3I6CA

Structure-based design of novel pin1 inhibitors (ii)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
113
structure length
113
Chain Sequence
b'EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-based design of novel human Pin1 inhibitors (II).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 42
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3i6cA00
4NNRA 3CGMA 3IKDA 2IF4A 4DRJA 4TX0A 2MLYA 3O5EA 3NI6A 1FAPA 2VCDA 4U86A 1ZK6A 5BXJA 4QT2A 4DRQA 3KABA 3LUOA 4U85A 2ZR6A 3JYMA 1YATA 3UI4A 4JFJA 1EYMA 4IQCA 1FKKA 4W9OA 1JNSA 3VAWA 2MNTA 1QPLA 1HXVA 1NMVA 4G50A 3O5KA 4DH0A 4W9QA 1A7XA 4TNSA 4DZ3A 2RUCA 5HW6A 2PV1A 3KAGA 1ROTA 3NTPA 2F2DA 3UI6A 2Y78A 4DROA 4DRPA 2KO7A 3FAPA 2KE0A 2MLZA 1D7JA 4TW7A 2XP6A 4W9PA 5HWCA 1FKLA 3JXVA 3O5PA 2PPNA 2XP4A 4GIVA 3O5JA 5HW8A 5GPGA 2DG9A 5B8IC 5DITA 1M5YA 4ODLA 4ODKA 1F8AB 4ODQA 4QIBA 4JFKA 1JVWA 5I98A 2M2AA 2F21A 1R9HA 3RFWA 1FKSA 4DIPA 2FAPA 4DRKA 1D6OA 3KACA 3KAHA 2MLXA 3IK8A 4TW6A 1FKRA 1FKDA 2KFWA 2MPHA 3PRDA 1FKFA 3GPKA 2PPOA 3UQBA 3WH0A 1F40A 3OOBA 2PV2A 4ITZA 5HKGA 3KADA 5HTGA 4ODMA 1Q6HA 2LJ4A 4LAVA 1Y0OA 4ODRA 1FKBA 2N87A 4U84A 3RGCA 3UF8A 2ZQUA 1Q6UA 2RUQA 5J6EA 1N1AA 4QT3A 2K8IA 4FN2A 1PBKA 3TC5A 3H9RB 1FKIA 1FJDA 2LGOA 2KGJA 2LKNA 4DRNA 2D9FA 4IPXA 2AWGA 5HW7A 1FKJA 2KR7A 2MF9A 4O2TA 2RQSA 3KCEA 3MDYB 5D75A 4R0XA 4C02B 4DRMA 4TW8A 4DRHA 3EY6A 4MSPA 3O5QA 3O5FA 5HWBA 1KT1A 1D7IA 1NSGA 5DIVA 4DT4A 2PV3A 2PBCA 4ODPA 4BF8A 3JYJA 3O5LA 3IKGA 4G2PA 4JFIA 1FD9A 5HT1A 1KT0A 4J4NA 3CGNA 4IQ2A 4FAPA 3NRKA 1W26A 2ITKA 2DG3A 2XP7A 3UI5A 1NMWA 1T11A 1ROUA 2PPPA 1JNTA 1QZ2A 3IHZA 3KAFA 5DIUA 1FKHA 4JFLA 2XPBA 4LAWA 2UZ5A 2ZQVA 4TYOA 2L2SA 3KZ7A 3TCZA 3TDBA 1L1PA 1QPFA 2XP3A 2XP5A 4JFMA 1J6YA 1B6CA 2XPAA 3UQAA 2M08A 1TCOC 3O5DA 2LPVA 2VN1A 2ZR5A 4DRIA 1C9HA 1P5QA 4J4OA 2F4EA 4DZ2A 4ODNA 2ZQTA 3I6CA 3PA7A 4ODOA 1J4RA 4MGVA 2XP8A 3B7XA 1FKGA 3KAIA 4JYSA 1PINA 1Q1CA 2RUDA 2RURA 1YW5A 2M1IA 2JZVA 2XP9A 2OFNA 3ODKA 4LAXA 1U79A 2DG4A 1EQ3A 2FKEA 1ZCNA 2ZQSA 3O5MA 1J4IA 3O5GA 1BKFA 1D7HA 3UQIA 1Q6IA 2KI3A 5HUAA 2RSEA 1BL4A 2Q5AA 3O5OA 1J4HA 4N19A 3PRBA 3O5IA 3O5RA 2ZR4A 1FKTA 4GGQA 4LAYA
chains in the Genus database with same CATH superfamily
4DRJA 2A3EA 1W9UA 1FAPA 5GQBA 4MNKA 4Z2JA 3LUOA 2EULA 1W1PA 3WQWA 1W1YA 2WK2A 1QPLA 3EIPA 1HXVA 1A7XA 4ZPVR 5HW6A 2F2DA 4HARA 4ZPTR 3G6MA 1H0IA 3FAPA 2MLZA 4R5EA 2XP6A 3JXVA 2PPNA 3O5JA 5HW8A 1HKJA 1WAWA 2DG9A 5DITA 3PRAA 5B8IC 3CHFA 4Z2LA 4JFKA 5I98A 4DRKA 3KAHA 4WIWA 4AY1A 1FKDA 3PRDA 5DF0A 4ITZA 3AS0A 1GPFA 4ODRA 1FKBA 3RM9A 1N1AA 1ZU8A 2LKNA 2MF9A 5D75A 1KFWA 3AS3A 4DRHA 1WB0A 1E44A 5HWBA 4W5UA 4BF8A 