3I6CA

Structure-based design of novel pin1 inhibitors (ii)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
113
structure length
113
Chain Sequence
EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of novel human Pin1 inhibitors (II).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 42
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3i6cA00
3O5OA 4DZ2A 1EQ3A 4DRNA 5I98A 2VN1A 1D7HA 2RUDA 4ODPA 4QIBA 2DG4A 5B8IC 4JFLA 3H9RB 1Q6UA 4IQCA 3O5PA 1FD9A 3O5RA 4U85A 2Q5AA 4G50A 1D7IA 4ODLA 3O5DA 4JFJA 2IF4A 2OFNA 4J4OA 5BXJA 1FKIA 3JYJA 4W9QA 1FKTA 2XP8A 3IKDA 4ODRA 4DRHA 1FJDA 1B6CA 3PA7A 1R9HA 4R0XA 2K8IA 4DRKA 3KADA 1L1PA 2KO7A 3KACA 1D6OA 2M08A 2RSEA 3OOBA 1N1AA 3JXVA 4ODMA 4TYOA 5HWBA 1Q6HA 4LAYA 4W9OA 2PPOA 3PRBA 1TCOC 3UQAA 3JYMA 5D75A 3UI5A 4DT4A 4DRPA 3ODKA 1Q1CA 4JFIA 3RGCA 5HW8A 3O5KA 2KGJA 3KZ7A 3TDBA 1FKKA 1FKGA 2DG9A 4IPXA 1NMVA 4DROA 1ZCNA 3I6CA 5HUAA 1FKBA 2RUCA 1EYMA 1HXVA 3KCEA 2XP7A 5J6EA 3UQBA 1YATA 1FKRA 2LGOA 4DIPA 4IQ2A 5DITA 4BF8A 3TC5A 1J4HA 3NI6A 3IHZA 1ZK6A 4U86A 3O5EA 2MF9A 3NRKA 2MNTA 4LAXA 4JFMA 1FKHA 5HKGA 3UQIA 1F8AB 3B7XA 4FAPA 2MLXA 1FKSA 2RUQA 3O5FA 4TX0A 3IK8A 4MSPA 1F40A 4FN2A 2XP9A 4DRJA 1FAPA 2F21A 2XP4A 4NNRA 3LUOA 1A7XA 2RURA 3RFWA 1P5QA 4DRIA 1KT1A 2AWGA 2M1IA 3GPKA 2M2AA 4C02B 2ZQSA 2ITKA 3MDYB 4TW8A 4TNSA 2XP6A 4ITZA 2MPHA 3O5JA 5HW6A 4ODNA 2F2DA 2KI3A 2L2SA 1Q6IA 3EY6A 1JVWA 2PPNA 3CGMA 4QT2A 3KAHA 5GPGA 4N19A 1Y0OA 1NMWA 2XP3A 4GGQA 4TW7A 2RQSA 2XPBA 4JYSA 4LAVA 5HT1A 5HTGA 1JNSA 2PBCA 3O5MA 4W9PA 2KE0A 2MLZA 1C9HA 2ZR4A 4JFKA 2ZQTA 1ROTA 2LKNA 4ODOA 2FAPA 3UI6A 1M5YA 2F4EA 2D9FA 4MGVA 3O5IA 3PRDA 2ZQVA 2KFWA 3O5LA 3UI4A 3TCZA 2PPPA 1KT0A 2XP5A 2ZR5A 4ODKA 1BL4A 3VAWA 4DRQA 1QPLA 5HWCA 1PINA 1YW5A 2JZVA 5HW7A 1NSGA 1D7JA 2LPVA 4U84A 2PV2A 1QZ2A 2N87A 2VCDA 5DIUA 1FKFA 5DIVA 3UF8A 1U79A 3WH0A 2PV3A 2PV1A 3O5QA 2KR7A 3KABA 1FKLA 1J6YA 3KAIA 1FKJA 1PBKA 3FAPA 1QPFA 2DG3A 4DZ3A 4G2PA 4TW6A 2FKEA 3KAGA 1W26A 2Y78A 3CGNA 2LJ4A 1FKDA 4ODQA 4LAWA 1JNTA 1T11A 3KAFA 1J4IA 4J4NA 1ROUA 3O5GA 2MLYA 3IKGA 1BKFA 2UZ5A 4DH0A 4QT3A 4GIVA 4DRMA 4O2TA 2XPAA 2ZR6A 1J4RA 3NTPA 2ZQUA
chains in the Genus database with same CATH superfamily
4Q7NA 5I98A 3WD3A 3ARYA 1OWQA 3H9RB 1Q6UA 4MTVA 4DWSB 1JNEA 2DT2A 2OFNA 3BMBA 3JYJA 4W9QA 4ODRA 1R9HA 3ARZA 4R0XA 2K8IA 3KADA 1L1PA 1D6OA 4ODMA 1LG1A 3RM8A 4LAYA 2A3CA 3PRBA 1TCOC 2FDMA 4DT4A 4JFIA 1HKKA 4WK9A 3GTYX 3KZ7A 1FKKA 4IPXA 4MNLA 1E6ZA 3QOKA 5HUAA 1GOIA 1EYMA 1VF8A 3CHFA 3KCEA 5J6EA 1W1VA 2LGOA 4IQ2A 4XAKA 1W9PA 1LG2A 1HJWA 2MNTA 4LAXA 4WKFA 4FAPA 3CHEA 4ZPTR 2IUZA 4TX0A 1JNDA 1ZBVA 4W5UA 4FN2A 1FFRA 3RFWA 