUA 2CYAA 2PWBA 2VA8A 4AS1A 2KW5A 5EHXA 2OD7A 3HEMA 3RF7A 1K63A 2I7VA 2O6LA 3UHFA 1NW9B 1DPGA 3WYFA 1QHGA 1EDZA 4L5CA 2RK4A 3HP7A 4BGIA 3BF7A 3QVUA 3IPAA 4YALA 5HCNA 5ALPA 4O5AA 1T10A 3OFKA 4QDTA 3ANYB 4CIYA 3GPLA 2AI3A 1JJ7A 4G5SA 2BGUA 3WB1A 5T5QA 1HPLA 2WF7A 4QM6A 1D6SA 2K4MA 5DU2A 4C05A 3DXZA 3I0NA 1H1LA 5C32A 5JSZA 3EAQA 4ZCMA 1JALA 4J1QA 3DXFA 1ZK2A 2Q4BA 4WEOA 5EERA 3T3MB 4OQYA 2QIOA 2ZJ5A 2X15A 3K8ZA 2ATCA 4QDUA 2GZRA 2NTEA 2HSJA 3O8BA 3ZN2A 2GZ1A 3ZE0B 3V7NA 2RJNA 3IXLA 4C20A 1XEAA 4Q3CA 3W6ZA 1Z7YA 4CF6A 1V3QE 3LUGA 2QYTA 4N4AA 1OIVA 4BO9A 4EELA 3AIKA 3DUFB 4WZBA 1GNQA 2Q4OA 2ZETA 4IVRA 2CXRA 3FKSD 4TGLA 1WKBA 1Q7TA 3A4TA 2KWIA 3DZBA 3G2OA 3JQ8A 4YMIA 1ZGBA 2G3YA 2QTGA 3NVKI 4K2HA 4EFNA 2LXNA 1JQBA 2PL3A 1PTJA 2D5CA 3WRVA 2IYLD 4LJ6A 4BYMA 3IAHA 5A6SB 3DOFA 4TV8A 4ER3A 3AX6A 3CB2A 4US0R 3W77A 1FSFA 4HRVA 4Q3LA 1B1AA 1LVGA 1G1MA 1OR8A 1MO5A 3A4NA 3H8JA 1Q7BA 1X1AA 3FSRA 3Q9NA 1JNXX 3TR6A 4B0OA 4ZFNA 2I4MA 1LB1B 3LV8A 3O95A 3L6EA 1BX3A 4L95C 1XXHA 2ONKA 4IDAA 5IFKA 3P9PA 5F52A 4J0GA 1WOMA 1L8LA 2R5FA 2VBIA 4JS0A 5CTJA 4FZJA 2V45A 3A58B 2VF7A 2M6KA 1PK8A 4F4FA 3CUVA 2Q3LA 1KYZA 3CPSA 3MFQA 3PC8C 4MKZA 4WV3A 4ROSA 4BQFA 2PK3A 1AS0A 3TL2A 2I7TA 2HA2A 5LXTF 4X1OA 2DH6A 2YRFA 4TXJA 5IDVA 1SXJE 3NU1A 4NV0A 3C1UA 3RIGA 3V7FA 2ZTSA 3O84A 2D3TA 1VJGA 1G8GA 1QVZA 2VRNA 3GLHB 4OIMA 1X86B 4TUYF 1N32B 4M88A 3HGQA 4KQWA 4L76A 4BB5A 2OECA 4FE3A 4LDJA 2CUNA 3WIVA 4CTOA 2ZM5A 3OP1A 1YA4A 2C9CA 2QJOA 3A70A 3C6YA 1QQBA 1W88B 2WILA 4RESA 2WUFA 3MYYA 1SFRA 4M8LA 2CUKA 4FN4A 1Q50A 3FYTA 1S0UA 1ILEA 2WIGA 4OP1A 3KX2A 1RDFA 1BQ3A 1FTQA 1GPLA 3BTVA 4OHVA 3RKSA 4B3DA 1DFHA 1HQYE 5BSFA 2VPXA 3HO6A 3VM6A 3JW8A 3O31A 3D8HA 3QPUA 3Q7PA 4E22A 1I7PA 3N6RA 