1OGGA 4ODPA 3WL0A 3IKGA 4G2PA 3GTYX 4J4NA 1OWQA 3NRKA 1E6RA 3ARVA 1LL6A 1NMWA 1ROUA 2PPPA 1JNTA 3IHZA 1FKHA 4JFLA 2XPBA 2FDMA 1NWUA 1VF8A 2XP3A 2XP5A 4JFMA 1ZBCA 1TCOC 2ZR5A 3CZ8A 1H0GA 1K9TA 2B5UB 2PN0A 3ALGA 2F4EA 3CHDA 2RURA 3ODKA 2XP9A 2DT1A 4WK9A 1U79A 3WD4A 2FKEA 1ZCNA 3O5GA 1LL7A 3O5OA 1XRVA 4N19A 1J4HA 1E6ZA 3B8SA 3PRBA 2P4VA 3CGMA 3WD2A 1WNOA 3ARUA 5BXJA 3NI6A 5JH8A 4U85A 1YATA 1EYMA 1FKKA 4XAKA 1JNSA 4G50A 3O5KA 4W9QA 3B9AA 2RUCA 3UI6A 3KAGA 2KO7A 3QOKA 3WIJA 5HWCA 3O5PA 4Q7NA 4ODLA 4ODKA 1F8AB 3AROA 4Z2IA 3RFWA 1D6OA 4TW6A 4L72B 1GRJA 3GPKA 2YBUA 3WH0A 1EDQA 3OOBA 2DSZA 4ODMA 4LAVA 1Y0OA 2ESCA 2IUZA 1ZL1A 3RGCA 3WD0A 1CTNA 2DSWA 3TC5A 3BMBA 3H9RB 1IX5A 4KR0B 1FJDA 4IPXA 2AWGA 1FKJA 3KCEA 3MDYB 4DRMA 4TW8A 3EY6A 4MSPA 3O5QA 3O5FA 4MPKA 3ARSA 1D7IA 1JNEA 4LGXA 2PBCA 4MNMA 5HT1A 4S3JA 3CGNA 1O6IA 2F23A 3UI5A 3KAFA 4LAWA 4HBOA 2UZ5A 2ZQVA 4TYOA 2L2SA 3KZ7A 1NWTA 3UQAA 2M08A 4DWSC 2LPVA 4DRIA 2O92A 3WKZA 1C9HA 3CH9A 5GPRA 1D2KA 2A3BA 2ZQTA 4Z2GA 3PA7A 1J4RA 1FKGA 3AQUA 3KAIA 1Q1CA 2M1IA 1ZBWA 4WKHA 2DG4A 3WQVA 3WL1A 1J4IA 1W1TA 1LQ0A 5HUAA 2WLYA 3O5RA 1W1VA 2ZR4A 4ZS6A 4P8UA 4MNJA 4MNLA 1HJXA 3O5EA 1FFRA 3UI4A 1E6NA 4W9OA 2MNTA 1NWSA 1NMVA 3CHCA 4DZ3A 3NTPA 3ARTA 4DROA 4DRPA 4TW7A 1D7JA 4W9PA 3AS1A 4GIVA 3RMEA 4UDMA 4ODQA 1HKKA 2M2AA 2F21A 1R9HA 3PR9A 1FKSA 4DIPA 2FAPA 2O9OA 3W4RA 1FKRA 2MPHA 4QZVB 1FKFA 3UQBA 2YBTA 1F40A 2PV2A 1LG1A 1Q6HA 2LJ4A 1OGBA 1E6PA 2WM0A 3UF8A 3WD3A 1Q6UA 2K8IA 4FN2A 1PBKA 1FKIA 4URIA 2D9FA 5HW7A 2KR7A 2B31A 2RQSA 4C02B 2A3AA 4NSBA 1KT1A 5DIVA 2PI6A 1GUVA 4DT4A 4L3NA 2DT0A 1X6NA 3O5LA 2DSUA 4NZCA 4FAPA 1E15A 1LL4A 1W26A 4Z2HA 4WKAA 1W9VA 4P8VA 1ITXA 3AS2A 5DIUA 4DWSA 1JNDA 1UR9A 4IT6A 2QF8A 3TDBA 3G6LA 1J6YA 2XPAA 3O5DA 4ML4A 4P8WA 1FFQA 1P5QA 4J4OA 2AOSA 4ODOA 4MGVA 2XP8A 4Z2KA 5DEZA 3ARRA 4JYSA 1PINA 3ARPA 4KQZA 2OFNA 4LAXA 1ZBVA 1HKIA 3OA5A 1XHGA 2ZQSA 3O5MA 4MAVA 2WLZA 2KI3A 2RSEA 2Q5AA 3O5IA 3ARWA 2DSVA 4GGQA 1EIBA 4NNRA 3IKDA 2IF4A 4TX0A 2MLYA 4U86A 2DT2A 2VCDA 1ZK6A 4QT2A 4DRQA 3KABA 2ZR6A 3JYMA 2G8ZA 3ARYA 4JFJA 2DPEA 2DT3A 4IQCA 5DO2A 3VAWA 1EHNA 2G41A 4DH0A 4TNSA 2PV1A 1ROTA 2Y78A 4WJXA 3ARXA 2KE0A 2A3CA 1FKLA 4HBEA 2XP4A 1HJWA 1LG2A 5GPGA 1M5YA 1X6LA 2ETNA 4QIBA 1JVWA 3KACA 2MLXA 3IK8A 4PTMA 2KFWA 3RM8A 2PPOA 1TFVA 1HKMA 1JCHB 2OLHA 4MTVA 5HKGA 3KADA 5HTGA 3B9DA 3WD1A 2N87A 4S3KA 4U84A 4P8XA 2ZQUA 2RUQA 5J6EA 1SR0A 3BXWA 4QT3A 3RM4A 2LGOA 2KGJA 4DRNA 3FXYA 4O2TA 4R0XA 1NSGA 3CHEA 3ALFA 2PV3A 1SYTA 3JYJA 4JFIA 1FD9A 1GOIA 1KT0A 1RD6A 4IQ2A 4Q22A 5HBFA 2ITKA 2DG3A 2XP7A 1T11A 3FY1A 1QZ2A 4DWSD 3B9EA 1HJVA 3TCZA 1L1PA 1W9PA 1QPFA 1LJYA 4IT4A 1B6CA 4DWSB 2VN1A 4DZ2A 4ODNA 3I6CA 3B7XA 3ARQA 3GU0A 4WKFA 2RUDA 1YW5A 4ZPWR 1UR8A 2JZVA 1NH6A 1E9LA 1ZB5A 1EQ3A 3ARZA 1BKFA 1D7HA 3UQIA 1Q6IA 1BL4A 1NWRA 1FKTA 1ZBKA 4LAYA
