3I5YA

Structure of mss116p bound to ssrna containing a single 5-bru and amp-pnp
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
509
structure length
509
Chain Sequence
SKLIHVPKEDNSKEVTLDSLLEEGVLDKEIHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLINTKFDSQYMVKAVIVAPTRDLALQIEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPNIVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKNSKSADNIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKFANSIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVRELEDAKNIVIAKQEKYEPSEEIKSEVLEAVTEEPEDISDIVISLISSYRSCIKEYRFSERRILPEIASTYGVLLNDPQLKIPVSRRFLDKLGLSRSPIGKAMFEIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Yeast DEAD box protein Mss116p reveals two wedges that crimp RNA
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
molecule keywords ATP-dependent RNA helicase MSS116
total genus 194
structure length 509
sequence length 509
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2009-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3i5yA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3i5yA02
4G01B 2DHRA 2FEMA 5E95A 1OV4A 4V0LA 2R6CA 3AP2A 5TMPA 3RS3A 1S9HA 3NHAA 2F7SA 4R71A 4FIDA 3ASZA 5JS8A 3IEUA 4PC2A 1WCV1 1ZYUA 3SI7A 3CO5A 4XH9B 4F38A 3TAHA 4OQMA 1OHHD 4BFSA 3FKQA 3NHBA 2GDJA 1G3MA 4TLCA 3AKEA 4XIGS 2DWPA 1ZC4A 4JT2A 1UBEA 4AYTA 1FW6A 2EFCB 1JJVA 2ZIAA 3EXAA 4HYYA 4PSKA 4R2HA 2QTVB 4B3XA 3A1VA 4V0ME 2PX0A 2FPMA 2XAUA 4D4LA 2QTFA 3RS2A 2CLDX 4D4JA 1EX6A 1WMSA 3GJ7A 1IN5A 4MH0R 2PCLA 1BYUA 5J4LA 4P0TA 2DR3A 5FTNA 2YC2C 4CEIB 2EU8A 2IC5A 1KY2A 4IFEA 5TV2A 1E99A 4L9SA 1SVWA 3K0CA 1AIPA 4MUAA 3AVWA 2XOKA 1Q1EA 1XD2B 1DVRA 2YWGA 1L4UA 5TVKA 4X8MA 2FF7A 2FZLA 5KDLA 5FOVA 1MRSA 3C16C 1E98A 2GVDC 3BRWD 5FPSA 3U7HB 1NMYA 1G1MA 5DO9A 2OBMA 5B58C 5AUNB 4TYYA 1AS0A 4AWXA 3CF2A 3IBYA 1GDDA 3VHLB 5EE1A 4AKIA 3FGNA 5FH9A 3MLEA 4HLQB 4LJ5A 4NCIA 3WP1B 4DB4A 1W48A 4S35A 1GUAA 4A0FA 5JCZA 2XTZA 5SZKB 3EPHA 4LHZA 2O8EA 1GG2A 1EK0A 2DYKA 2RHDA 4QBGB 5HZHA 1DADA 4I99A 3W6NA 4IOKA 4OQFA 1RE0A 1I2MA 3A1UA 3P26A 1CJUC 4TZ0A 3DDCA 1VHTA 1XJ0A 4IVQA 1MR3F 2G83A 1QVRA 3CWQA 3OEEA 4IDQA 4L16A 5FI1B 3QY0A 1RRPA 3RRZA 2AFIE 1KDTA 4JJKA 3TSZA 3ZZUA 5CLLA 2R44A 5TB5A 4YMUA 1Z06A 4F4IA 1SXJC 3B78A 5CIQA 3LWNA 2GTPA 2YOFA 4PZLA 5JZVA 4LJ4A 1E79A 2REXB 1VG0B 2BKUA 5G41A 3OESA 5HCNA 4EFLA 2MSEB 2R6FA 2X19A 1JALA 3A1SA 2ODBA 3NDPA 4HATA 4MYCA 3VU9B 1R5NA 2CHGA 3QF4A 3BBPA 2KBFA 1YZLA 4B71A 3IGFA 5FL3A 3NBFA 3ZJYA 2KI5A 2JLUA 1R0ZA 2BVNA 2ORIA 4BZPA 4BQSA 3QXHA 5FL7A 1E9RA 1ETUA 1XX6A 3JVVA 1TQDA 1LNZA 1X8KA 4B48A 1XTSA 3TSWA 4LJ9A 1QHSA 2P67A 3HPRA 4BZQA 2WKRA 4JLMA 3KXKA 3OFND 1DEKA 3O8CA 2WZQA 1G5PA 4S2EA 2GCOA 1BS1A 1YU9A 2E1RA 1D9XA 2ZI9A 2EFEB 5DE3A 2FPKA 4NHOA 1FNMA 1HYQA 2ZSBA 4QNMA 4EPWA 4JL5A 4EUNA 4KVGA 1FX0A 4TTQA 4DIEA 4JLAA 1IXSB 3FFAA 2HUPA 3O8DA 3PIRA 1CJMA 4DUGD 1CJVC 2WWHA 1SVMA 4DRZA 4DEXA 1JPJA 3L0SA 4MRSA 2PZGA 3GCGA 3OFNA 2CMKA 3OIVA 1US8A 2OAQ1 1NL3A 1KZGB 3BIFA 4B35A 1XPUA 4C7OA 2GESA 2IEYA 1BMFA 2QG6A 1E2DA 1ZU4A 4EQ6B 2IYSA 1E1RD 5EUQB 3EA0A 2P65A 3I3SR 3BD9A 2HJVA 3LRPA 1KI1A 3L43A 3RRMA 4MDFA 4OKSA 4IJMA 1P2UA 2IX3A 3TGPA 1E2HA 3EA5A 4Q21A 5EE0A 2KSQA 1GM5A 2A5GA 4CT5A 3RRNA 3EARA 2F43A 2OCBA 1XB2A 5AJWA 2ATVA 3K0EA 4BFTA 5L3QB 2C77A 3BGWA 5FR2A 3UKDA 1J8YF 1M7HA 3Q5DA 1QVAA 2QRNA 3CNLA 4R98A 2CLSA 5FTKA 4R9UC 3TAUA 3I32A 3I4LA 2VP6A 2WM9B 1UEIA 1IBRA 2Z4SA 1ZD9A 2N46A 2XITA 4WXRA 3AVQA 1W2HA 2FA9A 2UZ3A 5C2JB 3WNDA 1E1QA 3GQBA 1N6IA 2Z5FA 4DBLC 5IDVA 1DAGA 4G5QA 1M1YE 4BLTA 2PH1A 1Q1BA 4KAXA 5CK5A 2ZUCA 3MWKA 4LZZA 2FOLA 2BCJQ 1SQ5A 2HF9A 2VHQA 3SNHA 5J4VA 1KJYA 721PA 1AKYA 1D9ZA 4JMPA 4B3BA 1XTKA 3N70A 2CE2X 3AVYA 1G8FA 1S96A 4KFTA 2J3EA 3AVOA 4DB2A 1K6MA 4OHXA 1KAOA 4NTZA 1LS1A 4OK5A 3WY9A 1E4YA 1MO3A 1TF7A 3TE6A 2GEVA 1PLKA 3LW8A 3UIEA 2V8OA 5EXPA 4OK6A 4MRPA 1S0UA 2JDID 3T06B 1JB1A 3EZ6A 2J7PD 1TF5A 4LJYA 3RS4A 2QAGA 1N6OA 5M04A 1DO2A 4HZIA 3IPXA 1XU4A 3I1FA 1MT0A 5B64A 3UWOA 3TIFA 5FBVB 3Q3JB 1ZNXA 2WAXA 4U00A 3E70C 5G53C 4QXAA 3T1QA 3IQWA 2X8AA 4ZDIA 2FNAA 3CKLA 1T8TA 3RNLA 3TMKA 1TU4A 5FPHA 1IN6A 1CTQA 1EG7A 3REGA 2EWVA 1R4AA 4PO8A 2DPXA 2DFKB 5J40A 3EZ2A 4H1UA 1HA3A 4QHSA 1JAHA 5DGXA 3HR7A 1NVXQ 1XCGB 2OLJA 3CH4B 2PL3A 2AX4A 2QM8A 3T15A 3X2SA 4KYIB 1UDXA 2O0HA 3E1SA 1SVIA 4IFBA 3GLFE 1H65A 2ZJBA 2A3RA 4UJ3A 5A0FA 3LQRA 1E1QD 1CEEA 3QG5A 1XTQA 1ZRHA 2FZ4A 2J0VA 4JS0A 2BMFA 5EUMA 2HT6A 1KTVA 2W0MA 4A8JA 2WOOA 3FKSA 1N6RA 3SHFA 4Z54A 4C0HA 2IW3A 4TQ9A 1KI6B 1Q21A 1FUUA 3W3ZB 1DG1G 2OXCA 1BIFA 2OT3B 3NEJA 1KMQA 2W2TA 4MRNA 4XVQA 3X1WA 1E96A 3BFVA 4RFSA 1GL9B 1SHKA 1Z47A 3CRMA 3B1YA 5JEDA 3SR0A 4RY2A 3BB3A 3A8TA 3TQCA 5C1BA 1NJGA 4PHFA 3KB2A 1VCIA 2WSSA 4O0MA 5EXSA 2IYRA 2Q3MA 4Q1EA 4EKDA 4JZKA 1EXMA 1KMHA 2CL0X 1QBKC 1IHUA 3CF6R 4ZI2A 3FDIA 2A5DA 2ASEA 3C14C 2CCGA 1G6HA 2WV9A 3U4QA 3JZMA 1XTRA 1W36C 3PUZA 4A0RA 1YE8A 3ZS9A 4TLBA 2P6NA 5BYJA 3AM1A 4AG6A 2XB2A 4X8OA 4Q1DA 4HUQA 4TMWA 4B76A 3EPKA 3F5FA 1CJKC 4OK3A 3CRQA 3NC0C 5E4FA 1RFLA 4PHHA 2G1JA 1VMAA 1XWIA 4MA4A 5J4HA 2O0JA 3KUDA 1G6OA 2N1BA 2VTKA 4HAYA 3VFDA 4B3FX 4JLJA 3I73A 