3I6BA

Crystal structure of yrbi lacking the last 8 residues, in complex with kdo and inorganic phosphate
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
173
structure length
173
Chain Sequence
b'SLATCYGPVSADVMAKAENIRLLILDVDGVLSDGLIYMGNNGEELKAFNVRDGYGIRCALTSDIEVAIITGRKAKLVEDRCATLGITHLYQGQSNKLIAFSDLLEKLAIAPENVAYVGDDLIDWPVMEKVGLSVAVADAHPLLIPRADYVTRIAGGRGAVREVCDLLLLAQGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
publication title The Tail of KdsC: CONFORMATIONAL CHANGES CONTROL THE ACTIVITY OF A HALOACID DEHALOGENASE SUPERFAMILY PHOSPHATASE.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 64
structure length 173
sequence length 173
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.45: 3-deoxy-manno-octulosonate-8-phosphatase.
pdb deposition date 2009-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3i6bA00
4UAVA 1L7MA 2IYEA 4QJBA 2Q4RA 1QQ7A 3WK6A 4HAIA 3W5BA 1TJ5A 2YN4A 4I9GA 2FPWA 2CN1A 2JAOA 2HF7A 3E8MA 2VKQA 4HYTA 1RLOA 5AESA 2YJ3A 2JAWA 3ZI4A 3UMGA 2PKEA 3N8GA 1ZRMA 2HOQA 1TE2A 1F5SA 3ZU6A 4BEWA 4C4TA 5ALQA 3QUCA 3L0BA 3W5CA 1PW5A 2BDEA 4MWOA 3ED5A 3UM9A 1NRWA 4CE6A 3QNMA 5ALNA 1T5TA 2FUCA 4BYGA 2R8YA 4JB3A 2NYVA 5A3RA 1Q91A 3U7GA 3MPOA 3A1EA 4AS3A 3PCTA 3FPSA 3KZXA 3ZTYA 1SWWA 2G1AA 4UMFA 5AI9A 2OM6A 2G08A 1LVHA 3AR7A 1RRCA 2P11A 3ESRA 3TLMA 3E58A 4KN8A 1Q92A 1QYIA 1YS9A 1RDFA 2IOHA 1L8LA 4KNWA 1RKUA 4L6CA 1VFPA 5IT0A 3ZWDA 4Y2QA 3S6JA 5ALFA 3OCZA 2G07A 4FYPA 3NRJA 3L8FA 4YGYA 3QU4A 2FEAA 1Z4IA 1CQZA 1EK2A 4J03A 5AKJA 3I28A 4UW9A 5AK5A 5AHXA 4AP9A 5ALRA 2RARA 3CNHA 3ZUPA 2QYHA 1WPGA 3QX7A 3ZX5A 2C4NA 4KX5A 2YMPA 3FVVA 3M9LA 4BEVA 5ALGA 3NIWA 4Y2TA 1FEZA 2FPUA 3NASA 3RFUA 4DCCA 1TA0A 2JGAA 1ZD2P 1AQ6A 3KBBA 5AIAA 5ALHA 4EZEA 3W5DA 4EX6A 3L7YA 1Z4MA 3E81A 5ALYA 2ZBDA 4ZEXA 4FE3A 3J7TA 4C4SA 5AVWA 1JUDA 2R8XA 1O03A 5AW4A 1VJRA 3U26A 4KX3A 1N8NA 3UMCA 5AW9A 2EARA 1TJ4A 2G09A 4OD0A 2HO4A 1SU4A 5ALMA 4Y2XA 2YY6A 4CF4A 1WVIA 3QYPA 4EELA 1YJ5A 3I76A 2AUTA 3KDPA 3QU5A 1Z4NA 4RESA 2HHLA 2ZG6A 2IOFK 4YH1A 5AI6A 3QUBA 1RQLA 1RPZA 4UATA 2OBBA 1X42A 3OCWA 5AKEA 4UAUA 5FP0A 5AVSA 3ESQA 4F71A 4J2TA 2ZBFA 4CF3A 4UASA 3MC1A 2C88A 5AKHA 2I55A 1N9KA 4Y2SA 4UU0A 2WM8A 1QQ5A 4I9FA 4L57A 2HX1A 2YBDA 4HGPA 3WK9A 2B82A 3WKAA 4F72A 1U02A 1YNSA 4IG4A 3ZWKA 5IT4A 3B9BA 2I54A 3L1VA 4BNDB 3L0CA 2HCFA 3SKYA 3DDHA 5AM0A 2C8LA 5T41A 3HLTA 2B30A 4YCNA 3R09A 4HGNA 4Y2RA 2BDUA 1RMTA 4BX2A 5AW6A 3E84A 1L7PA 5ALXA 4H1WA 5AM4A 2P69A 4XPZA 3IJ5A 2I6XA 4XOUA 2AGVA 4Y2VA 2C9MA 2I7DA 5AIBA 4GIBA 5A3QA 2GFHA 3SHQA 3U7EB 5AKIA 1Z5UA 2BY4A 1YMQA 4HGQA 1ZD3A 5AI5A 1Z4QA 5AK4A 4Y2YA 3KC2A 2P9JA 3WGUA 2HSZA 2W4MA 1RLMA 3QXGA 2W43A 2GO7A 1S2OA 3N07A 2YMLA 3EWIA 3AR3A 2YJ6A 5AKZA 2B0CA 5A3SA 3QUQA 2I34A 5AICA 2RB5A 1L6RA 1Z4PX 3WGVA 2FPRA 4BKMA 5AW2A 2QLTA 5AVTA 2IOFA 5AVXA 3EF1A 4CF5A 3AR2A 1U7PA 4PNHA 1MH9A 1L7OA 1EK1A 3PGVA 3U7FB 3B8EA 2JARA 3ZTWA 3ZVMA 3U7HB 3VAYA 3UMBA 4YCMA 5AI0A 4G9BA 5ALZA 5ALDA 3I1YA 2HI0A 5AVUA 3A1DA 1T5SA 3HYCA 3QGMA 4UMVA 1Z4JA 5AK3A 3B9RA 1QQ6A 4Y2UA 1U2TA 4NV0A 4XE5A 5AM5A 2FPSA 1RQNA 1YDFA 1SWVA 3NALA 4YIHA 1XVIA 5AM2A 3WKBA 3FM9A 4G63A 4O8CA 2ODAA 5ALPA 2CFTA 5JJBA 1S8OA 3N28A 2EATA 3K1ZA 3IB6A 5AVZA 2HDOA 2NO5A 5AW7A 2ZOSA 4NAVA 2GHTA 2WFAA 5ALKA 3OTQA 3L0YA 3FGOA 2O9JA 1RMYA 2GMWA 4EEKA 5ALSA 2WHEA 1T9ZA 4C4RA 4UM7A 2ZBEA 3WK7A 3GYGA 2C8KA 4HGRA 1NNLA 3WKEA 3EF0A 2HEGA 5ALLA 3SD7A 3R9KA 4FFDA 1RKVA 1IWOA 1XP5A 3PGLA 3FPBA 4QQFA 2ZBGA 1L7NA 1WZCA 5AVRA 1ZD5A 3L8GA 3PDWA 4Y2PA 3OCUA 5AVYA 2YMMA 3OCXA 3WK8A 4L6AA 4YIKA 4EX7A 4B6JA 3SF0A 1RMQA 2WF9A 4BNDA 5E0OA 1ZOLA 2DQSA 3FZQA 5AM1A 2YMQA 1J8DA 4MUMA 2G06A 4DW8A 1QH9A 3QU7A 2WF6A 2X4DA 4E88A 3ZW7A 1L8OA 2R8EA 2I33A 1ZRNA 2CFRA 3AR9A 4UU1A 2YJ4A 5AKYA 1CR6A 4IFTA 3SKXA 1ZJJA 4NABA 2B8EA 4Y3UA 3RF6A 3NAMA 3KOOA 4BX0A 3ZVLA 5AI4A 3U13A 5AW8A 3EPRA 3ET5A 2JAUA 5AW3A 4UARA 3DV9A 5AW1A 4CNQA 5AK6A 4UM5A 2Q5EA 5AW5A 3NUQA 2G0AA 1RLTA 5ALEA 4Y2JA 1KYTA 3AR4A 4NFLA 5AW0A 3U19A 1RKQA 3QU9A 2WF5A 4GXTA 3N1UA 1YV9A 3WKDA 3I6BA 1Y8AA 4DFDA 2B8JA 5AI8A 3ET4A 5AKGA 3WK5A 4UMEA 2B1RA 2PQ0A 3AR5A 2P27A 2WF8A 3QU2A 2YJ5A 4HGOA 3L5KA 1Z88A 4NWIA 3QLEA 2IA5A 3SLRA 3M1YA 5AKXA 4XQ0A 1ZS9A 3A1CA 3MMZA 3QUTA 1O08A 2ZXEA 3F9RA 2CFSA 3L8EA 4BBJA 4ZEVA 4AS2A 2B1QA 4BX3A 3OCVA 3MN1A 2O2XA 2PR7A 2YFYA 3IRUA 1LTQA 2NO4A 3AR6A 3WKCA 5AVVA 2Q4TA 1Z5GA 2FDRA 2OA0A 5IS2A 1U7OA 3ZX4A 1TJ3A 2AMYA 2G80A 3W5AA 1Z4LA 3SMVA 4DWOA 2FPXA 5ALOA 4YCLA 3AR8A 3DAOA 1ZD4A 4ZEWA 1J97A 2HF2A 4RETA 3BA6A 2FI1A 2WF7A 4EENA 1NF2A 1Z4KA 1XPJA 5AVQA 4UMDA 3CZ4A 5ALIA 5ALWA 4OFZA 5ALVA 3ZVNA 2R8ZA 2MSNA 5AKKA 3OPXA 4KNVA 2OYCA 1Z4OA 2GHQA 5ALJA 5AKLA 4KYTA 3ONNA 3BWVA 1K1EA 1WR8A 3DNPA 1U2SA 4OCZA 3A3YA 3OCYA 3R4CA 2RBKA 3D6JA 2EAUA 1RC8A 2FUEA 4OHFA 5AM3A 2MU1A 5ALTA 2W11A 3WK4A 2RAVA 2AH5A 3L8HA 4JDPA 3NANA 3N5KA 1VJ5A 3L1UA 2D2VA 3P96A 5ALUA 3KD3A
chains in the Genus database with same CATH superfamily
