3I5ZA

Crystal structure of erk2 bound to (s)-n-(2-hydroxy-1-phenylethyl)-4-(5-methyl-2-(phenylamino)pyrimidin-4-yl)-1h-pyrrole-2-carboxamide
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
350
structure length
331
Chain Sequence
GAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVVATRWYRAPEIMLTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided design of potent and selective pyrimidylpyrrole inhibitors of extracellular signal-regulated kinase (ERK) using conformational control.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 1
total genus 107
structure length 331
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2009-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3i5zA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3i5zA01
4LG4A 3KMWA 4FEVA 2J9MA 3DZOA 2OU7A 3QA0A 5JN2A 3R1SA 3V5QA 5EQPA 5AUYA 3RM6A 3QA8A 4FZ7A 3BGPA 3AC1A 3FKOA 4PL4A 4W9XA 4IX5A 4J8NA 3DXPA 2OK1A 1PMUA 4E4MA 2JDRA 5IMEA 4F9CA 4OTRA 4QMOA 1PKGA 1W0XC 3PIXA 5LQFA 3BLHA 4L52A 2BAJA 5JK3A 2WOUA 2H9VA 5CEPA 2OF4A 3BLQA 3FXWA 4G3EA 5FM2A 4BYIA 3R9RA 2R5TA 5M55A 1J1CA 3AXWA 4ACGA 4MXXA 3FMJA 5BVDA 2I7QA 2XF0A 3MFSA 3ZH8A 4EK4A 3R1YA 3V5LA 5GZ9A 4EZ5A 1OL5A 5J1VA 2CKPA 5ANIA 2Z02A 3QQKA 2XK7A 3Q9XA 4RJ4A 3BGQA 1M7NA 4XV9A 2VTLA 4RJ8A 3U4WA 3E8NA 4I4EA 5CZIA 4QOXA 4K8AA 4ZXTA 3WE4A 5CAQA 3SVVA 5IA2A 5IQAA 2RKUA 1REKA 4BCPA 2QU6A 4DGGA 4YZMA 1OUKA 2XJ2A 2P0CA 2I0VA 4ZS0A 4FT5A 3FC1X 3MH1A 4CKIA 1JPAA 3GI3A 4FMQA 5CS6A 3W8QA 4R8QA 3WZEA 1H08A 3OWLA 2WMXA 5LJJA 3CPBA 2OJJA 1WMKA 3O8UA 3DOGA 1OKYA 3C7QA 4F7SA 4ASDA 3KVWA 4DFUA 3KU2A 4FTKA 1OI9A 2XK4A 5ETCA 3G6GA 4ZTHA 3TL8A 4QYHA 5HIDA 5L2TA 1UU7A 4DFBA 2WPAA 3SG8A 5IUIA 3TM0A 3KF4A 1JSUA 3F9NA 3BHUA 2ITXA 3D7ZA 3BZ3A 4CMTA 5CEMA 3ZO2A 5E92A 4RZWA 3W18A 4JG7A 3QTIA 2ETKA 1FQ1B 2QU5A 4BDIA 3R7EA 4GK4A 3F2AA 4FV8A 1ZXEA 1FGKA 1H27A 3DBEA 4DH1A 5E90A 4FICA 3M11A 3K5UA 1PW2A 4MD7E 1R78A 3AC8A 3F6XA 2R7BA 2BZJA 3QCSA 1YHSA 5GJGA 2QO7A 4FKIA 3LM0A 4JRNA 1DS5A 2A27A 5CSXA 1FVTA 3DCVA 5FGKA 5I9WA 3DJ6A 4EK3A 4MVFA 3TV4A 4CQEA 2ITTA 3DB8A 4JIKA 3JY0A 3LCDA 5DIAA 3V01A 5FLFA 2YA9A 2PUIA 4AN3A 4C57A 3GGFA 3CD3A 4FTOA 2JDTA 4GG7A 4M15A 3F3WA 3QRIA 3W33A 3H0ZA 4BIEA 4UX9A 4A4OA 3D2IA 4M67A 1R0PA 1S9IA 3MYGA 2X6EA 3RNIA 4MWIA 2R64A 3R8ZA 3UPXA 3ZFYA 2GNIA 3IS5A 2WZJA 4O7TA 4Y83A 3JPVA 1FGIA 2JAVA 2P33A 1RW8A 3UQCA 3RZBA 4M14A 3UNJA 2XUUA 2F7EE 3UZPA 4UMPA 2OGVA 4FSRA 3SV0A 1NA7A 2ITOA 3E8CA 3NVKI 1YXTA 3CTJA 4E7WA 4MAOA 2QR8A 4FTNA 4GKHA 5BNJA 5CT7A 5B2KA 3HV5A 2XRWA 3FLWA 1GZNA 2X7GA 4UWYA 2QKRA 4P7EA 3D5WA 2OF2A 2IW9A 3LMHA 4CTCA 4OAVB 4WSYA 3RBWA 1H1PA 3PE1A 3DT1A 3E87A 5AMNA 2VGOA 3KCFA 4FZ6A 3WBLA 4EQCA 1PMVA 1KOAA 3KULB 2R0IA 2XK9A 4NM3A 5BVKA 5KHXA 1M17A 3OC1A 2YCQA 2F9GA 1B39A 1IG1A 2WQMA 3OY3A 5EM8A 5AV1A 3ZO3A 4UXLA 2I0YA 4B4LA 3IOKA 1H01A 3HYHA 5DR9A 5E1EA 2CGXA 2P3GX 1PHKA 3FQSA 3ODYX 1LR4A 4GK2A 4IB5A 4KRCA 4MXAA 3FWQA 5HG5A 3BCEA 2YLEA 2A19B 1BL7A 5J87A 4TNDA 4L3JA 5K5NA 4K1BA 5AP5A 5FRIA 4EQMA 3HX4A 2WIPA 5J79A 1PXIA 2B9IA 3KXXA 3PVWA 4F9AA 3PP1A 2FH9A 4IJPA 5J95A 5JRQA 4LMNA 2R2PA 3QXOA 4H05A 3IGOA 2PVHA 5CASA 3GP0A 1OM1A 5I3RA 4DH5A 4DGLC 5FP5A 4BTKA 2C0OA 1M2PA 4WHZA 4J95A 3H3CA 5HG7A 2A1AB 4F0FA 5FXSA 4RVLA 3GC0A 4UALA 3EQIA 1HOWA 4M3QA 2I1MA 3PZHA 3DS6A 5EM7A 3TZMA 4JAIA 2ZMDA 5A3XA 3B2TA 3HV6A 3HKOA 5BX0A 2OH4A 2C0IA 4FT9A 4KSQA 4MNEB 5AV0A 1DI8A 3POZA 2DYLA 5ACBC 4U81A 3F3TA 5HBHA 4U5JA 4HYSA 1WBTA 2GNLA 1YWRA 2VAGA 4O0WA 4X21A 4BCJA 3OZ6A 4Y46A 3LHJA 3NYNA 4LYNA 1K3AA 5GJFA 4F0IA 4EH5A 5JGBA 3AD6A 1XH4A 2V55A 2W99B 3DBQA 4TWCA 1JKLA 5TO8A 4XG7A 4Z9LA 5BVWA 3ZYAA 3G9NA 4AZSA 5EI8A 2VWYA 5KMKA 1OMWA 5K0KA 4LFIA 1WBSA 2C5OA 3FAAA 5KUPA 1WFCA 5HNIX 2FO0A 4AQCA 3MPAA 3OCGA 5A4CA 2WGJA 3T9IA 3VUTA 5AA8A 5AR8A 3RI1A 3V51A 3WYYA 5L6OA 3HDMA 4LV5A 4XX9A 1KV2A 5HD7A 4NCTA 2PMOX 5DMZA 2W4KA 3OXTA 3I81A 4QD6A 3TIZA 4LQMA 5CX9A 3R8UA 4KSPA 5HO6A 3TTJA 3VWAA 3ZONA 4O7VA 4QNAA 4EKLA 4X2GA 4RVKA 3TNQB 3R8VA 5HLPA 4BI1A 1JNKA 4FG8A 1WAKA 1Y6AA 2HWPA 3G5DA 3GB2A 4JBVA 4NT4A 1QPCA 3VVHA 4ANQA 1LUFA 3G33A 4PRJA 4OT5A 3RNYA 5AIRA 3VBVA 2Y0AA 2I40A 4I4FA 2I0EA 2REIA 2B55A 3SAYA 4FV1A 2DUVA 4QP2A 3G15A 3UQGA 4A9TA 2BCJA 3JVSA 3NW7A 5HG9A 3RKBA 2R3JA 4MTAA 4FV3A 3R0TA 4RVMA 4D55A 3CS9A 3P9JA 3UIUA 4HYHA 4E5AX 4ZLYA 5A6OA 1UKHA 5LMBA 4R77A 2UVZA 4PL3A 5JQ8A 5BVOA 3VO3A 5FDPA 2C30A 2HZIA 5AR7A 3FSKA 2A2AA 3HUBA 4FTIA 5CXZA 3LFQA 3M42A 2OXXA 3GBZA 5HI2A 3R7UA 2HAKA 1M7QA 4BHZA 3OXZA 3IGGA 4R1VA 5E8XA 5H9BA 4F9YA 2BR1A 3MVMA 3ZZEA 4OTFA 5L3AA 3EN5A 3F82A 5DPVA 4AW1A 3PIYA 4YJNA 5KO1A 3O8PA 4I5HA 4QMYA 2W1HA 3LW0A 1M2RA 3FZOA 1TKIA 2H8HA 2W0JA 5F1ZA 4DGMA 4NKSA 4A9RA 5IDNA 3WF9A 2YISA 2WMVA 1PXPA 3NUAA 1PXMA 4QMLA 1U4DA 2VTHA 4FV5A 4U79A 3WOWA 3PXQA 3LOKA 4IACA 3BKBA 4DTBA 1PXLA 3F2RA 5T3QA 1ZY5A 2B54A 4YJVA 4FT0A 4IZYA 4BDDA 2VZ6A 2O3PA 4B0GA 3WARA 4JG6A 3QKMA 1M2QA 5LCKA 4HVGA 3Q3BA 4GYGA 4JQ7A 3IQ7A 3KEXA 1P4FA 4ZAUA 5HG8A 5D10A 4XV1A 2J5FA 2XBJA 5L8KA 5G6VA 3VHEA 4JR7A 3G0EA 2JIUA 3RZFA 5IDPA 1ZYCA 3ERKA 1O6LA 4JDHA 3PVGA 2R3QA 