2M1IA 4C02B 2WK2A 2ZQSA 2ITKA 1EHNA 4ITZA 3G6LA 2MPHA 5HW6A 4ODNA 1Q6IA 3CGMA 2O9OA 3ARUA 1Y0OA 4N19A 4S3JA 2XP3A 5HTGA 4LAVA 4W9PA 2ZR4A 4P8WA 4HBEA 1JCHB 3PRDA 3O5LA 3TCZA 4WKAA 3FXYA 4DRQA 1BL4A 1QPLA 2QF8A 4U84A 1QZ2A 2ETNA 2PV3A 3CHDA 3KABA 1FKLA 3FAPA 3ARRA 4NSBA 2FKEA 3W4RA 3KAGA 4HARA 3CGNA 4O2TA 1WAWA 4MNJA 3O5GA 1ZU8A 4QT3A 4DWSC 1HKIA 1HKJA 4DZ2A 2ZQUA 1E9LA 2DT1A 2A3AA 4HBOA 3WL0A 1EQ3A 2RUDA 1FD9A 3O5RA 4U85A 3ARTA 1D7IA 4ODLA 3O5DA 1WNOA 1LL4A 5BXJA 1FKIA 5HBFA 1FKTA 2XP8A 3IKDA 4DRHA 1FJDA 1B6CA 3PA7A 4UDMA 4LGXA 1NH6A 1W9VA 1ZB5A 4DRKA 4Z2HA 5DF0A 2WLZA 3JXVA 5HWBA 4S3KA 4DRPA 3AS2A 5HW8A 3O5KA 1H0GA 2KGJA 1ITXA 4MAVA 1X6LA 1FKBA 3EIPA 1GUVA 3RMEA 1UR8A 3CH9A 4DIPA 1GRJA 4BF8A 4Z2IA 1J4HA 2P4VA 3NI6A 1ZBCA 1ZK6A 4R5EA 3O5EA 1LQ0A 2EULA 5DO2A 3UQIA 3B7XA 3AS0A 3RM9A 2MLXA 2DPEA 2RUQA 4DRJA 2F21A 3LUOA 5GPRA 4QZVB 1P5QA 4DRIA 1KT1A 2M2AA 2G8ZA 3MDYB 4TNSA 1TFVA 3O5JA 1E6RA 3EY6A 2PPNA 4QT2A 4GGQA 2DSWA 4JYSA 2PBCA 2A3BA 3RM4A 3WD1A 2MLZA 1C9HA 2WLYA 4JFKA 2ZQTA 2LKNA 4ODOA 1EIBA 2FAPA 3UI6A 2F4EA 2O92A 3O5IA 2PPPA 2XP5A 5HWCA 1YW5A 1GPFA 1IX5A 1NSGA 2PV2A 5DIUA 1U79A 2DSUA 1UR9A 3ARSA 2KR7A 3OA5A 1J6YA 1FKJA 5JH8A 2AOSA 4KQZA 3WL1A 1NWUA 2Y78A 2LJ4A 3GU0A 3AS1A 1ROUA 4Z2LA 3WD2A 1W9UA 1FFQA 4GIVA 4DRMA 1D2KA 4U86A 4NZCA 1KFWA 2PI6A 3O5OA 4IT4A 1D7HA 2DG4A 3BXWA 4JFLA 4IQCA 3O5PA 2DT3A 2Q5AA 4G50A 1WB0A 2IF4A 4J4OA 3G6MA 3B9DA 4ML4A 3KACA 4Z2KA 3ARWA 1XHGA 1N1AA 3OOBA 4KR0B 2PPOA 4W9OA 2OLHA 3ODKA 3RGCA 1LL6A 1FKGA 1NWRA 2DG9A 1NMVA 4DROA 1ZCNA 2F23A 2RUCA 1HXVA 3ALFA 1YATA 3ALGA 3AS3A 5DITA 3ARQA 3WKZA 3TC5A 2B5UB 4P8UA 2DT0A 3NRKA 5HKGA 1FKSA 4MSPA 1F40A 2XP9A 4NNRA 4ZS6A 1A7XA 2RURA 3GPKA 1LL7A 1CTNA 5DEZA 2XP6A 2PN0A 3PR9A 2F2DA 2KI3A 1HJVA 3KAHA 1W1TA 1NMWA 4TW7A 1E44A 5GQBA 1M5YA 4MGVA 2ZQVA 2KFWA 3UI4A 1KT0A 2A3EA 4ODKA 4MNKA 2JZVA 1E6PA 4ZPWR 3B9AA 2G41A 3WH0A 4IT6A 3AQUA 2DG3A 4DZ3A 4G2PA 1W1PA 4TW6A 1ZBKA 4LAWA 1JNTA 4J4NA 2MLYA 3B8SA 3IKGA 1BKFA 2UZ5A 4DH0A 3WD0A 2XPAA 2ZR6A 1LJYA 1J4RA 3I6CA 4DRNA 1EDQA 2VN1A 4ODPA 4QIBA 5B8IC 3ARVA 4L72B 1OGBA 4MPKA 4P8VA 1SR0A 4JFJA 3WQVA 3AROA 1ZBWA 3WD4A 2KO7A 1ZL1A 2M08A 1W1YA 3CZ8A 2RSEA 2ESCA 4TYOA 1NWTA 1Q6HA 3UQAA 4Z2GA 1RD6A 3JYMA 3ARXA 5D75A 3UI5A 1Q1CA 4WIWA 4P8XA 3TDBA 1HKMA 4Q22A 3WQWA 2XP7A 3UQBA 4DWSA 1FKRA 4Z2JA 4DWSD 4ZPVR 1O6IA 2YBTA 3IHZA 2MF9A 2YBUA 4JFMA 1FKHA 3FY1A 2WM0A 1F8AB 3B9EA 1NWSA 1X6NA 1OGGA 3O5FA 3IK8A 1FAPA 2XP4A 4PTMA 2AWGA 1SYTA 1H0IA 4URIA 4TW8A 4L3NA 2L2SA 1JVWA 3WIJA 5GPGA 2RQSA 2XPBA 5HT1A 4AY1A 1JNSA 3O5MA 2KE0A 2DSVA 1ROTA 2D9FA 4MNMA 1E15A 1XRVA 2ZR5A 3VAWA 3ARPA 1PINA 5HW7A 1D7JA 2LPVA 2N87A 2VCDA 1K9TA 1FKFA 5DIVA 3UF8A 3CHCA 2B31A 1HJXA 2PV1A 4WKHA 3O5QA 4WJXA 3KAIA 1PBKA 1QPFA 2DSZA 1W26A 1FKDA 4ODQA 1T11A 3KAFA 1J4IA 3PRAA 1E6NA 3NTPA