2J41A 4NCHA 1ONPA 4FCTA 2OFPA 3TZCA 4WZBE 2Q4RA 3CSSA 3LXMA 4PU0A 4LJ5A 2X0IA 3FSGD 3TEFA 2Z5GA 3HKCA 1FRNA 2NXNA 2NYAA 3F6PA 3Q88A 4HDMA 3MTJA 4I9GA 3TDMA 4NMMA 1ZAKA 4AMVA 4OLAA 2POCA 4BLOA 1UBOS 1Z2NX 3KDAA 5G4KA 1PFUA 2ZRCA 4CMKA 4Z2AA 4ZQBA 4DXAA 5HOQA 2RAPA 4QU9A 1ADGA 5I7WA 2ADMA 1CEYA 3LLVA 3ORQA 4W5WA 2W70A 2FW6A 4LHEA 4W9NC 3SE0A 3ZBTA 1OTHA 1XZAA 3UT5B 3UOAB 3HKDA 1PW5A 3HKEB 3ISJA 4CHTA 3FYCA 1X1EA 6ADHA 3HXMA 3LKBA 5HDQA 4TYNA 3R7FA 3FVQA 5I3ZA 2BSAA 1VMKA 2PD3A 4JB3A 3JW8A 4ZAFA 4Z3DA 3BX1A 3P4XA 3F67A 1SBHA 1FSSA 5C7YA 3V1LA 3FVWA 3AVYA 4BBAA 4ZVSA 5FB3A 4Q1AA 2BFFA 2LIVA 3NBKA 1SKYE 3D0RA 2F59A 5JDCC 1X39A 1K8ZB 1BE8A 1CZRA 2G08A 4IXMA 3WFZA 1QAQA 1WDTA 4U0JA 4UHDA 2RE8A 2PVSA 4NYIR 4Z9BA 4BB0A 1VL0A 2G70A 2YOFA 4LECA 3HU1A 4MP6A 1XA0A 1EX7A 3M4XA 1UFOA 1MLDA 4IIJA 3UT6A 1U65A 4JUFA 5BV7A 1CRZA 1AQUA 1MRSA 4YMHA 1KAHA 2G9QA 5A0VA 1XL0A 3R74A 3T0GA 5L45A 1GTZA 2ZUDA 5AUQA 3DMFA 4Q9HA 1EFLA 5JNUA 4IUBS 3ORSA 4PBRA 5IX8A 2G40A 2V5VA 3P0JA 1T3LA 4Z3KA 4FYPA 5AR1A 3WICA 1DRVA 2FV8A 4FTWA 3R23A 1LY1A 4KDCA 5CVVA 3WP1B 2J59A 2YIVX 3I72A 3OX2A 3CH7A 4XX1A 4C1BA 3R3XA 4IHJA 3TOXA 1I6KA 5KKCA 4ZTUB 1IG3A 2HUNA 4YUAA 1E2MA 2P9TA 2PU7A 3L6RA 1CUAA 1LS1A 4Q7LA 3F4LA 3IV6A 1P8AA 3VZCA 4D97A 4GBJA 3MJTA 4CEHA 1ECFA 4DLKA 2Y3IA 3M9LA 4YGXB 5ALGA 1QIEA 3ZN2A 1U8CB 2Y66A 3AU8A 3DFIA 3G5AA 3ILSA 2XXJA 3ROXA 4PYJA 2EZ9A 2QUBA 4UQOA 1FLDA 5DHTA 3NO4A 4R8MA 2H2IA 1QO7A 4ZJYA 4V24A 2R68A 4OBXA 2OWDA 1VL8A 2X0KA 2ZJ2A 3PXXA 2HV9A 4B6EA 4D6PA 3A11A 1P17A 1P7ZA 1R3UA 1QONA 2XDYA 3KUCA 3L7YA 4UHCA 2I99A 2O4CA 3KKEA 2CBXA 4AF7A 2JZNA 1KMQA 3UHOA 1SXIA 1ECLA 1A04A 4DCMA 1CJTC 5T67A 3JQAB 1CZKA 4KUHA 5JS7A 2QUIA 1V7CA 3VR5H 5IJ0A 1SIUA 5ERYA 5I8ZA 3UUFA 1H8ED 5L4LA 1Y3BE 1M1YB 1IPHA 1K86A 3AEQB 4JAVC 5DKFA 5JCOC 4Z4GA 1H1LA 1JZTA 2FMXA 2R48A 4JN6B 1TF5A 4FI3F 4KR0A 3WGGA 4DUYB 3S2EA 2MHCA 4ZO4A 1WVIA 2HADA 2VP4A 1NBWB 1VSBA 3I76A 3KEFA 1FVOA 1KYIA 4MQEA 4UU7A 3N2ZB 5A0FA 3H5IA 3QKSA 1HYHA 4YQYA 5AQEA 1RYYA 5TF0A 3Q3JB 1MO6A 1L4LA 1BMDA 1NDHA 3MERA 3NDIA 3R0XA 5CLHA 3QXXA 3TAUA 4GMXA 1PBNA 4BV3A 1ZH2A 2IOQA 2XQFA 1WD5A 4PHCA 2PXHA 1OJ7A 3D6FA 1CUXA 4LF9B 4IS3A 4UE6A 3UK6A 2OCPA 1YONA 2HJGA 1A76A 4JOCA 4DA6A 5JY1A 2RHMA 3KTAB 1WPQA 1QR6A 3G2IA 4FYWA 4OG2A 4U9UA 1UKEA 3M33A 2HRQA 1YK1A 1C5KA 3ANYB 3NBFA 2AJTA 4Y2SA 3R7NA 2AD5A 3GG9A 4K9DA 1GNTA 4B75A 2QTLA 4XQCA 3TNFA 1O95D 4HQ6A 3QIVA 4HY3A 4DUGA 1D4FA 1U28A 3RHTA 1V6AA 4Q01A 3VPAA 2C7OA 1MFZA 3E2MA 1V16A 2NV2B 4H15A 2C96A 4AJ1A 1WMAA 4ID9A 5K5EA 2GFIA 1YNSA 4PAMA 1DJQA 2X8JB 3N3BC 1UFQA 2OQIA 4HXFB 4RE5A 5KYKA 2FW1A 1RVV1 1KEUA 3L0CA 2R6JA 3SF8A 4CMIB 3NIGB 3W2IA 1CS0B 2WIDA 2PSJA 5H82A 5CU7A 3D3WA 3HLTA 3NWBA 1QHSA 4KR3A 3HFJA 3HE3A 1A4IA 2VBCA 1Y7TA 1E2DA 1XD8A 3JD4A 5KREA 2DH6A 4JC4A 1Z7BA 3G6KA 3WE7A 4U00A 4BX2A 4F4UA 1M75A 1D4OA 1JG4A 2QRGA 3IQFA 4G85A 3STXA 1G21B 1OLUB 1T24A 3A9WA 3KJFA 1W2WB 2WFLB 3LCUA 3Q1LA 5DBHX 5EZSA 4D8WA 8GPBA 5J4HA 2UXCB 1YFKA 2BTQA 1NQXA 2CLKB 4B2PA 3BPSA 2EKQA 3R0ZA 3D5QA 4X8HA 1BX1A 4QSMA 1THMA 4Y2VA 4QRIA 3HJFA 1JJBA 4N54A 4OGLA 4XWAA 4ZANA 3FKSD 4O2AA 2ZIUB 4DQVA 2R6R1 3SHQA 1VJ0A 2P77A 3UB2A 2Q21A 2ORYA 1QH8A 2YV5A 1I6MA 3M3HA 4DWWA 4P35A 1ZD3A 2QAGA 2ZIVB 3D2LA 4PLWA 2IHYA 3VPCA 2D06A 1M6YA 2XB9A 4FILA 1AXEA 4ECEA 1QRSA 3JWGA 4A27A 3WGUA 3CW2A 3E05A 3EFOA 5J5VA 5KYNA 1CY2A 1X7XA 2QXTA 4FR0A 3OJ0A 1ZK2A 2YASA 1GQFA 5EIOA 2NW6A 5TRTA 3GJ0A 4KP7A 2FZWA 2V96A 2VJPA 3KVVA 2B0CA 4KXFB 3KKNA 3GN1A 1KR5A 1BSVA 3IE2A 2XE6A 2J5XA 2BKEA 4JCOA 5B1EA 4G0XA 5AICA 2A1UA 2ATIA 2JGEA 4XVRA 4PC6A 4XWTA 1B8NA 2GWRA 3BWMA 1N3BA 2D13A 3F49S 1FF9A 1NBEA 4P81A 1ESMA 2REOA 3F71A 4A0HA 4RTKA 4CF5A 4Z0NA 2GYUA 3V4LA 621PA 2VQFB 1KFBB 4PNHA 2R1VB 1L7BA 4ZOCA 1NOKA 3DXYA 1C0LA 5E6SA 1MXFA 3QVSA 5LA6A 4BQRA 2YCLA 4IUCS 3EZ9A 4UKDA 3IIKA 3W05A 1HQKA 3RU7A 4KC0A 2NNWB 3HP1A 5GADl 4Z5XA 2AFRA 1TCVA 1AZLA 2OC9A 2PYZA 2EWVA 3OZ7A 1O6GA 4MKXA 1Y5RA 3MCZA 1DWOA 4HDSA 4PNPA 1GA6A 2YWXA 1ISRA 3FD8A 5F1OA 5JEDA 2VF7A 3HJHA 1EBFA 1JR3D 4WD3A 4XDGA 1GG8A 3OZXA 4LIPD 3SEZA 2VAWA 5FTKA 3AOEC 4KSBA 1QZTA 5LOVF 4BFSA 1ATZA 1UEJA 5ITVA 6PFKA 4F5WA 4ILKA 5HWSA 4N1AA 4K03A 2IIPA 1AB6A 4YWHA 3R4VA 4CF6A 5CXUA 4WVLA 4D9NA 2V98A 5J1TB 3WR5A 2TYSB 1OU4A 4DT1A 5I8PA 2WJ6A 5AM2A 3P52A 2WWFA 3E5HA 1YQQA 3FDZB 3W3AH 4ESHA 1LTKA 3EXG2 5I6DA 4XYLA 2B20A 5E3IA 1QZUA 3CS3A 1S2LA 2GM3A 2XOKD 1KY3A 2XUAA 1H05A 4Q5IA 2YUTA 2IPOA 3FRJA 1KYVA 2O3RA 2OR3A 2PLRA 4OJTA 4BDSA 2Q8NA 1X13A 3KV3O 3N6XA 1D6SA 4EG3A 2IXEA 4WXPA 5IP5A 2W2MA 1H4VB 3MWJA 5EWMB 2FOLA 3GRAA 4K8RB 5ALKA 3ZZUA 1SIWA 3IUYA 3QBJA 4YAIA 4E1BA 3NUGA 4NENA 3LYLA 4GKJB 1Z73A 4L0CA 2GF9A 4NRDA 3N7AA 1RMYA 2GMWA 1J06A 3R3SA 4XTRA 1HNWB 2Q46A 1HNXB 1EINA 2WHEA 3R41A 2BR4A 2JD0A 1BGVA 4FYVA 2ODTX 4MJ3A 1G9TA 4L7QA 4COKA 3TOZA 2WJGA 3LRPA 2AHRA 5JXGA 2IELA 2A5JA 3TTWA 2I4LA 1U2RA 2QL6A 2HEGA 2YWJA 4LG1A 3SD7A 1GKUB 3E0QA 1BXRA 2BHLA 3TVYA 1KVQA 1HE1C 4D0RA 1ZGJA 3IT1A 1P2GA 1JFFB 2NZ8A 3EH2A 1ZSVA 3PTLA 2MCFA 2A8YA 2I0FA 5DCWA 4QTTB 1EUDA 1ECCA 5ILGA 3IALA 4RWEA 3VSDA 1JG6A 9ABPA 1D2AA 4L75A 5KSOA 5FLEX 3DYVA 4UNNA 2O23A 5JNLA 2EX4A 5HTOA 3DE0X 1JTEA 1E3SA 3ZZNA 4F3YA 1R9JA 1AD2A 3C8DA 1ACJA 3A06A 3HPQA 3QXCA 3VNVA 4V0QA 4P34A 4II7A 4P22A 2AB0A 