2ZCVA 2HGSA 1TKCA 2H6EA 5BNIA 5KU1A 5J58A 2W5UA 2DBZA 5HIAA 3ELUA 2CEKA 4N41A 1TGYA 3C3WA 3U7QB 4LXHA 3IQXA 1SVLA 2I66A 1I1NA 1X7ZA 2IU3A 3TLBA 4DXAA 1EESA 2INGX 4V0RA 4R7ZA 1PU2A 2QM0A 1W4AA 4C2TA 3MTIA 3MINA 4YPVA 4GR5A 4C1BA 1KYQA 2IKQA 3O1JC 4ENPA 2XZLA 3R3ZA 5DJ5A 2IV2X 4YXWD 4JMPA 1NGSA 2CF6A 4U3JA 3K5HA 2R84A 4Q00A 1KI4A 1UBGA 4NCBA 2PGLA 3HYLA 4NC9A 2PMEA 2VK4A 5BSGA 3SZUA 2JGJA 3AF5A 1IL0A 3MVEA 4RDHA 1K5DA 2CVZA 2IOYA 3G2IA 3KB6A 1JSXA 2ZVPX 3MERA 3PFBA 2XRYA 3QY9A 2CL6X 5CP8A 3BGIA 2IXDA 3M1LA 4MYHA 2H00A 1K9SA 1DIAA 1ZD5A 4MARA 4AP5A 2GFIA 5U4XA 3LWNA 3ZCVA 1VA5A 1WHSA 1SOAA 3BWMA 2FPPA 3HSYA 1PZMA 3QLEA 2VYCA 4MA5A 5AXAA 1CIPA 3F3KA 4MP8A 3GDFA 2O8FA 1GCIA 4OP3A 1EXMA 1J9ZA 4O2BF 5EUQB 5ARBA 3KSAC 3ZVRA 1D2CA 3PE4A 5KYWA 5DISB 3ESQA 4Z1MA 3WWEA 1KBZA 2JEYA 3SG0A 5JNSA 1OXVA 3DEIA 1IC6A 4TLDA 2AFIA 1N7HA 1T4BA 1EE1A 2FF7A 2ZB7A 2FPMA 2AG0A 3AUTA 3ILVA 3P2IA 1D6MA 1FNMA 1VKRA 2AG8A 3D7KA 3EVGA 3MB8A 4I1SA 4YO7A 1O97D 4EO7A 5ALKA 1I2CA 1L4HA 5J43A 5J2TF 3H7AA 2NU6A 1FSSA 2DE0X 2GWHA 1QGYA 1Y3HA 2Z30A 4HWOA 1J4AA 4KMRA 1N5LA 3OZSA 1ECJA 2DFLA 1GR0A 3CRMA 3E5RA 3M2TA 2BKVA 1WHTB 1ZOPA 2VCYA 3NV9A 4QDOA 3W5SA 1P4SA 4XA8A 3FX2A 1KIFA 5BWNA 3W7AA 1QTNA 2PZGA 3FPJA 3JQDA 1YBAA 4N03A 1Z13A 5JLAA 1CQPA 1QMGA 3B6IA 5THXA 4CIVA 3HY6A 4CRWB 4YV1A 5CCXA 4KVFA 1LQUA 2GQ0A 2GLXA 1YFJA 4RPIA 4KEAA 1U9ZA 2VYVD 5DHFA 2PFKA 1ZCBA 3PKIA 5FBHA 5JW6A 4DBZA 1HE5A 3I0MA 3O1IC 3NWPA 3GLGE 2V6IA 3KXLA 2OBFA 3ITNA 3NAQA 5E7MA 1VSVA 2J33A 4YV0A 1DKUA 2GKGA 5KTPA 1GPH1 4RXMA 2CB9A 1RWNA 1ONNA 3EASA 3DBRA 4MW0A 1BVYF 2G17A 3D4IA 4LXYA 3TG2A 1NQXA 4BP3A 4E5VA 5JCOC 3T15A 4C4PA 4G0XA 1XD8A 3ZV5A 1ODKA 1Z26A 2O52A 3QHAA 5THQA 1YI1A 1YRBA 1GIAA 2K87A 3ZDZB 