chains in the Genus database with same CATH topology
4Q7NA 5I98A 3WD3A 3ARYA 1OWQA 3H9RB 1Q6UA 4MTVA 4DWSB 1JNEA 2DT2A 2OFNA 3JYJA 4W9QA 4ODRA 1R9HA 3ARZA 4R0XA 2K8IA 3KADA 1L1PA 1D6OA 4ODMA 1LG1A 3RM8A 4LAYA 2A3CA 3PRBA 1TCOC 2FDMA 4DT4A 4JFIA 1HKKA 4WK9A 3KZ7A 1FKKA 4IPXA 4MNLA 1E6ZA 3QOKA 5HUAA 1GOIA 1EYMA 1VF8A 3CHFA 3KCEA 5J6EA 1W1VA 2LGOA 4IQ2A 4XAKA 1W9PA 1LG2A 1HJWA 2MNTA 4LAXA 4WKFA 4FAPA 3CHEA 4ZPTR 2IUZA 4TX0A 1JNDA 1ZBVA 4W5UA 4FN2A 1FFRA 3RFWA 2M1IA 4C02B 2WK2A 2ZQSA 2ITKA 1EHNA 4ITZA 3G6LA 2MPHA 5HW6A 4ODNA 1Q6IA 3CGMA 2O9OA 3ARUA 1Y0OA 4N19A 4S3JA 2XP3A 5HTGA 4LAVA 4W9PA 2ZR4A 4P8WA 4HBEA 3PRDA 3O5LA 3TCZA 4WKAA 3FXYA 4DRQA 1BL4A 1QPLA 2QF8A 4U84A 1QZ2A 2PV3A 3CHDA 3KABA 1FKLA 3FAPA 3ARRA 4NSBA 2FKEA 3W4RA 3KAGA 4HARA 3CGNA 4O2TA 1WAWA 4MNJA 3O5GA 1ZU8A 4QT3A 4DWSC 1HKIA 1HKJA 4DZ2A 2ZQUA 1E9LA 2DT1A 2A3AA 4HBOA 3WL0A 1EQ3A 2RUDA 1FD9A 3O5RA 4U85A 3ARTA 1D7IA 4ODLA 3O5DA 1WNOA 1LL4A 5BXJA 1FKIA 5HBFA 1FKTA 2XP8A 3IKDA 4DRHA 1FJDA 1B6CA 3PA7A 4LGXA 1NH6A 1W9VA 1ZB5A 4DRKA 4Z2HA 5DF0A 2WLZA 3JXVA 5HWBA 4S3KA 4DRPA 3AS2A 5HW8A 3O5KA 1H0GA 2KGJA 1ITXA 4MAVA 1X6LA 1FKBA 1GUVA 3RMEA 1UR8A 3CH9A 4DIPA 4BF8A 4Z2IA 1J4HA 3NI6A 1ZBCA 1ZK6A 4R5EA 3O5EA 1LQ0A 5DO2A 3UQIA 3B7XA 3AS0A 3RM9A 2MLXA 2DPEA 2RUQA 4DRJA 2F21A 3LUOA 5GPRA 4QZVB 1P5QA 4DRIA 1KT1A 2M2AA 2G8ZA 3MDYB 4TNSA 1TFVA 3O5JA 1E6RA 3EY6A 2PPNA 4QT2A 4GGQA 2DSWA 4JYSA 2PBCA 2A3BA 3RM4A 3WD1A 2MLZA 1C9HA 2WLYA 4JFKA 2ZQTA 2LKNA 4ODOA 1EIBA 2FAPA 3UI6A 2F4EA 2O92A 3O5IA 2PPPA 2XP5A 5HWCA 1YW5A 1GPFA 1IX5A 1NSGA 2PV2A 5DIUA 1U79A 2DSUA 1UR9A 3ARSA 2KR7A 3OA5A 1J6YA 1FKJA 5JH8A 2AOSA 4KQZA 3WL1A 1NWUA 2Y78A 2LJ4A 3AS1A 1ROUA 4Z2LA 3WD2A 1W9UA 1FFQA 4GIVA 4DRMA 1D2KA 4U86A 4NZCA 1KFWA 2PI6A 3O5OA 4IT4A 1D7HA 2DG4A 3BXWA 4JFLA 4IQCA 3O5PA 2DT3A 2Q5AA 4G50A 1WB0A 2IF4A 4J4OA 3G6MA 3B9DA 4ML4A 3KACA 4Z2KA 3ARWA 1XHGA 1N1AA 3OOBA 4KR0B 2PPOA 4W9OA 2OLHA 3ODKA 3RGCA 1LL6A 1FKGA 1NWRA 2DG9A 1NMVA 4DROA 1ZCNA 2RUCA 1HXVA 3ALFA 1YATA 3ALGA 3AS3A 5DITA 3ARQA 3WKZA 3TC5A 4P8UA 2DT0A 3NRKA 5HKGA 1FKSA 4MSPA 1F40A 2XP9A 4NNRA 4ZS6A 1A7XA 2RURA 3GPKA 1LL7A 1CTNA 5DEZA 2XP6A 3PR9A 2F2DA 2KI3A 1HJVA 3KAHA 1W1TA 1NMWA 4TW7A 5GQBA 1M5YA 4MGVA 2ZQVA 2KFWA 3UI4A 1KT0A 2A3EA 4ODKA 4MNKA 2JZVA 1E6PA 4ZPWR 3B9AA 2G41A 3WH0A 4IT6A 3AQUA 2DG3A 4DZ3A 4G2PA 1W1PA 4TW6A 1ZBKA 4LAWA 1JNTA 4J4NA 2MLYA 3B8SA 3IKGA 1BKFA 2UZ5A 4DH0A 3WD0A 2XPAA 2ZR6A 1LJYA 1J4RA 3I6CA 4DRNA 1EDQA 2VN1A 4ODPA 4QIBA 5B8IC 