1N5LA 2DFPA 1NG9A 1KMNA 3FZQA 4QREA 3WXBA 3GFBA 4AL4A 2WTAA 4F3KA 4YRPA 1SKQA 1UM9B 3T8YA 3CMCO 4PRLA 1CUWA 2AG1A 1LD3A 1NJFA 2Q5IA 3GJYA 3CMMA 4FZVA 4JX8A 1OBCA 4X66B 1ZA1A 2GYYA 5ARCA 1DEOA 3FPLA 2DHRA 4FE7A 4UCWA 2XECA 3NQ41 5F5LA 3IBTA 4EO7A 5F9MA 1E6MA 2FX5A 3B38A 5DSXA 5JAOA 4IWNA 2ZYIA 4JMLA 3PHGA 1P9WA 2LCIA 3N2YA 5ESXA 2H0AA 1U5BB 2CYAA 1U0FA 3PWZA 3S2GA 2FSFA 2N1BA 1SVIA 3IEKA 3WGJA 3C3JA 3EC1A 1OI4A 4MVJP 1BNCA 5HE9A 2J0UB 2J6BA 4EB0A 4QXQA 5KNCH 2JA1A 4BLSA 3P2JA 2OAP1 4BU0A 4MV0A 1K2VN 2Q5EA 3HCDA 3ITKA 4DA7A 3EFHA 2XWJI 5CDYA 3HXKA 2IWHA 2O2DA 2PV7A 3O82A 3PPVA 1YVUA 2RHWA 4PPNA 1XCMA 1RLTA 2QI9F 5E6RB 5LM3A 5ALEA 3PJGA 2CLCX 1Z2OX 3PLAE 1BVHA 5L4SA 5EIAA 3P1JA 3OLCX 3QU9A 2GARA 1SOUA 1XLUA 1S8AA 5EJ8A 3AVPA 5TMPA 3B20A 2QVGA 1XRQA 1CQIA 3JSXA 4OFXA 3FCOA 1SA0B 2I6GA 1QC5B 3PJFA 2QUAA 3E5RA 1J8FA 1U8FO 4H7DA 4GYJA 1KC3A 3NT4A 4HHEA 1X70A 1CJKC 1I2BA 2DWQA 1XVTA 3OPYA 4HAXA 4JNKA 4XLLA 2D4AA 2IV7A 2XQKA 3VHQA 1OTYA 3OM8A 1UODA 2OAQ1 3AEUA 3FIJA 3N86A 3AHIA 3GJ6A 2E4UA 2J7PD 3UBTA 3DDSA 5KTNA 1IU9A 1AQYA 2JI8A 2ZTVA 4EA6A 3EDMA 5TVGA 3R8CA 1QHYA 4BX3A 3OCVA 4XLTA 1LBIA 3SMQA 4ZMSA 2JJ8A 1PAUA 4AWAA 3QW2A 2XOXA 4D0GA 3ZHYA 1DEKA 2BEWB 2CDNA 4LVNA 1QF6A 2O19A 4OQLA 1HGXA 3OQIA 2A0FA 3PQ4A 1NVVR 4Q9JA 4AX8A 3L7OA 5L3SA 2FDRA 4R6XA 4YP9A 1P4HA 3JYNA 1EQUA 5EKUA 3RS3A 1VG1A 1CDZA 1ORDA 2A9PA 2YJZA 5WRFA 4JLSA 4IVRA 5DHFA 1DBSA 4UM9D 5FFMA 5IYZF 4BWGA 2FPXA 4YCLA 3KJIA 2E87A 3TW4A 3D3KA 1XIVA 3ER8A 1NRIA 2H5EA 1T2DA 1RZRD 1FBTA 1LDBA 1BFUA 1P60A 1DIBA 2HU8A 4HWGA 3M6MD 5TGDA 2O8CA 4UMDA 1KFEB 2J6IA 3FWPA 5ALIA 4G8BA 5B53A 1VKHA 3MNFA 3T7IA 3UMMA 1T4GA 2B61A 4HC4A 4UD2A 1RC1A 5EQJB 4KNVA 3I2IA 2OYCA 4I55A 4DJ5X 3UWMA 1NR1A 4JQYA 5CDHA 1W0KD 1W9HA 1K1EA 2PLFA 1DBWA 3TF5A 3LJKA 2I9PA 3I39X 3R6TA 2PGDA 2OHOA 4YAUA 1X77A 4DNFA 1MN6A 1D2GA 1OHHA 2DHDA 3AFOA 4OXYA 3C98A 4G41A 4NMHA 4O59O 1KL7A 2JLQA 1RS0A 1QOZA 4P2BA 1AUVA 4HZUB 4LBZA 3ZY5A 2E6UX 4G0QA 2PN1A 1YBFA 1FJXA 3U49A 3UAVA 8ATCA 3K35A 4C4TA 1UM8A 1I7NA 4HXYA 3SBXA 3N5KA 5KTOA 2P91A 2Y8EA 4QNMA 3LPAA 4MRVA 3HK2A 1UMDA 4TXHA 2D59A 5DM60 3WISA 4RZIA 1YDMA 3CSDA 1YA4A 3NBZC 3PSHA 5DTQA 3VNUA 2PX2A 2CE2X 3CNBA 3WB9A 1M8KA 1Z56C 2V7BA 5BV8A 1KC1A 2VDWA 1TJ5A 3EGOA 2BTOA 4YRAA 2VJNA 4BZPA 1KP3A 4XM0A 4HYTA 3D7MA 4BVJA 5ADHA 1PQUA 4E94A 2MT9A 4P0PB 3ZI4A 3CM0A 2QBYB 2A1TR 2FVXA 1BEEA 3NM4A 1EKXA 4KXMA 2BE7A 2ZEJA 4NXNB 2R8PA 4GICA 4HS9A 1FUEA 2E9SA 2MYTA 2ZQYA 5JROA 2G83A 4JB2A 3ADCA 4MAAA 1FDVA 2HGZA 1BDJA 3MINA 5TR9A 2AXNA 4PQFA 3T5TA 3FN4A 3DO8A 1MABA 1PKEA 3GX1A 1DC3A 4J0HA 5K6RA 1LLDA 1SCKA 3KAQA 2CHVA 3TLGA 5TQJA 3ER6A 4P4TA 1FCJA 3RWOA 1E5VA 2J3MA 2Z30A 4I6JA 1V2GA 1ZXBA 2OZEA 4RELA 4L4XA 4YI3A 5T5QA 1TMOA 5AHWA 3NGLA 4E33A 1O3YA 3E1KA 5EIXA 1QIGA 1BROA 2X9VA 3ITEA 4QWMA 4XM2A 5GOZA 1D7OA 1EYZA 3OQ1A 4KQKA 4G1VA 1CFZA 2LP4Y 2O50A 4EMSA 5M7EA 4XJTA 3AEYA 4C08A 2EX0A 4B73A 4BNZA 5BV1A 1RRCA 3LDHA 1OFIA 1Q19A 2X7HA 4C0AC 4D3DA 5HZMA 2XW6A 3KQSA 1G6Q1 4MDEA 4A8JC 1SUCA 5FPSA 2NV6A 1UBNA 1JEDA 1OIXA 1YS9A 1KRWA 1UBFA 2EWWA 1VYUA 3IT0A 3UUWA 3DVRX 3PIDA 4JJ7A 3COPA 4KSCA 5I4CA 5E38A 1YKFA 2R25B 3A6LA 5J2TB 3HSSA 5ALFA 3DWFA 1D9XA 4HG2A 4NU8X 4OQQA 4X5OA 4F5YA 1E0KA 1DV2A 4DGQA 4LOKA 2R7MA 2CLLB 2NM0A 3IUPA 1N6PA 3TFQA 4EHNA 1Z5OA 5LP6F 2EJBA 1L1RA 1Z08A 3UCXA 5CITA 4UW9A 5GZ6A 5AK5A 3MWGA 4B79A 5IJXA 1G8AA 1FSZA 1DMSA 1ENPA 1XG5A 4D82A 4EYKA 5DYIA 2INGX 5C8YA 5DSTA 2CUZA 2OCGA 1SC1A 1NP6A 1ONOA 3F7MA 3T9BA 3VTKA 3ZX5A 5LLDA 5EP2A 2RHGB 1OLXB 2W6ID 4O02B 1HI9A 4IRXA 1N9GB 1H0RA 3A9RA 4RYLA 5DU2A 5FUWA 1QHIA 1LF0A 2ZYHA 3KVNA 3FYUC 1PVOA 3DP9A 2IEBA 4YMTA 2CVPA 3I1JA 5DT9A 3U3ZA 1ZD2P 3GARA 1IM2A 4KO8A 5CEEA 1XAJA 4QDOA 5C31A 2VS1A 2BCJQ 4I4NA 4HLDA 3W8FA 4BFTA 2EL7A 5JJIA 5SYMA 2PT5A 1U0EA 3PK0A 4DEVA 4ZYWA 5HEKA 4X95A 5KJ6A 1D2NA 2R62A 1M1NB 4F6CA 3LA8A 4MW4A 4ZI2A 5DCLA 4ZHQB 1KXJA 1JPJA 3FCCA 2VPTA 2Q2VA 3GMIA 3L7KA 2W2KA 1OI2A 4EF4A 2ADFA 4RFSA 3U4QB 1N2CE 2XOEA 2NWQA 1Q0LA 4Q19A 1WZUA 3FOEC 1TJ4A 3TD2A 1XKQA 3VHXB 2GJ9A 2H8GA 5A03A 4HYYA 4WOKA 4XD7D 1Z8NA 4P98A 1YJ5A 3C1TA 1YS1X 2VZ0A 3I6QA 2O0JA 4NE7A 1EK0A 1QGZA 4ALJA 4ZI7F 3U44B 1QB7A 4WZBB 3AZPA 7MHTA 2D7CA 3RYCA 3EPLA 3T9FA 4QG7A 3KOXA 4RESA 4Q4JA 4Q3KA 4B33A 2QDXA 5FL7D 1VKOA 4EJMA 3OF2A 4UCFA 1YT5A 3CRRA 2IYNA 3BXGA 2ZE6A 1NAIA 2GTHA 2V97A 5EAIA 5FA8A 1KO5A 4ERXA 4YDQA 5LD2C 2D6FA 2L17A 1UKAA 4BMDA 1ZCBA 2Z3VA 2JVKA 4LQ4A 3OVMA 1GGMA 4YMSA 1IB0A 5CVDA 4HWOA 4CODB 1Y33E 2EGUA 3O9VA 3IQXA 1E7QA 4IIYA 2C0CA 4OIFA 4UHEA 3RF7A 3PDHA 1XEFA 3GB9A 2VEDA 2BT4A 4CN9A 4D0SA 2ERXA 2YBDA 3IHKA 3TD6A 5BMOA 1DQPA 4S1TA 2A1TS 5AH0A 2WWXA 3KL4A 5CLJA 3HJGA 4S2EA 5DM1A 3PEWA 2CY0A 3EGDA 1X8JA 2VUIB 4EPTA 1EFKA 3EMDA 2ID9A 3L1VA 1H6BA 3WAGA 3NRBA 2ID8A 3KQYA 4JQSA 1SKYB 3SKYA 4BLUA 4XVUA 3JYPA 3OHPA 3ME5A 4J43A 3IIMA 3RYHA 1T9DA 3W6NA 4QUEA 1WCIA 2JJ1A 4EL0A 1Z6YA 2FG7C 4PZYA 4QDUA 4RKEA 5KQGA 3WQSB 1DO0A 4M8NE 4TZ0A 2BDUA 3GJSA 4B17A 4CKWB 5CB0A 4PZUA 4I1RA 4R8SA 3PYLA 4OIMA 4EKGA 3PR2B 1G59A 2MOKA 4KLZA 2FXIA 4GGOA 1S1MA 2OAEA 3GGCA 4PPYA 1F4LA 1A9RA 1I2DA 3IS3A 3RGWS 