3B5JA 1JQJC 1E0KA 5G40A 5K8UA 1G3QA 1YZTA 1DS6A 2AXPA 3LH5A 3O8BA 1Q44A 4KFUA 4KBFA 2ZRDA 3IQXA 4NKRA 3VKWA 4Q4LA 1CS4C 1UKYA 5KDOA 3MWLA 1E32A 2VP9A 3IO3A 5SZJA 3R9IA 4U5XA 5E3HA 2GJKA 5A4JA 4MRRA 3U6BA 1N5LA 3P32A 5GADl 1S2MA 4B3DA 4PC3A 4PX9A 3N5CA 4F7WA 2X2FA 1TTTA 2W2VA 5K8IA 1BOFA 3C5CA 1LS6A 4HUTA 8OHMA 3CWZA 1GSIA 3TQFA 4Q5IA 2F3TA 3DHWC 2ZS7A 3KUCA 1P6XA 4DSTA 2QZ4A 1J2JA 3QQ5A 4A8JC 1F3OA 1JJ7A 3M1IA 3W3AA 2ZJ8A 4BE7B 5KSOA 2JATA 3J81k 5JEEA 2DFTA 3F8TA 1K8RA 4M53A 1R2QA 4URZR 5L3RA 4MDEA 3KFVA 1QF9A 4TL9A 2HXYA 5F98A 2BWJA 4GOXA 2VHUA 4AYWA 2WKPA 4ZCMA 4EPYA 3ZVRA 1G8PA 4ZCLA 3ADCA 1X1SA 2IF0A 2DFLA 2F1JA 1W0KA 2OV2A 4LJAA 1W0JA 4LUCA 1QRAA 2XEXA 4UXHA 1AZTA 3OEED 2Q0HA 3U3RA 4Q02A 3QKTA 4AKHA 1X6VA 2JASA 4NBSA 4URVR 2ZM5A 2QBYB 2IYXA 1XCMA 1Z2CA 5IT5A 3B9QA 3U7GA 3WHKA 1XXHB 2QMOA 2QQ0A 3QVUA 5CB6A 1SKYE 2V54A 1JR3E 4KBGA 5AK0A 1YHNA 1V5WA 2QA5A 4Q4HA 4MKFA 2NGRA 1ANKA 4BFZA 3HPQA 2H8KA 2QMEA 1WB9A 1G8HA 2BJWA 2ZS8A 1IXRC 4B44A 4GOKA 4IDHA 3ADDA 5TXGA 5EP2A 3IBGA 3UXMA 4GI7A 3WBJA 5JI2E 1LV7A 2QP9X 1KOFA 2WAYA 1HH4A 2YINC 2GCNA 4ZDWA 5EXXA 2R9VA 1YZQA 1Z6XA 1OH8A 4L4UA 4RZ3A 3FMOB 1KSFX 3ADBA 3LXXA 5L3VA 4G0NA 3QBTA 3LAWA 2C03A 4KV9A 4AIIA 4M1MA 3ZQJA 2GZHA 2HEIA 2WWIA 4RKEA 4TLDA 1A1VA 1JEDA 5G3ZA 1EFUA 1COWA 2BBTA 5J4YA 3Q72A 1LF5A 3M0EA 3PUVA 1CKEA 2ZYUX 5BW8A 4NYIR 1UKZA 3T12A 1KYIA 4CW7A 1NN0A 1E4VA 2JDIA 2GNOA 4XD7A 4ARZA 3D8BA 2FEOA 4WXPA 5JWHA 4DHEA 1UEJA 2C9CA 2YOHA 3GD7A 1L4YA 2H7VA 2ZS9A 3HJNA 3IILA 4MGZR 3K0FA 1LTQA 4NCNA 4Z1MA 5JLJA 3TW4A 4D26A 4TMKA 1VKJA 2LKDA 1HT2E 2FMXA 2FFHA 3M6AA 1NVWQ 3FWYA 1RPZA 5GJCA 1OHHA 3GLHE 3EPLA 1XD2A 1W4BA 2ZE5A 3PEUA 5AJZA 1U0LA 3UMRA 2A5JA 2VO1A 2ZE8A 3SBEA 2AKAB 3KKMA 4KI0A 1OH5A 1N25A 4JJZA 1N6PA 1OPXA 1T3LA 2AHOA 4MKIA 2J9RA 2ZR7A 2ATXA 3LX8A 2ZRGA 2QN6A 5CLQA 4A1FA 4NPHA 5FTLA 1QHNA 3RANA 5KDDA 3WXMA 3KQNA 1TNDA 1AM4D 3FFBA 1EWRA 3KKQA 2YKGA 4Q7JB 3K9HA 4OHVA 2QT0A 2CLCX 4RD1A 2G3YA 1OLOA 2YV5A 3KDSE 1P73A 2ZVPX 4E07A 3HU3A 5EE9A 1Q1QA 2ZRFA 2BMDA 4IDPA 3K9NA 3T61A 1OYWA 2XZOA 4JSTA 1GRRA 4PC6A 3SQXA 4PTLA 1F2UA 5H68A 3SOPA 2B8TA 4FMDF 5HE9A 1GKIA 4LBVA 1ZIPA 1VG9B 2IYLD 2ZI7A 3B82A 4QOSA 2EW1A 5JWOA 1GIAA 3VX4A 2NQ2C 4B75A 1U9IC 2ZRCA 2ZSAA 4ARZB 2OE2A 1V43A 1Z0IA 1E94E 1SVLA 2QORA 1RIFA 1E1RA 4B2LA 1DE0A 1I4DD 3FHOA 4B6EA 2QM7A 2O8DB 1ZD8A 2IYUA 3THYA 4TQAA 1XD9A 4O25A 4RVCA 1G5TA 2ZANA 1TADA 2G0NA 1QHHA 4LX0A 3B7GA 1ZJ6A 3QUSA 1OB2A 4GNKA 2IUSA 2LWIA 2RGBA 2V55B 1YRBA 4AURA 1MABB 3GJ6A 2C9YA 2WTUA 3BOSA 1U2RA 1LY1A 4YDHB 4ASUA 2WMNB 3FHTA 1VYVA 4DDVA 2ZI4A 1P62B 2A9KA 1J70A 5FUVA 1NLZA 3W8RA 5KSZA 3JVUA 3R9WA 3KKOA 1R10A 4IXMA 4YDSA 4OI1A 2AK2A 2ZAMA 3LXRA 1DAFA 1G21E 2ZRAA 4HZUB 1XBTA 4CEHA 3QXXA 5DHFA 1KI3A 4RD3A 1DARA 4Q9JA 4JLPA 3DM5A 5HE8A 1ZUNB 4QGFA 2ZJAA 2OFXA 1MRNA 4HB4A 3CF0A 5KUTA 4DLZA 2IS6A 2NTYC 4Q48A 2PT7A 2XJ9A 5JWRA 4TL6A 2OESA 2WIBA 3GFOA 1PJRA 1C4OA 5JJKA 2AR7A 2CXXA 3CPEA 4LI0A 4BEJA 2BM0A 2C96A 2ZI6A 1OXTA 2XSZD 3TUIC 1MABA 1ZMXA 2EVWX 2QEQA 1G7TA 4LHYA 3RAPR 4BRUA 1M34E 3C8UA 3A58B 3L8ZA 1K5DA 1N0WA 2FE4A 3IHLA 2ZJOA 4A82A 5FOSA 1JR3A 1AGRA 1U9IA 3AQ4A 1P7CA 3THYB 2VF7A 1CIPA 2FJUA 2REOA 3GEHA 3I8XA 3P20A 1CRPA 3X1DA 1W5SA 3K0AA 4PPNA 2HYDA 1GKYA 4JT4A 1T5IA 4KJZA 1AZSC 4N1AA 3NBXX 5JSZB 1CF4A 2ZRPA 4A8JB 2OFWA 2FSGA 1IONA 4Q9LA 5KOYA 3W5IA 5K8TA 2JJ2A 4AYXA 3VR6A 2AD5A 3R8CA 3RABA 3LBNA 821PA 1CRQA 1Q20A 1RW4A 4L15A 2ONKA 3UK6A 5D3MB 3KXIA 1KI7A 4LHWA 2FU5C 1R5BA 4L5BA 2AWNA 4HB0A 3WYGA 2D7DA 2QGZA 2VRWA 3FHCB 1XF9A 5J4KA 2OCYC 4WA7A 3RS0A 1KO4A 2WSMA 3AP1A 2ZR9A 3ND8A 5P21A 2PZEA 3QSYA 421PA 4C0BA 1G20E 3L0IB 4KHZA 1AK2A 3KQKA 2HLDA 2J41A 1D5CA 3LY5A 1UM8A 4Q9KA 5BN3A 2VQSA 4D80A 1XD8A 2J59A 1ZINA 4B32A 2I1VB 2ZQ5A 1IJFA 2R65A 1KNXA 3K9GA 3X1XA 2IL1A 2SHKA 2YYZA 4HUQB 1G3UA 4Z1MD 1SGWA 2EYUA 4JLVA 3MJRA 1I4TD 2REBA 1JEEA 1VYTA 2C98A 3NVAA 1SXJE 1P3JA 4D4KA 4US0R 1YZNA 3TLXA 4QJ3A 4YMTA 3PUXA 1S3SA 5L3SB 1G3IA 4DDTA 3SYKA 3G0HA 2ZE6A 2W58A 4JYCA 1X3SA 1Y63A 3GLGB 4V0OA 1E9AA 3NIBA 2ERXA 1HURA 4K81B 1T3HA 4QNRA 4TTRA 3HR8A 4R7ZA 5TARA 5EE3A 4EPVA 4ZKDA 3LVQE 1HTWA 1NBMA 3GFPA 3PFIA 3PJRA 1DELA 3K70B 4FINA 1U8ZA 4NL4H 2QP4A 4DLWA 2JA1A 4QRHA 3KXLA 2WJGA 3N2IA 3EIQA 1Z07A 1DAKA 2J46A 4NCKA 1Z29A 1DPFA 2ANCA 3UANA 2OEPA 3AVXA 5AUPB 3NXSA 1E9CA 5F3WB 2WHXA 5DN6A 3L8YA 4G5SA 3DKVA 3HYRA 1J8MF 1Z6AA 2R62A 1PUIA 3AF0A 1F2TB 4JL8A 3F3YA 5KYKA 3BS4A 1VCOA 1D6JA 2CL7X 5EZ6B 2D7CA 4KFRA 1HT1E 4GT1A 4D25A 4ZO4A 1W5TA 3F0TA 4TYWA 1PUJA 1NRJB 3AVUA 1IN8A 2ZROA 4LOAA 1XZPA 4M2LA 3WMGA 4B33A 1U0JA 2FDCA 2H92A 1G4AE 1WRBA 2OLKA 3GJXC 1SULA 3K9LA 3ECCA 3WHLA 2CVHA 1RRGA 1FTNA 3EWSA 1UBGA 1ZM2A 1BMFD 4Q4HB 3TBKA 3ZS8A 5JECA 5H1YA 3SBDA 3ZVNA 1FNNA 2ERYA 3SE0A 2JLZA 3DPUA 5CITA 2D74A 2IYTA 4BPBA 4C2TA 1KMHB 3KKPA 1IN4A 1E2LA 3NTUA 4FW9A 3U3KA 2V7QD 4I1VA 4A2WA 1TUEA 3A37A 1XEWY 4EJSA 4ESVA 4Y0AA 4LYJA 2ZRNA 1W1WA 2AWOA 5DSZA 1GL7A 1E79D 3JZAA 3VHXA 2O0KA 3QVVA 2B6HA 5DI3A 3BH7A 2H17A 4D0GA 4RD0A 3UG7A 1KDRA 1T0JB 4DSUA 4ZIRA 1FP7A 4TMVA 2ZJYA 1R6BX 2GKSA 2VSFA 1S8FA 2ZEJA 3ZIAA 2O8EB 1XFAA 1WDTA 1M6NA 2CK3D 5DI9A 4B34A 3BK7A 1TU3A 