3ARVA 4L72B 1OGBA 4MPKA 4P8VA 1SR0A 4JFJA 3WQVA 3AROA 1ZBWA 3WD4A 2KO7A 1ZL1A 2M08A 1W1YA 3CZ8A 2RSEA 2ESCA 4TYOA 1NWTA 1Q6HA 3UQAA 4Z2GA 1RD6A 3JYMA 3ARXA 5D75A 3UI5A 1Q1CA 4WIWA 4P8XA 3TDBA 1HKMA 4Q22A 3WQWA 2XP7A 3UQBA 4DWSA 1FKRA 4Z2JA 4DWSD 4ZPVR 1O6IA 2YBTA 3IHZA 2MF9A 2YBUA 4JFMA 1FKHA 3FY1A 2WM0A 1F8AB 3B9EA 1NWSA 1X6NA 1OGGA 3O5FA 3IK8A 1FAPA 2XP4A 4PTMA 2AWGA 1SYTA 1H0IA 4URIA 4TW8A 4L3NA 2L2SA 1JVWA 3WIJA 5GPGA 2RQSA 2XPBA 5HT1A 4AY1A 1JNSA 3O5MA 2KE0A 2DSVA 1ROTA 2D9FA 4MNMA 1E15A 1XRVA 2ZR5A 3VAWA 3ARPA 1PINA 5HW7A 1D7JA 2LPVA 2N87A 2VCDA 1K9TA 1FKFA 5DIVA 3UF8A 3CHCA 2B31A 1HJXA 2PV1A 4WKHA 3O5QA 4WJXA 3KAIA 1PBKA 1QPFA 2DSZA 1W26A 1FKDA 4ODQA 1T11A 3KAFA 1J4IA 3PRAA 1E6NA 3NTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5O A;  4DZ2 A;  1EQ3 A;  4DRN A;  5I98 A;  2VN1 A;  1D7H A;  2RUD A;  4ODP A;  4QIB A;  2DG4 A;  5B8I C;  4JFL A;  3H9R B;  1Q6U A;  4IQC A;  3O5P A;  1FD9 A;  3O5R A;  4U85 A;  2Q5A A;  4G50 A;  1D7I A;  4ODL A;  3O5D A;  4JFJ A;  2IF4 A;  2OFN A;  4J4O A;  5BXJ A;  1FKI A;  3JYJ A;  4W9Q A;  1FKT A;  2XP8 A;  3IKD A;  4ODR A;  4DRH A;  1FJD A;  1B6C A;  3PA7 A;  1R9H A;  4R0X A;  2K8I A;  4DRK A;  3KAD A;  1L1P A;  2KO7 A;  3KAC A;  1D6O A;  2M08 A;  2RSE A;  3OOB A;  1N1A A;  3JXV A;  4ODM A;  4TYO A;  5HWB A;  1Q6H A;  4LAY A;  4W9O A;  2PPO A;  3PRB A;  1TCO C;  3UQA A;  3JYM A;  5D75 A;  3UI5 A;  4DT4 A;  4DRP A;  3ODK A;  1Q1C A;  4JFI A;  3RGC A;  5HW8 A;  3O5K A;  2KGJ A;  3KZ7 A;  3TDB A;  1FKK A;  1FKG A;  2DG9 A;  4IPX A;  1NMV A;  4DRO A;  1ZCN A;  3I6C A;  5HUA A;  1FKB A;  2RUC A;  1EYM A;  1HXV A;  3KCE A;  2XP7 A;  5J6E A;  3UQB A;  1YAT A;  1FKR A;  2LGO A;  4DIP A;  4IQ2 A;  5DIT A;  4BF8 A;  3TC5 A;  1J4H A;  3NI6 A;  3IHZ A;  1ZK6 A;  4U86 A;  3O5E A;  2MF9 A;  3NRK A;  2MNT A;  4LAX A;  4JFM A;  1FKH A;  5HKG A;  3UQI A;  1F8A B;  3B7X A;  4FAP A;  2MLX A;  1FKS A;  2RUQ A;  3O5F A;  4TX0 A;  3IK8 A;  4MSP A;  1F40 A;  4FN2 A;  2XP9 A;  4DRJ A;  1FAP A;  2F21 A;  2XP4 A;  4NNR A;  3LUO A;  1A7X A;  2RUR A;  3RFW A;  1P5Q A;  4DRI A;  1KT1 A;  2AWG A;  2M1I A;  3GPK A;  2M2A A;  4C02 B;  2ZQS A;  2ITK A;  3MDY B;  4TW8 A;  4TNS A;  2XP6 A;  4ITZ A;  2MPH A;  3O5J A;  5HW6 A;  4ODN A;  2F2D A;  2KI3 A;  2L2S A;  1Q6I A;  3EY6 A;  1JVW A;  2PPN A;  3CGM A;  4QT2 A;  3KAH A;  5GPG A;  4N19 A;  1Y0O A;  1NMW A;  2XP3 A;  4GGQ A;  4TW7 A;  2RQS A;  2XPB A;  4JYS A;  4LAV A;  5HT1 A;  5HTG A;  1JNS A;  2PBC A;  3O5M A;  4W9P A;  2KE0 A;  2MLZ A;  1C9H A;  2ZR4 A;  4JFK A;  2ZQT A;  1ROT A;  2LKN A;  4ODO A;  2FAP A;  3UI6 A;  1M5Y