chains in the Genus database with same CATH topology
4DRJA 2A3EA 1W9UA 1FAPA 5GQBA 4MNKA 4Z2JA 3LUOA 1W1PA 3WQWA 1W1YA 2WK2A 1QPLA 1HXVA 1A7XA 4ZPVR 5HW6A 2F2DA 4HARA 4ZPTR 3G6MA 1H0IA 3FAPA 2MLZA 4R5EA 2XP6A 3JXVA 2PPNA 3O5JA 5HW8A 1HKJA 1WAWA 2DG9A 5DITA 3PRAA 5B8IC 3CHFA 4Z2LA 4JFKA 5I98A 4DRKA 3KAHA 4WIWA 4AY1A 1FKDA 3PRDA 5DF0A 4ITZA 3AS0A 1GPFA 4ODRA 1FKBA 3RM9A 1N1AA 1ZU8A 2LKNA 2MF9A 5D75A 1KFWA 3AS3A 4DRHA 1WB0A 5HWBA 4W5UA 4BF8A 1OGGA 4ODPA 3WL0A 3IKGA 4G2PA 4J4NA 1OWQA 3NRKA 1E6RA 3ARVA 1LL6A 1NMWA 1ROUA 2PPPA 1JNTA 3IHZA 1FKHA 4JFLA 2XPBA 2FDMA 1NWUA 1VF8A 2XP3A 2XP5A 4JFMA 1ZBCA 1TCOC 2ZR5A 3CZ8A 1H0GA 1K9TA 3ALGA 2F4EA 3CHDA 2RURA 3ODKA 2XP9A 2DT1A 4WK9A 1U79A 3WD4A 2FKEA 1ZCNA 3O5GA 1LL7A 3O5OA 1XRVA 4N19A 1J4HA 1E6ZA 3B8SA 3PRBA 3CGMA 3WD2A 1WNOA 3ARUA 5BXJA 3NI6A 5JH8A 4U85A 1YATA 1EYMA 1FKKA 4XAKA 1JNSA 4G50A 3O5KA 4W9QA 3B9AA 2RUCA 3UI6A 3KAGA 2KO7A 3QOKA 3WIJA 5HWCA 3O5PA 4Q7NA 4ODLA 4ODKA 1F8AB 3AROA 4Z2IA 3RFWA 1D6OA 4TW6A 4L72B 3GPKA 2YBUA 3WH0A 1EDQA 3OOBA 2DSZA 4ODMA 4LAVA 1Y0OA 2ESCA 2IUZA 1ZL1A 3RGCA 3WD0A 1CTNA 2DSWA 3TC5A 1IX5A 3H9RB 4KR0B 1FJDA 4IPXA 2AWGA 1FKJA 3KCEA 3MDYB 4DRMA 4TW8A 3EY6A 4MSPA 3O5QA 3O5FA 4MPKA 3ARSA 1D7IA 1JNEA 4LGXA 2PBCA 4MNMA 5HT1A 4S3JA 3CGNA 1O6IA 3UI5A 3KAFA 4LAWA 4HBOA 2UZ5A 2ZQVA 4TYOA 2L2SA 3KZ7A 1NWTA 3UQAA 2M08A 4DWSC 2LPVA 4DRIA 2O92A 3WKZA 1C9HA 3CH9A 5GPRA 1D2KA 2A3BA 2ZQTA 4Z2GA 3PA7A 1J4RA 1FKGA 3AQUA 3KAIA 1Q1CA 2M1IA 1ZBWA 4WKHA 2DG4A 3WQVA 3WL1A 1J4IA 1W1TA 1LQ0A 5HUAA 2WLYA 3O5RA 1W1VA 2ZR4A 4ZS6A 4P8UA 4MNJA 4MNLA 1HJXA 3O5EA 1FFRA 3UI4A 1E6NA 4W9OA 2MNTA 1NWSA 1NMVA 3CHCA 4DZ3A 3NTPA 3ARTA 4DROA 4DRPA 4TW7A 1D7JA 4W9PA 3AS1A 4GIVA 3RMEA 4ODQA 1HKKA 2M2AA 2F21A 1R9HA 3PR9A 1FKSA 4DIPA 2FAPA 2O9OA 3W4RA 1FKRA 2MPHA 4QZVB 1FKFA 3UQBA 2YBTA 1F40A 2PV2A 1LG1A 1Q6HA 2LJ4A 1OGBA 1E6PA 2WM0A 3UF8A 3WD3A 1Q6UA 2K8IA 4FN2A 1PBKA 1FKIA 4URIA 2D9FA 5HW7A 2KR7A 2B31A 2RQSA 4C02B 2A3AA 4NSBA 1KT1A 5DIVA 2PI6A 1GUVA 4DT4A 4L3NA 2DT0A 1X6NA 3O5LA 2DSUA 4NZCA 4FAPA 1E15A 1LL4A 1W26A 4Z2HA 4WKAA 1W9VA 4P8VA 1ITXA 3AS2A 5DIUA 4DWSA 1JNDA 1UR9A 4IT6A 2QF8A 3TDBA 3G6LA 1J6YA 2XPAA 3O5DA 4ML4A 4P8WA 1FFQA 1P5QA 4J4OA 2AOSA 4ODOA 4MGVA 2XP8A 4Z2KA 5DEZA 3ARRA 4JYSA 1PINA 3ARPA 4KQZA 2OFNA 4LAXA 1ZBVA 1HKIA 3OA5A 1XHGA 2ZQSA 3O5MA 4MAVA 2WLZA 2KI3A 2RSEA 2Q5AA 3O5IA 3ARWA 2DSVA 4GGQA 1EIBA 4NNRA 3IKDA 2IF4A 4TX0A 2MLYA 4U86A 2DT2A 2VCDA 1ZK6A 4QT2A 4DRQA 3KABA 2ZR6A 3JYMA 