2XNDA 5E7MA 4BC0A 4BVFA 4R2XA 5IZCA 5CYPA 3PF8A 1KH3A 2IVFA 3NIDB 4MEBA 4K87A 3SICE 4BWVA 1N2GA 4EVQA 1VKJA 4WJKB 4PCAA 3FKJA 3IMCA 1UDBA 1ZH6A 1NVEA 3A6ZA 3PRHA 2BONA 2ZRBA 3DWGA 3A7EA 3HYNA 3E18A 4J0KA 3VR2A 1JKXA 2OGZA 4D0LB 1O95C 4HCJA 4JVMA 4RY2A 2W93A 1JHQA 5FPTA 2WK1A 2HSZA 4U6NA 1W94A 2HYDA 1SEPA 4TTTS 2D3WA 2ECOA 4P86A 2BMDA 2O1EA 2YY7A 1PFQA 1XA4A 2H1IA 3KPYA 4Q7EA 4CKEB 4MHTA 2NP7A 1RZVA 3TBHA 3P2KA 1C8VB 3UMSA 4A23A 2X15A 4C7VA 5BUSA 4OXXA 4D41A 3COJA 1FTGA 1TU0A 3EXHC 3LHFA 3QVUA 1JLSA 2IZZA 2QRVB 2GCEA 3ESBA 2C7GA 1WDWB 3LPMA 3NP9A 4JASB 4POAA 2N47A 4WE3A 5BWMA 1FP4B 2AYZA 3ACCA 3GLKA 4CM4B 2IYTA 4L8LA 4MPJA 4BFLA 4F9TA 1V8DA 1Y7HA 1W36B 3VSBA 1BS2A 2V03A 3QV1A 4JZYA 3MHTA 2AWNA 2NU6B 3AEKA 3QY9A 1E96A 3ZTWA 3AQIA 5IXYA 1V43A 1BN6A 1XXHA 3BREA 1D1TA 1KSHA 3KLNA 2FAXA 1TVCA 1YRYE 2J32A 4YRSA 2Q9UA 3KVYA 4P5PA 3I9MA 4HDNA 4GLOA 3P71T 4RKQA 1GSAA 3DMRA 1USIA 1Z4JA 2LIPA 4K0KB 1JDUA 2K5UA 2PX3A 1V8OA 1G20A 4Y2UA 4TT3A 4O2RA 4M37A 2LRHA 2ZYGA 1OPRA 4MW2A 4LOIA 3WGNA 2QRPA 2D0IA 1TTHA 1DJMA 4PTZA 1FYFA 3BM5A 3Q2KA 4CFYA 2ETVA 2QPTA 2XMBA 3ONFA 3RRMA 4EQZA 3R9WA 2AIRA 3B7WA 4RA6A 3RLFA 2JS7A 2NUTA 3ZLBA 4WZAB 1GUDA 3TRKA 5CUQA 5FO0A 4YT8A 4UZSA 4DM3A 1P0MA 5HR5A 2VQEB 3EYAA 1P3Y1 4JKOA 2NTVA 1O58A 4RY0A 4TKMA 1IWBB 3LUJA 1E2NA 4UTNA 2XF2A 3EXHB 3N05A 3OWHA 2MR6A 2X9LA 2XE4A 4X93A 3WV4A 4EI9A 2IX3A 2C5HA 1QRUA 2OK8A 3AVUA 3GY0A 3BXXA 1RQPA 2GN6A 4CQMD 1L9XA 2HQSA 4NF2A 3I6MA 4LKRA 2I3ZA 2WIJA 1DKMA 5CD1A 3THYB 1IZ9A 1R64A 3H11B 4QEKA 2NVOA 4CLRA 4UHHA 1N78A 4OV6B 3HDYA 4RNDB 5CT4A 5K8CA 3LZDA 3KQLA 1YQWA 3WYEA 4JVOA 4RYDA 4G1UC 2UYCA 3NAQA 5JJKA 1N0VC 5K0CA 1Y80A 4MR7B 4R7ZA 4AB1A 3X1DA 3I53A 3WLSA 2ZBEA 3PDJA 3WK7A 1Q0PA 5BW4A 4R9NA 4D8YA 4N0MA 3WL3A 1PUJA 2B8NA 1H93A 4F56A 5D3MB 4ITVA 4ZCLA 4A8HA 5ENZA 5IYZA 4IJQA 4XDYA 2BW0A 1CWUA 1VL5A 2VP0A 4XFDA 1ZGBA 3QNWA 1EHCA 3D81A 3VPHA 4D46A 4R3UC 2AG8A 2YIMA 3TXAA 3T1HB 1KAMA 1DQYA 4XIFA 3I37X 1A4RA 3BXPA 3OCUA 3ZJ4A 4AICA 1OBOA 1QK3A 2GCGA 2C5GA 3OCXA 2NU8B 4EHLA 4DV2B 4FW8A 4QYSA 4EPXA 4L6AA 3PE4A 2K2WA 1T91A 1N8KA 3KKPA 2RGRA 2C0PA 1XU7A 3PUVA 3VZRA 1LWOA 3CPEA 3B3FA 2PTHA 2E85A 2QG9A 3DSRA 1V4VA 4JQZA 3B1WA 3AERB 5F7ZA 1P45A 4H7EA 5TARA 2ZKIA 1QIKA 2WTEA 4KGXA 4OMFG 4XWOA 2A4MA 4EK9A 3ZPXA 2TSYB 4RM2A 5B3JC 5CAEA 4G84A 4OYRA 4RGBA 1QH9A 1UEIA 5GY7A 3UA3A 5HJEA 5K8TA 4RH1A 1TM7E 2JLWA 3RUAA 2GAOA 3PGA1 3HXPA 3PDCA 4IH1A 4LTNA 4GM4A 1P4JA 2YVKA 4PHTA 1P0FA 2ZE5A 5FPQA 4ZFNA 3RRFA 1B23P 3GAZA 1WXXA 3QKUA 4R8RA 2Q5CA 1QRTA 5GP1A 3GGJA 4QGSA 3GVXA 3SOPA 2PU5A 3ZVLA 2CHQA 1YASA 2Y6VA 1MB3A 2N9UA 2X0FA 2CNWD 2FR1A 3O2QB 2NAFA 5F64A 2IEIA 2F17A 3DMNA 2P35A 4C78A 5I7OA 1XAHA 3ZR4B 3B60A 5JQGA 3SHFA 1JSCA 1A9OA 2IYXA 1DS6A 4ZD6A 5GZ3A 1Z25A 3B3GA 3AETA 4NNPA 3RODA 3T7TA 5KYYB 3LQKA 3QBDA 3DQPA 3LG2A 3OIUA 1U2GC 2Q3LA 4IJMA 5B1SA 2A78A 2F4VB 2NT3A 1XQWA 2HCBA 3OQHA 2ZETA 1G2OA 5DI9A 1A9QA 1MRNA 2YXPX 1RKQA 4GVXA 4KXNA 1ODKA 2R97A 1DJLA 3GLVA 2OLJA 1W44A 4WK2B 3CO0S 3RR2A 3DF7A 3N2IA 4YAJA 3T7EA 4JXZA 2YRFA 3ET4A 2CNNA 5A7GA 2JHCA 5IXSA 1TJNA 5EKDA 2PZKA 2B5WA 2B34A 2AN5A 2W7TA 3K1YA 4I5EA 4WXHA 4XVHA 4Y6OA 4YJ3B 5DYTA 3SJUA 4OSEA 1BD3A 1Q15A 1KPGA 3IQWA 4LYEA 1GPLA 4MKFA 1R6AA 3UQZA 5ELLA 1NNUA 1TK9A 4N41A 1EU1A 4CV2A 1RRKA 1N2OA 5JZSA 2PL1A 4GGPA 2JGMA 3MUEA 2GLXA 4KMRA 4IV5A 3LH5A 2B1QA 3A31A 3VU3A 4JJAA 2JIRA 4BKQA 1X7YB 4UFPA 2PWZA 2XJ9A 5BN3A 1Y1LA 4UNIA 3TDNA 1A8IA 1QUFA 1TGVA 1LTQA 3STHA 2B94A 1WU8A 4XDZA 1RTKA 3KXIA 1SG6A 2VT3A 3TRFA 4Z9YA 3A2KA 3D6TB 4JEIA 1U80A 5L95A 2OD9A 4X24A 3KXPA 2ZTMA 1R6DA 4V3CA 3RSQA 1U04A 1U7OA 3WQBA 2AJ8A 3FHLA 1WHSB 5CM2Z 4UUMA 3LKDA 5AJVB 1JDTA 1NYQA 3DE5X 4J0JA 3I58A 1A71A 1XT6A 2FCAA 4QX6A 4ZAGA 2O2GA 4L74A 2GBLC 3ZUGA 2B3DA 3GGOA 1P1CA 4Q93A 2P9CA 4DJJA 3TUZC 4KK4A 4RMJA 2HF2A 3R5JA 4X90A 5IULC 2PXXA 4GUDA 4E5VA 2X9QA 3GWGA 4B09A 1XPJA 2Q49A 3KYCB 1SNYA 2H7YA 1P73A 4LDJA 1R4ZA 4KQCA 3VZPA 3FNEA 3I1IA 2GZSA 3FNFA 3UN1A 4CQLB 4D92A 3V8EA 2IP1A 1Z4OA 1K9SA 1ZK3A 1SU7A 3ZKAA 3II6X 4XASA 3R75A 3GQBA 5ENVA 1VIVA 1U2SA 1Y1PA 4WCFC 5H1YA 3WDMA 4DNQA 3OCYA 2J9FB 2DQKA 4D42A 3Q2IA 1U9IC 4ZVNA 3EBOA 3ZI0A 1JP7A 2REQB 1JG3A 3EAQA 2VRNA 3FUUA 3E8SA 5UKDA 1EXWA 3W77A 5I7FA 3RU9A 1F0NA 4MARA 4WT7A 3GZJA 3D1VA 4HEJA 4Q34A 2D7JA 4ZYYA 1HL3A 4RAOA 2QXYA 3NANA 4BZXA 1V39A 3O73A 4ARZA 4DBZA 4DZZA 4EYEA 4HFRA 4RCYA 3M4JA 3IE0A 4MS3B 2XCTB 3DT6A 4Q02A 1FLAA 3QTLA 1AX9A 4HH4A 4JBNA 4N9WA 2WUWE 4B6RA 1SUDA 1TYAE 2OWEA 1VHDA 5G1PA 6REQA 3PV0A 2GSWA 5HQTA 5DLYA 1XVUA 2WVGA 4PBTA 2HK7A 1KZ4A 2HWKA 3KK0A 3L6DA 1XZJA 4J8PA 2FA9A 1MA3A 3W5BA 3GPLA 4ZDJA 1IBLB 1YHZA 4MQ5A 1MG5A 1U7DA 2Z1DA 1KSGA 4HQLA 4N40A 2WIBA 3ZBQA 4JYZA 4Y6RA 4ZQIA 2XHZA 2IXGA 2PKEA 1ZRMA 1DWQA 2Y1GA 3MILA 4TMXA 1K8QA 4UPVA 3P0IA 5JNSA 1KNXA 1YU6A 1UOQA 5CJJA 4EM6A 5BVHB 2C4HA 1PLJA 3Q2OA 4UVHA 3CNOA 4ZVTA 1BS1A 1NJSA 3QUCA 1NASA 2CLMB 4RD1A 2VJQA 4OHWA 4PGFA 2P3SA 1U3CA 2YINC 4OAQA 3RU2A 2QVBA 2XTJA 4GPD1 4XVCA 3EQ2A 4PXYA 3TXYA 3C5HA 1V41E 3TVTA 1VP9A 4WH0A 3EQ9A 1NI4B 3LWBA 3EQ6A 5AHKA 4KQJA 5A9TA 5E95A 1U1DA 4JXJA 4QFBA 3ROZA 1T36B 