1KK0A 1N6KA 1CBUA 3P4XA 2JCSA 4DLXA 4AK9A 3R9XA 2RCNA 3LW7A 3OEHD 4RKFA 2X2EA 1OXUA 4TQUS 2Q9AA 2WOJA 1N5JA 1Z0AA 3VAAA 1DAHA 3ZZ0A 3GLFB 4HSEA 1AS3A 2NZJA 1Z0FA 5FOUA 1XPOA 2PLRA 1A7JA 2ZTSA 4M1OA 3KFXA 3TRFA 1P60A 2CVFA 2G88A 3O8RA 2W6ID 1UAAA 1M7GA 3KZ1E 3UWKA 1D2MA 1BYIA 2QT1A 4W7SA 3H0KA 2F9MA 1II8B 2BIFA 3THXA 3GJ3A 4D6PA 4MGKR 5AJXA 1KK2A 2OUKA 2Q3FA 4M8NE 4F4JA 2PJZA 3M4YA 2XOKD 4M22A 2DCUA 4FXPA 3G5UA 1E3MA 3GMTA 1RYHA 2HLDD 4ZDKA 4FMCF 1E9EA 1YVDA 4PAMA 5JMTA 2IK8A 2IUTA 2J7KA 3AKYA 4ACAA 4V02A 3ZYCA 4DLVA 2OAP1 3DOEA 4LPKA 2G9NA 1E2PA 2D4HA 5HCIA 5AWFC 4CEJB 4EPRA 5CK4A 2RGNA 3CH5A 4LDJA 5TY0A 5KO2A 4M9SA 5LB4A 3CZQA 4A0HA 3CX8A 4HB3A 1GVNB 1WQ1R 4W5JA 4AKGA 2YJTD 2WJHA 1ESMA 5IK2D 1ZIOA 4XWKA 3KQUA 1GNPA 2PZFA 1FX0B 2X77A 2D3WA 1VHLA 2WPDD 5FOTA 1ZCAA 4Q4JA 5FPYA 3SQWA 3W8NA 5GVRA 1RVDA 3PG5A 3SU8A 4C0AC 4YXWD 2J7PA 2WWGA 1ESNA 2VP0A 1J7KA 2ZSDA 2CCKA 1X8LA 3PQCA 1TEVA 1G64A 4PSVA 5IK2A 2Z43A 1I2DA 1AKEA 3IDQA 2B8WA 3LA6A 4CIDA 2BBWA 4TWZA 4DCSA 1G19A 1W4RA 3A4MA 2IA5A 1ZD1A 2O8FB 3GEEA 1QDEA 4E09A 1A2BA 1E0AA 3AUXA 1YRAA 2ZYVX 4BFYA 3DZ8A 1A4RA 4GPTA 2L0XA 4CT4B 1KZ7B 2UZIR 5LBIA 5BWMA 2KJQA 3BWDD 2JLVA 3T1VA 1GITA 3I62A 4UKDA 2DBYA 1NBME 2JLSA 1GAJA 4B6FA 1P5ZB 2DY1A 3A1WA 1K5GA 4IOLA 2W6JA 3OIYA 4WZ6A 4C0LA 2F6RA 3LLMA 4TYQA 4N0DA 1C9KA 2VH5R 5CDFE 3GLIA 1XMJA 4LCBA 2GWHA 1DOAA 1VCMA 4LHVA 4Z8XA 1A2KC 2MSDB 2PCJA 4N0EA 1QHXA 3PVSA 5DYGA 1MKYA 1NSFA 2ODEA 4GOJA 5FOWA 1MO6A 1KY3A 5TDHA 4LBZA 5KHOC 2A5YB 3QEOA 4TMXA 4C3ZA 2YC4C 5HPYB 3K09C 4RJLA 3T1OA 3X1YA 1YZKA 1OSNA 3QBVA 1TEXA 4IRUB 1NG9A 1G7RA 1YR8A 2GCOB 2G6BA 2GILA 2JJ8A 3CLVA 4A15A 2C99A 4QGAA 2W83A 2P2LA 1W49A 2AD1A 3SJAA 1R0YA 4QJ4A 4G3XA 1RRCA 2VP2A 1P2VA 1NY6A 1IM2A 1T3SA 2GK7A 4NYMR 2P0EA 2YVUA 3I61A 4FCTA 4FCWA 2IS2A 1E0JA 2JJ1D 2ZRMA 1MH1A 1KKMA 5DISB 4BEBA 4QBIA 1KO8A 4K46A 1W2GA 4NYMQ 4KLZA 2QROA 4G5OA 2WWXA 5JFGA 4FMCB 2VBCA 3VR5A 2Z6VA 5GJBA 2C95A 3EAQA 2RAPA 3DKPA 3W6OA 3OEHA 4A2QA 1VIAA 2IBMA 1IOZA 4OYHA 4KODA 2BC9A 2ZRIA 2IWRA 4B73A 1IQPA 5HKKA 3IUYA 4NYJQ 4OQNA 4UJ5A 3WYAA 3DVLA 1T9HA 5LPNA 1QHYA 3SDZA 1P72A 4X8HA 5F9HA 5FUXA 4Q47A 3K0FB 3Q7QA 4KLNA 3PENA 2QE7A 1E2IA 3PEWA 1DAEA 3U7FB 4QL3A 1CR4A 2KE5A 3GP8A 1WE2A 2J45A 3WRXC 1G16A 1X86B 2C9OA 2NO1A 1P2TA 1U94A 1W46A 4RSGA 2XB4A 4EFNA 3PEVA 4C0SA 3CX6A 4R2IA 4LYHA 2JIZA 4Q1AA 2GXQA 4NONA 5A5GA 4Q4JB 4AC9A 2QI9C 5FUYA 5KPDA 2GXUA 4NYJR 3RSLA 4HAWA 4EPXA 1OH6A 3B6EA 3RLFA 2A78A 1NMZA 3MSXA 1Q12A 4GDFA 1QHHB 5EQTA 1OKKA 1E0SA 1G41A 2FGJA 4H1VA 4O3MA 1KI4A 1QHGA 1UKVY 4QJ5A 2CJWB 2AN9A 3CIOA 1RJ9B 2V9PA 4PHTA 4LC0A 4IDNA 1Z6GA 5HZKA 1KK1A 2AXNA 1XRJA 4EJSB 5LD2B 3QEJA 2XXAA 2ORWA 2RGXA 4H9GA 4PQFA 5E7JA 1ZM4A 1UKEA 1W4AA 2VHCA 1OT3A 1WA5A 3VTKA 2Z0MA 4DLRA 1VG8A 3K8YA 5FOXA 3OF5A 2P3SA 1RRFA 2AK3A 2XNSA 4Q7LA 4XSGA 4US1R 5FTJA 1H8HA 3N2EA 4A9AA 1XPRA 1IY2A 3QKRB 2C04A 3C15C 4XVUA 2BCGY 2H18A 2QAGC 2R8RA 4GFDA 1C1YA 2GAAA 2ODNA 2NG1A 2V1XA 2PBRA 4WAUA 4CRWB 1SXJA 2ODWA 1HY3A 4V03A 2WWWA 2ZRJA 2AKYA 4QC2A 2RMKA 1FP6A 5BYKA 1F60A 3LX5A 4Z51A 3ADKA 1WBBA 2YZ2A 4F4CA 2VSOA 1OJLA 4GZMA 1QHIA 4WZBE 1XEXB 1YR7A 4W5WA 3UMFA 1NBMD 2RGDA 2H1LA 3SEAA 1OXXK 4PC7A 3LBIA 1CR0A 3PCRB 3VR2A 2WKQA 3Q7PA 3PUWA 2OO7A 2IYVA 4AY2A 5EZ5A 3CR8A 4DXAA 1HUQA 1T0HB 3NBZC 5FPTA 5D3MA 5J5CA 4DT1A 2V6IA 1ONBA 2MMGA 3DM9B 5BXQC 2GHIA 2GK6A 4C2UA 3MFYA 2AL7A 5E7IA 5KNDA 4QM7A 1NG1A 4HDCA 2BBOA 2R6GA 5DI3B 2GA8A 3VR3A 4A6XA 1JQLB 4P31A 4MKGA 4RZXA 3IEVA 5KSYA 2JJ2D 2QTHA 1AA9A 2EFDB 5KPJA 1FQJA 3RDPA 3U44A 3QXCA 1NIJA 1NVVR 3K70C 4E5UA 3TSOA 1M2OB 3EWAA 4M1WA 2HDNB 5LD2C 2FSHA 1VYUA 1YR9A 4HLCA 2XNDA 4TSFA 5CYOA 2WJJA 1CULC 2HCBA 3OZXA 4HDOB 3C4JA 3Q5EA 3CNOA 3SYNA 5CJPA 1KSJA 1NY5A 1U8YA 1UJ2A 1OF1A 2J87A 1WF3A 2OSBA 5FUWA 2DWQA 1Z6YA 5J47A 1OFUX 1E9BA 5EP1A 3AUYA 4BFVA 3WP0A 4PZYA 3NDBB 3VKHA 1E2GA 5UKDA 2ZR0A 2QY9A 2V6JA 3RWOA 1QG4A 2NO9A 4WOPA 3U4QB 1IY1A 1NF3A 3OIUA 3KB1A 4V0NA 3CONA 3FTQA 4PPQA 3WYFA 3AEZA 3AV0B 3ZQ6A 1OFIA 2BV3A 1HEIA 1ZW6A 3THOA 4EQ6A 2BM1A 2V1UA 3ND9A 4RD2A 4ON9A 5GJWC 1F48A 4GMDA 3S1AB 4QHTA 5HR5A 1GRNA 3R8FA 3NH9A 1E2JA 4YC7A 2NPFA 3HYTA 1AQUA 3AKCA 4MUBA 2EWWA 3B85A 4LPSA 4RD6A 1II9A 1KAGA 2F9LA 2WIAA 4FMBB 3BFKA 2CBZA 2P6RA 1KDOA 2I1QA 2RKOA 1H8ED 4GP6A 2F1HA 4JYBA 3EC1A 2FSFA 3K1JA 3EIHA 1CU1A 4ABYA 1N0UA 2EYQA 1OW3B 3BERA 2E9SA 1KGDA 1XDBA 2H5EA 4W5HA 5E7MA 2JLWA 4TYNA 4A2PA 2PT5A 4J0QA 1NVUQ 5DLQC 1P2SA 2QPAA 4MQBA 2JJ1A 2Q9BA 1UBFA 1U81A 2PEYA 3CUEF 4UNSA 5L3QA 4WZAE 2MMCA 3A4LA 1E6CA 1G7CA 1XEXA 4OJKA 1HQYE 3MRSA 2QSYA 2QQEA 4LJ6A 4LYFA 1OXVA 4EDHA 4JKYA 3CRVA 3G82C 2WSSD 3QG1A 4WVFA 3L2OB 2B7CA 1RZ3A 3ASYA 3WNBA 2ZE7A 1VIYA 1Z2AA 2F1IA 2WWFA 4PAOA 3ZLJA 1CXZA 1VPLA 1E2KA 2GBLC 4TMTA 1BO6A 3KJHA 4C0KA 2DB3A 1EFCA 1Z8FA 3QF7A 3PITA 1ZAKA 4C0QC 1ODFA 3DOFA 4WW0A 2P5SA 4HAUA 3WMFA 4AKEA 3AVTA 4FD2A 2D62A 1NI3A 3BFXA 4Q7MB 4TSFD 1JR6A 2ZETA 1SVSA 2G0TA 3NKVA 4A4DA 2GXAA 5K8LA 3PR1A 3TR0A 4CF7A 5JI3E 1FMJA 1GFIA 3PUYA 4B3GA 4Z8YA 2GEDA 1S9DA 3NEYA 4HDQB 1QG2A 4PQYA 1IJEA 1FMLA 3QIAA 4TZ6A 2GAOA 1Q0UA 2ZJ2A 2IYWA 4P3YA 4JVMA 1Z28A 3FPAA 4QFMA 3W6PA 4PANA 3SS8A 3EC2A 2A7QA 