1OPJA 2IVSA 5E9EA 4FVPA 5C01A 3LKMA 2X6DA 4X2NA 1A48A 1OITA 5CI6A 4EOQA 4ACCA 3TDWA 3KRRA 5K3YA 5KHWA 5AAFA 4JX3A 3HDNA 3NEWA 1GIHA 4GEOA 2VWZA 3RTPA 3VAPA 3QAME 4L7SA 5CT0A 3AMYA 2SRCA 4YNOA 4E6AA 4BZOA 2GS6A 1QPJA 1CKPA 1STCE 1W8CA 4TYJA 3DTWA 5FQDC 3SA0A 3QKKA 2R3OA 2A4LA 4FKGA 1GAGA 5DE2A 4IAZA 3P23A 5EFQA 4EK5A 3VBYA 3KXNA 3CLYA 4FK3A 4YU2A 5LVMA 3ALNA 4RWLA 3DBDA 2VTTA 1SVEA 4ITHA 2PVRA 4XEYA 3PJ1A 4YZDA 4FTRA 4O6EA 3UOLA 4D1SA 4TT7A 2F7ZE 3UZTA 2JDVA 2WTCA 3QQLA 4ENYA 1JKTA 4KBCA 3FLQA 4FR4A 3PRIA 3OBJA 3JY9A 1PY5A 2GMXA 3ODZX 5LWMA 4C02A 5IH4A 4F70A 3EZRA 4JVGA 3RJCA 3TTIA 4WG5A 2ZOQA 3EFLA 2FUMA 2R3LA 2VGPA 3FMNA 3HEGA 5AP6A 3I5NA 4MCVA 5FBNC 4YTIA 4I21A 2QOFA 2GNGA 2YIYA 1VZOA 4KS8A 5FG8A 3VUDA 2E9OA 4FG9A 4AG8A 3L8SA 2UW3A 4JG8A 2G2FA 3CQEA 5I9UA 2OW3A 1QCFA 2VTSA 2QHNA 5FM3A 2HENA 4FSZA 5DA3A 4OTWA 5DLSA 5HVKA 4DINA 5EOLA 4FNYA 3R01A 3OEFX 3K5VA 2UW6A 3ET7A 1P4OA 4K11A 3UNKA 4I0RA 4BWXA 2OZAB 1TVOA 5LARA 2GS2A 1UNGA 4FNWA 4BCOA 5AUUA 5IEXA 2B9JA 2OO8X 3NWWA 3ZMMA 4EH3A 3PVUA 4IQ6A 4W4XA 4FKVA 3KVXA 2WTIA 5AX9A 2WTKB 2X9FA 2YDIA 5FBOA 2W5BA 4X3JA 3VQUA 3EFJA 2QO2A 3E62A 2Y7JA 3R7VA 2WMSA 3GC7A 2C68A 5DBXA 4RIXA 4EH7A 3KREA 4BWKA 4OW8A 5AV4A 2PZ5A 2JEDA 1J1BA 3R63A 4QMPA 4UZDA 5HGIA 4CXAA 4CZTA 4NUSA 4YNEA 3WI6A 4S2ZA 4EK6A 5LVPA 2J0KA 2JFMA 4RSSA 4O7WA 4U3YA 3EN7A 2UW7A 1MRUA 5F9EA 1H25A 4EOOA 2JDOA 3LXKA 3MB6A 3WF6A 4TW9A 2B9FA 1FMOE 2GNJA 2EB2A 4XLIA 1B38A 3ZUUA 5CF6A 5H8BA 1Z9XA 3F2NA 4TRLA 4ZTLA 2VTAA 2BMCA 4EJ7A 3LFDA 2YWPA 2R4BA 3MV5A 3QCYA 3VUMA 5A46A 2WHBA 2J90A 4JDIA 4F6UA 2F57A 4FEWA 2JGZA 4C8BA 4PV0A 4QQCA 4RT7A 3C50A 4NW6A 4BZNA 4PP7A 1WBOA 4BRXA 1FOTA 5EQYA 4XHKB 1ZYSA 4BZDA 2JKKA 4TWNA 2OI4X 3OHTA 1ZY4A 5L6WL 4EONA 4YJQA 5EG3A 1OBDA 1MP8A 5HOAA 3OBGA 3BEGA 4F63A 3CE3A 3ZM4A 3SDJA 4I94A 3QL8A 2ERZE 4PTGA 4QQ5A 3CIKA 2R3GA 4C3RA 2OJIA 2HW6A 3UC4A 4O7ZA 2IZSA 2C6DA 2E9PA 2YM7A 4DTAA 4GU9A 4P5QA 3V6SA 4CRLA 5KMOA 5DWRA 4GUEA 4ZMEA 2PTKA 3C5UA 3F7ZA 4IE9A 5DN3A 1Q5KA 5IF1A 2XNPA 4U44A 3CEKA 2OJFE 3A7FA 2W1ZA 4R5SA 3UC3A 3JS2A 3MBLA 3EMGA 3NRMA 3AGMA 3OEZA 4J96A 4UWBA 5EM6A 5KE0A 5C27A 1F0QA 3QTWA 4Y5QA 3MJ2A 1E9HA 3DKFA 4ZSEA 3TKHA 3AC4A 4YZ9A 2QONA 2VO0A 4FYOA 1U5QA 1ZYJA 3U9CA 4XUFA 4AWIA 4D0XA 3F5UA 3PPZA 3U4UA 2ITWA 5J9ZA 4GCJA 2OJ9A 3BHVA 4G9CA 4AGWA 2XIKA 2IJMA 2FGIA 4IB3A 4LOQA 3FY0A 4LM5A 3UOJA 1R1WA 1G3NA 3I6UA 4E4LA 1WVYA 3TEIA 3DDQA 4IX6A 5HKMA 3DB6A 4F09A 4N0SA 5AR2A 3PA3A 4CFWA 1IAJA 2QOKA 4A7CA 4DG2E 3MFRA 3ORKA 4RFMA 5TT7A 3C0IA 4XV2A 4ID7A 5C8NA 3C4WA 4EKKA 2GQSA 1UWJA 2JFLA 4MBJA 3S4QA 3R30A 4CV9A 1FPUA 1OKWA 4W9WA 4BCNA 4FIJA 4GUBA 5IUGA 2X8IA 3Q60A 2WO6A 3D5VA 5K5XA 3HAMA 5F94A 3ZXZA 1NT2A 4H3BA 4OBQA 3AOXA 4ALUA 1MQBA 3IONA 1P2AA 2QVSE 3U87A 3CKWA 2QOBA 2FA2A 4GRBA 5DG5A 2VWXA 3IW7A 3LXPA 4O0TA 3CSVA 4MNEA 1Q99A 4F7LA 3W2SA 3KL8A 1H8FA 1DM2A 3BYSA 3ZU7A 2ZMCA 2R3HA 3B8RA 5CAVA 4O27B 1Z5MA 3BHYA 3KC3A 2WTVA 2QLQA 4D1ZA 3C51A 4UMRA 1URWA 3L8VA 4WD5A 2BTSA 4C2WA 2DWBA 3DFAA 4JQEA 2UZOA 5E8UA 3SLSA 1ZLTA 4BDFA 4XNEA 4YLLA 4ANLA 4BDHA 1VYWA 3FPQA 3UYTA 3NUUA 3R1NA 4EQUA 4F7NA 3N4UA 4ZJVA 4JAJA 4ZSGA 3PFQA 2VTJA 3ORPA 4X3FB 2QURA 4BTJA 5I9YA 4L53A 5ANDA 4O0SA 4BDEA 3ZZWA 4B8LA 4FKOA 2WD1A 3LFNA 4IB0A 3UO4A 3NIEA 4EOMA 4QQJA 2W4JA 4IEBA 1K9AA 3SOCA 3PY3A 1SMHA 4TTHB 2WMBA 2WTKC 4R78A 4ALVA 4OTHA 2BAKA 1SNXA 2WEIA 3LQ8A 2VV9A 4Y8DA 4KRDA 2IVVA 5FP6A 4ENXA 5AV3A 4ASXA 3FDNA 4AGCA 5EI2A 4USEA 3OTVA 4OTPA 1OL2A 4AZEA 2XZSA 4O7YA 3SD0A 4ANMA 3PG1A 1W83A 4Y85A 3W2QA 1OPLA 2HZ4A 1KV1A 5K9IA 4V04A 3TG1A 4TY1A 3COIA 3KN6A 4I0SA 2RIOA 1KE7A 4YR8A 3FEGA 2C47A 4R7IA 4E1ZA 5M57A 4XS2A 2QHMA 3Q04A 3MW1A 5FXQA 3VS2A 2X2KA 1DAYA 1OUYA 3E64A 3O71A 4G3GA 2QG7A 1CKIA 3VS6A 3S1HA 2HY0A 2UZDA 4G1WA 4NCTC 2GPHA 3MN3A 3R6XA 4RJ5A 1YOJA 2ITVA 2XNMA 4UY9A 3N4VA 4Y72A 1YW2A 2HWOA 2V0DA 3LFBA 4L45A 4C38A 4GS6A 4MXCA 3VUKA 2JBOA 5A14A 3F88A 3KRWA 3F69A 3V04A 1HCLA 3OD6X 3UMXA 4ANSA 4YPDA 4AT5A 3VRZA 2OJGA 2F2CB 4DG0E 4BDJA 3CCNA 4FV0A 3QF9A 5A4QA 3GU4A 4MK0A 1PYEA 4RJ6A 2W17A 1KE6A 2W1FA 3BRBA 1XO2B 5KMIA 5E4HA 3UJGA 1Y6BA 4LUDA 5ACKA 4Y95A 1O9UA 2YLFA 2O0UA 3K54A 3HV4A 4IWDA 2GHLA 1IA8A 1JOWB 3TWJA 2GHMA 3A8XA 3BGZA 3KFAA 1M14A 1PYXA 2XKDA 4FSMA 2J51A 2GQRA 3C4FA 2OIBA 3R02A 2VTRA 3BYOA 4QNYA 5EDRA 3ZEPA 4AXAA 4HVHA 4O83A 2PZPA 5L2WA 2VD5A 2O2UA 3GEQA 5FUTA 2B53A 3IW4A 2X2MA 3S2PA 2YACA 2W05A 4PTCA 1CDKA 3MGYA 2J0LA 4LL5A 2XVDA 4QP9A 4FIHA 5DHJA 5EH0A 4C58A 5FXRA 2CSNA 3KCKA 3FI8A 3ZXTA 4JDJA 2VWIA 5J5TA 2VN9A 5AIKA 3TNIA 3A7JA 2BILB 4C7TA 4EOPA 3FKLA 3NNVA 4NJ3A 4I22A 5L6PA 4CKJA 3VS4A 4IAYA 2X4ZA 2XNNA 3FQHA 2ONLC 3C4CA 1YQJA 4O7SA 4NZWB 3EB0A 4FKRA 4Z7HA 2ONLA 3GCUA 3ZLSA 1ATPE 5D9HA 3Q9ZA 3ZRLA 2XCKA 1YDSE 4FX3A 4CKRA 5JH6A 5ANEA 3L9MA 4QP3A 5F20A 5KZIA 1KOBA 3P08A 4TXCA 1WBWA 2PZYA 3D9VA 4RA4A 4FV2A 4CD0A 3PXRA 3FLNC 5E91A 5CAOA 5IG1A 3U6HA 3HA8A 3HMNA 4WA9A 4O81A 3O0GA 2BZKB 4PF4A 4D4SA 5IA5A 3BQCA 3GVUA 3LCTA 4DEIA 4OTQA 2R7IA 1TQMA 2HZNA 3EH9A 4P90A 1CTPE 4HCVA 4FIGA 5CSHA 3Q6UA 5TE0A 5CEKA 4WBOA 4FK6A 2BRBA 2YN8A 3AMAA 3DV3A 3U8WA 3W8LA 