4I5EA 1B7GO 1ORWA 1M2NA 1R50A 3COVA 4G8DA 2D0DA 4RVDA 1U7WA 2ZUVA 1MO6A 3TSAA 3ZE9A 4LCBA 2A9QA 1GXSA 1CUYA 4S1VA 1W2WB 4Q4CA 4XFJA 5CDUA 5AHOA 5DK4A 1T9GR 1D0VA 1LH0A 1JP7A 2Q8QA 3ETNA 3GH1A 3G2KA 4UFPA 821PA 4ZHSA 1WPQA 2QMYA 1KQOA 3O3NB 3PNQA 1EBFA 4JOSA 16PKA 3KV1A 1P0MA 1Z5GA 5A9SB 2ZJBA 1X80B 1Y9AA 2QLLA 3MT9A 3UB4A 2LE0A 4A1FA 2A3NA 2ZWVA 3KP1A 4WW0A 4Y18A 2B83A 4C2BA 3C3CA 4H1VA 3RK4A 5JARA 4LECA 4YV2A 1G6KA 3A1TA 3QEKA 3SHFA 3QUQA 4BVLA 5BW4A 3OOHA 4MYSA 3K70D 2A5JA 3QVGA 3QYFA 3IQWA 1GARA 4P38A 1KWKA 4YP7A 3MLEA 5DCYA 3GRAA 5E6SA 3QFRA 4NCIA 1OIXA 2ZYDA 3TQTA 2J8ZA 2DHCA 4ZEXA 3V4VB 4YLEA 4BVAA 5ALRA 1UWKA 4DLKA 3BMNB 2YRWA 3H5LA 3PI6A 2YCBA 2PJUA 5SZJA 5A06A 3CSSA 3WIUA 5IHXA 4HGPA 1WLYA 4FGLA 3GG9A 1GY8A 3IR6A 4LZLA 3WYEA 3KDAA 3QPAA 4EHNA 5AUPB 2F64A 5DGCA 2X7HA 4CUJA 4YRIA 3WMRA 6PFKA 2NNLD 1USUA 2H2AA 4GWLA 4EA6A 5JATA 3OHPA 1M2FA 2C9ZA 3Q2KA 1S3SA 3FB4A 1Q22A 4XW2A 3W5HA 1BHJA 4Y2YA 3EX7C 3DE7X 1V16B 4RD2A 1RIIA 4RZQA 1XRQA 3T5TA 4L9AA 5DLPA 3ZNOA 2DR3A 4XZ3A 2VPYA 4MQLA 1B4DA 2XHZA 3GJ4A 5HUHA 3ZVNA 1TCUA 1HE2A 4QQNA 1A7AA 1EUZA 4FZVA 1I3CA 1YJXA 1OWNA 3LHFA 5TR9A 3SF8B 5CFMA 5JSUA 1H65A 1NRXA 3QMPA 1JEYB 1C41A 3QPCA 3OX4A 4XKJA 3WJAA 4BQPA 3G79A 1VHWA 3ZHZA 2G70A 5L53A 1LI4A 1PO7A 5CH5A 2PO7A 3B82A 4BVEA 1J0XO 2PH5A 3OQIB 5JYDA 1DCMA 1PD1A 3JQGA 2FYTA 3EHDA 4FQ5A 3KK0A 3CLTC 5LXTB 2IY8A 4FYWA 3MQFA 1VSBA 2I55A 3VSCA 1RFLA 1Z8HA 2IYTA 2OZEA 3CGWA 3E7FA 3WX0A 5JRDS 1PL8A 5BSEA 1ZQ1A 4M21A 1NTRA 2YN2A 4G0YA 2ACWA 2ZYTX 4CV2A 4JAVC 3LHIA 2JLCA 2ZT6A 3ZW7A 3AUAA 3U1BA 1E8DA 2DSNA 1IIRA 1G21A 1JPJA 3EH1A 3F71A 4J1SA 2HOQA 4X97A 3VR3A 1KEEB 2FPRA 1FTYA 2AD1A 5EL0A 3W5VA 3QOYA 5B3KA 3KEOA 1QHNA 2O8VA 1PYGA 4S1TA 5H9VA 2YHSA 