5EP3A 1JAIA 2ZU6A 2F1RA 2IWHA 3MWJA 3R20A 1GL6A 1Q57A 3T1TA 1YZGA 3SJZA 5KU1A 4JLDA 3NWJA 3BH0A 4KYUA 4LJ7A 4BLRA 4JLKA 3IIJA 1P9NA 2IXFA 3RC8A 4IOMA 4M9QA 3P27A 2QUZA 5FBRB 1DAMA 4F91B 2K5UA 2QPTA 4O2LA 3U3OA 4DLSA 5CJ2A 2CNWA 3IPYA 3OE7D 3V9PA 5AJYA 1Q1ZA 4B74A 1GOTA 4B47A 4JBXA 3U2QA 5CDFA 2ZAOA 5B2ZA 3CR7A 5FI0B 3T5DA 3RRYA 5KNBA 4EAQA 3BORA 3MUFA 4D82A 1W36D 4QG7A 5CM9C 4M9ZA 2FH5B 4XD7D 1J99A 3AH8A 4MYHA 1TAGA 4PPGA 5BN5A 4TT3A 1A5TA 2OHFA 1H8HD 3EIEA 4UNNA 2V3CC 3WNCA 3UMSA 3CRW1 1CR2A 3AGQA 1SVOA 3AF3A 2A5FA 1Q3HA 2VIIA 2DFNA 4CYMA 1KNQA 1L7VC 3REFA 4BRWA 4E03A 1UDWA 4L9WA 3HU1A 2ZRBA 3BH6A 1WBDA 2ZXUA 4OJQA 3GLGE 3CW2A 1O3YA 2QMUA 2FG5A 1YKSA 4ERNA 3SZRA 3ZZTA 2RB4A 3B8HA 5CB8A 3QKUA 4WBSA 3D6TB 5DIFA 3QXSA 4LK2A 3K0SA 3L0PA 4X8LA 3RYTC 3GLGA 1FQKA 1F2UB 3AF4A 2WVJA 4HEJA 1XTIA 2CE7A 3LFUA 4ZV4A 1NNEA 4L8GA 1E9SA 4JSYA 2V7QA 2D2FA 2ZITA 4Q00A 2DWOA 2GCPA 4FWTA 2VF8A 2FFBA 3D7MA 3GLIB 3RHFA 1TX4B 2HCJB 2BBSA 4G1UC 3U3MA 4LJ8A 2Q6TA 3T5GA 3ZD7A 4C30A 2IS4A 3A6PC 1JXMA 2VHJA 1Z0KA 1ZM9A 3VMFA 4BWYA 1OB5A 2WMOB 4RCYA 3WBKA 2F55A 4AI6A 1Z0DA 4ASUD 4PXAA 1NSTA 1NIPA 1ZP6A 3AF2A 3VNVA 2MSCB 4UXIA 5AUQA 3SN6A 1NLFA 3VR1A 1VECA 4KXFB 5FR1A 4BASA 2IXGA 4BFWA 1N6NA 3AF1A 4KFSA 4OHZA 2I3BA 3I5YA 1TF2A 4A36A 1N6LA 1GZSA 5HTKA 4I4LA 4GP7A 1OE0A 3CNNA 2QENA 3OIWA 4KSBA 4EFMA 4PHGA 1KHTA 3SFZA 3O47A 1T8UA 3ICQB 1Z22A 1CR1A 4DDUA 1XMSA 4M1YA 4LV6A 4D81A 4OBEA 1E2MA 4ITRC 2ZI3A 5C18A 5EE5B 2QP3A 3RSOA 1NKTA 1AS2A 3QOFA 3C7KA 3RVBA 3TUJC 4D4MA 2ONJA 1G7SA 5FPKA 1SKYB 2BJVA 4I1OA 3Q9LA 1ZU5A 1XXHE 2W00A 4NU0A 3SFVA 2CHQA 5FL7D 3EZ7A 4HAXA 1Z63A 4U02A 1ELOA 2R2AA 1PV4A 3QNUA 4I1SA 1E69A 1KI6A 2Q21A 3HU2A 2D2EA 2R6DA 2UVQA 2BEJA 5AJVB 2R6AA 4G5GA 4HB2A 3K0CC 1CLUA 1DBSA 2BHRA 4XVRA 1YQTA 4LBYA 3R7WB 1EGAA 1M7BA 1JXOA 3T34A 3CX7A 1VCNA 3CM0A 3GFTA 3TR5A 5DN6D 3SYLA 3FKSD 4BLSA 1E9FA 5IRCD 3AVVA 1ZNWA 1R0WA 2VLIA 2RGAA 3B1WA 1R8QA 2QSZA 3NC1C 4TLAA 3MJHA 2IYYA 4NP6A 4YXWA 2YNMA 1W44A 4FWIB 4IDOA 2CNWD 1EFTA 4DEYA 2TMKA 4LV5B 4JKIA 2RGCA 4TL7A 3PV0A 4TYPA 1ZUHA 2O5VA 2ZRHA 1HE8B 2FPLA 4ZCIA 3AVPA 5AR1A 2HF8A 2IYZA 1HQCA 3KQLA 5F2EA 2GJAA 5IF9A 4OHWA 3EW9A 1BH2A 4M1TA 4BUJA 2CJWA 3H84A 3EZFA 3AP3A 4BLPA 3GLHB 5SZHB 4BGDA 4V0MA 1N3BA 1U90A 2XZPA 3SJBA 1VTKA 2VEDA 1JBKA 4B2PA 4MYTA 1P61B 5CYPA 3KTAA 1SKQA 4M1SA 3LD9A 4CEJA 1KO7A 2HV8A 2O52A 1FPMA 3QENA 4A92A 2VP5A 1XMIA 1TQ2A 5JJLA 4M21A 4P4SA 3MAAC 1FOEB 4XTRA 2W6IA 3H86A 3PEYA 1UF9A 2XZLA 1U0HC 2OCPA 4US2R 2Q3HA 2I4IA 1UADA 4QGHA 3WRYC 3U5ZB 4RFVA 5DH9A 3V4FA 2FFQA 3A1TA 4KCGA 4UNQA 4P4TA 1HE1C 3VQTA 1KI2A 4NCJA 1KDPA 4DWJA 4LWZA 2OFOA 3A4NA 2W2XA 3LDAA 3QF4B 2CCJA 2CK3A 3QKSA 4OI2A 4URYR 1B23P 3HDTA 2QE7D 4M4SA 3ZIAD 2BMJA 4OQLA 4LSGA 1J90A 2WJVA 4TMZA 4MITA 3U44B 4DCVA 2IT1A 1T4GA 1G8GA 1OKKD 4W9MC 1NN3A 5EJEA 4LV8B 4JVNA 2O8DA 1G5RA 2CDNA 1Z3IX 4LBWA 4YLGA 2XXAB 1P4SA 2VA8A 2IYQA 3U6KA 4YQFA 4HLUC 2WWYA 2XTMA 3LV8A 3ICEA 4U7DA 4DT1B 4C4PA 2JIZD 1RJ9A 2ZJ5A 5LDDC 3KTAB 1PVOA 1II0A 2LKCA 4Q66C 4LYAA 3BXZA 4G5RA 5C4GB 5JSZA 4OL0A 3L82B 1D8TA 1DG3A 2YWHA 3EG5A 5KTYA 3DL0A 4UNPA 2KWIA 2C8VA 1AN0A 1GKUB 3MG9A 4DIDA 1US8B 2GVZC 2ZJZA 3QPVA 3KJEA 4M1KA 2XGJA 2ZSFA 3T35A 4OI4A 2ZRLA 5KNCA 4GSYA 1MO5A 2V4ZA 4GMXA 5JS7A 3E5HA 5DYIA 4B3CA 2VPPA 3QKSB 1G8YA 1XNJA 2W0SA 4DUGA 3I92A 1UBCA 2BMEA 2PMKA 1HV8A 4DSNA 2WICA 1XJCA 2VSXA 1WXQA 2XTNA 4CEHB 1KSHA 3P4YA 3Q8XB 3CBQA 4DJTA 1Z83A 4DVGA 3CPHA 4A0GA 4ESHA 2WJYA 4Q9HA 1CP2A 3AKDA 4HZUA 4MGYR 2PEZA 4RZUA 1XXHA 5L8VA 2OM2A 3KL4A 1UPTA 3QPWA 5JJIA 4FCVA 3FE2A 3VU9A 1KI8A 3OE7A 3VR4A 2GF9A 1I4LD 4MRVA 3TUZC 3E2IA 4HI0E 4V0KA 2NIPA 4JVLA 2PMDA 3KX2A 4Q7KA 4URXR 2QBYA 1NMXA 1B0UA 3SJCA 1OXSC 1XZQA 2YOGA 4B43A 2HYIC 4MKHA 2IHBA 4TT3D 2FGKA 1JPNA 2ECKA 5CM8B 2ZREA 1G18A 1RC8A 2FX3A 2QRZA 3TVTA 1MOZA 1IAQA 1WP9A 3TNFA 3EPJA 1S1MA 3A36A 2QMHA 4JVSB 2J1LA 4P4UA 4URWR 3CPJB 2W6JD 1ZNZA 1OIVA 1TUIA 2VL7A 4HLDA 2GRJA 4PFSA 3IO5A 2QAJA 4IXNA 4BZXA 4NDZA 3ZD6A 1II8A 3IIMA 3THXB 2ZSEA 1AGPA 4M0LA 2GZDA 3BB1A 3TJZA 2VHTA 3THWB 1W4CA 2BOVA 2OXRA 3LO5A 1ZC3A 3QPUA 1Z6TA 1XEFA 2NZ8A 4RD4A 3H4MA 1P75A 4XJXA 2RHMA 3OAAD 3TVDA 3W34A 1TQ6A 2B21A 3GJ0A 2OG2A 4CVNA 4EIWA 5ANRB 4KVAA 3RWMB 4GBMA 4EJSC 1GP2A 5LB2A 4D0LB 121PA 1SXJB 1OFHA 2FWRA 1G3RA 1FZQA 1XMVA 2GBLA 3SC3A 4HAZA 1LB1B 1LVGA 1NN5A 2OBLA 3AGPA 1SZPA 3B1XA 3BAFA 1OIXA 1NLYA 3V00A 3WMEA 4LRWA 1O87A 4Q4AA 2EQBA 1X1RA 3FMIA 4O2RA 3U61B 2NO7A 2N42A 1LF0A 1T6NA 4LY6A 3LVRE 1DAIA 5JHHB 2WPDA 4XWOA 1NKSA 2O8BB 4PC1A 1YR6A 5FFMA 5D3QA 1TQ4A 2J0UB 1ZM3A 3DZDA 1FUKA 5B30A 1N5IA 4IEIA 1JR3D 4MGIR 4RZ2A 2J0QA 2PX3A 1RYFA 4XSHA 2LCFA 3BC1A 4B2IA 4DCNA 4K8OA 3LNCA 1U8AA 4Q03A 4RFSB 4KO8A 4KITB 2HXSA 3HWSA 3KJIA 3EX7C 2WJIA 3FMPB 5JRJA 2ANBA 1GILA 1ZVQA 2GETA 3LBHA 1BKDR 2OILA 3GJ4A 4HAVA 4ILEA 4AG5A 2FV8A 3DO6A 2KB0A 1KSGA 3W9YA 1A82A 2QPOA 1NVVQ 3GLHA 4JLNA 1ZBDA 1KJWA 4DCTA 2ZI5A 4JL6A 3Q85A 2F3RA 3W5JA 4Q19A 2CHVA 4NH0A 4YONB 3BB4A 3MWYW 2RGNC 3U7EB 4I1UA 1G4UR 1N5KA 5EP4A 1TMKA 2IXEA 4ZPXA 1UFQA 1GNRA 1P9WA 1ZM7A 4F92B 3GJ5A 2IS1A 2F43B 1Z5ZA 4IHQA 2EFGA 2XSZA 3RS5A 3HP1A 2FFAA 1KO5A 4FI3C 2Z83A 4BFXA 