4PNKA 5IA4A 3R7OA 4GT5A 3ORXA 4CCBA 3PY0A 1QPDA 1Y8GA 3H9FA 3ORLA 3EQDA 2C4GA 3QX4A 4ALWA 4UXQA 3ENMA 5JFWA 4AUAA 3BYVA 3ZS5A 1ZMUA 4BGGA 4J52A 4G6OA 4RX9A 4AE9A 5DRDA 4YC8A 3LPBA 1ND4A 3D7TA 2FYSA 5I0BA 4IANA 3P78A 3RAWA 2VWUA 3MTLA 1GNGA 5J9YA 4F64A 1JAMA 2PVKA 3DTCA 1E1XA 4KA3A 4LMUA 2C6IA 3UPZA 3QKLA 4CFFA 1IASA 4HPTE 4BCKA 3W2OA 4DGNA 4ZSLA 3LLTA 4B7TA 1J91A 4LGDA 4XRLA 2WTJA 1ERKA 2C6KA 4YJOA 4WUNA 2JD5A 2C6EA 3PLSA 2BRMA 4L6QA 2QQ7A 3ZBXA 3ZO1A 4C4HA 4CNHA 1RE8A 3DU8A 2XIZA 5B2MA 3HMIA 4QMZA 1YI4A 3VBTA 4UV0A 2WQNA 3LIJA 3R22A 4QP7A 4DEAA 2FSTX 5M56A 4DE4A 3E93A 3NS9A 3UODA 4F99A 2UZTA 4OBOA 3F5PA 3R8PA 2ZM1A 4D5HA 3G51A 3KK9A 4AT4A 4DYMA 5I9ZA 1LEZA 4R1YA 4K9YA 4QTAA 1YXVA 3ETAA 3GUBA 5HCZA 3HVCA 4M66A 4NYEA 5DI1A 1YXUA 2ESMA 5HLWA 2ITZA 3EZVA 4RG0A 3I0QA 3QQHA 3DBCA 2PULA 3AT2A 5BVFA 4IIRA 4YHFA 3A7HA 3QCQA 4RIXB 5CY3A 2XEZA 3FV8A 4LI5A 4CT1A 3ULIA 2Z2WA 4RBLA 3WYXA 1QMZA 4UYAA 5HCYA 3PYYA 3LQ5A 1V0OA 1RDQE 4CCUA 3QGWA 4U6RA 5KKRC 5HEZA 3ZUTA 5GINE 4P2KA 1Q24A 2V5QA 2Y6MA 3E8EA 4FKSA 2P55A 3W2RA 3PIZA 4I24A 4QTEA 2X4FA 3KULA 4BDAA 5EHYA 3KXGA 4ZTRA 3HNGA 4XBUA 4AACA 2OIQA 3BU5A 1LEWA 4QPMA 2B52A 5AUWA 4XRJA 4U7ZA 4H3QA 1Q8TA 2YEXA 3RP9A 4KIKA 3FMHA 1H1WA 4MD9E 4OBPA 3D5XA 4I1ZA 3EYHA 4UBAA 5M08A 3LQ3A 2JC6A 4FF8A 5HICA 4TWPA 1GOLA 4FTAA 3D14A 4KAOA 3QWKA 4PDSA 4IFGA 1OVEA 2EXMA 2ITNA 4FV6A 3RK7A 3EKNA 5M53A 1LPUA 4HCTA 4W4VA 3E88A 3DGKA 2OWBA 4KIPA 2X81A 3DA6A 2VTIA 3DKCA 4Z3VA 4TNBA 5CEIA 4DT8A 3RMFA 1XQZA 4Q9SA 4RJ3A 3I1AA 5DRBA 3V3VA 2GDOA 3BYMA 4BGQA 4BCQA 4AZVA 2KULA 3V5TA 2PE2A 4B9DA 4NW5A 1J7IA 3IW8A 4RMZA 2I6LA 5CTPA 5EDQA 3CJGA 4XG9A 4LRMA 4G17A 1ZMWA 2CN8A 5ICPA 1OIQA 3DFCB 4EUTA 4F6WA 1ZARA 2XYUA 4IZ5A 1Z57A 5ETAA 4FUYA 5HNBA 5HZNA 4GW8A 4PMSA 4YC3A 4CMUA 2F4JA 4JT3A 2PUPA 4TYGA 2OBJA 4O0VA 4V0GB 2RFSA 4W8DA 4O38A 3W2CA 5FTQA 1BI8A 5CU2A 3U9NA 3NAXA 3O23A 3KA0A 4A4XA 4AA5A 3Q4CA 4HZRA 4QTDA 4AAAA 4EK8A 5AM7A 4FNXA 5M07A 2CKOA 3LFAA 5CAPA 2V22A 5KKRB 4DA5A 3JVRA 2G2HA 3Q4TA 1SNUA 4APPA 2RG5A 4FEUA 4CGAA 3NVMB 4C61A 3QRUA 3BPRA 4X2FA 4ASEA 3T9TA 3ZSHA 1VEBA 2Y9QA 3ZDUA 4YBKA 5EM5A 2IZTA 5L8LA 3I0OA 3MB7A 4CFMA 3LJ1A 4HOKA 2YCRA 4M0YA 3QTQA 2IVTA 4J71A 3OUNB 4U8ZA 4PMTA 3A8WA 1PRYA 4OTIA 2QKWB 3Q9WA 5AP0A 2PVJA 2HYYA 2PVMA 2CDZA 4QMQA 2YAKA 1GJOA 5DVRA 2QNJA 3KY2A 3AD5A 3H30A 5EW3A 5C26A 2HW7A 3NYXA 2Z7SA 3QZFA 5JGAA 4WKQA 5B7VA 4LRJA 3O51A 3ZRKA 4XOYA 4H39A 4D4VA 3VW6A 3FL5A 2PUUA 4YZCA 3QCXA 4YLJA 5AUTA 3G9LX 4M8TA 3E7VA 3SG9A 2H6DA 4EBWA 3PRFA 4PPAA 4CYIA 3CC6A 3ENHA 4FSWA 3NCZA 4B99A 1J7LA 4O0YA 3UVPA 5AP4A 3H10A 3L9LA 4IAFA 4O0XA 2X8EA 2YIRA 4RIOA 4L42A 3EQBA 1PXOA 3IKAA 2C5YA 2CHLA 2BROA 3QX2A 2W5HA 4M68A 4RLLA 4XH6A 2YM4A 1SVHA 4FTMA 4NKAA 1JBPE 3NUYA 5IISA 5C1QB 5AP3A 3LJ0A 4IM3A 4C4EA 2C3LA 4D1XA 3HMMA 1UNLA 4D2SA 4DCEA 2FB8A 4D2WA 1OIUA 4LOOA 4JQ8A 3P7CA 4F1TA 2E9UA 4FKUA 3BIZA 2XK3A 4S30A 5CSVA 4U0IA 4WG4A 4W4YA 2WQEA 4JL9A 4IVCA 3SC1A 5LVNA 1H1RA 3BU3A 2BPMA 2C1AA 3SRVA 3WZKA 3MVLA 2YABA 3MJ1A 1T45A 5TKDA 1AGWA 1G5SA 1BL6A 5DYJA 3I4BA 4ZJJA 3PSCA 3FYJX 3MH2A 3QQGA 2XBAA 4A9YA 4XOZA 2JKMA 3UP2A 3U6JA 2IW8A 2W1DA 4L01A 3BI6A 3FZSA 3GU6A 4GMYA 4ZK5A 3ORTA 4B8MA 1S9JA 3MIAA 5GHVA 1H4LA 3TT0A 5FWKK 5K4JA 2BZIB 3BWJA 5ANJA 2YJSA 2P2HA 2WMUA 2UZBA 3GOPA 4MX9A 1U46A 2YDKA 3QUPA 4ZSJA 4ZTSA 4YHJA 5H2UA 4WNMA 2PK9A 3CQUA 1ZRZA 5IA3A 3BHHA 4CZYB 3ELJA 4K2RA 3IW5A 5HO8A 5EYKA 3UVRA 4C35A 4FE2A 4G2FA 3EHAA 1CM8A 3OUKA 5IQFA 4X7QA 4IXPA 1RJBA 4O96A 3KXMA 2WU6A 5HQ0A 4BFMA 1I09A 1YOMA 4NIFA 3U54A 4MQ2A 3EYGA 3PJ2A 3Q52A 2Y6OA 3R1QA 4ZEGA 3VHKA 5FEEA 2QOQA 3CTQA 4JDKA 4QTCA 1XBCA 4EWQA 2X8DA 4L9IA 5AP1A 4CLJA 4N57A 2IVUA 3R9DA 2B4SB 4EHZA 4FZDB 3QUEA 3E8DA 3D2KA 3QTSA 2YCFA 5CVGA 2YJRA 3MI9A 4AU8A 3D5UA 3FC2A 2BTRA 1R39A 2GTNA 5EKNA 2ZV9A 2Q0NA 4NL0A 4QQTA 4I6BA 2CNUA 2CPKE 2J5EA 3O50A 1PJKA 4JX7A 3DXNA 5DNRA 5CVHA 4BBEA 5DH3A 3RWPA 4E73A 1OGUA 5H8GA 4WT6A 4EZ3A 3NSZA 2BKZA 3H9OA 2V62A 3K3JA 3K3IA 3R21A 1L3RE 4ZZMA 3H9RA 3VS3A 4AT3A 4AZFA 2IWIA 5IQCA 5E8WA 3T3UA 4ZY4A 2DQ7X 4YJRA 3WF8A 2ZM3A 2J0IA 4PPBA 4QMWA 3REPA 2G9XA 2XM8A 3SXSA 1WVWA 3KF7A 4RC4A 3KGAA 3SX9A 4A9UA 4FEQA 1WCCA 4L3PA 4FGRA 5E1SA 2JIIA 5HO7A 5BYLA 3ZM9A 3S95A 2WMTA 4YO4A 4CRSA 5KX8A 2GTMA 3QBNA 4QP1A 2PVFA 3FZ1A 3MS9A 3O7LB 3NUPA 1PXNA 4RX5A 4WG3A 1ZOGA 4AFEA 3UIXA 4EH9A 4F9BA 4AW2A 3OG7A 1H0VA 2WMWA 1BUHA 5J7BA 2ZM4A 4XJ0A 3FHRA 3T8OA 3AC5A 3EN9A 3WIGA 4AP7A 4FSTA 4RIYB 3MY0A 4WRGA 5BUIA 5IKWA 1YVJA 2WMRA 3T3VA 3TNHA 5A6NA 4O21A 3CD8A 1BLXA 3F3VA 3GFEA 3PZEA 4EORA 1OL7A 4YJPA 2VX1A 5FD2A 2NRYA 3R7GA 4HYIA 4C4FA 1E1VA 1OBGA 2RFNA 3OW3A 4XCUA 2BVAA 2R3NA 3GC9A 1K2PA 4AS0A 3Q53A 4UZHA 2ETRA 2G2IA 3OWPA 4C33A 2CJMA 4YSMA 3P79A 4MKCA 1VYZA 3FSFA 1U54A 2YDJA 2W96B 3GFWA 4L44A 2VO7A 3MTFA 3QFVA 4L43A 5E8ZA 1ZOEA 3ORIA 3R00A 3II5A 1JKSA 4QMXA 3E63A 4JIAA 3GOKA 4JBQA 5I5ZA 4RIYA 3G6HA 3ZUVA 4C36A 4QTBA 3HLLA 4N70A 4EHVA 4MBLA 4F1MA 4RIWB 3ACJA 1XR1A 4HZSA 4LGHA 3TUDA 3QTXA 4ZLOA 4KIOA 4C34A 4R3PA 3TZ9A 3DNDA 3NPCA 5HX6A 4YZBA 5AM6A 5CSPA 4BBFA 2BKKA 4M12A 4GFOA 4XBRA 4E93A 3PXYA 