A;  2F4E A;  2D9F A;  4MGV A;  3O5I A;  3PRD A;  2ZQV A;  2KFW A;  3O5L A;  3UI4 A;  3TCZ A;  2PPP A;  1KT0 A;  2XP5 A;  2ZR5 A;  4ODK A;  1BL4 A;  3VAW A;  4DRQ A;  1QPL A;  5HWC A;  1PIN A;  1YW5 A;  2JZV A;  5HW7 A;  1NSG A;  1D7J A;  2LPV A;  4U84 A;  2PV2 A;  1QZ2 A;  2N87 A;  2VCD A;  5DIU A;  1FKF A;  5DIV A;  3UF8 A;  1U79 A;  3WH0 A;  2PV3 A;  2PV1 A;  3O5Q A;  2KR7 A;  3KAB A;  1FKL A;  1J6Y A;  3KAI A;  1FKJ A;  1PBK A;  3FAP A;  1QPF A;  2DG3 A;  4DZ3 A;  4G2P A;  4TW6 A;  2FKE A;  3KAG A;  1W26 A;  2Y78 A;  3CGN A;  2LJ4 A;  1FKD A;  4ODQ A;  4LAW A;  1JNT A;  1T11 A;  3KAF A;  1J4I A;  4J4N A;  1ROU A;  3O5G A;  2MLY A;  3IKG A;  1BKF A;  2UZ5 A;  4DH0 A;  4QT3 A;  4GIV A;  4DRM A;  4O2T A;  2XPA A;  2ZR6 A;  1J4R A;  3NTP A;  2ZQU A; 
#chains in the Genus database with same CATH topology
 4Q7N A;  5I98 A;  3WD3 A;  3ARY A;  1OWQ A;  3H9R B;  1Q6U A;  4MTV A;  4DWS B;  1JNE A;  2DT2 A;  2OFN A;  3BMB A;  3JYJ A;  4W9Q A;  4ODR A;  1R9H A;  3ARZ A;  4R0X A;  2K8I A;  3KAD A;  1L1P A;  1D6O A;  4ODM A;  1LG1 A;  3RM8 A;  4LAY A;  2A3C A;  3PRB A;  1TCO C;  2FDM A;  4DT4 A;  4JFI A;  1HKK A;  4WK9 A;  3GTY X;  3KZ7 A;  1FKK A;  4IPX A;  4MNL A;  1E6Z A;  3QOK A;  5HUA A;  1GOI A;  1EYM A;  1VF8 A;  3CHF A;  3KCE A;  5J6E A;  1W1V A;  2LGO A;  4IQ2 A;  4XAK A;  1W9P A;  1LG2 A;  1HJW A;  2MNT A;  4LAX A;  4WKF A;  4FAP A;  3CHE A;  4ZPT R;  2IUZ A;  4TX0 A;  1JND A;  1ZBV A;  4W5U A;  4FN2 A;  1FFR A;  3RFW A;  2M1I A;  4C02 B;  2WK2 A;  2ZQS A;  2ITK A;  1EHN A;  4ITZ A;  3G6L A;  2MPH A;  5HW6 A;  4ODN A;  1Q6I A;  3CGM A;  2O9O A;  3ARU A;  1Y0O A;  4N19 A;  4S3J A;  2XP3 A;  5HTG A;  4LAV A;  4W9P A;  2ZR4 A;  4P8W A;  4HBE A;  1JCH B;  3PRD A;  3O5L A;  3TCZ A;  4WKA A;  3FXY A;  4DRQ A;  1BL4 A;  1QPL A;  2QF8 A;  4U84 A;  1QZ2 A;  2ETN A;  2PV3 A;  3CHD A;  3KAB A;  1FKL A;  3FAP A;  3ARR A;  4NSB A;  2FKE A;  3W4R A;  3KAG A;  4HAR A;  3CGN A;  4O2T A;  1WAW A;  4MNJ A;  3O5G A;  1ZU8 A;  4QT3 A;  4DWS C;  1HKI A;  1HKJ A;  4DZ2 A;  2ZQU A;  1E9L A;  2DT1 A;  2A3A A;  4HBO A;  3WL0 A;  1EQ3 A;  2RUD A;  1FD9 A;  3O5R A;  4U85 A;  3ART A;  1D7I A;  4ODL A;  3O5D A;  1WNO A;  1LL4 A;  5BXJ A;  1FKI A;  5HBF A;  1FKT A;  2XP8 A;  3IKD A;  4DRH A;  1FJD A;  1B6C A;  3PA7 A;  4UDM A;  4LGX A;  1NH6 A;  1W9V A;  1ZB5 A;  4DRK A;  4Z2H A;  5DF0 A;  2WLZ A;  3JXV A;  5HWB A;  4S3K A;  4DRP A;  3AS2 A;  5HW8 A;  3O5K A;  1H0G A;  2KGJ A;  1ITX A;  4MAV A;  1X6L A;  1FKB A;  3EIP A;  1GUV A;  3RME A;  1UR8 A;  3CH9 A;  4DIP A;  1GRJ A;  4BF8 A;  4Z2I A;  1J4H A;  2P4V A;  3NI6 A;  1ZBC A;  1ZK6 A;  4R5E A;  3O5E A;  1LQ0 A;  2EUL A;  5DO2 A;  3UQI A;  3B7X A;  3AS0 A;  3RM9 A;  2MLX A;  2DPE A;  2RUQ A;  4DRJ A;  2F21 A;  3LUO A;  5GPR A;  4QZV B;  1P5Q A;  4DRI A;  1KT1 A;  2M2A A;  2G8Z A;  3MDY B;  4TNS A;  1TFV A;  3O5J A;  1E6R A;  3EY6 A;  2PPN A;  4QT2 A;  4GGQ A;  2DSW A;  4JYS A;  2PBC A;  2A3B A;  3RM4 A;  3WD1 A;  2MLZ A;  1C9H A;  2WLY A;  4JFK A;  2ZQT A;  2LKN A;  4ODO A;  1EIB A;  2FAP A;  3UI6 A;  2F4E A;  2O92 A;  3O5I A;  2PPP A;  2XP5 A;  5HWC A;  1YW5 A;  1GPF A;  1IX5 A;  1NSG A;  2PV2 A;  5DIU A;  1U79 A;  2DSU A;  1UR9 A;  3ARS A;  2KR7 A;  3OA5 A;  1J6Y A;  1FKJ A;  5JH8 A;  2AOS A;  4KQZ A;  3WL1 A;  1NWU A;  2Y78 A;  2LJ4 A;  3GU0 A;  3AS1 A;  1ROU A;  4Z2L A;  3WD2 A;  1W9U A;  1FFQ A;  4GIV A;  4DRM A;  1D2K A;  4U86 A;  4NZC A;  1KFW A;  2PI6 A;  3O5O A;  4IT4 A;  1D7H A;  2DG4 A;  3BXW A;  4JFL A;  4IQC A;  3O5P A;  2DT3 A;  2Q5A A;  4G50 A;  1WB0 A;  2IF4 A;  4J4O A;  3G6M A;  3B9D A;  4ML4 A;  3KAC A;  4Z2K A;  3ARW A;  1XHG A;  1N1A A;  3OOB A;  4KR0 B;  2PPO A;  4W9O A;  2OLH A;  3ODK A;  3RGC A;  1LL6 A;  1FKG A;  1NWR A;  2DG9 A;  1NMV A;  4DRO A;  1ZCN A;  2F23 A;  2RUC A;  1HXV A;  3ALF A;  1YAT A;  3ALG A;  3AS3 A;  5DIT A;  3ARQ A;  3WKZ A;  3TC5 A;  2B5U B;  4P8U A;  2DT0 A;  3NRK A;  5HKG A;  1FKS A;  4MSP A;  1F40 A;  2XP9 A;  4NNR A;  4ZS6 A;  1A7X A;  2RUR A;  3GPK A;  1LL7 A;  1CTN A;  5DEZ A;  2XP6 A;  2PN0 A;  3PR9 A;  2F2D A;  2KI3 A;  1HJV A;  3KAH A;  1W1T A;  1NMW A;  4TW7 A;  1E44 A;  5GQB A;  1M5Y A;  4MGV A;  2ZQV A;  2KFW A;  3UI4 A;  1KT0 A;  2A3E A;  4ODK A;  4MNK A;  2JZV A;  1E6P A;  4ZPW R;  3B9A A;  2G41 A;  3WH0 A;  4IT6 A;  3AQU A;  2DG3 A;  4DZ3 A;  4G2P A;  1W1P A;  4TW6 A;  1ZBK A;  4LAW A;  1JNT A;  4J4N A;  2MLY A;  3B8S A;  3IKG A;  1BKF A;  2UZ5 A;  4DH0 A;  3WD0 A;  2XPA A;  2ZR6 A;  1LJY A;  1J4R A;  3I6C A;  4DRN A;  1EDQ A;  2VN1 A;  4ODP A;  4QIB A;  5B8I C;  3ARV A;  4L72 B;  1OGB A;  4MPK A;  4P8V A;  1SR0 A;  4JFJ A;  3WQV A;  3ARO A;  1ZBW A;  3WD4 A;  2KO7 A;  1ZL1 A;  2M08 A;  1W1Y A;  3CZ8 A;  2RSE A;  2ESC A;  4TYO A;  1NWT A;  1Q6H A;  3UQA A;  4Z2G A;  1RD6 A;  3JYM A;  3ARX A;  5D75 A;  3UI5 A;  1Q1C A;  4WIW A;  4P8X A;  3TDB A;  1HKM A;  4Q22 A;  3WQW A;  2XP7 A;  3UQB A;  4DWS A;  1FKR A;  4Z2J A;  4DWS D;  4ZPV R;  1O6I A;  2YBT A;  3IHZ A;  2MF9 A;  2YBU A;  4JFM A;  1FKH A;  3FY1 A;  2WM0 A;  1F8A B;  3B9E A;  1NWS A;  1X6N A;  1OGG A;  3O5F A;  3IK8 A;  1FAP A;  2XP4 A;  4PTM A;  2AWG A;  1SYT A;  1H0I A;  4URI A;  4TW8 A;  4L3N A;  2L2S A;  1JVW A;  3WIJ A;  5GPG