2JAQA 3R7WA 4BFUA 1H8EA 1FTSA 4MYUA 4TN1A 2BEKA 3I72A 1N0VC 1OIWA 5EXTA 2GJSA 4DDWA 3TH5A 3MGCA 3FVQA 4P4SB 2QL6A 4EPTA 1R8SA 2BDTA 5B57C 1E2QA 1N6HA 3U3JA 4Q01A 3NBYC 4DLUA 5H70A 1LW7A 1L2TA 4ZIRB 3I8SA 5BN4A 621PA 2ZU0C 3EZ9A 2GJ8A 3ZGXA 2RH5A 2RGEA 2IF2A 3IKJA 4HLUA 4PAQA 4F93B 1NN1A 5DHAA 1YZUA 4RCZA 2CEAA 4BLOA 1U99A 4XOIA 2VP4A 1XTJA 1G17A 4FMDB 4WIAA 2ORVA 5GJVC 1F6BA 2B92A 3H2YA 521PA 6Q21A 3LLUA 3IIKA 2ZRKA 2G1KA 3K53A 2Z4RA 2H16A 1EFRD 3PXGA 3K0AB 1M8PA 1DTSA 3CB4A 4PR0A 1S1CA 2HT1A 1LFDB 4BLQA 3MMPA 1T91A 3L0OA 4CDGA 4NE2A 4JLBA 1SVKA 5DNYB 1EWQA 3FB4A 4Y0VA 2O8BA 2JLRA 3D31A 4Q4AB 2OCAA 3EASA 2XNDD 1GWNA 2IEZA 2X1VA 2ZVQX 1XJQA 3B2EA 1F5NA 1YJ5A 3MD0A 2J5XA 1FL9A 3DMNA 2JLYA 1DO0A 1NJFA 4PSAA 2PLFA 4DKXA 4DLTA 3KQHA 2UKDA 3DEFA 1KKLA 4FN5A 3ETLA 2B7BA 1VG1A 2BKEA 2ZUDA 4ZKEA 3GJ8A 4UQOA 3GLIE 1AQYA 1SXJD 2HJGA 4C0JA 4DSOA 1E2EA 4YMSA 1EFHA 2C2HA 3QJYA 4PO1A 3UPUA 5JCPA 3B1VA 4IVRA 4Q1CA 1E2FA 5C46F 2QAGB 4D0NA 4TTPA 4Q1BA 3NH6A 3BE4A 2GXSA 3VX3A 5H8WA 4BECA 1EESA 4OI0A 3OHMA 3OAAA 2AFHE 2YWEA 4Q18A 5JBQA 5JRZA 1PZNA 3IHWA 3TW8B 2GZAA 1D2EA 3AB3A 2IHYA 3ZVLA 4NMMA 2H57A 2OBNA 1IXZA 4IKEA 1AJEA 5L3SA 2JEOA 3ZVMA 2PJRA 1E9DA 4UXJA 2QU8A 4DCUA 4YMWA 3ZDQA 2JLXA 1U98A 2D06A 2NMVA 1XP8A 4NYIQ 4A6PA 3SHWA 1T5LA 5FBQB 4QBFA 3S1AA 1KJZA 1SHZA 3DMDA 1OH7A 3ONWA 2O8CA 1W36B 4QHYA 5GVSA 2IUUA 1ZNYA 1Q3TA 4DZZA 5FBWB 1GNQA 1R0XA 1CJTC 1N2CE 3B9PA 2CL6X 2GF0A 2EFHB 1OFTA 1COWD 2XX3A 5FTMA 4I81A 3VKGA 2YWFA 5KSPA 1TPZA 2J0SA 4QGGA 3FOZA 4D2IA 4OHYA 1EX7A 1ZUIA 3W90A 5FBLB 2P5TB 3FYHA 4CZ2A 2FSIA 3GPLA 3B13B 4JIMA 1GTVA 2JGNA 2WBLC 2OZEA 1Y3AA 4TL8A 2E87A 2KBEA 4JLOA 5BQ5A 3RC3A 5C4MA 4ZDJA 4KSCA 4IOJA 5HKKD 4M9XA 2ZPTX 5IHPA 4GZLA 3P1JA 4QM6A 3QE0A 1R7RA 2GEUA 4P33A 2O8CB 1E2NA 1F2TA 4C7OB 3GLFA 4E22A 1R5OA 1X8JA 2ZYWX 4NZYA 3QI2A 4QBHA 2QNRA 1VDZA 3CRRA 2NO6A 4UNRA 3B1ZA 1W7AA 4OQXA 3I5XA 3TK1A 1ZCBA 5AUOB 2Y8EA 4IW3B 1JI0A 4II7A 3C41J 4IEEA 5G3YA 4XTCS 3GEIA 1W0JD 1W0KD 2ZYTX 1PLLA 1OYYA 5JHGB 2J0UA 3RS7A 4ACBA 3TKLA 1IN7A 3V4RA 2C5LA 4GRAA 1XEWX 1S3GA 4QKQA 4NCHA 1W47A 4Q9IA 4LGMA 3UATA 1JNYA 3D3QA 5F9FA 3K09A 1TL7C 3B60A 2VYFA 1Q22A 2YHSA 3VNUA 1IY0A 4URUR 1QZXA 1FFHA 3U60B 1XCPA 1Z0JA 3X1ZA 2C78A 3H1TA 3KJGA 1KIMA 2ZUBA 1D2NA 2XJ4A 4ZI3A 4DC9A 3K70D 1M74A 4PZZA 2Q9CA 4PO9A 4PPFA 2A30A 4LHXA 4TLEA 221PA 1MO4A 2G77B 3QKRA 4PQRA 3QXJA 1KI9A 1P9RA 3UG6A 5ELXA 4JBWA 3ZH9B 2RGGA 4DLYA 2P6UA 4C9BA 1GRQA 1L8QA 1RKBA 2GJ9A 4N3NA 3NG1A 1S4QA 1NP6A 3CZPA 4IVPA 4KU4A 2A2ZA 2NOAA 3KKNA 4YMVA 2NO0A 4AD8A 3THWA 1Z08A 2FN4A 4XWAA 1EFRA 3LQQA 3MCAA 2JLQA 3C5HA 4CEIA 4JBYA 4LC1A 1G9XA 1G291 4GL2A 1JECA 3FMFA 1KK3A 1MV5A 5SZIA 2NPIA 4POAA 2O8FA 1KO1A 4CGZA 3BJIC 4Q1FA 1PLJA 2QGNA 4P32A 5CIWA
chains in the Genus database with same CATH superfamily
2FEMA 3ZE9A 1LCIA 4BNXA 4V0LA 1Y6ZA 4L4XA 1V45E 3K4HA 5HKOA 5C5DA 1S9HA 3HKBA 2UV8A 3NHAA 5ECDA 1Z7WA 2VEOA 3GEGA 3M1LA 1ZL2A 3P2IA 1J0CA 1FA9A 3LCRA 4ZQIA 3OZIA 5KQRA 2FZCA 1FSFA 1RKQA 4JBNA 3BSSA 4TS3A 3CO5A 4EW2A 4GSLA 4KP7A 2I67A 4XH9B 4BMNA 1Z2NX 2ILTA 3PC7A 1QSGA 1WXFA 3SY8A 3VBCA 2C94A 1R6UA 4FEEA 4XARA 1YCFA 2GDJA 3ABSB 3ZHQA 4DMFA 1Y80A 1O5IA 1FXUA 1SQFA 1ZC4A 2NXCA 1UBEA 2DBQA 2OPBA 4JT2A 3HI6A 3U9TA 2ZIAA 3EXAA 1ND5A 2Q46A 3DYIA 4KW7A 4R2HA 2WJZB 2WIFA 3PPVA 4DV2B 1CY1A 2FPMA 1L4KA 1THGA 4FZRA 3RS2A 1MX1A 1EX6A 2MSWA 3LXMA 3PNPA 3ZGOA 3ZJ5A 1DTEA 2ALJA 4MH0R 1SOWA 2PCLA 5AM5A 1Z12A 2HPVA 4OLHA 2YMPA 5T67A 3D4IA 3LT5A 2Q49A 4LZLA 1RJDA 1E99A 1YUNA 3AILA 1BG6A 4L9SA 4YREA 1Y5MA 4IXWA 3C6YA 3L06A 4X64B 3CVWA 4RY0A 5JBIA 5KHAA 4H31A 1T36B 5CA1A 2O2IA 3H04A 1FFEA 1G8AA 3N53A 4E88A 1Y1SA 2WZDA 2YWGA 3O4FA 1QK5A 4NHEA 4X8MA 3SF0A 2Z04A 3G79A 4E4TA 4ZHQF 3WJ2A 2DAPA 2R0QC 3ZCTA 3EGXB 1E98A 4EI2A 1WO8A 2XQKA 3BEDA 3WYCA 3O4IA 4YV7A 3RSZA 5B4VA 1EDZA 2P79A 2RBGA 5FPSA 5KEIA 1NMEA 3QVTA 3EEQA 1P3DA 3IBTA 3D5QA 5DO9A 4QO7A 1RLIA 1XZEA 4TYYA 1FRFS 4QAQA 1IBCA 1Z34A 2PDAA 3LPMA 1L4NA 4L2IA 4BWVA 5KKNB 3F49S 1GDDA 3IBYA 4E5YA 3C8ZA 4EFDA 4HGPA 4IDFA 4KE9A 3FGNA 4JWTA 4DMLA 1SG9A 3EZGA 4NCIA 3WOHA 4PG4A 5AXCA 4B6RA 3OJEA 4AQYB 1ZG3A 1ZGAA 3GZTB 4JGBA 1GG2A 2RHDA 4KN9S 3EDCA 4C01A 2XA9A 3BTOA 1DADA 1YNOA 4I99A 3STXA 1GV1A 4OQFA 3ZQ4A 2HLPA 3A1UA 3ETGA 1JEYA 3WZMA 2FWJA 3LWBA 3TBHA 1XJ0A 5BUQA 1MR3F 1J0XO 1QVRA 2BJHA 2Z2XA 2HUNA 3DDHA 3OEEA 3P9NA 4M0PA 5EMLA 3UH1A 3ZZ1A 2FLVA 3IP8A 3P0IA 5G0UA 2QRPA 5DW0A 4K0RA 3RRZA 5BPFA 1KDTA 4JJKA 3KOMA 3DT6A 2WU3A 2YXDA 4YMUA 3OM0A 1SXJC 2QTLA 1RWNA 3A3OA 1U28A 3TQHA 1HYEA 3DE6X 1TKRA 2NPOA 1E79A 4NPAA 4A0SA 4DWVA 1VG0B 5ALFA 3FG9A 1AC5A 2ZB4A 2ZSJA 3GZNA 1TCCA 2ODBA 1NLMA 1PG0A 3SKXA 1CQXA 3ZV3A 3EQ2A 3VU9B 1DOHA 3K0HA 1YS1X 1EM6A 4IWNA 4QXPA 1HZJA 4MCJA 5DYTA 1EDEA 3M2TA 4YCLA 3BBPA 4B71A 4CQLB 2GEJA 3ZJYA 2BVNA 1NDUA 2V0NA 3L7CA 5FL7A 3BTVA 1E9RA 5M7EA 1KZ1A 2QW0X 1XZFA 3L3BA 2BFEB 2BONA 13PKA 1LNZA 3IP6A 4F5WA 3CT6A 1VA5A 3NNDA 3PVZA 3T9AA 2A88A 1WCWA 2XIJA 3OICA 1QHSA 3TSWA 4W5RA 1V1MA 4J0CA 3HJRA 1WABA 1ML3A 1N2ZA 3OCUA 2WKRA 1E1LA 5BR4A 3N59A 1W581 1ULBA 3O8CA 2YRXA 5A71A 4KPUA 3DL2A 2GCOA 4Q3EA 1JDBB 3C70A 2E1RA 3OPYA 4XB1A 3VI3B 1NULA 