3G68A 4MPDA 3UA4A 1PI3A 4R69A 3U7QB 2AI2A 2KM1A 5JTUA 3ZY6A 1L7RA 1L7QA 3MT7A 4PPFA 4MKHA 5LMZA 1DP4A 1J5XA 3PR3A 2E4WA 1Q1AA 3TRIA 1GZUA 1SWWA 3RG8A 4AJJA 1DOZA 2H4HA 2WRZA 3SQLA 1Q7TA 1CPYA 1XJQA 4H7FA 4HB2A 2Z4SA 2Q07A 1UJMA 1JBKA 3BHIA 4GQAA 1UT5A 5TPZD 3VR6H 4BX9A 1DDGA 1I2MA 2YFKA 4LOLA 4HN4B 4RKWA 2C8VA 2R44A 3F74A 3FJ1A 2XMSA 3KG2A 3WTCA 1Y6GA 2CKMA 3R7SA 3DFMA 4DIDA 1V7PC 1WMSA 1WSAA 3NBXX 1LLQA 1T5LA 1VA5A 1VFPA 3LVQE 4RSGA 4IP0A 1QXSA 4D98A 2YIJA 2M6LA 4YR9A 2Z6QA 3L8FA 5F5XA 4R54A 2IUFA 2X23A 3B1VA 3GPIA 3QVGA 2QN1A 3D4IA 3E2IA 5TV2A 4Z4FA 3FTEA 3MJSA 1PJQA 5EP3A 4P3NA 2H29A 3C45A 2QN7A 4CM9D 2PO7A 5AVJA 3EGXA 1XTUA 1F4PA 2EGHA 2PFKA 1ZN2A 2XNJA 2XV1A 3LLSA 1W88B 5TJHA 1RI3A 3HNRA 3DTTA 3SYKA 1ID8A 5EJFA 4L78A 4G6ZA 1U7UA 3I3SR 4F45A 1VBFA 5IEJA 2VFAA 4HXEB 2EKPA 3QLVA 3O9ZA 2Q28A 2ZR9A 3BD6A 3C1AA 4JKIA 2P41A 1NUAA 4E7OA 3THSA 1J90A 3NHFA 3CKKA 1O97D 2ACEA 3JQQA 4MAMA 1X7WA 5AOBA 4BNGA 5F78A 1NG1A 1GTSA 4ZJZA 1MB2A 4QBGB 5JMTA 1JJVA 1G8FA 1NXSA 4OXNA 4Q3BA 5KDLA 1GQ2A 1UWKA 1RRMA 3GLSA 2G4CA 1JS1X 4X1OA 3RSFA 4C0BA 1ICEA 4JLWA 3VUFA 3QA3E 3OQJA 4GGMX 1YS7A 2VYNA 3J7TA 1SRRA 2H00A 3GGPA 2POQX 5HFNA 1GQSA 1WSWA 3TQSA 3V1UA 5DOZA 4YV7A 2QS9A 2DETA 3NAGA 1JIQA 3GBVA 3NHJA 1U3DA 4JVNA 4L22A 1YAJA 5D3QA 3LCVB 1DB3A 2CLHB 5H5JA 5F52A 1KK3A 4ARSA 4PVDA 1G7SA 4AYXA 3LXXA 2YY6A 1QHXA 4UUNA 1MG0A 1N2IA 3IUJA 1BIFA 3RTAA 1SHLA 3WL5A 1YIOA 3WWOA 5K05A 2PUCA 2JANA 4TSFD 4RPJA 3C3MA 1Q1QA 2HGSA 3OA0A 3JQAA 2YN0A 2KYRA 5L7YA 4ZZ3A 1JFTA 4FMDB 1QIIA 4FHZA 1F1JA 2JLYA 1ISPA 1EZ1A 1ULSA 1VJ1A 1WZIA 2I6FA 3TD9A 1M1YA 2UU9B 1AT1A 2ZG6A 3LQYA 4TKUA 5DLQC 4KIFA 3H75A 1O8CA 2CC2A 3AEZA 1PWHA 3DGEC 3SC6A 4X6YA 1AKQA 1OX5A 4RSHA 4V1CA 4FB5A 4Q1EA 4YFVA 4RPLA 4DLAA 3CJRA 2I5PO 4GE3A 3R7LA 1CEQA 1N5IA 1NMYA 3RIYA 3GJ7A 2WKSA 5K8JB 2A9JA 1JQ3A 3GLFE 5CXXA 4LN1A 2VH2A 4G8CA 2HX1A 3IOEA 5EZYF 2B98A 1UXKA 3FZNA 4PLCA 4RMGA 5A5VA 5AT1A 2E48A 5JZMA 1D2MA 2J48A 3KTAA 2IHUA 4PFKA 3USZA 1XTPA 1ESCA 2JIOA 4I7EA 3RBAA 5IUNC 5KTKA 3KSRA 4AP6A 3V4PB 1DAOA 4F4HA 5A9SB 2XCRB 2HCFA 3BDIA 3KXKA 3CJTA 1PVDA 1II8B 2J3IA 3UT0A 4C05A 4CLEA 1AQNA 2VWPA 1EVEA 4WJZA 3E9MA 1E69A 3C4QA 4E2ZA 3C87A 2QSUA 3E3OA 4C0SA 3O84A 3GI1A 3SAJA 4ARIA 2KLBA 3VU0A 3HUFA 2RFLA 3OEHA 2V7QA 5C4MA 1JQ5A 3CLTD 4B6PA 1N1EA 3FLMA 2X8JA 1JDZA 2IUSA 4M0UA 4ME6A 1GYRA 1I6WA 2I6QA 2JBHA 2EVWX 4FZ5A 4WNAB 5AM4A 2HIMA 5EERA 5HJ2A 1CS0A 4LI0A 5H83A 5I9TA 4CMIA 1UP7A 1U8XX 2QGNA 1KJNA 2H92A 5JCOA 2QVYX 2NPFA 4EJSC 3EZLA 2NYRA 3MCTA 4B47A 1H5QA 4OMUA 3KLBA 3WQHA 4WFKA 1OLUA 2ZANA 3X3HA 4DCJA 3BIOA 3PXUA 5AI5A 2PGLA 3VPGA 3ZW9A 4LE2A 4B6QA 3VDQA 3P2EA 4YPOA 4JGBA 3BGWA 1NZFA 2P9JA 3G17A 3K9HA 1C1YA 1DU4A 4HLUC 4KN9S 5LQRA 2GZAA 3F6YA 1JG2A 4CM5A 1ABBA 4ON9A 3C6YA 1C9YA 2C9OA 2TS1A 3K73O 1U9JA 3QX3A 3DZJA 4GEGA 4YUWA 4UVDA 1TM3E 4Q4CA 2PX4A 2B4TO 5B4TA 2VDVE 1GTVA 3LCMA 3AGQA 3THWA 3RVSA 3VH1A 2W6JA 4DPKA 2IE0A 3B78A 4HVCA 4GPTA 1X80B 1KI3A 2H18A 4IRUB 1GDHA 3T3GA 2P3LA 3W9BA 3D0KA 5AVTA 1H2BA 2QN2A 3A3PA 4FDLA 5AVXA 1E3MA 2Z9DA 2H1VA 2PZMA 4MIYA 1F2VA 3I6YA 2G67A 2QTVB 2DAPA 4ENTA 2X86A 3PGVA 4FGUA 3QM1A 3IBCA 1WAMA 4IW3B 5P8WA 5ITSA 2QDKA 3RAFC 4GX0A 3ESCA 1QQTA 3DAFA 3EZGA 3B8EA 4Y8VA 3WZMA 4ZHQF 2W6NA 3ZI7A 4C7OB 5HKLA 1N2CB 3VAYA 4OUDB 2JDIA 4A2CA 4X62B 4TVKA 5ALZA 2HJSA 1VYHA 4OUKX 3HV2A 3I1YA 4NH0A 1ISJA 2XAUA 3TRJA 4AIIA 1Y4ZA 1MB0A 3A1DA 1NYTA 2DHQA 1D5CA 4MV1A 3IPXA 1BXKA 1D2HA 1Y6ZA 2I3BA 1JIXA 1YB1A 2ANBA 2LGJA 2M1XA 3PE3A 4H3SA 1P6XA 3N2KB 4KQFA 1NVAA 1ZK1A 2YQZA 1L5HB 3E8XA 5TEVA 3PFGA 2Z2KA 1P2VA 1JALA 1H65A 2QE6A 1YI8A 2VCHA 5KNBA 3WAJA 3VO8A 1JFLA 1WJGA 4O8CA 4Q3CA 4LC9A 1SHKA 1HE5A 3IR6A 5GINE 2VXYA 2NNLD 4EUSA 3O4VA 5JJBA 3KD2A 4P5DA 4IH4A 5KVVA 3SC3A 5ERGB 3LGSA 3OE7A 4YAFA 4BQEA 1Z6AA 5L9AA 4JD5A 2A92A 4HS4A 4KXYA 1TZ2A 4MWBA 3NDBB 3AFIA 4O3MA 1VMIA 4KQHA 5FI1B 1GAWA 1MC1A 4PXSA 4R9VA 5F2OA 3C85A 2B21A 1UDXA 4ZT5A 2HDOA 3ZCSA 3CZ9A 4CG1A 5KHOC 4MXDA 4S24A 1Y6FA 2XZPA 3U4DA 3DA8A 4Q48A 1T43A 5KYWB 1E2JA 5I9IA 3OTQA 5E6UA 4OHOA 5I7RA 3NOOA 2UVQA 2YVLA 3CIOA 4I4LA 1GQYA 2CD9A 2HJHA 4AW9A 3FMVA 2HA5A 4JUAA 2ODEA 1J0AA 5JYCA 4LE1A 4YUZA 3AU9A 1VBNA 4BCBA 5KVQA 1M5UA 4FKZA 4ROSA 2D1TA 2OBLA 1XHEA 5FT9A 4N5MA 2BGJA 2GNAA 5EWMA 1Q3TA 4ARBA 4F04A 3AY6A 3TJRA 2PKXA 2NAPA 4KFTA 3PQ7A 4NG5A 4YRQA 2DCMA 4Z7JA 1U7HA 4NPAA 5DTEA 2EQAA 5JHGB 1NE2A 5A04A 4RY8A 1QYRA 2QB5A 2LD4A 3HY3A 1BMFD 2YV2A 4IKOA 4LMPA 5TVKA 3FPKA 5JYDA 5K51A 1AHNA 3DB1A 1DCFA 1HRKA 1P0PA 3O2JA 4Y2PA 2V6GA 1E0DA 3QTTA 3CX4A 1ZW6A 1BMTA 3TMYA 1MT0A 2WTMA 2OXCA 1MAWA 1QLJA 2H9IA 3W5SA 2BZGA 5CM9C 1WHTB 2PL9A 4IDOA 2VOJA 1GT91 1UC4B 1KIFA 1LPBB 1M2OA 2QJFA 1JFFA 1Q44A 3B6IA 3BB1A 2IS4A 5D51S 2Q29A 3EMBA 4F2DA 4EPYA 2HWXA 2QTNA 3DHWC 4ZP1A 3CRVA 3ONDA 1DTWA 1UMKA 5CW1A 1OAOC 2V5UA 4US2R 1CRWG 1SCBA 5HF9A 3INGA 4NH4A 2WLTA 2CFRA 4W9RA 3BILA 2QTBA 1FFYA 4LJRA 3A6EA 3EVFA 3IAFA 3TX2A 2CLDX 1CR6A 1NXOA 2J4DA 3EB9A 1MD9A 3E6AA 2GVDC 2VDLB 3YASA 4CWAA 1JTFA 2JBWA 2VF4X 2ONJA 3RF6A 2G72A 4BQNA 4BX0A 1HT2E 1PQWA 4ENPA 3R3ZA 4M7PA 2CUTA 1I32A 1UM9A 3BL8A 3PGJA 4W1SA 2EJCA 