4L67A 4CYJA 4R7BA 1Q97A 2EUFB 4CLIA 4FTJA 3QZIA 4ZS4A 4OUCA 4I20A 5C8MA 3C4XA 2HXQA 3SW7A 4ACMA 4GK3A 4FTLA 2VRXA 4HW7A 4RJ7A 4CFNA 1UA2A 2QI8A 3R28A 4BCHA 4IHPA 4NIFB 3QYWA 4E5BA 3LAUA 3ORMA 4K77A 3R7YA 1FVVA 3FBVA 4M97A 4QMVA 1W84A 1ZYLA 2X9EA 3UO6A 3UDBA 5LCJA 5CSWA 2GQGA 2HZ0A 2P2IA 4WRSA 5AAEA 2VWWA 5IA1A 3TACA 2CNVA 4FZAB 3EN6A 5CU0A 4KBAA 5D41A 1EH4A 2XJ1A 4NFMA 4ORKA 3GENA 3MY5A 3S00A 1ZZLA 3PA5A 4DHFA 3CY3A 3KRXA 3L8XA 4HVSA 3NAYA 3TUCA 4CFUA 2NP8A 3MSSA 3SQQA 3UG2A 4IAIA 4FV4A 1TQPA 1ZZ2A 4E26A 4I41A 3AC3A 5M4FA 4XG2A 5FDXA 4DGOA 4NH1A 3GXLA 3HZTA 2XRUA 4BBMA 5KCVA 3KRJA 4I5PA 1YXSA 1NW1A 4PY1A 1BI7A 4TPTA 1REJA 2C1BA 3L1SA 2JLDA 2PL0A 4TWOA 3Q4UA 2IG7A 3IG7A 2PPQA 2IPXA 3OFMA 4QPAA 4BF2A 3DK7A 4I23A 2BFXA 3HRFA 2O8YA 3ROCA 5CF4A 4GIHA 1DI9A 1ZMVA 3LXNA 3VS0A 2XP2A 4EH2A 1T46A 4ANBA 3D7TB 4ZP5A 3N9XA 4ANOA 2F7XE 3FZRA 4MXYA 4TZRA 4MF0A 2KTYA 3BV3A 2PE1A 4HGTA 4RWJA 5HVYA 4X6QC 5HVJA 4FOBA 4FEXA 5KMJA 3RPSA 4G3DA 5CU6A 1G8SA 1NVRA 4JS8A 3PY1A 3Q4ZA 3KK8A 3RAIA 4MXZA 4E3CA 5AR3A 1IR3A 1Q8ZA 2VO6A 4NEUA 4AW5A 2EXEA 4KABA 4DEBA 4GVJA 3LFFA 4JOAA 4O1OA 4WNKA 4Y73A 1UU3A 3EN4A 4C37A 3FMKA 4U40A 3V5JA 1Q8YA 5TR6A 4A4LA 3IDPA 2YM8A 1OKZA 4Q2AA 3TIYA 5LXMA 3PXFA 5AAGA 4H1JA 1OL1A 2IZUA 2FSLX 2G01A 3D94A 5BYZA 4C3PA 4YURA 3DQXA 1FBNA 4V01A 5KMLA 3OCBA 4L8MA 4ONAA 3P4KA 2OH0E 4XV3A 5F95A 3WE8A 4J97A 3BLRA 1PMNA 4QP8A 3VUGA 2WEVA 2OG8A 1APME 4LRKA 3VJOA 3EJ1A 2UW5A 3RM7A 3OXIA 1H07A 2Q0BA 3N4TA 2OXYA 5J8IA 5IEYA 5KBQA 3FXXA 4RFZA 3JXWA 1NVQA 4DFNA 3R8LA 3ULZA 3RK9A 4MYGA 2R3MA 3PVBA 5EDPA 4OLIA 2EXCX 2BFYA 3PPKA 3IW6A 3AD4A 3R2YA 4BVUA 3A4OX 4TYHA 2CN5A 2R3PA 2R9SA 4MWHA 1YDTE 3C0HA 3QUDA 4BI2A 4KUJA 5H8EA 3M2WA 3IOPA 3C5IA 2YIWA 3WILA 4FG7A 2ZDTA 2ZV2A 5CNNA 3W1FA 4EL9A 4FTCA 5KZ0A 5A9UA 5EOBA 5JFXA 4C59A 5GIPE 5LMAA 1H28A 4RZVA 4EOJA 3CTHA 3PXZA 4IWQA 2YZAA 2C6MA 4B6LA 2PU8A 3V8WA 1H1SA 2C69A 2UV2A 4IX3A 5CI7A 2VX0A 3G90X 5LMKA 1UVRA 4HVDA 3KMUA 4QP4A 3OWJA 4JJRA 4AZTA 4DAWA 4FA2A 1W7HA 3POOA 4EUUA 5HLNA 4CFVA 2Y4IC 3F7WA 2W9ZB 2PZIA 1A06A 3ITZA 4J98A 4WIHA 3NNUA 5ANOA 3CR0A 4CTBA 3PWDA 4N4SA 3NGAA 5DEWA 4PDYA 2W06A 4IW0A 3HMOA 4TYHB 4EJNA 4KKGA 1WZYA 1V1KA 2AYPA 4DTKA 3FE3A 2C6LA 4F6SA 3ZRMA 3MESA 2BHHA 4WNOA 3EQHA 3R73A 3HV3A 3ZFXA 3E3PA 5M09A 2J4ZA 1UU8A 5T6KA 1BKXA 3KB7A 4W8EA 3C1XA 3UIBA 5HIEA 5KNJA 5BQ0A 3U6IA 3DZQA 1H24A 5I3OA 1JLUE 3OVVA 4XP2A 4ERKA 3ID6C 3DJ5A 3LFCA 2ETMA 4GL9A 4U42A 2PVNA 2RF9A 5KMMA 2J0JA 4Y5HA 5HU3A 4UN0C 3NMUF 3QWJA 3VNTA 4AF3A 2O64A 2LAVA 3QXPA 2PVLA 5L2QA 5HE3A 2NO3A 3CXWA 5IMXA 4BGHA 5BMMA 4FV9A 4QO9A 3EFWA 4YC6A 3PJCA 3FMLA 2CLXA 3A2CA 1V0BA 3A7GA 3MFUA 3R7IA 3TV7A 5AA9A 4APCA 3FI2A 4MEDA 3ATTA 3L9PA 2F2UA 4UWCA 4C4IA 2J2IB 4BDBA 3FMEA 2CGVA 3ZLXA 3LFSA 4H3PA 2GFCA 3IDCA 3QTRA 4UB7A 4S32A 1WBPA 4ZMFA 4L3LA 1YHVA 2C6TA 5LMKC 3JUHA 4IDTA 4DEGA 4R3RA 2WB8A 4FIIA 4M84A 4EOSA 4F7JA 4ZOGA 3EOCA 3OCSA 2VX3A 4D2VA 4JBPA 4V05A 2ZV7A 3RWQA 3QD4A 3PG3A 3OROA 3VBQA 4E6QA 5CANA 4EC8A 5CAUA 3ZLYA 2UW9A 3B8QA 5EQEA 3EL8A 4KIKB 5M4IA 2OSCA 2BIYA 5AP7A 4IADA 5AUVA 2YCSA 1PF8A 3BU6A 5A4LA 4O2PA 5JFSA 5M4UA 2GNFA 4IWPA 2XKFA 3UBDA 3C0GA 3HA6A 3P1AA 3SXRA 2ZJWA 3MPMA 3A4PA 5HIBA 4EYJA 3ZTXA 2C5XA 2QODA 4H36A 5AR5A 3NYVA 3QLFA 4Z16A 2F49A 2Z7RA 3EFKA 3Q96A 3TJCA 3NUNA 1A9UA 3QQFA 1QL6A 1H0WA 3LE6A 3NZ0A 3H0YA 3R8MA 3VBXA 4O84A 1FMKA 2J50A 3QLGA 4OR5A 4EOLA 3CGOA 3KN5A 2XNBA 4DH7A 4EC9A 2UZWE 4FZFB 1JWHA 4JI9A 4QYYA 4O82A 4DFYA 1I44A 3TKIA 4RLKA 2EVAA 3RALA 4BC6A 1YKRA 2QOLA 3E92A 2CGWA 3VUHA 4BYJA 3RPRA 2XNOA 4AZWA 4G9RA 5L4QA 1U59A 2WMQA 3EKKA 3HP2A 3MWUA 3P0MA 2G15A 4EH4A 4V0GA 5JGDA 4QMNA 1CKJA 4R5YA 4RQVA 3I7BA 4O0UA 5C4KA 2VTMA 3DBFA 1AQ1A 1H26A 5D12A 3VRYA 1IEPA 1NVSA 1ZWSA 4AX8A 4KKEA 2CLQA 3C9WA 4MH7A 4FL1A 3FMDA 4GSBA 4W4WA 5EW8A 2WELA 2X7OA 3O8TA 4FUXA 1W98A 3UG1A 4HVIA 3HRCA 5HU9A 4BTMA 5IEVA 4O7LA 5AJQA 1YWNA 2E9VA 3F3ZA 3MVJA 4FKWA 4L46A 3WF7A 4RC2A 4U45A 1O6KA 1OB3A 3LCKA 3K2LA 4G5JA 4A07A 4RGJA 2C3IB 5EHLA 2E9NA 2ZYBA 5A4EA 4YUQA 2NNWB 3FXZA 4JLCA 3RAKA 1XH9A 4FKQA 3P7BA 2BRNA 5JSMA 1XH7A 1XBAA 2GU8A 4J99A 2RGPA 3VS5A 4DFZE 5GZAA 5M44A 4X2KA 1SM2A 3QD2B 4YSJA 5L8JA 2P4IA 4ZJIA 2XM9A 4FI1A 2JAMA 5EYMA 3W32A 3OOMA 3UYSA 2YHVA 4ZIMA 3SW4A 2CKEA 2PWLA 4J8MA 3ZC5A 3W55A 2XNGA 4BKZA 3HP5A 4TKSA 2EWAA 5DT0A 3ZC6A 4AGDA 1MRYA 4YTHA 3QC9A 2WOTA 3CJFA 5AWMA 4E6DA 5IQEA 2PMNX 3IO7A 4E5WA 5HE0A 3ZFMA 4FIEA 3ZSGA 3WZDA 4FGBA 5KBRA 3TDVA 5IZFA 1O6YA 3AG9A 4BHNA 3A7IA 4H58A 1Q3DA 4WOVA 3BE2A 4BCFA 1IAHA 3OT3A 4FTQA 4BR3A 1Q41A 2YWVA 3QC4A 3VS1A 2OLCA 4YJSA 3O96A 4QMTA 3QD3A 2CMWA 3UTOA 2VTQA 2WQOA 4FKPA 4EOKA 1UKIA 1PXJA 4NU1A 4OTGA 4OGRA 4EH8A 4MNFA 2YM6A 1OZ1A 2W5AA 5K0XA 1XBBA 2H34A 4JR3A 3EQCA 4CV8A 4ZY5A 3A60A 2UVXA 5IPJA 3NYOA 3UNZA 3JR1A 2G1TA 3I7CA 5CENA 3QRTA 3FY2A 3HMPA 4AA0A 5HORA 2J6MA 3BQRA 4O6LA 2WTWA 1YI6A 2RSVA 4MXOA 3DK6A 3Q32A 3MDYA 4O91A 2FSOX 1CMKE 4IMYA 4JNWA 2UUEA 1X8BA 3I79A 4FC0A 2GCDA 2R3RA 1FVRA 5FTOA 3SRVB 2XKCA 2XIRA 1U5RA 1YDRE 3F3UA 3TCPA 4ZTNA 1J3HA 4BKJA 3LMGA 2W4OA 3PTGA 4DEDA 2OIDA 2XKEA 5C03A 1BMKA 2W1GA 