1T5SA 1X1AA 2BGGA 1BSVA 4NHOA 1FNMA 2WJPA 4GUAA 4G0OA 4JNCA 5F78A 2ZCVA 3RUPA 2FI1A 5C34B 3CINA 4EPWA 5CB4B 4JL5A 4P4GA 3UK2A 3AHEA 5JG7A 4WK2B 1FX0A 3HUUA 2PU5A 4JLAA 4DIEA 3IHTA 3FFAA 3OLYA 2HUPA 3NM6B 1G60A 4DUGD 1KE2A 3WAGA 1O97D 1SVMA 1MNQA 3B1FA 1CZRA 4Y1GA 4GGOA 4M0UA 5CAEA 3OQPA 3L0SA 4MRSA 5A3JA 3U16A 2OC4A 3GCGA 3GP3A 3OFNA 4GI3A 2FEKA 1XPUA 1CDZA 1GARA 1I13A 4TXJA 1X9GA 2C4HA 5ITVA 3L84A 3X0DA 4J75A 2GESA 1GLNA 5AI9A 3ZNQA 1E2DA 1ZU4A 3O7WA 4OM8A 3SJ7A 4EQ6B 1XVTA 4TS1A 4H3HB 5LP6F 5JR3A 4L4SA 4EZBA 3SAJA 3D59A 4U4AA 3ZWKA 1N8SA 1ZWLA 3LRPA 2CUNA 3OE5A 1BNCA 4WY5A 2V7VA 2XGMA 1PBNA 2ZRQA 1KI1A 2FSUA 1PAUA 3N2NA 3CKMA 1UIMA 3F3SA 3TGPA 3NCHA 2AZXA 1AKMA 3FRJA 3N2ZB 4O1IA 5E7QA 5IN5A 2A5GA 1GM5A 3RRNA 4BO2A 1W93A 3KPYA 4GX0A 2OCBA 3EQ8A 4IVNA 4NAUA 1EFLA 4INPA 4CKWA 5J23A 3NJ8A 1ZJ4A 3RO7A 1QVAA 1B26A 1TZBA 2QRNA 2CLSA 4H1TA 4LRUA 5EJFA 4YYZA 2GD1O 3T3MB 1HKUA 5AJHA 1ZRMA 2C0PA 2VP6A 2HK8A 1QAOA 1UEIA 3SZUA 1IBRA 2Z4SA 1EH5A 2N46A 2Q5IA 3GVIA 3PXCX 3KAJA 4NBWA 4MO9A 4WXRA 3UT0A 4H6PA 2D00A 2GLXA 2O0MA 4D6XA 5L6LB 1C0IA 4DJ5X 3C5EA 1M6EX 2F3SA 3N6VA 4EI9A 4RSRA 3WNDA 4OGLA 3TL6A 1E1QA 1EA5A 4O2AA 2Z5FA 4QDUA 5IDVA 2AA3A 1DAGA 5JAMA 3TG2A 4G5QA 4GX5A 1M1YE 1KU0A 3BPSA 2EOAA 2HA3A 3QVLA 1ZR2A 1EIZA 3MWKA 3NHMA 3OURA 4LZZA 2FOLA 1YRLA 1SPBS 2VHQA 5J4VA 4QOHA 4Q0MA 1D9ZA 3P9RA 3A70A 4BC0A 5IH7A 2CE2X 3ZOKA 3ZXIA 3AVYA 2MINB 1G8FA 4G1FA 1HE4A 2DRIA 3KM0A 4WZBA 2BGUA 2BZSA 1YI8A 3AVOA 4KX5A 2B78A 4DB2A 2IV7A 2GERA 3A6EA 1V8OA 3KZNA 3RC7A 3VGJA 3FUVA 4E6EA 4DV3B 3WY9A 1MO3A 4TRMA 3UAWA 1QNFA 3R24A 1Y8RB 2XDWA 4B17A 4ZCTA 3MJVA 4KZKA 2YS6A 2R3SA 4BX8A 2V8OA 2WAMA 1LTHR 1H6AA 2AC4A 1S0UA 3ROPA 2D0OB 5CNKA 1JB1A 3PNYA 1TF5A 3DBIA 4RMJA 3DL4A 3FGOA 3BG5A 5B64A 1MUUA 2PWZA 2P4EA 4HMQA 1FFDA 2WAXA 2B6NA 3GQBB 5G53C 3FNGA 1BXZA 2YJGA 4HS9A 5EWLB 2QV0A 3EMVA 4ZDIA 3CKLA 5FUMA 2B4RO 1Z36A 2ES4A 1TU4A 4JJGA 4PO8A 4PQEA 2GNPA 7GPBA 1HA3A 1Y42X 1N1GA 1NZFA 1YCHA 3WQQA 4HGQA 2WTAA 3ST7A 1T29A 5JMWA 4QOGA 1XZHA 2OZPA 5HM6A 1H9CA 3IQZA 4RELA 3GH1A 2RE8A 3QTLA 2MDTA 3PE4A 3EUEA 4N01A 3CH7A 4NV3A 4KYIB 3KSZO 1UDXA 1ZKDA 2NUAA 1F8XA 5IASA 1H65A 1P1HA 1PWHA 1UT8A 2A3RA 2KS6A 2XNCA 2QNBA 3KHSA 3LC1O 4PNZA 3AL2A 1AUXA 5AI4A 1SHUX 3HZRA 4FONA 4ZC1A 3ZHOA 3RIHA 2A1UB 3EVCA 1XTQA 5EUMA 2FZ4A 2Y1KA 3OCZA 2BMFA 1BCSA 1H3NA 2GRUA 3KJXA 4JS0A 5J5VA 2R96A 3JAWA 3FKSA 3SHFA 1A27A 2JIRA 2P9CA 4R0VA 4G26A 4C0HA 4D3YA 4DPKA 1V2HE 4F86A 2IW3A 2BRUC 2HQBA 1FJHA 3FVTA 4TQ9A 4H7PA 1WNTA 5EJAA 5LP6B 4B7ZA 1QC5B 3EGEA 2OXCA 1BIFA 5J1TB 2YIMA 3GY0A 4XDGA 3NEJA 3N05A 2Q7OE 5BY2A 4MRNA 1UP7A 2FQYA 2OXFA 1J4AA 1QB7A 3LUKA 1Z47A 1SHKA 2PG3A 3H9CA 3B1YA 3Q3HA 5KWJA 2HSDA 3SR0A 4CM6A 2I7CA 3BB3A 2IYAA 3JZDA 3KB2A 1VCIA 2WSSA 1T24A 2H2AA 2W70A 1PT7A 4JZKA 2POQX 4J3JA 4XQGA 3G9ZA 1DRVA 2FP4B 3DB1A 3QVSA 3NU1A 5DWVA 5BQPA 5EJMA 2WV9A 3LFTA 4QO8A 3Q7SA 3U4QA 4JYAB 2OUIA 1AQ6A 1MEJA 1Y1RA 2PT9A 3ESQA 4J0KA 2PUVA 2R47A 4TLBA 2FQQA 4DJDC 4XKJA 5BYJA 2IHKA 4ZOLA 3AM1A 4L08A 2XB2A 2BTOA 1ISIA 4C0XA 4OFBA 1FNCA 4MDHA 5D6NA 4UU8A 3IP9A 4O2AB 3CRQA 4RKWA 2E3JA 2G1JA 3VPFA 4BBZA 4EH1A 6NULA 5IFLA 5J4HA 2O0JA 1OAKA 1ISPA 1G6OA 1HORA 1I0ZA 1ZSVA 2B7LA 2BDUA 3CRZA 4HAYA 4JLJA 3RROA 1J2EA 1RFGE 1U0NA 3I73A 4P22A 3EVFA 1DS6A 2AXPA 3LH5A 3LKBA 3PRYA 4KFUA 4KBFA 5CH3A 2ZRDA 3IQXA 1YCDA 3VKWA 4ENUA 3R7NA 4Z2YA 2KQUA 1UKYA 2P6MA 1E32A 1K0FA 5E3HA 4JUFA 2GJKA 4AJ2A 1U04A 3U6BA 3RR2A 3P32A 3TGLA 1YJQA 1ZGGA 2V96A 4BMSA 3BMQA 4BKPA 4TYMA 1PO7A 3N5CA 4Y7CA 4IXTA 4BKUA 4UVDA 3AFGA 3DFZA 3ET5A 4WEQA 1BOFA 4DM4A 1LS6A 2EBUA 1NXWA 1Z5OA 4A26A 4P54A 3MQFA 1X39A 1DIBA 1ULUA 1GRVA 3VISA 2F3TA 4JASB 5KU7A 2UAGA 1QGUA 2QZ4A 1E6UA 2E2WA 1F3OA 1JJ7A 2EGUA 3I58A 3M1IA 3P7MA 1QGED 4BE7B 2JKVA 4U2DA 3EUWA 4H27A 2DFTA 3Q7TA 5JEEA 5KB3A 3PVCA 5L3RA 2PH3A 1X7ZB 2ATCA 3OJ0A 5DBGA 1ZHOA 2P62A 5DHQA 2HMYB 4L75A 1ZSNA 4NI5A 2C5GA 1ULSA 2PRJA 3GMSA 1V96A 5BVHA 1SM4A 4HDNB 3ZUGA 1TO6A 1C3OA 4RHEA 4UE6A 4LJAA 3PD0A 4LUCA 4C5BA 3OEED 4BO6A 1M6WA 4ZFNA 2X5XA 4I1YA 3U3RA 4AKHA 1I9GA 4RY9A 2A9PA 4NBSA 1NV8A 1MAVA 1YIOA 1O9BA 5COAA 3ZHVA 2FUG6 3G5TA 1EUYA 4NNJA 1IZ8A 1QYIA 4EG6A 2R8YA 1SU6A 1IQ0A 3CO0S 3ONNA 5CB6A 1IJKA 3ZUPA 5ULLA 3FSJX 4QA9A 3UAGA 2OV4A 3PHBE 4EUEA 2QJWA 4D9BA 3QBEA 2O5RA 4GBGA 1BD3A 1SHTX 2QMEA 4DCCA 1A9PA 2HJRA 4N3CA 3FYTA 3GZJA 5GONA 4EF6A 3W5VA 3ADDA 3N2LA 3EGCA 2P7IA 2XLCA 4BB6A 2W8BB 2G67A 1Z5UA 1N77A 4CQLA 2DY0A 1I2BA 1CS0B 3AFOA 3CNHA 4GI7A 3HA7A 2DVMA 4GXRA 1ISSA 1LV7A 2QLNA 3PEEA 2V7BA 2YINC 3CW9A 5LP6C 1JEOA 1USWA 1FQWA 1Z6XA 2F59A 2FP4A 4I3FA 3WGJA 3KYBA 3FMOB 3KQPA 4RZ3A 3P9YA 3RVLA 2I7VA 1ATIA 3D54D 2PGLA 3LAWA 4UFOA 5DK4A 4KWCA 1LBHA 4DE5A 1EJBA 3ZQJA 4BFLA 2YZMA 1MT3A 5G3ZA 2IHUA 2PJUA 1WV1A 1C9MA 4BGEA 5J4YA 1LF5A 3R44A 3PUVA 4FSXA 4B4DA 4P84A 3RHTA 4DRXA 1NN0A 1YASA 2JDIA 2R8EA 3T5BA 2GNOA 1SCQA 4QDXA 1VCHA 1KVUA 1ZMBA 4J7XA 1U2SA 2FEOA 4WXPA 5TQ0B 4BS9A 2C9CA 1EBFA 4YXFA 1UZLA 4UBOA 3VZRA 3K5IA 5IFKA 3HJNA 1QH8B 4WADA 4TRNA 5GM1A 4MGZR 2AZDA 5BWLA 3O38A 3RBAA 1A76A 3TW4A 4N5NA 4EFKA 3UC9A 4UC0A 3RW9A 4EY3A 1JIUA 2FMXA 3KJFA 1RPZA 1X7WB 1Y33E 5F3RA 3EPLA 3GF4A 