4X1YB 4EFLA 2Y99A 2P4EA 1YCFA 1YR6A 2BUAA 3WO1A 5JVDB 1XUOA 3A14A 3AJEA 4LVOA 3AKDA 3C7KA 4RS4A 5BN5B 3LOUA 1P2BA 1NR7A 2NSJA 4TTPA 2NXJA 3L3BA 2D2FA 2COEA 3PVCA 3M9XA 3Q7TA 4GMFA 1I4EB 4O2BF 2G88A 2NXCA 2NUAB 1VB5A 5EFOA 1U5BA 5FUXA 5G0VA 1Y48E 2F1JA 2ZSKA 3U5ZB 1QP4A 5LUBA 3H7IA 2F3TA 4CMAA 4Y2JA 3UXHA 4TROA 2J0UA 3R0VA 4R16A 2FN4A 1KK0A 2WF5A 2CVHA 4RIFA 5DYWA 4Q1VA 4DFDA 1XEAA 4IAOA 1B4DA 2L42A 3FMOB 4BN4A 2OBYA 2YTZA 4GXNA 5AKGA 5HCIA 2P27A 3SEAA 2VYVD 1GGNA 1PT8A 4MJLA 2PFSA 1XLWA 1E3IA 4GH5A 3BKXA 4HLNA 1MEEA 4J16A 2DTDA 1O6BA 3BB3A 4ID3A 4LC0A 4PZPA 3SLRA 7ADHA 2DUWA 4Z4QA 1RRGA 1ZS9A 2GN4A 4C88A 1XPRA 2D54A 3MMZA 4IXDA 4KU4A 4OLJA 4J1TC 2NO7A 3TH5A 3N6RA 3FDIA 1Z7GA 1SA0A 1YA8A 3GT7A 4P3OA 5EI5A 2GN1A 3EOAI 4RTRA 5LMCA 2JIMA 3HYLA 1A27A 2VF2A 3MN1A 3QWHA 4X60A 2AOWA 2PUTA 3OFNA 4R2JA 3HJRA 1VBMA 2VNSA 3JPWA 1RI5A 5H0IA 1CY8A 1HNZB 3I5UA 4Y9TA 4DIBA 4PLZA 3RHFA 4DAEA 3L5OA 2PR2A 4Y6SA 4BMOB 1W6UA 2XPCA 1GARA 2G80A 4O5OA 1HRDA 2F8LA 1GR1A 2WP8J 1YUNA 3LUPA 4N7BA 5F3WB 3FFAA 1NLMA 3NVAA 4BGVA 3RT9A 4EF6A 4ZGGA 2FGJA 3ZYCA 2BEWA 2GA9A 1XCLA 2E55A 2WOOA 3FI9A 2JI7A 3T5BA 1Z4KA 3SJCA 4BXOA 3KQPA 4RK6A 2BDTA 1CY7A 2PKYX 3P7MA 1EG2A 3L0DA 3WLFA 3Q8LA 1K3UB 3QJGA 1E1MA 4DA0A 3NH9A 1NR5A 5B6JA 4JC8A 3E03A 3T12A 5CA0B 1A2KC 3VH2A 2HLHA 4PSKA 5E4TA 4H4CA 2ZJYA 1QG4A 4IOKA 4KTVE 2ANCA 1ISHA 5FI3A 3ZHBA 5C46F 4NLLA 1H6DA 1E3TA 1TEHA 3MRSA 4WBXC 3MHPA 4JJZA 3ZU3A 2QLLA 3PCXA 1Y8ZA 3V8BA 3NYQA 4M1SA 4NZOA 2W6MA 3WLJA 2PLNA 1RW4A 4JITA 2IYLD 1WM1A 1YRQA 3TIVA 2EGGA 1UXJA 3R7BA 5KOHB 2P2GA 4NV1A 3K6SA 3DBVO 2G3YA 2FEKA 3QVXA 1OBFO 1E7YA 2UUPA 5ALUA 3H1TA 2CLFB 1TUGA 4BNHA 2V0NA 1CUEA 1WF6A 4ZT6A 2ST1A 4AN1A 2ZTUA 3D7NA 4HZUA 5JO0A 1XMQB 2PFGA 5HKKD 2VSYA 3PRKE 3SJBA 3SZGA 3B3AA 2HF7A 3UWOA 4MIKA 1CUDA 1KXZA 2PWPA 3JRXA 5EHQA 2GVZC 1KA9H 4ZVQA 1A96A 3RKUA 1Z2CA 2QW0X 3BCHA 3EFEA 2AC2A 1VMAA 4H31A 5FPHA 3ZU6A 1DCTA 4M55A 2JFYA 3W5CA 1A82A 2KS6A 1TLTA 3IBYA 5EZ6B 4RVGA 3WNZA 1GRRA 3MWYW 4KL8S 3UAYA 5BUQA 4DR1B 5ITZB 1T5TA 2AW5A 3OKFA 4KUEA 5BOVA 2GEBA 5TSDA 1C4WA 4Q16A 5DLEA 4CG3A 4ESOA 1VPDA 2YVUA 3T38A 4U8HA 3GMSA 1FLVA 4M88A 2ZYTX 1SQFA 5KMGA 5A1JA 2JCSA 2NLOA 3JYOA 4AXXA 3R5HA 4O63O 4Q00A 4BP3A 2ZI5A 1ZNXA 3DNMA 4R84A 1AB5A 2ISQA 2G1AA 4R5MA 4DDUA 4YRBA 1HYGA 1JE1A 3H4VA 4CMJA 3FBGA 2JFFA 1SOMA 1LVHA 4AULA 2P11A 4ZRMA 4ECAA 2XMZA 1R10A 1QE0A 1E5DA 3HCEA 1XWWA 4J1NA 4GR5A 3HU2A 2QL5A 4DSAA 5C8DA 2F55A 4RDXA 4KI0A 3L7IA 4NCAA 1OT5A 4O4LF 1OROA 4KNWA 5KPDA 2IBMA 2PZLA 3BSWA 4IOLA 3M6FA 2JHPA 2EERA 4JB8A 4D9HA 3FCYA 2PKQP 4ZU6X 1T0IA 1UP4A 4N3CA 3ZQUA 5IT0A 4W5OA 3DB2A 4JIMA 3NMUF 2JHGA 1RJWA 1DC6A 3NRJA 4R4JA 3VI4B 4AFNA 4HWKA 4YO8A 1H8HD 1MV5A 1Z45A 4R6WA 3M5PA 3T7KA 1D0VA 2CT8A 3R7WB 3HWSA 4WXYB 4URXR 1MO3A 3SI7A 4Y1GA 1JWLA 2ZJ6A 2RG1A 2ODPA 1GNSA 3MD9A 3CH6A 3KNZA 3NGMA 4RW0A 4BCCA 5JFTA 4KBGA 4MMYB 3A1VA 3M3DA 3AWDA 1U8EA 2DTXA 3FFXA 2I4MA 3R3HA 5J2TA 1KO7A 5GM2A 5J47A 1V5EA 2XE8A 4EG1A 3WIBA 2H54A 4R2LA 3PHLA 3GEPA 4KPFC 4MX8A 3ZV6A 3UCEA 4PGMA 1KDYA 3WIOA 4YCSA 3UZUA 3NBUA 3WLMA 2WP0A 3RSGA 4DA9A 1QX3A 3O4JA 4QARA 3RUFA 1KYXA 1B0ZA 4NBSA 1E98A 1XU4A 1TF2A 2PEYA 4G25A 1C3OB 5KINB 3DMPA 1WB4A 2E82A 3DVAB 3Q7EA 4MCJA 4CMEC 2PH3A 3M5WA 3ND8A 1JEAA 3EZ2A 4EX6A 2EFCB 3F3MA 2QD1A 1AY0A 3BJZA 2C3MA 3ETJA 4L07A 1KARA 3UGKA 2Q5OA 1DLJA 4F3RA 3NYWA 2DSTA 1MJ5A 1OLXA 3ITDA 3FPEA 4FNMA 4ZEXA 3W2HA 1N9GA 3NHWA 2HQRA 2YHSA 2QL9A 4JQCA 3ZZ0A 4E6EA 4NBTA 4NZPA 5KWVA 1XNGA 3I2JA 4S1PA 1AKVA 1J56A 2J31A 4H4DA 4KXUA 4LNUB 3GZTB 3WJ1A 4UAGA 2CMGA 2VPWA 3TZKA 3IQHX 1XAIA 3N8IA 2XTZA 3LI2A 1IM8A 4NFYA 4YT4A 2QLNA 2F90A 4LRWA 4EG6A 2AC7A 4PX3A 4ENSA 4H60A 2MINB 4AZ3B 1M1NA 2YRXA 3G5LA 3FSGA 4EDFA 4ZHQA 2IH4A 3PB3A 2Y0DA 3LT1A 5B2FA 3GJQA 1GUAA 2IUEA 4UCXA 5CVUA 1J49A 1YTLA 2D5AA 3H87A 4Y6GB 1Z4NA 3KFLA 4K05A 1JR2A 4GI1A 1CUJA 5TY0A 3VHXA 1Z6PA 1KBOA 2B35A 4R1QA 3SDZA 1E2PA 5K0ZA 2VPQA 1X42A 2GN2A 1U7XA 2I2WA 1O97C 1J2EA 1KE2A 1JJIA 3U44A 2AMLA 1HE3A 2I6SA 4GT1A 4U39A 4MR8B 4WZBA 3D8TA 4J3JA 2OV8A 2VZEA 4AJPA 1GM5A 5IKEA 1EGQA 4LRXA 1U1CA 3HYSA 3FTPA 1DRWA 1F0KA 1ZGZA 1EPUA 1XEXB 3LFHA 4L51A 4RZHA 5KVSA 2B7CA 2OTCA 5CPFA 4EW3A 2QY9A 3OZWA 1DLIA 4I3GA 4L8YA 1X15A 1U2DA 3QPBA 3OU6A 4W7HA 3TWOA 5G0SA 5K0SA 1J33A 2H1OA 3WKAA 4F72A 1UL1X 2W2QA 3LVFO 4IUDS 3IA2A 4O4HB 2I54A 1Z3IX 4I50F 2X42A 4FJ2A 4HDKB 4JJEA 4KFSA 4NBVA 5TB5A 1CE8B 2VWQA 2YR0A 4MYUA 2X4GA 3D9QX 3H16A 4ZC1A 3S3TA 5FOXA 121PA 4PSVA 4C0WA 5EJAA 4JI8B 4BE4A 1KH2A 1JJAA 2D2XA 2FXVA 3H6KA 4JP8A 4K6FA 5JSQA 2PUBA 5P21A 1QOPB 2PVCA 4QTYA 2A3RA 1WPXA 5IG2A 5JAPA 1TEZA 3R3JA 1R0KA 2J0VA 2QF7A 2YHIB 3AVVA 3TEJA 4F93B 2EG9A 2HCTA 2GBCA 2WSSD 3CRZA 2ESRA 4YRNA 3R8FA 1XTVA 2XVAA 1Z62A 3CPJB 3OM9A 3VI3B 4B84A 4E07A 2Q1WA 4UOEA 1AKRA 2OHXA 2WU1A 1A3CA 1AV7A 3QF7A 4PHGA 5IVIA 3DE1X 1GKLA 2DERA 4Q47A 3EYWA 3HA7A 1I9CA 3RS4A 3LKZA 2AR9A 3T7SA 4KJZA 1FP6A 4KITB 5F1PA 1PU2A 3A3OA 1HXHA 4IQFA 1KPIA 2X7XA 1BWRA 3ESDA 2QM0A 1EA5A 4O29A 2FVYA 3CXRA 4OTZA 3UW3A 1CR4A 3AVXA 4BVAA 1X1QA 2JFOA 4OJQA 4V38A 2IGTA 1NWHA 3ODPA 2PAFA 1U8ZA 2N3ZA 2WT8A 4G0VA 3PQ3A 