2QCSA 2X39A 3DNEA 3DKGA 5CZHA 5FEQA 4D0WA 4DFLA 5AUZA 3RHXA 3AMBA 3CY2A 3LLAA 5EYDA 1QPEA 3UO5A 4UEUA 5CLPA 3G0FA 4YHTA 5BUJA 4QYFA 3ORZA 3Q5ZA 5I4NA 1YWVA 5E8SA 5ETIA 3VF9A 4ANNA 2B9HA 5DGZA 3NDMA 3TUBA 2PHKA 3CGFA 3PXKA 3GT8A 4HYUA 4YJUA 2YM3A 4RX7A 3H4JA 4LUEA 2PVYA 4II5A 4DG3E 4E8AA 3BHTA 2WTDA 4DEEA 3DJ7A 3SGCA 4RC3A 3VJNA 4DEHA 1AD5A 4PDOA 4C4JA 5DT3A 3P7AA 2UZVA 3W16A 4DLJA 5JT2A 1GZOA 3OP5A 1B6CB 4UMUA 1DAWA 3FZTA 3EL7A 4G3CA 5B2LA 4IH8A 2ACXA 3AT4A 1XH5A 3CQWA 4D5KA 2NRUA 4GVAA 1TQIA 1GIJA 3ATSA 2R0UA 2X1NA 5C4LA 5C9CA 4U97A 3AGLA 4X3FC 4XMOA 4EWHA 2V7AA 3S0OA 2PYWA 2R3IA 3BELA 4PPCA 4JRVA 5D11A 5D7VA 3PDTA 4PUZA 2JIVA 4HNIA 4Q5HA 4WBBB 4HGSA 4KD1A 4MBIA 3SKCA 3KQ7A 4G16A 2B1PA 5HBEA 3F66A 3IECA 4FYNA 4YJTA 3QALE 2ITPA 4FSQA 4GV1A 4I93A 4IM2A 4WSQA 4DFXE 1R0EA 2X7FA 3Q9YA 4FVRA 4F65A 1YI3A 3FHIA 4FODA 1HCKA 4WO5A 4YLKA 5B0XA 5HX8A 1MQ4A 1U54B 2BAQA 2R3FA 3R04A 3R9HA 5M51A 5AP2A 3QZGA 3VC4A 4QMUA 4XLVA 3N51A 3C13A 2HCKA 2ZDUA 3FLSA 3KMMA 2WMAA 5A4TA 3V5PA 2YERA 4PMMA 3RPOA 1Q8UA 4C0TA 1OIRA 2OZAA 4KIQA 2Z7LA 5E7RA 5FTGA 4I0TA 1FINA 2BHEA 3F5XA 5TOZA 4DH3A 4CEGA 2J0MB 5LVLA 4ACDA 3VW8A 5IH6A 1MRVA 5IQDA 4PNIA 4RIWA 3ZLWA 3ALOA 2XEYA 3BBWA 2PUNA 1UV5A 3MFTA 1YRPA 2BDFA 3SHEA 5CF5A 4AOTA 3U51A 4IWOA 3NW5A 4FBXA 3EQFA 3LZBA 1GIIA 4BCMA 2O5KA 3MVHA 4CFXA 3DLSA 5IH5A 3DLZA 2ZV8A 2XH5A 2UW8A 1F3MC 3PJ3A 2C3JA 4NTSA 2C3KA 2GSFA 5J9LA 1VR2A 4ERWA 3OT8A 4DCAA 1SZMA 5CWZA 3MH0A 1JQHA 3V5WA 4L7FA 4MF1A 3LVPA 4EZ7A 4AOJA 3RK5A 3E7OA 5AR4A 5CF8A 2AUHA 4YO6A 4C2VA 4EYMA 3QYZA 3AQVA 2WNTA 1YOLA 3GQIA 4O86A 3CBLA 1H00A 4IZ7A 2BIKB 4F9WA 1Y8YA 1ZOHA 2QO9A 3UMWA 3DAEA 4E4XA 5JQ5A 3UQFA 1VJYA 1Q62A 3L9NA 5E8YA 4EI4A 1Q3WA 3M1SA 4A06A 3RCJA 3NR9A 4DH8A 4K33A 3UOHA 4U80A 3W10A 2CCIA 2ITYA 4I6QA 4NTTA 5EK7A 4KS7A 3OS3A 5T68A 3DKOA 3RCDA 4U43A 4CT2A 5IU2A 3TXOA 2XIXA 2YAAA 4PX6A 4CQGA 3KXHA 3RINA 2WQBA 3HV7A 4FV7A 5IQGA 2WAJA 2UZEA 3G2FA 1WBNA 2GFSA 2OICA 3DPKA 4EHGA 3RGFA 4F08A 4ACHA 3PSBA 5CEOA 2QOOA 3Q2JA 4XP3A 2ERKA 3LFEA 4PP9A 4AN9A 4IBMA 1LP4A 3I5ZA 4LOPA 2X2LA 5L2SA 5GIOE 2ZAZA 3IK3A 4GH2A 3R9NA 1URCA 3VN9A 1XHAA 3FI3A 3FKNA 4XG6A 1OL6A 4ITJA 3WIKA 3Q5IA 3QD0A 4FSUA 2OFVA 3SXFA 4AA4A 4P4CA 4AGUA 3NLBA 4F4PA 5C8KA 5IQBA 4DBXA 4YZNA 4KINA 1KE9A 4QYEA 4GJ2A 3NIZA 3VQHA 3WZUA 1IRKA 4D28A 2FVDA 2W7XA 4QRCA 4M7IA 5HBJA 4YP8A 2BRGA 2IN6A 2UZLA 3RHKA 2BZHB 3VULA 2W1IA 2XCHA 2GHGA 4C4GA 1G8AA 4HNFA 1UWHA 2R3KA 2JITA 3UE4A 1J7UA 3HAVA 3NW6A 2CGUA 2XIYA 3LM5A 4KBKA 4MD8E 5EKOA 3ZOSA 5I9XA 2VNWA 3KXZA 3BYUA 4S34A 3ZDIA 1P5EA 4P5ZA 2XK6A 3OF0A 3HL7A 5CQUA 3BBTB 3ZBFA 3OY1A 4IAKA 5AX3A 4BDCA 4OAUC 3HECA 3THBA 4J1RA 2CNQA 5JZJA 4TN6A 4RQKA 1Q8WA 5DOSA 5CEQA 4M0ZA 3S3IA 3QRKA 2X0GA 2WIHA 4IVBA 2W9FB 4FSNA 4NJDA 2ITUA 5F4NA 3ROYA 4YTFA 4ZTMA 4HJOA 4BN1A 1XWSA 2RFEA 2VTNA 3ZEWA 2UW4A 2VU3A 4AFJA 3MA3A 4BIBA 4FNZA 2UZUE 4EHEA 2YFXA 1YHWA 4IC7A 5IQIA 4JBOA 5H3QA 2VWBA 1PMEA 2OKRA 3NUSA 4MHAA 5HE1A 4ZSAA 2UW0A 2A0CX 2HY81 2RFDA 2VNYA 4GG5A 2XYNA 4L00A 3WZJA 3LJ2A 4RFYA 5BUEA 5LWNA 3ZHPC 2I0HA 4HCUA 3UIMA 1YXXA 4CZUA 3VIDA 2JDSA 2Q83A 3GCQA 4UMQA 5AFVA 4QMMA 1MUOA 2EU9A 3ZO4A 3FYKX 1M52A 2ZB0A 4ITIA 1BX6A 2JBPA 3A62A 4U41A 5E8TA 5JMSA 4S31A 2IW6A 1OPKA 4WUAA 4O22A 2PMIA 5JKGA 4K6ZA 5BVNA 4G34A 2WKMA 4LL0A 4AOIA 1WBVA 4BICA 3EQPA 4X0MA 4I6HA 3OW4A 4RVTA 5AV2A 1XH8A 4M13A 1OKVA 2IZRA 4K0YA 3NX8A 4DF3A 1GZ8A 3FLYA 2QOCA 5JRSA 2EB3A 3EQRA 4E4NA 4E6CA 3TNPC 2C5VA 4U3ZA 5DFPA 3WF5A 4NSTA 3O17A 2QOIA 2QC6A 5BVEA 4Z7GA 3NCGA 4FL2A 5ETFA 3QU0A 4TYIA 1SYKA 3B2WA 4N6YA 3Q2MA 2AC3A 3QHRA 2VO3A 2XA4A 3VF8A 4NM7A 4QYGA 4I5CA 3C4EA 3LXLA 5CXHA 3D15A 3RPYA 4I92A 4HPUE 3O2MA 4NFNA 2B7AA 5CNOA 2QG5A 4RRVA 4BWPA 3HRBA 5J1WA 4R6VA 4M69B 3PPJA 3UVQA 4FIFA 1H1QA 4QPSA 4D2PA 4KNBA 1L8TA 3FLZA 3I6WA 2OZOA 3MIYA 2CCHA 4XG8A 4XG3A 2J7TA 3IPHA 3GQLA 4ZZNA 4J53A 4D2RA 3V8SA 5D7AA 5J5SA 4GYIA 2GS7A 2C5NA 2HELA 2ITQA 4RWIA 2RG6A 5JEBA 4D4YA 2GNHA 4BCGA 4FTTA 2YITA 5D1JA 2Y8OA 4Z55A 5CU4A 3PSDA 4HGEA 2QD9A 5I9VA 3ANQA 2BALA 3OWKA 4USDA 2XS0A 4IAAA 4BIDA 4K18A 1XKKA 5DR2A 2ZVAA 3CPCA 4O7RA 3V6RA 3NNWA 2FSMX 2VUWA 4X2JA 3RAHA 4DC2A 4OT6A 1Y57A 4O0RA 2CKQA 4CMOA 5BYYA 2WFYA 5JZNA 2JKQA 3OOGA 2E2BA 2C6OA 2PZRA 4M69A 3UZRA 4AN2A 3PE2A 2B0QA 2WXVA 3KRLA 2RL5A 4BB4A 3LMIA 4DT9A 5TF9A 2YZLA 3NUXA 5BPYA 3TJDA 4IB1A 3D4QA 4XYFA 3O7LD 1SVGA 4QP6A 4J7BA 3R2BA 4BI0A 4GT4A 4PTEA 2NPQA 3TNWA 4CVAA 3LCOA 3VBWA 5JFVA 2HOGA 4BY9E 4PQNA 1F5QA 1NXKA 3F61A 3GNIB 4RX8A 4RA5A 2UZNA 4NM0A 3F5GA 3COMA 4I6FA 4DLIA 4I5MA 4CG8A 4KWPA 4U9AA 2PSQA 3DAKA 3PJ8A 4FKLA 4IC8A 3RPVA 5EI6A 3DAJA 2JKOA 3TZ7A 4TYEA 3GU7A 1CSNA 3QTUA 1R3CA 5ANKA 4ZZOA 3TN8A 5DT4A 1RQQA 4G5PA 3EIDA 3U55A 3ORNA 3QHWA 4FT3A 3OTUA 3DQWA 5ANGA 2Y4PA 4FOCA 3BE9A 4BTFA 2VWVA 3AT3A 4YBJA 1XH6A 2XK8A 4D9TA 3W2PA 3CKXA 3SOAA 4IFCA 4BDGA 1NY3A 3GC8A 5AADA 4I3ZA 3PLAE 2W1CA 2HK5A 4G6NA 4DBNA 2VTOA 4FSYA 5GJDA 4O2ZA 1OIYA 1JVPP 3CP9A 4FL3A 4L68A 3ZSIA 5IUHA 5GZ8A 1KUTA 5IQHA 3UGCA 3FJQE 1JKKA 3FZPA 5HESA 3V8TA 4QT1A 4USFA 4IJ9A 4XG4A 4HGLA 5CU3A 2QOHA 3Q6WA 1XJDA 3IDBA 4DN5A 3LCSA 4GU6A 