A;  2RQS A;  2XPB A;  5HT1 A;  4AY1 A;  1JNS A;  3O5M A;  2KE0 A;  2DSV A;  1ROT A;  2D9F A;  4MNM A;  1E15 A;  1XRV A;  2ZR5 A;  3VAW A;  3ARP A;  1PIN A;  5HW7 A;  1D7J A;  2LPV A;  2N87 A;  2VCD A;  1K9T A;  1FKF A;  5DIV A;  3UF8 A;  3CHC A;  2B31 A;  1HJX A;  2PV1 A;  4WKH A;  3O5Q A;  4WJX A;  3KAI A;  1PBK A;  1QPF A;  2DSZ A;  1W26 A;  1FKD A;  4ODQ A;  1T11 A;  3KAF A;  1J4I A;  3PRA A;  1E6N A;  3NTP A; 
#chains in the Genus database with same CATH homology
 4Q7N A;  5I98 A;  3WD3 A;  3ARY A;  1OWQ A;  3H9R B;  1Q6U A;  4MTV A;  4DWS B;  1JNE A;  2DT2 A;  2OFN A;  3JYJ A;  4W9Q A;  4ODR A;  1R9H A;  3ARZ A;  4R0X A;  2K8I A;  3KAD A;  1L1P A;  1D6O A;  4ODM A;  1LG1 A;  3RM8 A;  4LAY A;  2A3C A;  3PRB A;  1TCO C;  2FDM A;  4DT4 A;  4JFI A;  1HKK A;  4WK9 A;  3KZ7 A;  1FKK A;  4IPX A;  4MNL A;  1E6Z A;  3QOK A;  5HUA A;  1GOI A;  1EYM A;  1VF8 A;  3CHF A;  3KCE A;  5J6E A;  1W1V A;  2LGO A;  4IQ2 A;  4XAK A;  1W9P A;  1LG2 A;  1HJW A;  2MNT A;  4LAX A;  4WKF A;  4FAP A;  3CHE A;  4ZPT R;  2IUZ A;  4TX0 A;  1JND A;  1ZBV A;  4W5U A;  4FN2 A;  1FFR A;  3RFW A;  2M1I A;  4C02 B;  2WK2 A;  2ZQS A;  2ITK A;  1EHN A;  4ITZ A;  3G6L A;  2MPH A;  5HW6 A;  4ODN A;  1Q6I A;  3CGM A;  2O9O A;  3ARU A;  1Y0O A;  4N19 A;  4S3J A;  2XP3 A;  5HTG A;  4LAV A;  4W9P A;  2ZR4 A;  4P8W A;  4HBE A;  3PRD A;  3O5L A;  3TCZ A;  4WKA A;  3FXY A;  4DRQ A;  1BL4 A;  1QPL A;  2QF8 A;  4U84 A;  1QZ2 A;  2PV3 A;  3CHD A;  3KAB A;  1FKL A;  3FAP A;  3ARR A;  4NSB A;  2FKE A;  3W4R A;  3KAG A;  4HAR A;  3CGN A;  4O2T A;  1WAW A;  4MNJ A;  3O5G A;  1ZU8 A;  4QT3 A;  4DWS C;  1HKI A;  1HKJ A;  4DZ2 A;  2ZQU A;  1E9L A;  2DT1 A;  2A3A A;  4HBO A;  3WL0 A;  1EQ3 A;  2RUD A;  1FD9 A;  3O5R A;  4U85 A;  3ART A;  1D7I A;  4ODL A;  3O5D A;  1WNO A;  1LL4 A;  5BXJ A;  1FKI A;  5HBF A;  1FKT A;  2XP8 A;  3IKD A;  4DRH A;  1FJD A;  1B6C A;  3PA7 A;  4LGX A;  1NH6 A;  1W9V A;  1ZB5 A;  4DRK A;  4Z2H A;  5DF0 A;  2WLZ A;  3JXV A;  5HWB A;  4S3K A;  4DRP A;  3AS2 A;  5HW8 A;  3O5K A;  1H0G A;  2KGJ A;  1ITX A;  4MAV A;  1X6L A;  1FKB A;  1GUV A;  3RME A;  1UR8 A;  3CH9 A;  4DIP A;  4BF8 A;  4Z2I A;  1J4H A;  3NI6 A;  1ZBC A;  1ZK6 A;  4R5E A;  3O5E A;  1LQ0 A;  5DO2 A;  3UQI A;  3B7X A;  3AS0 A;  3RM9 A;  2MLX A;  2DPE A;  2RUQ A;  4DRJ A;  2F21 A;  3LUO A;  5GPR A;  4QZV B;  1P5Q A;  4DRI A;  1KT1 A;  2M2A A;  2G8Z A;  3MDY B;  4TNS A;  1TFV A;  3O5J A;  1E6R A;  3EY6 A;  2PPN A;  4QT2 A;  4GGQ A;  2DSW A;  4JYS A;  2PBC A;  2A3B A;  3RM4 A;  3WD1 A;  2MLZ A;  1C9H A;  2WLY A;  4JFK A;  2ZQT A;  2LKN A;  4ODO A;  1EIB