3H1GA 2VI5A 4ZTBA 1PWYE 1W5TA 1K6JA 1V11B 2EW1A 3N07A 3S99A 2B8TA 3N0VA 3ZHOA 1I10A 3E48A 1U0JA 2CL0X 2WJZB 1Q7EA 4JU8A 4KBFA 1FFCA 5KQMA 4BTLA 4PLPA 4QWWA 4RADA 2QTTA 4RK5A 3W5HA 4JNCA 1CQWA 4C0QC 4HRVA 3VPDA 4FGKA 4WKGA 2J3DA 1Z6QA 2Q9AA 3TQTA 1KJQA 1Z6XA 3X1XA 1N0WA 1QGUA 2IOFA 3ZGNA 1XL1A 2P78A 1B74A 3F5DA 4MROA 1IZZA 3AR2A 3RFFA 4DLVA 4XGRA 3RUCA 1KMHB 2W37A 4QHYA 4XYMA 2IH5A 3I73A 3OJWA 2O0HA 4QOEA 1AE1A 1G3QA 2XXAB 4MDFA 1ADFA 1FFHA 4MSUA 3ROMA 1AURA 2BRUC 1LBEA 1JR4A 1N5RA 1MUUA 1GG2A 2QRVA 3PQCA 5HIAA 2OD2A 1GDTA 4RLQA 1S89A 1FP4A 2IPMA 4JX9A 1G8YA 3ZHQA 3VPBA 1QE3A 2ENUA 3THXB 2JJQA 1PF7E 1RXYA 1F9AA 2H7XA 4R81A 5JAQA 2P6NA 5FRDA 5B58C 5MFZA 4J7XA 2GAIA 1P61B 2PQ2A 4HLCA 3PNQA 1KSJA 2YHUA 3D8RA 1THGA 4G23A 5CIWA 2NADA 1CSEE 1T9GR 5DYYA 1CKEA 1NV8A 4FGLA 4YMLA 1I3MA 1KVUA 1PGPA 3A2NA 3IEVA 5E7JA 2ZIWB 4OK5A 4A7PA 2EP8A 4C0HA 1G8SA 2QM7A 3FF4A 4FFSA 4N6GA 4UVEA 4R1OA 2FX3A 1EXNA 1PCXA 4ZZIA 1M0EA 1LB1B 1FU7A 5DW0A 5KWSA 5LUAA 4GW3A 3WY9A 4KE7A 2XZOA 4H0NA 4W1PA 5DLPA 1JHVA 2RGGA 4AG5A 4D4KA 1J99A 3JQ8B 2GCOA 5KYUB 1QYDA 3GLFB 2WJWA 2Q4DA 2OCLA 2P62A 2PEZA 3QUAA 3GIDA 5JCPA 3B9QA 3HSYA 3T3MB 2EFJA 1SXGA 1TKRA 3VNBA 1O96B 3K2EA 1FNSA 4QULA 3C3EA 1DUIA 3QX9A 5D5HA 4FKMA 4XR4A 3LQ2A 4H0FA 1AF4A 4RJKA 3TR0A 3EXHA 3N74A 1EX1A 4IVNA 1HO3A 1PTKA 1DELA 4EEKA 1GGJA 3WBJA 4E2XA 2ZROA 4YXFA 2RMKA 1C7IA 2HUPA 3B7GA 1ZD1A 2IODA 4BQQA 4BLWA 1EXDA 3NTQA 1U4SA 4FOOA 1QS0B 3JYLA 3GFVA 4MV3A 5LC1A 4L5AA 3NX4A 3GRPA 4C04A 3THYA 1SMKA 3GT3A 1VSVA 4NTZA 3K9NA 2W2NA 2VSQA 5JWRA 1KE1A 3WRWA 3L1JA 4DIOA 1E62A 1V5GA 1SCUB 3HZZA 3UJCA 3FKSA 4F9FA 3KJNA 1OIVA 2EEPA 5IBRA 1GV1A 1RQ7A 1U6JA 4CNBA 1Z37A 1F51E 4MR7A 4OBBA 5AUNB 1L7NA 1N3LA 2XUJA 1Z06A 2NSDA 3JQEA 4LZPA 2LDXA 1WZ2A 3U3DA 4Y6PA 3G23A 1T29A 1P19A 1SG9A 5C8XA 4AG6A 4C3VA 5DNUA 2WPNA 2ZKLA 3ZWBA 4QDTA 1H6CA 2ZB3A 4IOJA 4MVWA 1XAGA 4PPQA 1QZZA 2QM3A 5D3MA 5KSPA 2DUMA 3AXSA 4DWVA 4E46A 1X19A 2R1ZA 2VSNA 1IAQA 5ED4A 1K2WA 2JASA 1SK9A 3GXOA 4TYWA 2PMCA 3F47A 3VHRA 3P26A 4H7HA 3HB4X 2ACVA 1JSZA 3PXCX 4JT4A 2Z5LA 4YRJA 2QYOA 3E1GA 1WQ3A 2VAXA 3KKOA 3MS7A 4Q3NA 4IX1A 1TK2A 1Y3IA 3NFRA 4OGGA 3RKSA 2ZIGA 4ZCRA 4DDVA 5L3QA 2IP4A 3TGWA 5A62A 1P4RA 4B7CA 2UZAA 3J81A 2WMNB 2PKQO 1JIIA 2O7QA 2JIDA 3DLTA 1FVXA 1FDIA 2AG5A 2ZS8A 3AERA 4CM3A 4J90A 2H9AA 2VC2B 2VZ8A 4DDHA 1M9NA 4MGKR 4E03A 5FEUA 1K5PA 1RZ3A 4X7RA 2G9VA 3K9BA 3U2QA 3O3MB 4C0JA 4TKVA 4NOKA 2IPXA 4FYMA 2APJA 2Y1XA 2CLIB 4JVSB 4ETWA 4LGVA 1QLWA 4IFIA 1ETHA 2W6QA 4I5DA 1CDEA 1Z0DA 3S2UA 2C4TA 2P4UA 4TXMA 4H17A 4P4GA 1PQYA 3U7RA 4BJ1A 5EZQA 9ATCA 5KI6A 1STOA 2HJRA 5LZ7A 4KYVA 4YREA 2F9LA 1TGYA 3CLVA 3LOQA 2WLSA 3GUVA 2IW1A 2WKQA 3G8YA 3Q40A 3VR5A 3BWYA 2IYFA 2W48A 2NSYA 4ZRNA 1OOEA 3BERA 3CJQA 2QP3A 1ZW1A 2H57A 3M6WA 3NWPA 2R6DA 4TLCA 5KTTA 3VV2A 2WIAA 3RVDA 2WU4A 2MMCA 5ICSA 2XKKA 2W5UA 4LMRA 4R40A 3RQIA 4PZDA 3DMDA 2DT5A 1QYXA 3DL2A 1ZK0A 4TRJA 3ZVRA 1C9JA 4GX1A 2FFAA 4PYOA 5BQ3A 2Q50A 2ZTLA 2HLDD 2HY7A 2MYNA 3BMNA 4U6QA 2XXBA 4DNPA 2O59A 2V6JA 2QQ5A 1L1QA 1DXQA 5LWHA 5I7SA 2ZXEA 4G67A 3DMTC 3ILVA 3WRXC 2A86A 3O7WA 5LQAA 1BDMA 1RWKA 2ZUWA 1T9GS 1E9FA 4ZDKA 5DV9A 2YHAA 4KVGA 3K9FC 2ZXUA 1XZQA 2PR7A 1Z0FA 5B3JA 2FRDC 3V34A 1GOTA 1M6NA 1R4MA 2FR0A 4L73A 4PYIA 4X85A 3USCS 3WXMA 1ODJA 6NULA 5EHNA 4O4LA 1CUCA 4GPAA 1GWNA 3AI3A 4F8YA 1BWPA 3D4LA 1WDKA 3RT1A 3D3NA 3MLBA 1USGA 3K6KA 5ECYA 3M4ZA 5EE3A 1T2EA 1VYVA 4Q4DA 3SMVA 2QR2A 1X7YA 5JS1A 3TGPA 1NBME 3FI0A 1GZ4A 1GA4A 3PHBE 4UEQA 4KIUA 3QOFA 2ES4A 2AEFA 2HA7A 2XKJE 2FI1A 1XFDA 3UAGA 3TFOA 2QTHA 3VZBA 4L7VA 5C34B 4EEZA 3NBMA 5ALWA 3NIFB 5B7NA 3LXUX 1G8MA 1TUBB 1I5OA 1WHSA 3NJRA 4BMZA 5ALVA 2O4UX 5IN4A 4GZ6A 3QPWA 4PAQA 1IOZA 1E9CA 1H66A 1SZCA 1XKTA 2ZRDA 3CBGA 3UK0A 2GKOA 1JIJA 2ODNA 1NVVQ 3L1KA 2BKUA 5CLGA 4EFDA 4ZO9A 5GONB 1IBKB 1XROA 4NNJA 1GZ5A 2B4RO 521PA 3OOYA 2QN6A 4OCZA 5EY5B 3K1TA 1NBMD 4MLDA 3RT7A 1T9KA 3EOBI 5B57C 2P3QA 5KPJA 1ZN8A 2AE2A 2NO6A 4EPRA 1JH9A 3KYCA 4H59A 5B1DA 1WEHA 4JI6B 3IDQA 1L2TA 2O06A 4CUJA 3DDNA 2VA9A 5AM3A 5ALTA 5IM4F 1M10A 4CQLA 1ILEA 4UDNA 4XGQA 5E7QA 4FMCF 1EEHA 4ZQCB 3A70A 1HT0A 1E2QA 1XV5A 4L4YA 5T64A 3KB1A 5JW6A 2DSNA 1DEHA 1KRHA 1KEEB 2HM7A 2JKZA 3QQPA 4PGAA 4BJ3A 3LF1A 2DXIA 1NU8A 3GGDA 4IHQA 1JA9A 2NO9A 2REQA 1EM8B 1WUKS 3I8OA 4FN4A 4MEAA 4Y0VA 5U9CA 2FQ1A 2AXQA 4OJMX 4UOZA 3IDOA 5BNWA 3A4IA 3D7SA 1F2TB 2I8AA 1U1FA 3UMYA 4FS3A 5FYDA 3UMGA 3ETCA 2X1HA 2JPDA 2CWWA 3HBLA 2NUPB 2AS0A 1IK6A 1ESZA 2ZUSA 5I47A 1DT5A 1UOOA 2I03A 2UYOA 4L5CA 1NC1A 4BEWA 1M74A 5MN4A 4JJKA 4OOEA 3SXUB 1XK6A 3L0BA 4AQYB 3RU3A 1LGYA 5CNIA 1QCCA 5JRJA 3O90A 3UM9A 1C41A 4B4WA 3QMPA 1TAGA 1U0OC 4G56A 4FEAA 4A0RA 4EP1A 2GBLA 1VBKA 2BMAA 5FXMA 2JBAB 2NYVA 3M82A 3O38A 3QELB 1ABEA 1VSQA 1E7WA 1PJ3A 1MGOA 1SK8A 4WINA 2E4VA 3V33A 5THQA 1K4YA 2O20A 1MO5A 3PDIB 1ZCZA 1EWTA 4AS3A 5JH7F 1XN1A 1FDSA 2PIAA 3VU8A 5IABA 3DKPA 3LPLA 4J1SA 5SICE 5EVJA 1KZ6A 2JLCA 4DOMA 3DV0A 3TQOA 1QRAA 5H68A 2BI8A 2XVXA 3AR7A 4JHXA 3H1EA 2JATA 4JT2A 4V0KA 3SFTA 1XZKA 1I7LA 1NI4A 2XUOA 2Q5HA 4WBNB 1PTJA 4I50A 4WCFA 5JWOA 2FU5C 2WG1A 3IO3A 3IPLA 2G76A 1E7MA 2HPVA 