2G8ZA 3ARYA 4JFJA 2DPEA 2DT3A 4IQCA 5DO2A 3VAWA 1EHNA 2G41A 4DH0A 4TNSA 2PV1A 1ROTA 2Y78A 4WJXA 3ARXA 2KE0A 2A3CA 1FKLA 4HBEA 2XP4A 1HJWA 1LG2A 5GPGA 1M5YA 1X6LA 4QIBA 1JVWA 3KACA 2MLXA 3IK8A 4PTMA 2KFWA 3RM8A 2PPOA 1TFVA 1HKMA 2OLHA 4MTVA 5HKGA 3KADA 5HTGA 3B9DA 3WD1A 2N87A 4S3KA 4U84A 4P8XA 2ZQUA 2RUQA 5J6EA 1SR0A 3BXWA 4QT3A 3RM4A 2LGOA 2KGJA 4DRNA 3FXYA 4O2TA 4R0XA 1NSGA 3CHEA 3ALFA 2PV3A 1SYTA 3JYJA 4JFIA 1FD9A 1GOIA 1KT0A 1RD6A 4IQ2A 4Q22A 5HBFA 2ITKA 2DG3A 2XP7A 1T11A 3FY1A 1QZ2A 4DWSD 3B9EA 1HJVA 3TCZA 1L1PA 1W9PA 1QPFA 1LJYA 4IT4A 1B6CA 4DWSB 2VN1A 4DZ2A 4ODNA 3I6CA 3B7XA 3ARQA 4WKFA 2RUDA 1YW5A 4ZPWR 1UR8A 2JZVA 1NH6A 1E9LA 1ZB5A 1EQ3A 3ARZA 1BKFA 1D7HA 3UQIA 1Q6IA 1BL4A 1NWRA 1FKTA 1ZBKA 4LAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NNR A;  3CGM A;  3IKD A;  2IF4 A;  4DRJ A;  4TX0 A;  2MLY A;  3O5E A;  3NI6 A;  1FAP A;  2VCD A;  4U86 A;  1ZK6 A;  5BXJ A;  4QT2 A;  4DRQ A;  3KAB A;  3LUO A;  4U85 A;  2ZR6 A;  3JYM A;  1YAT A;  3UI4 A;  4JFJ A;  1EYM A;  4IQC A;  1FKK A;  4W9O A;  1JNS A;  3VAW A;  2MNT A;  1QPL A;  1HXV A;  1NMV A;  4G50 A;  3O5K A;  4DH0 A;  4W9Q A;  1A7X A;  4TNS A;  4DZ3 A;  2RUC A;  5HW6 A;  2PV1 A;  3KAG A;  1ROT A;  3NTP A;  2F2D A;  3UI6 A;  2Y78 A;  4DRO A;  4DRP A;  2KO7 A;  3FAP A;  2KE0 A;  2MLZ A;  1D7J A;  4TW7 A;  2XP6 A;  4W9P A;  5HWC A;  1FKL A;  3JXV A;  3O5P A;  2PPN A;  2XP4 A;  4GIV A;  3O5J A;  5HW8 A;  5GPG A;  2DG9 A;  5B8I C;  5DIT A;  1M5Y A;  4ODL A;  4ODK A;  1F8A B;  4ODQ A;  4QIB A;  4JFK A;  1JVW A;  5I98 A;  2M2A A;  2F21 A;  1R9H A;  3RFW A;  1FKS A;  4DIP A;  2FAP A;  4DRK A;  1D6O A;  3KAC A;  3KAH A;  2MLX A;  3IK8 A;  4TW6 A;  1FKR A;  1FKD A;  2KFW A;  2MPH A;  3PRD A;  1FKF A;  3GPK A;  2PPO A;  3UQB A;  3WH0 A;  1F40 A;  3OOB A;  2PV2 A;  4ITZ A;  5HKG A;  3KAD A;  5HTG A;  4ODM A;  1Q6H A;  2LJ4 A;  4LAV A;  1Y0O A;  4ODR A;  1FKB A;  2N87 A;  4U84 A;  3RGC A;  3UF8 A;  2ZQU A;  1Q6U A;  2RUQ A;  5J6E A;  1N1A A;  4QT3 A;  2K8I A;  4FN2 A;  1PBK A;  3TC5 A;  3H9R B;  1FKI A;  1FJD A;  2LGO A;  2KGJ A;  2LKN A;  4DRN A;  2D9F A;  4IPX A;  2AWG A;  5HW7 A;  1FKJ A;  2KR7 A;  2MF9 A;  4O2T A;  2RQS A;  3KCE A;  3MDY B;  5D75 A;  4R0X A;  4C02 B;  4DRM A;  4TW8 A;  4DRH A;  3EY6 A;  4MSP A;  3O5Q A;  3O5F A;  5HWB A;  1KT1 A;  1D7I A;  1NSG A;  5DIV A;  4DT4 A;  2PV3 A;  2PBC A;  4ODP A;  4BF8 A;  3JYJ A;  3O5L A;  3IKG A;  4G2P A;  4JFI A;  1FD9 A;  5HT1 A;  1KT0 A;  4J4N A;  3CGN A;  4IQ2 A;  4FAP A;  3NRK A;  1W26 A;  2ITK A;  2DG3 A;  2XP7 A;  3UI5 A;  1NMW A;  1T11 A;  1ROU A;  2PPP A;  1JNT A;  1QZ2 A;  3IHZ A;  3KAF A;  5DIU A;  1FKH A;  4JFL A;  2XPB A;  4LAW A;  2UZ5 A;  2ZQV A;  4TYO A;  2L2S A;  3KZ7 A;  3TCZ A;  3TDB A;  1L1P A;  1QPF A;  2XP3 A;  2XP5 A;  4JFM A;  1J6Y A;  1B6C A;  2XPA A;  3UQA A;  2M08 A;  1TCO C;  3O5D A;  2LPV A;  2VN1 A;  2ZR5 A;  4DRI A;  1C9H A;  1P5Q A;  4J4O A;  2F4E A;  4DZ2 A;  4ODN A;  2ZQT A;  3I6C A;  3PA7 A;  4ODO A;  1J4R A;  4MGV A;  2XP8 A;  3B7X A;  1FKG A;  3KAI A;  4JYS A;  1PIN A;  1Q1C A;  2RUD A;  2RUR A;  1YW5 A;  2M1I A;  2JZV A;  2XP9 A;  2OFN A;  3ODK A;  4LAX A;  1U79 A;  2DG4 A;  1EQ3 A;  2FKE A;  1ZCN A;  2ZQS A;  3O5M A;  1J4I A;  3O5G A;  1BKF A;  1D7H A;  3UQI A;  1Q6I A;  2KI3 A;  5HUA A;  2RSE A;  1BL4 A;  2Q5A A;  3O5O A;  1J4H A;  4N19 A;  3PRB A;  3O5I A;  3O5R A;  2ZR4 A;  1FKT A;  4GGQ A;  4LAY A; 
#chains in the Genus database with same CATH topology
 4DRJ A;  2A3E A;  1W9U A;  1FAP A;  5GQB A;  4MNK A;  4Z2J A;  3LUO A;  2EUL A;  1W1P A;  3WQW A;  1W1Y A;  2WK2 A;  1QPL A;  3EIP A;  1HXV A;  1A7X A;  4ZPV R;  5HW6 A;  2F2D A;  4HAR A;  4ZPT R;  3G6M A;  1H0I A;  3FAP A;  2MLZ A;  4R5E A;  2XP6 A;  3JXV A;  2PPN A;  3O5J A;  5HW8 A;  1HKJ A;  1WAW A;  2DG9 A;  5DIT A;  3PRA A;  5B8I C;  3CHF A;  4Z2L A;  4JFK A;  5I98 A;  4DRK A;  3KAH A;  4WIW A;  4AY1 A;  1FKD A;  3PRD A;  5DF0 A;  4ITZ A;  3AS0 A;  1GPF A;  4ODR A;  1FKB A;  3RM9 A;  1N1A A;  1ZU8 A;  2LKN A;  2MF9 A;  5D75 A;  1KFW A;  3AS3 A;  4DRH A;  1WB0 A;  1E44 A;  5HWB A;  4W5U A;  4BF8 A;  1OGG A;  4ODP A;  3WL0 A;  3IKG A;  4G2P A;  3GTY X;  4J4N A;  1OWQ A;  3NRK A;  1E6R A;  3ARV A;  1LL6 A;  1NMW A;  1ROU A;  2PPP A;  1JNT A;  3IHZ A;  1FKH A;  4JFL A;  2XPB A;  2FDM A;  1NWU A;  1VF8 A;  2XP3 A;  2XP5 A;  4JFM A;  1ZBC A;  1TCO C;  2ZR5 A;  3CZ8 A;  1H0G A;  1K9T A;  2B5U B;  2PN0 A;  3ALG A;  2F4E A;  3CHD A;  2RUR A;  3ODK A;  2XP9 A;  2DT1 A;  4WK9 A;  1U79 A;  3WD4 A;  2FKE A;  1ZCN A;  3O5G A;  1LL7 A;  3O5O A;  1XRV A;  4N19 A;  1J4H A;  1E6Z A;  3B8S A;  3PRB A;  2P4V A;  3CGM A;  3WD2 A;  1WNO A;  3ARU A;  5BXJ A;  3NI6 A;  5JH8 A;  4U85 A;  1YAT A;  1EYM A;  1FKK A;  4XAK A;  1JNS A;  4G50 A;  3O5K A;  4W9Q A;  3B9A A;  2RUC A;  3UI6 A;  3KAG A;  2KO7 A;  3QOK A;  3WIJ A;  5HWC A;  3O5P A;  4Q7N A;  4ODL A;  4ODK A;  1F8A B;  3ARO A;  4Z2I A;  3RFW A;  1D6O A;  4TW6 A;  4L72 B;  1GRJ A;  3GPK A;  2YBU A;  3WH0 A;  1EDQ A;  3OOB A;  2DSZ A;  4ODM A;  4LAV A;  1Y0O A;  2ESC A;  2IUZ A;  1ZL1 A;  3RGC A;  3WD0 A;  1CTN A;  2DSW A;  3TC5 A;  3BMB A;  3H9R B;  1IX5 A;  4KR0 B;  1FJD A;  4IPX A;  2AWG A;  1FKJ A;  3KCE A;  3MDY B;  4DRM A;  4TW8 A;  3EY6 