A;  2FAP A;  3UI6 A;  2F4E A;  2O92 A;  3O5I A;  2PPP A;  2XP5 A;  5HWC A;  1YW5 A;  1GPF A;  1IX5 A;  1NSG A;  2PV2 A;  5DIU A;  1U79 A;  2DSU A;  1UR9 A;  3ARS A;  2KR7 A;  3OA5 A;  1J6Y A;  1FKJ A;  5JH8 A;  2AOS A;  4KQZ A;  3WL1 A;  1NWU A;  2Y78 A;  2LJ4 A;  3AS1 A;  1ROU A;  4Z2L A;  3WD2 A;  1W9U A;  1FFQ A;  4GIV A;  4DRM A;  1D2K A;  4U86 A;  4NZC A;  1KFW A;  2PI6 A;  3O5O A;  4IT4 A;  1D7H A;  2DG4 A;  3BXW A;  4JFL A;  4IQC A;  3O5P A;  2DT3 A;  2Q5A A;  4G50 A;  1WB0 A;  2IF4 A;  4J4O A;  3G6M A;  3B9D A;  4ML4 A;  3KAC A;  4Z2K A;  3ARW A;  1XHG A;  1N1A A;  3OOB A;  4KR0 B;  2PPO A;  4W9O A;  2OLH A;  3ODK A;  3RGC A;  1LL6 A;  1FKG A;  1NWR A;  2DG9 A;  1NMV A;  4DRO A;  1ZCN A;  2RUC A;  1HXV A;  3ALF A;  1YAT A;  3ALG A;  3AS3 A;  5DIT A;  3ARQ A;  3WKZ A;  3TC5 A;  4P8U A;  2DT0 A;  3NRK A;  5HKG A;  1FKS A;  4MSP A;  1F40 A;  2XP9 A;  4NNR A;  4ZS6 A;  1A7X A;  2RUR A;  3GPK A;  1LL7 A;  1CTN A;  5DEZ A;  2XP6 A;  3PR9 A;  2F2D A;  2KI3 A;  1HJV A;  3KAH A;  1W1T A;  1NMW A;  4TW7 A;  5GQB A;  1M5Y A;  4MGV A;  2ZQV A;  2KFW A;  3UI4 A;  1KT0 A;  2A3E A;  4ODK A;  4MNK A;  2JZV A;  1E6P A;  4ZPW R;  3B9A A;  2G41 A;  3WH0 A;  4IT6 A;  3AQU A;  2DG3 A;  4DZ3 A;  4G2P A;  1W1P A;  4TW6 A;  1ZBK A;  4LAW A;  1JNT A;  4J4N A;  2MLY A;  3B8S A;  3IKG A;  1BKF A;  2UZ5 A;  4DH0 A;  3WD0 A;  2XPA A;  2ZR6 A;  1LJY A;  1J4R A;  3I6C A;  4DRN A;  1EDQ A;  2VN1 A;  4ODP A;  4QIB A;  5B8I C;  3ARV A;  4L72 B;  1OGB A;  4MPK A;  4P8V A;  1SR0 A;  4JFJ A;  3WQV A;  3ARO A;  1ZBW A;  3WD4 A;  2KO7 A;  1ZL1 A;  2M08 A;  1W1Y A;  3CZ8 A;  2RSE A;  2ESC A;  4TYO A;  1NWT A;  1Q6H A;  3UQA A;  4Z2G A;  1RD6 A;  3JYM A;  3ARX A;  5D75 A;  3UI5 A;  1Q1C A;  4WIW A;  4P8X A;  3TDB A;  1HKM A;  4Q22 A;  3WQW A;  2XP7 A;  3UQB A;  4DWS A;  1FKR A;  4Z2J A;  4DWS D;  4ZPV R;  1O6I A;  2YBT A;  3IHZ A;  2MF9 A;  2YBU A;  4JFM A;  1FKH A;  3FY1 A;  2WM0 A;  1F8A B;  3B9E A;  1NWS A;  1X6N A;  1OGG A;  3O5F A;  3IK8 A;  1FAP A;  2XP4 A;  4PTM A;  2AWG A;  1SYT A;  1H0I A;  4URI A;  4TW8 A;  4L3N A;  2L2S A;  1JVW A;  3WIJ A;  5GPG A;  2RQS A;  2XPB A;  5HT1 A;  4AY1 A;  1JNS A;  3O5M A;  2KE0 A;  2DSV A;  1ROT A;  2D9F A;  4MNM A;  1E15 A;  1XRV A;  2ZR5 A;  3VAW A;  3ARP A;  1PIN A;  5HW7 A;  1D7J A;  2LPV A;  2N87 A;  2VCD A;  1K9T A;  1FKF A;  5DIV A;  3UF8 A;  3CHC A;  2B31 A;  1HJX A;  2PV1 A;  4WKH A;  3O5Q A;  4WJX A;  3KAI A;  1PBK A;  1QPF A;  2DSZ A;  1W26 A;  1FKD A;  4ODQ A;  1T11 A;  3KAF A;  1J4I A;  3PRA A;  1E6N A;  3NTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...