3R83A 1JSVA 3D83A 3OCTA 2OFUA 5HTIA 1JSTA 2Z7QA 3BEAA 3DXQA 4D2TA 4PMPA 4PL5A 1BYGA 2O63A 4YMJA 2Y4IB 1P14A 3GCPA 3OMVA 3VS7A 5GNKA 5J7HA 3ANRA 4FVQA 2DS1A 2BDJA 3TI1A 3PUPA 3E5AA 3QRJA 2HXLA 5A54A 3I60A 4AW0A 4D9UA 3DY7A 3ZCLA 4NK9A 3UP7A 5EHOA 2BDWA 5LVOA 3A61A 4G3FA 4O1PA 5DR6A 3FQEA 4BL1A 5K4IA 2PY3A 2PMLX 4FT7A 4GFGA 5IA0A 3E3BX 4EBVA 4C62A 3TKUA 4OTDA 4RPVA 3KKVA 2IO6A 4FKJA 2Z60A 4IVAA 4CSVA 3FMMA 4MQ1A 3BX5A 4JXFA 4GKIA 1Y91A 2BRHA 2V7OA 3DK3A 4LV8A 5AEPA 4BKYA 3EQGA 1KE5A 5EW9A 2BUJA 4UMTA 4F1OA 4R3CA 3ACKA 2HIWA 3FUPA 4FTUA 4X3FA 5HHWA 4DITA 3P5KA 5AUXA 3R71A 1V0PA 3QQJA 5FEDA 3COHA 1KSWA 2Z8CA 1GZKA 1PKDA 3A99A 4ZY6A 1UNHA 4YPSA 4BCIA 4G31A 5HE2A 4Q9ZA 3HUCA 4C3FA 3PP0A 3MPTA 1UU9A 1ZYDA 3P86A 4GIIA 2XB7A 4NM5A 3R9OA 4PDPA 5DEYA 5HNGA 3TV6A 4YTCA 4ZLZA 4QMSA 3DDPA 4A9SA 2VTPA 3GCVA 2O65A 4ARKA 3L8PA 4IZAA 2PE0A 5G1XA 2QLUA 3UOKA 5M4CA 1WVXA 4PWNA 4F0GA 4IX4A 3FPMA 3MH3A 3GU5A 4WNPA 1KE8A 2YIXA 5KMNA 2YIQA 3JYAA 4ZTQA 4ASZA 1Q4LA 4Q5EA 3C4ZA 3AC2A 4GJ3A 4R7HA 4BDKA 4TL0A 3BV2A 5HCXA 1ZAOA 4RWKA 2C0TA 3HGKA 2YM5A 3FI4A 5HD4A 3RVGA 3VUIA 2OXDA 1KWPA 4FKTA 4IVDA 2H96A 4NWMA 4IM0A 4E20A 2W1EA 3COKA 2ZB1A 4LGGA 4CG9A 4O7NA 4S33A 5ITAA 4D58A 2QR7A 4EEVA 1OECA 4KB8A 4GT3A 5CVFA 2LGCA 4EOIA 5HTBA 3MY1A 3QQUA 4YGAA 3PA4A 2XJ0A 4AE6A 5EYCA 3EWHA 3GU8A 2XMYA 4H1MA 3QZHA 4D4RA 1Q61A 3QGYA 5LOHA 3BWFA 1IA9A 3QTZA 4G6LA 3GCSA 2UVYA 4GFMA 4KKHA 3NNXA 4UYNA 2XNEA 4IDVA 4XP0A 5CQWA 5CALA 5M06A 5HTCA 5E8VA 3TZ8A 1GY3A 4N6ZA 4EH6A 5BMSA 4X6RA 1W82A 3D0EA 5CYIA 2AC5A 3MA6A 5L2IA 2WU7A 3FL4A 1PXKA 3PWYA
chains in the Genus database with same CATH superfamily
4LG4A 3KMWA 4FEVA 2J9MA 3DZOA 2OU7A 3QA0A 5JN2A 3R1SA 3V5QA 5EQPA 5AUYA 3RM6A 3QA8A 4FZ7A 3BGPA 3AC1A 3FKOA 4PL4A 4W9XA 4IX5A 4J8NA 3DXPA 2OK1A 1PMUA 4E4MA 2JDRA 5IMEA 4F9CA 4OTRA 4QMOA 1PKGA 1W0XC 3PIXA 5LQFA 3BLHA 4L52A 2BAJA 4AXDA 5JK3A 2WOUA 2H9VA 5CEPA 2OF4A 3BLQA 3FXWA 4G3EA 5FM2A 4BYIA 3R9RA 2R5TA 5M55A 1J1CA 3AXWA 4ACGA 4MXXA 3FMJA 5BVDA 2I7QA 2XF0A 3MFSA 3ZH8A 4EK4A 3R1YA 3V5LA 5GZ9A 4EZ5A 1OL5A 5J1VA 2CKPA 5ANIA 2Z02A 3QQKA 2XK7A 3Q9XA 4RJ4A 3BGQA 1M7NA 4XV9A 2VTLA 4RJ8A 3U4WA 3E8NA 4I4EA 5CZIA 4QOXA 4K8AA 4ZXTA 3WE4A 5CAQA 3SVVA 5IA2A 5IQAA 2RKUA 1REKA 4BCPA 2QU6A 4DGGA 4YZMA 1OUKA 2XJ2A 2P0CA 2I0VA 4ZS0A 3BL7A 4FT5A 3FC1X 3MH1A 4CKIA 1JPAA 3GI3A 4FMQA 5CS6A 3W8QA 4R8QA 3WZEA 1H08A 3OWLA 2WMXA 5LJJA 3CPBA 2OJJA 1WMKA 3O8UA 3DOGA 1OKYA 3C7QA 4F7SA 4ASDA 3KVWA 4DFUA 3KU2A 4FTKA 1OI9A 2XK4A 5ETCA 3G6GA 4ZTHA 3TL8A 4QYHA 5HIDA 5L2TA 1UU7A 4DFBA 2WPAA 3SG8A 5IUIA 3TM0A 3KF4A 3W0OA 1JSUA 3F9NA 3BHUA 2ITXA 3D7ZA 3BZ3A 4CMTA 5CEMA 3ZO2A 5E92A 4RZWA 3W18A 4JG7A 4LV7A 3QTIA 2ETKA 1FQ1B 2QU5A 4BDIA 3R7EA 4GK4A 3F2AA 4FV8A 1ZXEA 1FGKA 1H27A 3DBEA 4DH1A 2XANA 5E90A 4FICA 3M11A 3K5UA 1PW2A 4MD7E 1R78A 3AC8A 2R7BA 3F6XA 2BZJA 3QCSA 1YHSA 5GJGA 2QO7A 4FKIA 3LM0A 4JRNA 1DS5A 2A27A 5CSXA 1FVTA 3DCVA 5FGKA 5I9WA 3DJ6A 4EK3A 4MVFA 3TV4A 4CQEA 2ITTA 3DB8A 4JIKA 3JY0A 3LCDA 5DIAA 3V01A 5FLFA 2YA9A 2PUIA 4AN3A 4C57A 3GGFA 3CD3A 4FTOA 2JDTA 4GG7A 4M15A 3F3WA 3QRIA 3W33A 3H0ZA 4BIEA 4UX9A 4A4OA 3D2IA 4M67A 1R0PA 1S9IA 3MYGA 2X6EA 3RNIA 4MWIA 2R64A 3R8ZA 3UPXA 3ZFYA 2GNIA 3IS5A 2WZJA 4O7TA 4Y83A 3JPVA 1FGIA 2JAVA 2P33A 1RW8A 3UQCA 3RZBA 4M14A 3UNJA 2XUUA 2F7EE 3UZPA 4UMPA 2OGVA 4FSRA 3SV0A 1NA7A 2ITOA 3E8CA 3NVKI 1YXTA 3CTJA 4E7WA 4MAOA 2QR8A 4FTNA 4GKHA 5BNJA 5CT7A 5B2KA 3HV5A 2XRWA 3FLWA 1GZNA 2X7GA 4UWYA 2QKRA 4P7EA 3D5WA 2OF2A 2IW9A 3LMHA 4CTCA 4OAVB 4WSYA 3RBWA 1H1PA 3PE1A 3DT1A 3E87A 5AMNA 2VGOA 3KCFA 4FZ6A 3WBLA 4EQCA 1PMVA 1KOAA 3KULB 2R0IA 2XK9A 4NM3A 5BVKA 5KHXA 1M17A 3OC1A 2YCQA 2F9GA 1B39A 1IG1A 2WQMA 3OY3A 5EM8A 5AV1A 3ZO3A 4UXLA 2I0YA 4B4LA 3IOKA 1H01A 3HYHA 5DR9A 5E1EA 2CGXA 2P3GX 1PHKA 3FQSA 3ODYX 1LR4A 4GK2A 4IB5A 4KRCA 4MXAA 3FWQA 5HG5A 3BCEA 2YLEA 2A19B 1BL7A 5J87A 4TNDA 4L3JA 5K5NA 4K1BA 5AP5A 5FRIA 4EQMA 3HX4A 2WIPA 5J79A 1PXIA 2B9IA 3KXXA 3PVWA 4F9AA 3PP1A 2FH9A 4IJPA 5J95A 5JRQA 4LMNA 2R2PA 3QXOA 4H05A 3IGOA 2PVHA 5CASA 3GP0A 1OM1A 5I3RA 4DH5A 4DGLC 5FP5A 4BTKA 2C0OA 1M2PA 4WHZA 4J95A 3H3CA 5HG7A 2A1AB 4O4CA 4F0FA 5FXSA 4RVLA 3GC0A 4UALA 3EQIA 1HOWA 4M3QA 2I1MA 3PZHA 3DS6A 5EM7A 3TZMA 4JAIA 2ZMDA 5A3XA 3B2TA 3HV6A 3ML1A 3HKOA 5BX0A 2OH4A 2C0IA 4FT9A 4KSQA 4MNEB 5AV0A 1DI8A 3POZA 2DYLA 5ACBC 4U81A 3F3TA 5HBHA 4U5JA 4HYSA 1WBTA 2GNLA 1YWRA 2VAGA 4O0WA 4X21A 4BCJA 3OZ6A 4Y46A 3LHJA 3NYNA 4LYNA 1K3AA 5GJFA 4F0IA 4EH5A 5JGBA 3AD6A 1XH4A 2V55A 2W99B 3DBQA 4TWCA 1JKLA 5TO8A 4XG7A 4Z9LA 5BVWA 3ZYAA 3G9NA 4AZSA 5EI8A 2VWYA 5KMKA 1OMWA 5K0KA 4LFIA 1WBSA 2C5OA 3FAAA 5KUPA 1WFCA 5HNIX 2FO0A 4AQCA 3MPAA 3OCGA 5A4CA 2WGJA 3T9IA 3VUTA 5AA8A 5AR8A 3RI1A 3V51A 3WYYA 5L6OA 3HDMA 4LV5A 4XX9A 1KV2A 5HD7A 4NCTA 2PMOX 5DMZA 2W4KA 3OXTA 3I81A 4QD6A 3TIZA 4LQMA 5CX9A 3R8UA 4KSPA 5HO6A 3TTJA 3VWAA 3ZONA 4O7VA 4QNAA 4EKLA 4X2GA 4RVKA 3TNQB 3R8VA 5HLPA 4BI1A 3W0SA 1JNKA 4FG8A 1WAKA 1Y6AA 2HWPA 3G5DA 3GB2A 4JBVA 4NT4A 1QPCA 3VVHA 4ANQA 1LUFA 3G33A 4PRJA 4OT5A 3RNYA 5AIRA 3VBVA 2Y0AA 2I40A 4I4FA 2I0EA 2REIA 2B55A 3SAYA 4FV1A 