A;  4MSP A;  3O5Q A;  3O5F A;  4MPK A;  3ARS A;  1D7I A;  1JNE A;  4LGX A;  2PBC A;  4MNM A;  5HT1 A;  4S3J A;  3CGN A;  1O6I A;  2F23 A;  3UI5 A;  3KAF A;  4LAW A;  4HBO A;  2UZ5 A;  2ZQV A;  4TYO A;  2L2S A;  3KZ7 A;  1NWT A;  3UQA A;  2M08 A;  4DWS C;  2LPV A;  4DRI A;  2O92 A;  3WKZ A;  1C9H A;  3CH9 A;  5GPR A;  1D2K A;  2A3B A;  2ZQT A;  4Z2G A;  3PA7 A;  1J4R A;  1FKG A;  3AQU A;  3KAI A;  1Q1C A;  2M1I A;  1ZBW A;  4WKH A;  2DG4 A;  3WQV A;  3WL1 A;  1J4I A;  1W1T A;  1LQ0 A;  5HUA A;  2WLY A;  3O5R A;  1W1V A;  2ZR4 A;  4ZS6 A;  4P8U A;  4MNJ A;  4MNL A;  1HJX A;  3O5E A;  1FFR A;  3UI4 A;  1E6N A;  4W9O A;  2MNT A;  1NWS A;  1NMV A;  3CHC A;  4DZ3 A;  3NTP A;  3ART A;  4DRO A;  4DRP A;  4TW7 A;  1D7J A;  4W9P A;  3AS1 A;  4GIV A;  3RME A;  4UDM A;  4ODQ A;  1HKK A;  2M2A A;  2F21 A;  1R9H A;  3PR9 A;  1FKS A;  4DIP A;  2FAP A;  2O9O A;  3W4R A;  1FKR A;  2MPH A;  4QZV B;  1FKF A;  3UQB A;  2YBT A;  1F40 A;  2PV2 A;  1LG1 A;  1Q6H A;  2LJ4 A;  1OGB A;  1E6P A;  2WM0 A;  3UF8 A;  3WD3 A;  1Q6U A;  2K8I A;  4FN2 A;  1PBK A;  1FKI A;  4URI A;  2D9F A;  5HW7 A;  2KR7 A;  2B31 A;  2RQS A;  4C02 B;  2A3A A;  4NSB A;  1KT1 A;  5DIV A;  2PI6 A;  1GUV A;  4DT4 A;  4L3N A;  2DT0 A;  1X6N A;  3O5L A;  2DSU A;  4NZC A;  4FAP A;  1E15 A;  1LL4 A;  1W26 A;  4Z2H A;  4WKA A;  1W9V A;  4P8V A;  1ITX A;  3AS2 A;  5DIU A;  4DWS A;  1JND A;  1UR9 A;  4IT6 A;  2QF8 A;  3TDB A;  3G6L A;  1J6Y A;  2XPA A;  3O5D A;  4ML4 A;  4P8W A;  1FFQ A;  1P5Q A;  4J4O A;  2AOS A;  4ODO A;  4MGV A;  2XP8 A;  4Z2K A;  5DEZ A;  3ARR A;  4JYS A;  1PIN A;  3ARP A;  4KQZ A;  2OFN A;  4LAX A;  1ZBV A;  1HKI A;  3OA5 A;  1XHG A;  2ZQS A;  3O5M A;  4MAV A;  2WLZ A;  2KI3 A;  2RSE A;  2Q5A A;  3O5I A;  3ARW A;  2DSV A;  4GGQ A;  1EIB A;  4NNR A;  3IKD A;  2IF4 A;  4TX0 A;  2MLY A;  4U86 A;  2DT2 A;  2VCD A;  1ZK6 A;  4QT2 A;  4DRQ A;  3KAB A;  2ZR6 A;  3JYM A;  2G8Z A;  3ARY A;  4JFJ A;  2DPE A;  2DT3 A;  4IQC A;  5DO2 A;  3VAW A;  1EHN A;  2G41 A;  4DH0 A;  4TNS A;  2PV1 A;  1ROT A;  2Y78 A;  4WJX A;  3ARX A;  2KE0 A;  2A3C A;  1FKL A;  4HBE A;  2XP4 A;  1HJW A;  1LG2 A;  5GPG A;  1M5Y A;  1X6L A;  2ETN A;  4QIB A;  1JVW A;  3KAC A;  2MLX A;  3IK8 A;  4PTM A;  2KFW A;  3RM8 A;  2PPO A;  1TFV A;  1HKM A;  1JCH B;  2OLH A;  4MTV A;  5HKG A;  3KAD A;  5HTG A;  3B9D A;  3WD1 A;  2N87 A;  4S3K A;  4U84 A;  4P8X A;  2ZQU A;  2RUQ A;  5J6E A;  1SR0 A;  3BXW A;  4QT3 A;  3RM4 A;  2LGO A;  2KGJ A;  4DRN A;  3FXY A;  4O2T A;  4R0X A;  1NSG A;  3CHE A;  3ALF A;  2PV3 A;  1SYT A;  3JYJ A;  4JFI A;  1FD9 A;  1GOI A;  1KT0 A;  1RD6 A;  