2ZE5A 3AFMA 3E5NA 3Q5GA 5GONB 5SY4A 2OGTA 1GPUA 2CXHA 3I9V1 2D2VA 4X61A 2WD7B 3KKMA 5G0SA 5HFJA 4C04A 2V5VA 1X0XA 2JHFA 1OPXA 2Z6QA 1YZVA 2RC6A 2J9RA 1ENOA 2I1LA 4EEXA 3LX8A 4MIOA 1YL5A 5CLQA 1FNBA 1Q19A 1DC8A 3K6KA 4GQAA 4JSRA 3WGLA 4NPHA 4A1FA 3JWGA 4ZCRA 3E7PA 3WXMA 4EHIA 3LPLA 4YMIA 1AM4D 3OZBA 4HRXA 2OL4A 4ZQGA 2VOEA 2YKGA 4MLDA 2JGLA 4AJEA 3NKFA 3GW8A 2D5LA 4Z3KA 2YNMC 4MVYA 2G3YA 4EHKA 4LSZA 3W3AH 1P73A 3FSRA 1AKVA 1N2CB 3OE1A 2O7SA 3C4QA 3U0VA 2BKLA 1QFSA 2IKSA 1SU8A 2GBGA 4TLMB 5I8ZA 1W88A 1GRRA 3NOQA 4PC6A 4YASA 4ERXA 2Z8YA 1F2UA 1DJQA 5H0IA 1M34A 4K9PA 4AAYA 1UBJS 4FMDF 5HE9A 1IFXA 1XIVA 5F1YA 4ZZ2A 4E1BA 4LBVA 4C3OB 4FBMA 1QGUB 2HQ1A 1KBOA 4ZT5A 1AN9A 1L5QA 2EW1A 1GIAA 3UXHA 5C37A 2NQ2C 1U9IC 3E15A 4ARZB 3KIPA 1JG3A 3K1AB 3CNBA 2FQWA 2VDQB 1CUZA 1GG9A 5COQA 3GNLA 2W48A 4HTFB 2AQ8A 4R54A 4CG3A 3HSYA 4WBNF 3FTEA 3RFXA 1I4DD 1W85B 3EPPA 3L7LA 1BAPA 2Q0SA 2PIAA 3LQ4A 2XHEA 3VMMA 4AIRA 4TQAA 1LBEA 2F8MA 4O25A 4RVCA 3TTTA 2EBFX 4UQLA 3JYPA 4NVRA 2Y0EA 1YS2X 3LHDA 3FYUA 4JB0A 1ZJ6A 2FW1A 1J2TA 1I5OA 2G09A 2IUSA 3QUSA 5HBGA 1C1XA 2LWIA 5KOJB 1D6SA 2HK6A 3TNDA 2YIJA 3F98A 2V55B 1E3TA 1W75A 1IXKA 1YRBA 2LV8A 3OTQA 3PKZA 4M98A 5F35A 2RARA 1GQFA 2C9YA 3HKCB 2LE0A 2PD6A 4E5VA 1BGWA 4JJIA 1LY1A 4YDHB 4ASUA 1NASA 1ESZA 1RAAA 4XIIA 2UXDB 4FB4A 3I28A 1CUXA 1J8QA 2GN0A 4FNGA 3E3MA 4UMFA 4DDVA 2ZI4A 4YECA 1J70A 3EGXA 3H8VA 2PS1A 3SQOA 3JVUA 3ZWAA 1SU4A 3BBLA 1D4ZA 5CVVA 1R10A 4R8LA 5F7JA 2GN4A 2AK2A 3LOPA 1BU5A 4JI1B 3MNFA 4YUXA 2O14A 5AVXA 3OJLA 2ZRAA 4HZUB 4KXWA 1HE5A 3WRYA 4DYVA 3DC7A 1U3UA 3TL2A 4BNWA 4DS3A 3UYLA 4C29A 3DM5A 4E07A 4U7HA 1JP7A 2OFXA 4BVBA 4LOHA 2AHRA 5KUTA 4DLZA 2NTYC 4NV1A 1M6HA 1MORA 2PT7A 2DFPA 4KQMA 4TL6A 2NWQA 4CKEB 2VYVD 2WIBA 3L7KA 3MT0A 5I9BA 3GFOA 3TVYA 4BATA 1QR6A 2AR7A 2AE2A 3MERA 4ZU6X 5LA6A 2BM0A 4BEJA 1SUDA 4ZI2A 5I3CA 1VI6A 5HIAA 1UBNA 1EZZA 4G6ZA 4IGFA 4XCXA 3U4CA 4BRUA 1I8TA 1VHDA 3C8UA 3ASUA 3JQDA 2OGZA 4BN0A 3A58B 3CA8A 3ANMA 3L8ZA 4DC0A 4R1NA 2OYSA 3AUUA 2DPMA 5CT8A 5FOSA 1JR3A 1AGRA 4F2WA 3DMYA 1P7CA 4ZPJA 5BQFA 1QE5A 2EX0A 2GBFA 2REOA 2VUSA 3GEHA 3P20A 3P9IA 4BKQA 4FB5A 5CDGA 4JJ8A 1UDCA 3B5EA 4EGAA 1XZGA 4FNOA 2GTIA 4ML3A 1FB5A 1RACA 4INOA 3RG2A 5TIIA 1T5IA 2DSNA 3ZX4A 5JSZB 3NBXX 1EFDN 1M6YA 1TQ8A 1I1OA 1SXIA 3QFTA 5CVEA 2G1PA 5DK6A 4D43A 3QTBA 5E1BA 3BK1A 2XE8A 2HA4A 3OJCA 5K8TA 1X9HA 1NFQA 2IE0A 5IVIA 3RVRA 3VR6A 4OX9Y 3RABA 1J00A 3LBNA 4BNZA 4CV1A 3H11A 4DA7A 2QZPA 2ONKA 2JA2A 3NUZA 3KXIA 5FF9A 3BRCA 3E0XA 4MQEA 2CNNA 2RCYA 3QU2A 1C3EA 1U9ZA 4JIGA 4DA8A 3GG2A 4UATA 5J4KA 4LDNA 2FOIA 3QJGA 3VU3A 2WAOA 5JSHA 1KO4A 2D4AA 3EXIB 3QSYA 1XRRA 2BFWA 4O8ZA 2PZMA 4C0BA 1G20E 2PPLA 5JISA 3M49A 4Z4QA 1N3YA 3NORA 3GG9A 2J41A 1LSJA 1UC8A 2O23A 4OYRA 3RVSA 3VR2D 2VJOA 2OBBA 2XRFA 4EO7A 2Y4NA 4QJIA 4IQ4A 3NVKI 1KXJA 1ODCA 2PMFA 1D7OA 4D80A 3HLKA 1RKUA 4JHXA 2BFCB 2I1VB 3FVVA 3IQHX 5B2EA 2R65A 3K9GA 4YHHB 2IL1A 2YDYA 4GX2A 4MWSA 3TCKA 3UW3A 4D4GA 4HK4A 1CUAA 3TKYA 1J2UA 2BAGA 4UTRA 3M1YA 2VZ0A 2REBA 1VYTA 4WNAB 1WY5A 4WKOA 1PJZA 4D4KA 3TLGA 4CKBA 1FFXB 3OX3A 2HX1A 1YZNA 2PKRA 2XHZA 3T5CA 1MJ5A 2PX2A 3V4PB 1BWPA 4V3CA 4DDTA 7ABPA 3TQSA 3G0HA 3WIDA 2ZE6A 2W58A 4JYCA 4DWOA 2WQ6A 2R8PA 1Z88A 2WT4A 5DP2A 4YAWA 1JEYB 2ZYIA 4GWLA 1UBRS 1HURA 2DKFA 4K81B 4TTRA 3HR8A 2R48A 4UBKA 4IP0A 3AM5A 2O19A 3H75A 2NM0A 3LVQE 2FTKE 1NBMA 4O4JA 3GFPA 1JDVA 5DV9A 1DELA 1DRUA 4YJ3B 1U8ZA 1ZA2A 4Z4GA 5FWYA 3N2IA 2GSWA 3HXTA 4NG5A 3K8QA 1Z07A 1PX0A 2X0DA 1DAKA 4CTMA 2J46A 3UANA 1DPFA 2ACWA 2ANCA 2EAUA 2H1HA 2OEPA 4CG2A 5JAOA 4V3BA 4NAVA 2QX6A 1JWLA 2NZ2A 2ZTVA 1DBWA 4YUZA 2P68A 1Q50A 2NU7A 3DKVA 1KS2A 2J33A 3GRKA 2WIGA 4COOA 1V9SA 1X13A 2E4AA 2HIGA 4MOWA 4JL8A 5F5XA 3M34A 3UHAA 1QDUA 5ITZB 1QUEA 3BS4A 3D8HA 5AM2A 2ZIFA 1Z5VA 4JB2A 1D6JA 4F1JA 1P7PA 3GNQA 3O5AA 4F2GA 1IZ7A 3WL3A 4KFRA 3TINA 1GZ3A 4ZO4A 4LIPD 1C9EA 1O0SA 1PUJA 4Y9TA 1BFDA 1IN8A 3C85A 3CZ5A 3JQRA 1PR1A 3KBBA 4MI3A 2P9TA 2AFRA 4FYHA 1ZJWA 1NVMB 2CDBA 4GZ3A 4C4ZA 3H2IA 4OY3A 2CVHA 5ALPA 4XGIA 4YFVA 1HT0A 3TW6A 2ETXA 3R74A 2P9GA 1JT2A 2M6RA 1FK8A 3TBKA 5JECA 4JC5A 1BGXT 4C22A 3QVXA 4IF6A 2Z3ZA 5KJEA 1A3CA 3SBDA 3PZBA 5MN6A 4JI2B 2PY6A 1FNNA 2O3TA 1P81A 2JLZA 2ECOA 3GHHA 4LTDA 1T5DX 3FOEC 1XEAA 4ZVSA 5HMMA 4C2TA 3DWGA 3ITEA 4A2WA 2EG5A 3A37A 2RIPA 3H6HA 2WFAA 4D97A 4MMYB 2F67A 4TXLA 4BO3A 2Q3EA 2ZKIA 4RUKA 4XM2A 5EMJA 1U5AA 5JVDF 1W1WA 2AWOA 3DE4X 5DSZA 1IE3A 2PKEA 3LQFA 3OCVA 1GL7A 3IAHA 1E79D 4JQSA 3WIOA 4CF4A 4DRYA 2O0KA 3QVVA 5DI3A 5BWNA 3HXKA 1ORRA 1U11A 2Q29A 3AETB 3BH7A 4FW8A 2V3WA 4NBKA 1KDRA 1M1NA 3IUEA 3M5PA 4J7CA 2J9XB 4MPDA 4RD0A 5K1ZA 4B45A 4ZIRA 2Q5CA 5CX1B 2ZG6A 2YHUA 1SBCA 3ZWPA 5AVWA 5KVCA 3K9FC 2EW2A 3P9CA 3TPCA 4IYRA 1I3LA 2ZJYA 1JIQA 4LFBB 1GT6A 3K1AA 2VHEA 3B52X 1XFAA 1WDTA 2FOXA 4BQQA 2GO1A 3TFOA 2FR8A 2CK3D 1PI3A 2AOTA 2HJ9A 1RWQA 3F1LA 3LT0A 4G1VA 2JCSA 2CY0A 1B8NA 4M76B 4MI9A 1JSZA 4ZEOA 4RKFA 3IL2A 1OXUA 3MHPA 4I19A 2Q9AA 2WOJA 2YJ6A 3O94A 4IHJF 3ZXXA 3TLBA 2OK8A 4J2HA 4JEHA 3VAAA 2WFZA 1B0AA 1D07A 3IFSA 2I8LA 3ZZ0A 4QUKA 4HSEA 2D5AA 2QR2A 4DJAA 5JASA 3MWEA 3ZGLA 1JQ3A 3B3JA 5CJJA 2PLRA 3CVYA 1JIXA 4AZ3B 1FRNA 3NBKA 