4MVJG 1FMJA 1TU4A 4HYQA 3U7QA 5IXJA 2E1RA 3ZCQA 1P44A 2FG6C 3COWA 1NIJA 3DD1A 4QAJA 4HWRA 3W9YA 2ZWIA 2RHCA 1JAZA 2Q7DA 4CL2A 1Z35A 1FDUA 4QJ5A 1COWD 1KNQA 3W1WA 3V1NA 2DBQA 1FB5A 4DIKA 2G07A 2IPLA 3CHYA 5KJFA 3A0RB 4ZA2A 2VRWA 4RJ2A 3FPGA 1EIWA 2YHBA 1Y34E 1L4EA 2IF2A 3OFVA 1CNFA 1CQZA 4IUYA 4RVCA 4WFIA 4EG0A 3EXFA 2PH1A 5JSYA 3DLCA 1Q11A 2Q2QA 3R1IA 5A71A 2AKEA 1V9CA 2Z95A 4HP8A 4DQDA 3GJ3A 2QU7A 5J58A 3KZKA 3KPWA 2RBEA 3VO2A 4G1FA 2HA6A 4AP9A 2YN2A 1EVKA 4L3OA 4QBIA 2VYFA 4FS8A 4YCJA 4OK6A 4LK2A 1JAXA 1XX6A 3EEQA 4KX5A 1DKLA 4D4GA 1VE7A 2WWTA 4PTYA 4DJTA 2PMBA 1CR0A 1PV2A 2VRCA 4ZALA 1U0TA 3AFNA 4JENA 2FPUA 3DZFA 4P93A 2PK3A 4QOFA 1XDZA 2VF8A 2JIPA 4S1WA 3SZMA 1W88A 4ZI3A 1AVTA 4FINA 1WE2A 1U3WA 1ZC4A 2FJ0A 1MOSA 4OI0A 5SYNA 2V9ZA 1BXGB 1YULA 2GPYA 3BHJA 4C5AA 1TW2A 4X84A 3UJAA 4JYCA 1IBRA 3KUUA 5AVWA 4C4SA 4RULA 1DOHA 1QKKA 4M8SA 1U2PA 4D1YA 2P9EA 1XRSB 2H2FA 3PJRA 2OO7A 1LNZA 1FFAA 2QZSA 3LUCA 3U26A 4D8VA 5LP1A 1HETA 4DC9A 5AW9A 1WEKA 3IDFA 1QJCA 3QWAA 1E3WB 2H1RA 5FWAA 2G25A 1UDAA 3NNNA 3ZZMA 2FKAA 1NPDA 1I0LA 2I78A 1F2UB 5ICGA 2NQTA 3ZCPA 4UUAA 1NW8A 3QOWA 4FSHA 4YQZA 4W8HA 1KZYC 1EUQA 2CWDA 3L0SA 3WGQA 1S8FA 2WM3A 2H1FA 2P75A 2VSOA 4ZVMA 3I9NA 2VP5A 3LX8A 1LH0A 3DZDA 3QMWA 3ETEA 2L2QA 2B7BA 1RPTA 2Y27A 2P0EA 4OBWA 4YH1A 5JI3E 4U2CA 2VJCA 1SZJG 2XAAA 4LY3A 2CL7X 1AMNA 1XQ9A 4H7JA 5IDXA 4EZIA 3GGGA 2O0KA 3L0ZA 3DHEA 1I4DD 3QMMA 4P3PA 3PNVA 4GPZA 3C5EA 4KAAA 2P1ZA 2QUHA 4TVSA 5IT5A 4XFJA 2YY5A 5IHXA 4KQWA 1LSUA 1RBZA 5FWDA 4N48A 4B4DA 3DFZA 4M21A 1H0HA 1KORA 1T35A 2OD7A 3ONEA 4OQYA 3G0DA 4DARA 2PV0A 3IKMB 1H2YA 3AM3A 3B6ZA 2FZEA 4I9FA 4L57A 3DMGA 4LC1A 5SZIA 4B3FX 1UBMS 3V1TC 1DDIA 3MYYA 3LCCA 1UMBB 4HADA 4TYPA 3G9TA 3STTA 4BV2A 1QK4A 2C78A 5KNCA 3DO5A 4MJ7A 5A5FA 1S7CA 1ML4A 1E3LA 1SOWA 2CDCA 4MLZA 4B2YA 3TW0A 1WD7A 4CQNA 3QEJA 2LKDA 2UDPA 3C74A 3LT0A 3N9IA 1GSOA 2FFJA 3WB2A 3D6NB 2O8FB 1E0AA 2A9KA 3CUTA 2L82A 3JU3A 4L0DA 4Z0HO 3UNXA 3UWSA 2QK4A 3TFWA 3OE1A 1EI9A 2NU7A 3R09A 1TO2E 2BFEA 4M1ZA 4TX1A 2MR5A 3QNUA 1T6ZA 2AXEA 2LR0A 3IA7A 1L5RA 1B3RA 2X5OA 3T1NA 4BWFB 3QKIA 4J0EA 4RLSA 2J1LA 1NGSA 2G9RA 2UVPB 2V8OA 5C1DA 4FT4A 1SRQA 3N2GB 1JVNA 3OJEA 3QEMB 2XRFA 4J91A 3ZV7A 2C3YA 3PHHA 4JXKA 3W4IA 4LFAB 1U7TA 4DMKA 1PG5A 2J9YB 5JEEA 1R0BA 2C2KA 3O8DA 4YQEA 3AUXA 2QRKA 1DXHA 3H2BA 2BZSA 1BVYF 3MS4A 3SIPA 1CYDA 3SS9X 5A4DA 4TN1A 1QHHB 4TS1A 1O87A 3QYJA 1O2DA 1AZWA 5A06A 4WNAA 1Z4QA 2YX1A 3OECA 4Y2YA 5SY4A 2AK3A 5J3JA 1P9NA 1DMRA 1G5RA 1LVGA 3D31A 3LS2A 4FPXA 1G1MA 1FYEA 2VPZA 5I48A 3WIDA 4IFBA 1Q2UA 5DEOA 2ZCUA 2CCJA 3WA7A 2ZSAA 3DP7A 2Q62A 2AL7A 2YUIA 2OHIA 3PRJA 4UE2A 4AJOA 1JRLA 1XCJA 5A3SA 1E1CA 1QNLA 3BE6A 3UAXA 2OAGA 2V7TA 2FSUA 4MWSA 4Q1CA 3T9AA 2PMWB 3HBNA 4GOLD 3V5NA 3ZHVA 3SE7A 1L6RA 1HDZA 3Q1KA 5KB3A 1H3EA 1CF2O 2H52A 2BIFA 4WA7A 1Y9EA 3RNLA 5JSUA 5K3EA 4P38A 4XSGA 3ZWMA 1CTQA 2CXSA 4B3HA 3HKBB 1RE1A 5AXCA 4P82A 2G0NA 1MO2A 5IK2A 3DE3X 3WNCA 4EWLA 3BGOS 3EGEA 2BBWA 4NSNA 1GVNB 1O8BA 4S12A 4P92A 4URYR 3T7DA 4WQMA 1O89A 3AI2A 5HQ3A 2DTEA 3D4OA 1OGJA 2I6UA 4AJ4A 1F8YA 1V26A 1SUEA 1A1SA 2PXAA 5EPUA 3L2OB 4D4JA 2FUKA 2R7KA 1XCOA 2Z56A 3Q9UA 5D84A 4ENWA 5ALDA 5D7NA 1KAOA 3CC8A 3KJQA 5IBCA 1NW4A 2C99A 4UJ5A 1TADA 3BT7A 3HDGA 3JWEA 3LT4A 5GPBA 2QTVA 1B15A 2FEOA 5BYAA 2FRVA 4ZV9A 1OXXK 4LGCA 1J6UA 2ABWA 3WS7A 3WYNA 2A1IA 4IMPA 2O2SA 3B9RA 3SHTA 2WTXA 1XEWY 1GCUA 5GV8A 4MUJA 4YJ2A 1SB8A 1N2CA 4X7MA 4OUDA 4GAEA 3FMFA 1ZVQA 4NONA 4TV8F 3WTBA 2GBGA 1NMSA 3ZDQA 1I3OA 1RQNA 1QO0D 2Q5FA 5CT6A 4C20A 5CX1B 3ZDBA 2E5LB 1WXEA 1YDEA 2QQ0A 4FKBA 4MW9A 1TZBA 4AROA 1AKTA 1GGFA 2ZGVA 3P0FA 5LN1A 2QHXA 3OLQA 2QMEA 2WBLC 1YL5A 3EIHA 3O3CA 1L5QA 3EULA 3NTUA 3N2KA 4MW1A 4CKCA 3W8NA 1S8OA 1I8TA 2XGMA 1U3TA 4L16A 3RJ5A 1R5BA 1VECA 1HOXA 2YYYA 5HZKA 4RTLA 1SXPA 3IUQA 3RJMA 3NFYA 4ETMA 2G1PA 2OGTA 3PLRA 4V0ME 3TSAA 1S9HA 2GRJA 4QVKA 4NR0A 3LY5A 2Y1WA 4FGWA 5B2EA 3CBQA 1GADO 2BCEA 3PPXA 4CETA 4ES6A 1V4BA 4FFLA 1JEEA 1ISSA 2IYRA 3M4YA 4JY7A 4Q82A 4EUEA 1RM3A 1M7HA 4KFCA 1GITA 2O8DA 1AUQA 1OILA 5EEHA 5LZ8A 3PNBA 3IP8A 4P33A 3CQ9A 1EUYA 1TVKA 1HSZA 4RV5A 1JFSA 4KAJA 2ZDHA 1W19A 3JATB 1XEWX 4QBHA 1R7RA 2FDCA 5KYWA 5HIJA 5KQSA 1A77A 2CCKA 3OICA 3ZDZB 4QEZA 3V46A 3EVEA 1USKA 3CIFA 1XOIA 2ZVDA 3HKCB 1U9YA 4HDMB 2WY2D 1HH4A 4R9UC 3KLPX 4PSDA 3SQDA 4RIEA 4YCBA 1IWOA 1C4XA 5D5QA 2PWAA 5FJIA 1VOTA 2HDWA 1XZHA 2DLDA 4IJUA 4ZOLF 2K2QB 3QHAA 1TDJA 5I9BA 1U0GA 5C3MA 2YMMA 4CPDA 3H1AA 2JFXA 2XB2A 5B7PA 3CR3C 3EZXA 5REQB 3LX5A 5T8KA 4EX7A 3TW8A 5HMLA 1M1ZA 2CKDA 2FZKA 2WD7A 1QV7A 1T3HA 2C29D 2WF9A 4MGIR 4Y6QA 1XMPA 4BNDA 1ZIYA 2CNLA 1FQKA 1X9IA 1XTSA 4AURA 1F6BA 2DR2A 1SVMA 2Q7XA 4ED9A 2GOYA 1T8WA 1J8DA 2YMQA 4DV6B 1WXFA 1MT3A 2G06A 4FYXA 1Y98A 3QHPA 1TKAA 4WOPA 4WSOA 5FWYB 2GLUA 3W90A 3BEDA 5E9QA 2X4DA 5CLFA 2C98A 5BSFA 4AY4A 5LDDC 4R1PA 4TYYA 1QZ3A 1E1RD 5IM4A 2ZUCA 3N2NA 4YRRA 3KWMA 3A1SA 1TYEB 3HC7A 3LMKA 3OHSX 4PLGA 3TL3A 2WB2A 1WTAA 1YBVA 2QTZA 1CDOA 1Y9AA 2HNBA 3BRSA 3CLSD 5ITWA 4G86A 1NI3A 2C2XA 2DUNA 4IIFA 3THOA 1PD1A 2HQ1A 3VNRA 5EINA 3ZHZA 1U0BB 3V4SA 4A15A 4HNQA 4RF5A 3TB4A 2CZCA 2C20A 2OXFA<