4IQ2 A;  4Q22 A;  5HBF A;  2ITK A;  2DG3 A;  2XP7 A;  1T11 A;  3FY1 A;  1QZ2 A;  4DWS D;  3B9E A;  1HJV A;  3TCZ A;  1L1P A;  1W9P A;  1QPF A;  1LJY A;  4IT4 A;  1B6C A;  4DWS B;  2VN1 A;  4DZ2 A;  4ODN A;  3I6C A;  3B7X A;  3ARQ A;  3GU0 A;  4WKF A;  2RUD A;  1YW5 A;  4ZPW R;  1UR8 A;  2JZV A;  1NH6 A;  1E9L A;  1ZB5 A;  1EQ3 A;  3ARZ A;  1BKF A;  1D7H A;  3UQI A;  1Q6I A;  1BL4 A;  1NWR A;  1FKT A;  1ZBK A;  4LAY A; 
#chains in the Genus database with same CATH homology
 4DRJ A;  2A3E A;  1W9U A;  1FAP A;  5GQB A;  4MNK A;  4Z2J A;  3LUO A;  1W1P A;  3WQW A;  1W1Y A;  2WK2 A;  1QPL A;  1HXV A;  1A7X A;  4ZPV R;  5HW6 A;  2F2D A;  4HAR A;  4ZPT R;  3G6M A;  1H0I A;  3FAP A;  2MLZ A;  4R5E A;  2XP6 A;  3JXV A;  2PPN A;  3O5J A;  5HW8 A;  1HKJ A;  1WAW A;  2DG9 A;  5DIT A;  3PRA A;  5B8I C;  3CHF A;  4Z2L A;  4JFK A;  5I98 A;  4DRK A;  3KAH A;  4WIW A;  4AY1 A;  1FKD A;  3PRD A;  5DF0 A;  4ITZ A;  3AS0 A;  1GPF A;  4ODR A;  1FKB A;  3RM9 A;  1N1A A;  1ZU8 A;  2LKN A;  2MF9 A;  5D75 A;  1KFW A;  3AS3 A;  4DRH A;  1WB0 A;  5HWB A;  4W5U A;  4BF8 A;  1OGG A;  4ODP A;  3WL0 A;  3IKG A;  4G2P A;  4J4N A;  1OWQ A;  3NRK A;  1E6R A;  3ARV A;  1LL6 A;  1NMW A;  1ROU A;  2PPP A;  1JNT A;  3IHZ A;  1FKH A;  4JFL A;  2XPB A;  2FDM A;  1NWU A;  1VF8 A;  2XP3 A;  2XP5 A;  4JFM A;  1ZBC A;  1TCO C;  2ZR5 A;  3CZ8 A;  1H0G A;  1K9T A;  3ALG A;  2F4E A;  3CHD A;  2RUR A;  3ODK A;  2XP9 A;  2DT1 A;  4WK9 A;  1U79 A;  3WD4 A;  2FKE A;  1ZCN A;  3O5G A;  1LL7 A;  3O5O A;  1XRV A;  4N19 A;  1J4H A;  1E6Z A;  3B8S A;  3PRB A;  3CGM A;  3WD2 A;  1WNO A;  3ARU A;  5BXJ A;  3NI6 A;  5JH8 A;  4U85 A;  1YAT A;  1EYM A;  1FKK A;  4XAK A;  1JNS A;  4G50 A;  3O5K A;  4W9Q A;  3B9A A;  2RUC A;  3UI6 A;  3KAG A;  2KO7 A;  3QOK A;  3WIJ A;  5HWC A;  3O5P A;  4Q7N A;  4ODL A;  4ODK A;  1F8A B;  3ARO A;  4Z2I A;  3RFW A;  1D6O A;  4TW6 A;  4L72 B;  3GPK A;  2YBU A;  3WH0 A;  1EDQ A;  3OOB A;  2DSZ A;  4ODM A;  4LAV A;  1Y0O A;  2ESC A;  2IUZ A;  1ZL1 A;  3RGC A;  3WD0 A;  1CTN A;  2DSW A;  3TC5 A;  1IX5 A;  3H9R B;  4KR0 B;  1FJD A;  4IPX A;  2AWG A;  1FKJ A;  3KCE A;  3MDY B;  4DRM A;  4TW8 A;  3EY6 A;  4MSP A;  3O5Q A;  3O5F A;  4MPK A;  3ARS A;  1D7I A;  1JNE A;  4LGX A;  2PBC A;  4MNM A;  5HT1 A;  4S3J A;  3CGN A;  1O6I A;  3UI5 A;  3KAF A;  4LAW A;  4HBO A;  2UZ5 A;  2ZQV A;  4TYO A;  2L2S A;  3KZ7 A;  1NWT A;  3UQA A;  2M08 A;  4DWS C;  2LPV A;  4DRI A;  2O92 A;  3WKZ A;  1C9H A;  3CH9 A;  5GPR A;  1D2K A;  2A3B A;  2ZQT A;  4Z2G A;  3PA7 A;  1J4R A;  1FKG A;  3AQU A;  3KAI A;  1Q1C A;  2M1I A;  1ZBW A;  4WKH A;  