4CM8A 3NALA 3R0JA 1EGHA 2I4MA 4MUKA 1K63A 1DDGA 2JK0A 4EF4A 3GJZA 3OM1A 3EC7A 3KZ1E 1ULAA 1E77A 4AL4A 1K98A 4ZODA 2ABWA 3AYXB 4S12A 2QT1A 1ZJ5A 4E30A 1OWMA 2BIFA 2F9MA 2SKDA 3GJ3A 1GUFA 1LNSA 4ER3A 4WBNB 2NYVA 2E6KA 1RXEA 2X0NA 1PWEA 3FNEA 4NBUA 4P34A 2XOKD 3NONA 2WIJA 2DCUA 4FXPA 4KQFA 3G5UA 4OU4A 1O94A 3NT4A 4A8HA 4BP3A 2ZJ1A 1V16B 3NAQA 5T6MA 2VZ9A 4L4ZA 2GUWA 4JI8B 2CD7A 3JALB 3GXBA 4O59O 3R5SA 4DLVA 2OAP1 3DOEA 1U31A 4DQLA 2J48A 1DQPA 1KH3A 3A6KA 5E9AA 4FDMA 3U56A 2FZ5A 2I34A 3CH5A 5TY0A 4RIFA 2R84A 4M9SA 4A0HA 4CLOA 4M88A 5L4NA 2ZBQA 2WTMA 3Q6MA 4HB3A 4HXGA 4D3XA 1WB4A 2VPIA 3IUJA 1EJ2A 4W5JA 3RFTA 4C1NA 1M67A 2A9RA 2DETA 1ESMA 1LLFA 2FN8A 1Q16A 1ZIOA 3N7TA 4HXFB 4XWKA 1Q14A 3KQUA 1USIA 3M6IA 3UQZA 4PX3A 1XVLA 3DWEX 3VR6D 3ZJVA 1F2DA 1LJ8A 1VHLA 3B70A 3JTMA 4Q4JA 4UD2A 3SQWA 3NYRA 2P6OA 2Y0CA 4LY3A 1P2FA 1CEYA 2IXTA 1RVDA 4YXWD 3SU8A 1DNPA 3IQEA 2WWGA 5D5HA 4Y6LA 5JROA 3FPKA 2Z3VA 1YRQA 4BGUA 1RYEA 3RH0A 2Z43A 2F64A 1YBMA 1YGYA 4I0WB 3PTAA 4FEYA 4TTVA 1T36A 1B1AA 1UAGA 2ZYAA 3ZWOA 2BRUA 4Y7DA 4QBTA 4QU5A 1W4RA 3C97A 4DV0B 2EKLA 5DKFA 2W2OA 3G2MA 3ENQA 1TJ3A 1WCXA 4PTZA 2LBPA 3EUFA 1SIBE 4NMLA 4ZCSA 3RBXA 1LBSA 4URFA 3ZCUA 1H2RS 5IKXA 1E0AA 3AUXA 1YRAA 3DZ8A 3DD1A 4GPTA 1H6DA 1TIBA 3K05A 4ZV9A 4EZIA 1KZ7B 4X1KA 4ICIA 4DSNA 2KJQA 1VKOA 1WW8A 1GITA 1P91A 1PJCA 3DMRA 4WBXC 5E3JA 5BQ3A 2UUBB 1HOXA 1MDFA 1T8RA 2ZUEA 4IS2A 1NBME 2JLSA 5B58T 1GAJA 4S1NA 3A1WA 4B1FA 4PEVA 3LQYA 1P6UA 1EX9A 1MVLA 4NCXA 4DMUB 3LLMA 1UQTA 3DAGA 4BL5A 5CDFE 3GLIA 2NU6A 4ZOQI 1M3SA 1UPFA 2GWHA 4M9RA 5AI5A 4LHVA 1ZONA 2MSDB 5IWAB 3EJ6A 3TSCA 1Z16A 1MKYA 3TJMA 1KY3A 2V6GA 5BMOA 4LBZA 2Y68A 2MOKA 3IMFA 5K0EA 5IDXA 1FYEA 1RI4A 2YC4C 1AGNA 4DNQA 3LWDA 3T1OA 2XH8A 5DGHA 7ADHA 3QBVA 1L5OA 1TEXA 4JYPA 5I4CA 2W42A 1KDZA 2Q27A 2VHZA 2JJ8A 2CD9A 3CLVA 1P77A 1DIGA 1Q15A 2W83A 1N9KA 3J7AC 1TVMA 1W52X 2E0IA 3AHDA 2XWJI 3E4CA 1IZ0A 4YHBA 3VC2A 5T8KC 2AD1A 3UB4A 1GKKA 4HV4A 4XLLA 1A8IA 1WUIS 2QN8A 2H54A 4QJ4A 2DXIA 8MHTA 4QXOA 2P0EA 2YVUA 1VHQA 2JJ1D 3IIEA 3D81A 2GM5A 2PVPA 1MH1A 3S8EA 3RAEC 1F8UA 1KKMA 1R5JA 3GL9A 4C7KA 4DBVO 5EKUA 4K46A 5CB4A 1QAMA 3V80A 1W2GA 1XHFA 3D3WA 3JD0A 2ZWPA 1A88A 4G5OA 4L9AA 4QDOA 4YPFA 5K2MA 4WXYB 1KJJA 2Y92A 2XPCA 2Z6VA 5GJBA 2C95A 4BB0A 4ETIA 3BTUA 1YI0A 3DKPA 5A5EA 1UJCA 5BNWA 3W6OA 5LZ9A 1QIMA 1TTQB 3PDIB 1VIAA 4P35A 3RIEA 1DUIA 4KODA 1JQBA 3JYNA 3FLMA 4ZK6A 2P8SA 3V1UA 4UJ5A 3O9MA 1V71A 5KQPA 1QHYA 2I3DA 4H1WA 1P72A 3ZWNA 3ZHSA 1MXHA 3U13A 3RU7A 3FLEA 4AX4A 2FZVA 4XJVA 4M36A 3P94A 1ZS9A 4X6XA 1J06A 1PT9A 3F67A 3F96A 3PENA 3AWIA 3M6WA 4RDIA 1DAEA 2QX9A 4MVJM 1A7KA 1RBMA 1T3GA 3ESBA 4MP8A 4WEOA 1QLWA 3GPDG 4B09A 5BSGA 4JOCA 3GP8A 4LMBA 1UXGA 5GINE 4F3KA 1ZN8A 3L8FA 2C9OA 2X4DA 4WECA 5HA5A 1W46A 2QAIA 4DYDA 5B1YA 4QXRA 4RTLA 5CFNA 3PEVA 2HIAA 3FCCA 1WSAA 2GA9A 3HB9A 4LYHA 5LCXA 2IOFK 1K92A 4AY4A 2I7DA 2OHVA 2GXQA 4M7RA 4RSMA 3F6RA 2YJZA 3ICWA 3HS3A 4OBWA 2YBEA 1SBHA 5EYPA 4ZO7A 2VRCD 3RSLA 1MQ8B 2HHCA 4ZHSA 3M4NA 1Q12A 3AEQA 3SG0A 2FPUA 2FUEA 5FXMA 3V4OA 3VJMA 1MGPA 5EQTA 2PVSA 1FPQA 1IZZA 4MCAA 4YJ2A 1G41A 5JXIA 1T5HX 2CXPA 4H1VA 3NHWA 4MINA 4C7XA 1QHGA 4O3MA 1C7EA 5KOHB 2BR5A 2JFXA 3P9ZA 4DQVA 5EIBD 4LC0A 1VGRA 3INNA 4IDNA 5DT2A 3EULA 2OXEA 2D5CA 1ZY2A 3SMVA 4GXQA 1I7LA 1YQXA 1CUVA 2HWUA 2O3SA 3DMPA 2I03A 2O2DA 3NVMB 2RGXA 2QNIA 4MV8A 4U6SA 1ECBA 3LZDA 2E49A 3IIIA 4MCHA 1MB3A 2NU9B 1V37A 1UKEA 4D0SA 3BQNB 3IULA 1OT3A 1U7PA 2Z2ZA 2Z0MA 3VTKA 3WJ1A 4BAZA 1B6RA 1VG8A 4BMXA 2EGHA 3IPRA 4J9UE 1RRFA 4FM9A 5IS2A 4DA4A 4B83A 1TTPB 2R79A 1RHRA 2WT9A 3N2EA 3G9UA 3SXJA 3ML1A 5IM4A 3KJZA 2QUJA 1FMCA 1CR6A 2C04A 1OAOC 2BCGY 4H7FA 4FYJA 3QEMA 3W6UA 3GP5A 4CRWB 4WAUA 4RCVA 1BXGA 4I5EA 3HZHA 2HU7A 2C4MA 1U0TA 1R9NA 4GPZA 5DSXA 2ZVJA 3CU5A 3JARB 1ZFNA 3FR8A 2ZRJA 2AKYA 3NHFA 3JQGB 1D03A 1FP6A 3OZWA 1SOAA 4DABA 1WBBA 4DPLA 3ETJA 1N78A 1OJLA 3RAJA 3R6TA 1YR7A 4W5WA 5KWSA 1NVTA 2AOVA 1OX4B 3GCXA 3SEAA 3BWYA 1OXXK 4PC7A 2L69A 3TTXA 5CT9A 2NW6A 1CR0A 1FBNA 1R27A 3MIIA 5ICEA 1LU9A 2PNFA 2WKQA 3VR2A 2P2ZA 1RXSA 2QMZA 2BKXA 2W2KA 3CR8A 3VNSA 4WINA 5FPTA 3OJFA 5J5CA 3SKVA 4DT1A 1JHYA 1ONBA 1NNSA 4W82A 1QOPB 2EP5A 2PD3A 3MFYA 2AL7A 2JW5A 3LC7O 1MD9A 5K3CA 1TO1E 1U8UA 3ZHCA 1VLJA 3DQPA 1A9RA 4XVHA 3RSFA 2H06A 4HVCA 2BBOA 4MARA 3VR3A 3L4KA 3PC3A 4ZJZA 3IEVA 1T6BY 4BTVA 1VJ5A 4YRPA 4XD2A 5FJIA 4QPPA 1K7EB 2EFDB 4R1TA 4RGVA 3RUIA 2OENG 4CV2A 5KPJA 1MJGA 3RDPA 1L4FA 3QXCA 3UT5A 4E5UA 1R0CA 3TSOA 2QD5A 5B3LA 2XUHA 3VNBA 4LF5B 3EWAA 5I7HA 2XVAA 4ZARA 2HDNB 5BSKA 4IF4A 3VYRB 5LD2C 2P3OA 2VOJA 4NEGA 4Q9NA 3U7RA 5CYOA 2WJJA 4Y6PA 2IEGA 3MOGA 3SYNA 2IH5A 4I3HA 2O6LA 3A9CA 3GEMA 1Z4QA 1KR2A 1U8YA 1UJ2A 1ZH0A 1TM3E 5TQ2A 3O2QB 2AYXA 1JVBA 2QG9A 3ILYA 2OSBA 4IXDA 2DWQA 2BR3A 3C3MA 3D6NB 4WKGA 5FUWA 5J47A 1PJ8A 2QVZX 3BULA 4HDRB 3I34X 5C3UA 7AT1A 3OLQA 3N3AC 4EG0A 2FN3A 1PL0A 3AUYA 2WYIA 3HP7A 3QVJA 4PZYA 1V6AA 4FBGA 1SN7A 1YCGA 5G0VA 4K9SA 2IV3A 3UOGA 2AJDA 2R1TB 4PXYA 5B37A 1SIUA 1CX9B 4FDUA 4HQOA 5F1KA 2ZR0A 4IGAA 1OTXA 1NYTA 4L8VA 4WOPA 1V47A 3U4QB 2NYAA 2OV1A 3OIUA 1IHOA 2IVZA 2OB1A 3KB1A 3OMWA 3PT5A 5DZSA 5JZ9A 4RMIA 3WYFA 3M89A 3AV0B 4DMGA