2DUVA 4QP2A 3G15A 3UQGA 4A9TA 2BCJA 3JVSA 3NW7A 5HG9A 3RKBA 2R3JA 4MTAA 4FV3A 3R0TA 4RVMA 4D55A 3CS9A 3P9JA 3UIUA 4HYHA 4E5AX 4ZLYA 5A6OA 1UKHA 5LMBA 4R77A 2UVZA 4PL3A 5JQ8A 5BVOA 4QEBA 3VO3A 5FDPA 2C30A 2HZIA 5AR7A 3FSKA 2A2AA 3HUBA 4FTIA 1XMLA 5CXZA 3LFQA 3M42A 2OXXA 3GBZA 5HI2A 3R7UA 2HAKA 1M7QA 4BHZA 3OXZA 3IGGA 4R1VA 5E8XA 5H9BA 4F9YA 2BR1A 3MVMA 3ZZEA 4OTFA 5L3AA 3EN5A 3F82A 5DPVA 4AW1A 3PIYA 4YJNA 5KO1A 3O8PA 4I5HA 4QMYA 2W1HA 3LW0A 1M2RA 3FZOA 1TKIA 2H8HA 2W0JA 5F1ZA 4DGMA 4NKSA 4A9RA 5IDNA 3WF9A 2YISA 2WMVA 1PXPA 3NUAA 1PXMA 4QMLA 1U4DA 2VTHA 4FV5A 4U79A 3WOWA 3PXQA 3LOKA 4FJVA 4IACA 3BKBA 4DTBA 1PXLA 3F2RA 5T3QA 1ZY5A 2B54A 4YJVA 4FT0A 4IZYA 4BDDA 2VZ6A 2O3PA 4B0GA 3WARA 4JG6A 3QKMA 1M2QA 5LCKA 4HVGA 3Q3BA 4GYGA 4JQ7A 3IQ7A 3KEXA 1P4FA 4ZAUA 5HG8A 5D10A 4XV1A 2J5FA 2XBJA 5L8KA 5G6VA 3VHEA 4JR7A 3G0EA 2JIUA 3RZFA 5IDPA 1ZYCA 3ERKA 1O6LA 4JDHA 3UDZA 3PVGA 2R3QA 1OPJA 2IVSA 5E9EA 4FVPA 5C01A 3LKMA 2X6DA 4X2NA 1A48A 1OITA 5CI6A 4EOQA 4ACCA 3TDWA 3KRRA 5K3YA 5KHWA 5AAFA 4JX3A 3HDNA 3NEWA 1GIHA 4GEOA 2VWZA 3RTPA 3VAPA 3W0PA 3QAME 4L7SA 5CT0A 3AMYA 2SRCA 4YNOA 4E6AA 4BZOA 2GS6A 1QPJA 2ZFYA 1CKPA 1STCE 1W8CA 4TYJA 3DTWA 5FQDC 3SA0A 3QKKA 2R3OA 2A4LA 4FKGA 1GAGA 5DE2A 4IAZA 3P23A 5EFQA 4EK5A 3VBYA 4MUQA 3KXNA 3CLYA 4FK3A 4YU2A 5LVMA 3ALNA 4RWLA 3DBDA 2VTTA 1SVEA 4ITHA 2PVRA 4XEYA 3PJ1A 4YZDA 4FTRA 4O6EA 3UOLA 4D1SA 4TT7A 2F7ZE 3UZTA 2JDVA 2WTCA 3QQLA 4ENYA 1JKTA 4KBCA 3FLQA 4FR4A 3PRIA 3OBJA 3JY9A 1PY5A 2AQXA 2GMXA 3ODZX 4C02A 5IH4A 4F70A 3EZRA 4JVGA 3RJCA 3TTIA 5LWMA 4WG5A 2ZOQA 3EFLA 2FUMA 2R3LA 2VGPA 3FMNA 3HEGA 5AP6A 3I5NA 4MCVA 5FBNC 4YTIA 4I21A 2QOFA 2GNGA 2YIYA 1VZOA 4KS8A 5FG8A 3VUDA 2E9OA 4FG9A 4AG8A 3L8SA 2UW3A 4JG8A 2G2FA 3CQEA 5I9UA 2OW3A 1QCFA 2VTSA 2QHNA 5FM3A 2HENA 4FSZA 5DA3A 4OTWA 5DLSA 5HVKA 4DINA 5EOLA 4FNYA 3R01A 3OEFX 3K5VA 2UW6A 3ET7A 1P4OA 4K11A 3UNKA 4I0RA 4BWXA 2OZAB 1TVOA 5LARA 2GS2A 1UNGA 4FNWA 4BCOA 5AUUA 5IEXA 2B9JA 2OO8X 3NWWA 3ZMMA 4EH3A 3PVUA 4IQ6A 4W4XA 4FKVA 3KVXA 2WTIA 5AX9A 2WTKB 2X9FA 2YDIA 5FBOA 1ST0A 2W5BA 4X3JA 3VQUA 3EFJA 2QO2A 3E62A 2Y7JA 3R7VA 2WMSA 3GC7A 2C68A 5DBXA 4RIXA 4EH7A 3KREA 4BWKA 4OW8A 5AV4A 2PZ5A 2JEDA 1J1BA 3R63A 4QMPA 4UZDA 5HGIA 1TZDA 4CXAA 4NUSA 4YNEA 3WI6A 4S2ZA 4CZTA 4EK6A 5LVPA 2J0KA 2JFMA 4RSSA 4O7WA 4U3YA 3NFGB 3EN7A 2UW7A 1MRUA 5F9EA 1H25A 4EOOA 2JDOA 3LXKA 3MB6A 3WF6A 4TW9A 2B9FA 1FMOE 2GNJA 2EB2A 4XLIA 1B38A 3ZUUA 5CF6A 5H8BA 1Z9XA 3F2NA 4TRLA 4ZTLA 2VTAA 2BMCA 4EJ7A 3LFDA 2YWPA 2R4BA 3MV5A 3QCYA 3VUMA 3PUFC 5A46A 2WHBA 2J90A 4JDIA 4F6UA 2F57A 4FEWA 2JGZA 4C8BA 4PV0A 4QQCA 4RT7A 3C50A 4NW6A 4BZNA 4PP7A 1WBOA 4BRXA 1FOTA 5EQYA 4XHKB 1ZYSA 4BZDA 2JKKA 4TWNA 2OI4X 3OHTA 1ZY4A 5L6WL 4EONA 4YJQA 5EG3A 1OBDA 1MP8A 5HOAA 3OBGA 3BEGA 4F63A 3CE3A 3ZM4A 3SDJA 4I94A 3QL8A 2ERZE 4PTGA 4QQ5A 3CIKA 2R3GA 4C3RA 2OJIA 2HW6A 3UC4A 2NYAA 4O7ZA 2IZSA 2C6DA 2E9PA 2YM7A 4DTAA 4GU9A 4P5QA 3V6SA 4CRLA 5KMOA 5DWRA 4GUEA 4ZMEA 2PTKA 3C5UA 3F7ZA 4IE9A 5DN3A 1Q5KA 5IF1A 2XNPA 4U44A 3CEKA 2OJFE 3A7FA 2W1ZA 4R5SA 3UC3A 3JS2A 3MBLA 3EMGA 3NRMA 3AGMA 3OEZA 4J96A 4UWBA 5EM6A 5KE0A 5C27A 1F0QA 3QTWA 4Y5QA 3MJ2A 1E9HA 3DKFA 4ZSEA 3TKHA 3AC4A 4YZ9A 2QONA 2VO0A 4FYOA 1U5QA 1ZYJA 3U9CA 4XUFA 4AWIA 4D0XA 3F5UA 3PPZA 3U4UA 2ITWA 5J9ZA 4GCJA 2OJ9A 3BHVA 4G9CA 4AGWA 2XIKA 2IJMA 2FGIA 4IB3A 4LOQA 3FY0A 4LM5A 3UOJA 1R1WA 1G3NA 3I6UA 4E4LA 1WVYA 3TEIA 3DDQA 4IX6A 5HKMA 3DB6A 4F09A 4N0SA 5AR2A 3PA3A 4CFWA 1IAJA 2QOKA 4A7CA 4DG2E 3MFRA 3ORKA 4RFMA 5TT7A 3C0IA 4XV2A 4ID7A 5C8NA 3C4WA 4EKKA 2GQSA 1UWJA 2JFLA 4MBJA 3S4QA 3R30A 4CV9A 1FPUA 1OKWA 4W9WA 4BCNA 4FIJA 4GUBA 5IUGA 2X8IA 2X0PA 3Q60A 2WO6A 3D5VA 5K5XA 3HAMA 5F94A 3ZXZA 1NT2A 4H3BA 4OBQA 3AOXA 4ALUA 1MQBA 3IONA 1P2AA 2QVSE 3U87A 3CKWA 2QOBA 2FA2A 4GRBA 5DG5A 2VWXA 3IW7A 3LXPA 4O0TA 3CSVA 4MNEA 1Q99A 4F7LA 3W2SA 3KL8A 1H8FA 1DM2A 3BYSA 3ZU7A 2ZMCA 2R3HA 3B8RA 5CAVA 4O27B 1Z5MA 3BHYA 3KC3A 2WTVA 2QLQA 4D1ZA 3C51A 4UMRA 1URWA 3L8VA 4WD5A 2BTSA 4C2WA 2DWBA 3DFAA 4JQEA 2UZOA 5E8UA 3SLSA 1ZLTA 4BDFA 4XNEA 4YLLA 4ANLA 4BDHA 1VYWA 3FPQA 3UYTA 3NUUA 3R1NA 4EQUA 4F7NA 3N4UA 4ZJVA 4JAJA 4ZSGA 3PFQA 2VTJA 3ORPA 4X3FB 2QURA 4BTJA 5I9YA 4L53A 5ANDA 4O0SA 4BDEA 3ZZWA 4B8LA 4FKOA 2WD1A 3LFNA 4IB0A 3UO4A 3NIEA 4EOMA 4QQJA 2W4JA 4IEBA 1K9AA 3SOCA 3PY3A 1SMHA 4TTHB 2WMBA 2WTKC 4R78A 4ALVA 4OTHA 2BAKA 1SNXA 2WEIA 3LQ8A 2VV9A 4Y8DA 4KRDA 2IVVA 5FP6A 4ENXA 5AV3A 4ASXA 3FDNA 4AGCA 5EI2A 4USEA 3OTVA 4OTPA 1OL2A 4AZEA 2XZSA 4O7YA 3SD0A 4ANMA 3PG1A 1W83A 4Y85A 3W2QA 1OPLA 2HZ4A 1KV1A 5K9IA 4V04A 3TG1A 4TY1A 3COIA 3KN6A 4I0SA 2RIOA 1KE7A 4YR8A 3FEGA 2C47A 4R7IA 4E1ZA 5M57A 4XS2A 2QHMA 3Q04A 3MW1A 5FXQA 3VS2A 2X2KA 1DAYA 1OUYA 3E64A 3O71A 4G3GA 2QG7A 1CKIA 3VS6A 3S1HA 2HY0A 2UZDA 4G1WA 4NCTC 2GPHA 3MN3A 3R6XA 4RJ5A 1YOJA 2ITVA 2XNMA 4UY9A 3N4VA 4Y72A 1YW2A 2HWOA 2V0DA 3LFBA 4L45A 4C38A 3BLAA 4GS6A 4MXCA 3VUKA 2JBOA 5A14A 3F88A 3KRWA 3F69A 3V04A 1HCLA 3OD6X 3UMXA 4ANSA 4YPDA 4AT5A 3VRZA 2OJGA 2F2CB 4O4BB 4DG0E 4BDJA 3CCNA 4FV0A 3QF9A 5A4QA 3GU4A 4MK0A 1PYEA 4RJ6A 2W17A 1KE6A 2W1FA 3BRBA 1XO2B 5KMIA 5E4HA 3UJGA 