2DG4 A;  3WQV A;  3WL1 A;  1J4I A;  1W1T A;  1LQ0 A;  5HUA A;  2WLY A;  3O5R A;  1W1V A;  2ZR4 A;  4ZS6 A;  4P8U A;  4MNJ A;  4MNL A;  1HJX A;  3O5E A;  1FFR A;  3UI4 A;  1E6N A;  4W9O A;  2MNT A;  1NWS A;  1NMV A;  3CHC A;  4DZ3 A;  3NTP A;  3ART A;  4DRO A;  4DRP A;  4TW7 A;  1D7J A;  4W9P A;  3AS1 A;  4GIV A;  3RME A;  4ODQ A;  1HKK A;  2M2A A;  2F21 A;  1R9H A;  3PR9 A;  1FKS A;  4DIP A;  2FAP A;  2O9O A;  3W4R A;  1FKR A;  2MPH A;  4QZV B;  1FKF A;  3UQB A;  2YBT A;  1F40 A;  2PV2 A;  1LG1 A;  1Q6H A;  2LJ4 A;  1OGB A;  1E6P A;  2WM0 A;  3UF8 A;  3WD3 A;  1Q6U A;  2K8I A;  4FN2 A;  1PBK A;  1FKI A;  4URI A;  2D9F A;  5HW7 A;  2KR7 A;  2B31 A;  2RQS A;  4C02 B;  2A3A A;  4NSB A;  1KT1 A;  5DIV A;  2PI6 A;  1GUV A;  4DT4 A;  4L3N A;  2DT0 A;  1X6N A;  3O5L A;  2DSU A;  4NZC A;  4FAP A;  1E15 A;  1LL4 A;  1W26 A;  4Z2H A;  4WKA A;  1W9V A;  4P8V A;  1ITX A;  3AS2 A;  5DIU A;  4DWS A;  1JND A;  1UR9 A;  4IT6 A;  2QF8 A;  3TDB A;  3G6L A;  1J6Y A;  2XPA A;  3O5D A;  4ML4 A;  4P8W A;  1FFQ A;  1P5Q A;  4J4O A;  2AOS A;  4ODO A;  4MGV A;  2XP8 A;  4Z2K A;  5DEZ A;  3ARR A;  4JYS A;  1PIN A;  3ARP A;  4KQZ A;  2OFN A;  4LAX A;  1ZBV A;  1HKI A;  3OA5 A;  1XHG A;  2ZQS A;  3O5M A;  4MAV A;  2WLZ A;  2KI3 A;  2RSE A;  2Q5A A;  3O5I A;  3ARW A;  2DSV A;  4GGQ A;  1EIB A;  4NNR A;  3IKD A;  2IF4 A;  4TX0 A;  2MLY A;  4U86 A;  2DT2 A;  2VCD A;  1ZK6 A;  4QT2 A;  4DRQ A;  3KAB A;  2ZR6 A;  3JYM A;  2G8Z A;  3ARY A;  4JFJ A;  2DPE A;  2DT3 A;  4IQC A;  5DO2 A;  3VAW A;  1EHN A;  2G41 A;  4DH0 A;  4TNS A;  2PV1 A;  1ROT A;  2Y78 A;  4WJX A;  3ARX A;  2KE0 A;  2A3C A;  1FKL A;  4HBE A;  2XP4 A;  1HJW A;  1LG2 A;  5GPG A;  1M5Y A;  1X6L A;  4QIB A;  1JVW A;  3KAC A;  2MLX A;  3IK8 A;  4PTM A;  2KFW A;  3RM8 A;  2PPO A;  1TFV A;  1HKM A;  2OLH A;  4MTV A;  5HKG A;  3KAD A;  5HTG A;  3B9D A;  3WD1 A;  2N87 A;  4S3K A;  4U84 A;  4P8X A;  2ZQU A;  2RUQ A;  5J6E A;  1SR0 A;  3BXW A;  4QT3 A;  3RM4 A;  2LGO A;  2KGJ A;  4DRN A;  3FXY A;  4O2T A;  4R0X A;  1NSG A;  3CHE A;  3ALF A;  2PV3 A;  1SYT A;  3JYJ A;  4JFI A;  1FD9 A;  1GOI A;  1KT0 A;  1RD6 A;  4IQ2 A;  4Q22 A;  5HBF A;  2ITK A;  2DG3 A;  2XP7 A;  1T11 A;  3FY1 A;  1QZ2 A;  4DWS D;  3B9E A;  1HJV A;  3TCZ A;  1L1P A;  1W9P A;  1QPF A;  1LJY A;  4IT4 A;  1B6C A;  4DWS B;  2VN1 A;  4DZ2 A;  4ODN A;  3I6C A;  3B7X A;  3ARQ A;  4WKF A;  2RUD A;  1YW5 A;  4ZPW R;  1UR8 A;  2JZV A;  1NH6 A;  1E9L A;  1ZB5 A;  1EQ3 A;  3ARZ A;  1BKF A;  1D7H A;  3UQI A;  1Q6I A;  1BL4 A;  1NWR A;  1FKT A;  1ZBK A;  4LAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...