3G0DA 3VU0A 1YACA 3P97A 1HA3A 1TVMA 3Q40A 4P83A 1VP3A 2VLIA 1KZ4A 4PC1A 5EKTA 5CVEA 2VT6A 3Q9LA 5C8VA 3FZGA 3E1GA 2CXUA 3DBIA 4WE3A 4BQEA 4YUZA 3U56A 2I87A 3F6SA 3H1BA 2JCBA 4DSZA 3AM1A 1FXWA 5BMVA 2CLKB 2GBGA 1X39A 4NZYA 4OREX 1P8AA 3AEUB 1JU4A 2FX5A 4MITA 2GN1A 2OLKA 2VJPA 2BEWA 5KBYA 4ARIA 4DBLC 1KFEB 1Y8CA 2WKWA 3EXG2 4K6GA 1ENPA 4PM4A 1YDGA 1YRYE 4DQXA 4DIMA 4XCQA 5A5GA 3GAMA 4BZQA 5GVSA 1G18A 1MDFA 2CCJA 4FYMA 4EPXA 3KIPA 1LDMA 1SZDA 1U0SY 2OGZA 1KZYC 2ZDQA 3IIMA 4LSWA 2A6PA 3WMGA 1KPIA 4RABA 1VQ1A 4DRYA 1VIYA 1YDEA 2HEIA 3ZXYA 4AQDA 1Z4KA 3EQ2A 4JENA 1LCIA 1VGRA 1YE8A 2ECFA 3JATB 3O2QB 5C35A 1RHRA 5IN4A 1RXSA 1ZWKA 2BLNA 3FMVA 4J7UA 2H1WA 3UBMA 5F98A 2F3TA 1PT8A 3K35A 2FX3A 2PL1A 2GD2A 2OXCA 3T41A 1KMMA 2AA3A 2EZ9A 2EFJA 2HX1A 3C4JA 4QGBA 3V7UA 2CY0A 2Z3VA 3W6PA 4B71A 3S70A 4GSYA 1YZLA 3S27A 2G5PA 3KUXA 2G9QA 5C3UA 1M67A 1IY0A 4YAFA 2X0DA 2BJHA 5EFOA 2FW1A 3UOGA 1I5RA 3MT7A 1XZMA 3LKVA 4RNDB 1EG2A 5I47A 4A15A 1XEFA 3B3JA 3FGPA 4MVJH 1TOAA 3CWCA 1VFNA 5BSVA 3ZGLA 2Q1TA 2VDWB 3CMMA 1YFKA 5ELLA 1GEEA 4MUXA 3V6LA 5KYKA 5ALIA 3AB8A 4TYMA 1FDTA 3R3VA 3MGCA 2IZ5A 3UJDA 1L7MA 4JT4A 2Y4OA 1G5HA 3RSSA 5B7PA 1D8TA 1G7RA 1ONPA 2HZ7A 3DC2A 4RUKA 1EZ4A 1E0SA 2GXQA 4XWAA 4EKGA 1P4GA 1AA6A 1GPJA 2R00C 1KEPA 4O08A 3KZVA 2O1EA 3UPDA 2OB1A 2QTCA 5KIAA 3NR2A 4CODB 2IEYA 5HRUA 3PEUA 2C2BA 2P2YA 2WU8A 1IK4A 3IUEA 4GMGA 4HN9A 4KIJA 1I4WA 4PYKA 4Q9KA 3BWCA 4PZLA 1JR6A 1DKPA 2AJDA 3EDQA 3M3PA 4JSRA 3OPVA 1W5TA 1TIPA 4ENTA 2C2ZA 3PGMA 4WBNB 4XB6B 2G36A 5IANA 3BPSA 2VCHA 3IYLW 4NI5A 2YNMA 2JI4A 3NKVA 4PYJA 2DEUA 3UK6A 5ARDA 1VM6A 2J5RA 1Q20A 2I6UA 4WX2B 5CNMA 3GLIB 1QONA 3CWZA 4UXIA 1Z4NA 4ALJA 2FF5A 5FWYB 1NBEA 1KOGA 5FCDA 3GJQA 1QE0A 1EXWA 2XJ4A 3VYWA