1Y6BA 4LUDA 5ACKA 4Y95A 1O9UA 2YLFA 2O0UA 3K54A 3HV4A 4IWDA 2GHLA 1IA8A 1JOWB 3TWJA 2GHMA 3A8XA 3BGZA 3KFAA 1M14A 1PYXA 2XKDA 4FSMA 2J51A 2GQRA 3C4FA 2OIBA 3R02A 2VTRA 3BYOA 4QNYA 5EDRA 3ZEPA 4AXAA 4HVHA 4O83A 2PZPA 5L2WA 2VD5A 2O2UA 3GEQA 5FUTA 2B53A 3IW4A 2X2MA 3S2PA 2YACA 2W05A 4PTCA 1CDKA 3MGYA 2J0LA 4LL5A 2XVDA 4QP9A 4FIHA 5DHJA 5EH0A 4C58A 5FXRA 2CSNA 3KCKA 3FI8A 3ZXTA 4JDJA 2VWIA 5J5TA 2VN9A 5AIKA 3TNIA 3A7JA 2BILB 4C7TA 4EOPA 3FKLA 3NNVA 4NJ3A 4I22A 5L6PA 4CKJA 3VS4A 4IAYA 2X4ZA 2XNNA 3FQHA 2ONLC 3C4CA 1YQJA 4O7SA 4NZWB 3EB0A 4FKRA 4Z7HA 2ONLA 3GCUA 3ZLSA 1ATPE 5D9HA 3Q9ZA 3ZRLA 2XCKA 1YDSE 4FX3A 4CKRA 5JH6A 4FRFA 5ANEA 3L9MA 4QP3A 5F20A 5KZIA 1KOBA 3P08A 4TXCA 1WBWA 2PZYA 3D9VA 4RA4A 4FV2A 4CD0A 3PXRA 3FLNC 5E91A 5CAOA 5IG1A 3U6HA 3HA8A 3HMNA 4WA9A 4O81A 3O0GA 2BZKB 4PF4A 4D4SA 5IA5A 3BQCA 3GVUA 3LCTA 4DEIA 4OTQA 4DHIB 2R7IA 1TQMA 2HZNA 3EH9A 4P90A 1CTPE 4HCVA 4FIGA 5CSHA 3Q6UA 5TE0A 5CEKA 4WBOA 4FK6A 2BRBA 2YN8A 3AMAA 3DV3A 3U8WA 3W8LA 4PNKA 5IA4A 3R7OA 4GT5A 3ORXA 4CCBA 3PY0A 1QPDA 1Y8GA 3H9FA 3ORLA 3EQDA 2C4GA 3QX4A 4ALWA 4UXQA 3ENMA 5JFWA 4AUAA 3BYVA 3ZS5A 1ZMUA 4BGGA 4J52A 4G6OA 4RX9A 4AE9A 5DRDA 4YC8A 3LPBA 1ND4A 3D7TA 2FYSA 5I0BA 4IANA 3P78A 3RAWA 2VWUA 3MTLA 1GNGA 5J9YA 4F64A 1JAMA 2PVKA 3DTCA 1E1XA 4KA3A 4LMUA 2C6IA 3UPZA 3QKLA 4CFFA 1IASA 4HPTE 4BCKA 3W2OA 4DGNA 4ZSLA 3LLTA 4B7TA 1J91A 4LGDA 4XRLA 2WTJA 1ERKA 2C6KA 4YJOA 4WUNA 2JD5A 2C6EA 3PLSA 2BRMA 4L6QA 2QQ7A 3ZBXA 3ZO1A 4C4HA 4CNHA 1RE8A 3DU8A 2XIZA 5B2MA 3HMIA 4QMZA 1YI4A 3VBTA 4UV0A 2WQNA 3LIJA 3R22A 4QP7A 4DEAA 2FSTX 5M56A 4DE4A 3E93A 3NS9A 3UODA 4F99A 2UZTA 4OBOA 3F5PA 3R8PA 2ZM1A 4D5HA 3G51A 3KK9A 4AT4A 4DYMA 5I9ZA 1LEZA 4R1YA 4K9YA 4QTAA 1YXVA 3ETAA 3GUBA 5HCZA 3HVCA 4M66A 4NYEA 5DI1A 1YXUA 2ESMA 5HLWA 2ITZA 3EZVA 4RG0A 3I0QA 3QQHA 3DBCA 2PULA 1XMMA 3AT2A 5BVFA 4IIRA 4YHFA 3A7HA 3QCQA 4RIXB 5CY3A 2XEZA 3FV8A 4LI5A 4CT1A 3ULIA 2Z2WA 4RBLA 3WYXA 1QMZA 4UYAA 5HCYA 3PYYA 3LQ5A 1V0OA 1RDQE 4CCUA 3QGWA 4U6RA 5KKRC 5HEZA 3ZUTA 5GINE 4P2KA 1Q24A 2V5QA 2Y6MA 3E8EA 4FKSA 2P55A 3W2RA 3PIZA 4I24A 4QTEA 2X4FA 3KULA 4BDAA 5EHYA 3KXGA 4ZTRA 3HNGA 4XBUA 4AACA 4QDEA 2OIQA 3BU5A 1LEWA 4QPMA 2B52A 5AUWA 4XRJA 4U7ZA 4H3QA 1Q8TA 2YEXA 3RP9A 4KIKA 3FMHA 1H1WA 4MD9E 4OBPA 3D5XA 4I1ZA 3EYHA 4UBAA 5M08A 3LQ3A 2JC6A 4FF8A 5HICA 4TWPA 1GOLA 4FTAA 3D14A 4KAOA 3QWKA 4PDSA 4IFGA 1OVEA 2EXMA 2ITNA 4FV6A 3RK7A 3EKNA 5M53A 1LPUA 4HCTA 4W4VA 3E88A 3DGKA 2OWBA 4KIPA 2X81A 3DA6A 2VTIA 3DKCA 4Z3VA 4TNBA 5CEIA 4DT8A 3RMFA 1XQZA 4Q9SA 4RJ3A 3I1AA 5DRBA 3V3VA 2GDOA 3BYMA 4BGQA 4BCQA 4AZVA 2KULA 3V5TA 2PE2A 4B9DA 4NW5A 1J7IA 3IW8A 4RMZA 2I6LA 5CTPA 5EDQA 3CJGA 4XG9A 4LRMA 4G17A 1ZMWA 2CN8A 5ICPA 1OIQA 3DFCB 4EUTA 4F6WA 1ZARA 2XYUA 4IZ5A 1Z57A 5ETAA 4FUYA 5HNBA 5HZNA 3AKJA 4GW8A 4PMSA 4YC3A 4CMUA 2F4JA 4JT3A 2PUPA 4TYGA 2OBJA 4O0VA 4V0GB 2RFSA 4W8DA 4O38A 3W2CA 5FTQA 1BI8A 5CU2A 3U9NA 3NAXA 3O23A 3KA0A 4A4XA 4AA5A 3Q4CA 4HZRA 4QTDA 4AAAA 4EK8A 5AM7A 4FNXA 5M07A 2CKOA 3LFAA 5CAPA 2V22A 5KKRB 4DA5A 3JVRA 2G2HA 3Q4TA 2XAOA 1SNUA 4APPA 2RG5A 4FEUA 4CGAA 3NVMB 4C61A 3QRUA 3BPRA 4X2FA 4ASEA 3T9TA 3ZSHA 1VEBA 2Y9QA 3ZDUA 4YBKA 5EM5A 2IZTA 5L8LA 3I0OA 3MB7A 4CFMA 3LJ1A 4HOKA 2YCRA 4M0YA 3QTQA 2IVTA 4J71A 3OUNB 4U8ZA 4PMTA 3A8WA 1PRYA 4OTIA 2QKWB 3Q9WA 5AP0A 2PVJA 2HYYA 2PVMA 2CDZA 4QMQA 2YAKA 2IEWA 1GJOA 5DVRA 2X0OA 2QNJA 3KY2A 3AD5A 3H30A 5EW3A 5C26A 2HW7A 3NYXA 2Z7SA 3QZFA 5JGAA 4WKQA 5B7VA 4LRJA 4AQKA 3O51A 3ZRKA 4XOYA 4H39A 4D4VA 3VW6A 3FL5A 2PUUA 4YZCA 3QCXA 4YLJA 5AUTA 3G9LX 4M8TA 3E7VA 3SG9A 2H6DA 4EBWA 3PRFA 4PPAA 4CYIA 3CC6A 2XARA 3ENHA 4FSWA 3NCZA 4B99A 1J7LA 4O0YA 3UVPA 5AP4A 3H10A 3L9LA 4IAFA 4O0XA 2X8EA 2YIRA 4RIOA 4L42A 3EQBA 1PXOA 3IKAA 2C5YA 2CHLA 2BROA 3QX2A 2W5HA 4M68A 4RLLA 4XH6A 2YM4A 1SVHA 4FTMA 4NKAA 1JBPE 3NUYA 5IISA 1G8KA 5C1QB 5AP3A 3LJ0A 4IM3A 4C4EA 2C3LA 4D1XA 3HMMA 1UNLA 4D2SA 4DCEA 2FB8A 4D2WA 1OIUA 4LOOA 4JQ8A 3P7CA 4F1TA 2E9UA 4FKUA 3BIZA 2XK3A 4S30A 5CSVA 4U0IA 4WG4A 4QDVA 4W4YA 2WQEA 4JL9A 4IVCA 3SC1A 5LVNA 1H1RA 3BU3A 2BPMA 2C1AA 3SRVA 3WZKA 3MVLA 2YABA 3MJ1A 1T45A 5TKDA 1AGWA 1G5SA 1BL6A 5DYJA 3I4BA 4ZJJA 3PSCA 3FYJX 3MH2A 3QQGA 2XBAA 4A9YA 4XOZA 2JKMA 3UP2A 3U6JA 2IW8A 2W1DA 4L01A 3BI6A 3FZSA 3GU6A 4GMYA 4ZK5A 3ORTA 4B8MA 1S9JA 3MIAA 5GHVA 1H4LA 3TT0A 5FWKK 5K4JA 2BZIB 3BWJA 5ANJA 2YJSA 2P2HA 2WMUA 2UZBA 3GOPA 4MX9A 1U46A 2YDKA 3QUPA 4ZSJA 4ZTSA 4YHJA 5H2UA 4WNMA 2PK9A 3CQUA 1ZRZA 5IA3A 3BHHA 4CZYB 3ELJA 4K2RA 3IW5A 5HO8A 5EYKA 3UVRA 4C35A 4FE2A 4G2FA 3EHAA 1CM8A 3OUKA 5IQFA 4X7QA 4IXPA 1RJBA 4O96A 3KXMA 2WU6A 5HQ0A 4BFMA 1I09A 1YOMA 4NIFA 3U54A 4MQ2A 3EYGA 3PJ2A 3Q52A 2Y6OA 3R1QA 4ZEGA 3VHKA 5FEEA 2QOQA 3CTQA 4JDKA 4QTCA 1XBCA 4EWQA 2X8DA 4L9IA 5AP1A 4CLJA 4N57A 2IVUA 3R9DA 2B4SB 4EHZA 3AKLA 4FZDB 3QUEA 3E8DA 3D2KA 3QTSA 2YCFA 5CVGA 2YJRA 3MI9A 4AU8A 3D5UA 3FC2A 2BTRA 1R39A 2GTNA 5EKNA 2ZV9A 2Q0NA 4NL0A 4QQTA 4I6BA 2CNUA 2CPKE 2J5EA 4JMQA 3O50A 1PJKA 4JX7A 3DXNA 5DNRA 5CVHA 4BBEA 5DH3A 3RWPA 4E73A 1OGUA 5H8GA 4WT6A 4EZ3A 3NSZA 2BKZA 3H9OA 2V62A 3K3JA 3K3IA 3R21A 1L3RE 4ZZMA 3H9RA 3VS3A