3I6CA

Structure-based design of novel pin1 inhibitors (ii)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
113
structure length
113
Chain Sequence
EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-based design of novel human Pin1 inhibitors (II).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 42
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3i6cA00
2LPVA 1D7IA 3NI6A 5DITA 2PV3A 4QT3A 3UI4A 3TDBA 3LUOA 1FJDA 1FAPA 1YW5A 1FKTA 4DZ2A 4FAPA 1QPFA 4DRQA 3PRDA 2M1IA 2OFNA 3KAFA 2RUDA 5DIUA 2MPHA 2ITKA 3KAGA 2KFWA 2PBCA 3KACA 3IKDA 4DRIA 3UI5A 1NMWA 3IKGA 2ZR6A 4C02B 1PINA 2MLXA 4DRHA 3TCZA 2ZQTA 1KT1A 1R9HA 4GIVA 4ODLA 4ODNA 3O5QA 2MNTA 2RQSA 3MDYB 3O5FA 2XPBA 1ROTA 4TYOA 1L1PA 5I98A 4DRPA 1Q6UA 1BL4A 1C9HA 2JZVA 2LGOA 2KR7A 2MF9A 3UF8A 2XP7A 2IF4A 1TCOC 4IQCA 4MGVA 1JNTA 4ODMA 4ODOA 4GGQA 3WH0A 1FKGA 2KE0A 4ODRA 1EQ3A 2PV2A 4LAWA 1YATA 1FKIA 5J6EA 3RFWA 4MSPA 3UQAA 2KI3A 4O2TA 2AWGA 4ODPA 4DRJA 2RSEA 5HUAA 1NMVA 1ROUA 2KO7A 2Y78A 3FAPA 1BKFA 2XP4A 2MLZA 3JYMA 4IPXA 4N19A 2K8IA 1ZCNA 4TNSA 3TC5A 4DT4A 2KGJA 2RUQA 4DRKA 1D7HA 2XP3A 3VAWA 1ZK6A 1J6YA 3KABA 3O5LA 5HTGA 4DIPA 3KCEA 5BXJA 1A7XA 1F8AB 3CGNA 4QIBA 2Q5AA 1FKKA 4TX0A 5HT1A 4JFJA 4FN2A 2DG3A 2MLYA 1D6OA 1FKLA 2XPAA 3NTPA 3O5OA 4LAYA 4NNRA 1F40A 2FKEA 2PPNA 2UZ5A 3KADA 5HWCA 2VN1A 3I6CA 2XP8A 4JFLA 1JVWA 3OOBA 1W26A 3UQBA 2D9FA 3KZ7A 2LKNA 4W9PA 5HW8A 5HW7A 1Q1CA 2N87A 1KT0A 5GPGA 3O5KA 3RGCA 4DRMA 1U79A 4TW6A 1JNSA 1EYMA 2F4EA 4ITZA 3CGMA 3JYJA 1FKFA 1M5YA 1J4IA 1Q6IA 2PPOA 2PV1A 3IK8A 3O5JA 1PBKA 4TW8A 2DG4A 2ZQSA 4JFKA 4ODQA 2ZR5A 2F21A 1FKSA 2M08A 4G2PA 1FKDA 4QT2A 3O5RA 2XP6A 4DROA 1FKHA 3O5IA 2VCDA 3UI6A 3IHZA 5B8IC 2DG9A 3NRKA 1FKBA 3H9RB 4U86A 1QZ2A 3EY6A 2F2DA 1J4HA 5HKGA 3O5MA 4J4OA 1HXVA 3JXVA 4JYSA 1T11A 2ZQVA 2PPPA 1FKRA 5D75A 4LAVA 4W9OA 2XP9A 3UQIA 2L2SA 2FAPA 4J4NA 4R0XA 4BF8A 1Q6HA 3O5PA 3O5GA 4IQ2A 2LJ4A 4DZ3A 3B7XA 1N1AA 3KAIA 1NSGA 2ZQUA 3GPKA 2RUCA 3KAHA 1QPLA 4JFMA 4TW7A 4U84A 5DIVA 3O5DA 1P5QA 3PRBA 4ODKA 5HW6A 4G50A 2XP5A 1Y0OA 5HWBA 1B6CA 3PA7A 1FKJA 4LAXA 1J4RA 4JFIA 4DRNA 3O5EA 2RURA 2ZR4A 1D7JA 3ODKA 4DH0A 1FD9A 2M2AA 4U85A 4W9QA
chains in the Genus database with same CATH superfamily
2LPVA 2DT2A 3UI4A 4MNKA 1FAPA 4FAPA 2WLYA 3WD2A 1SR0A 4ZPVR 3FY1A 5DIUA 2MPHA 2DSUA 3AS3A 3KACA 4DRIA 2MLXA 4DRHA 3CHDA 4KR0B 4GIVA 1LQ0A 3O5FA 3CHCA 3RMEA 4AY1A 5I98A 1Q6UA 3ARPA 2IF4A 1TCOC 4MNJA 1JNEA 4WKAA 1FKGA 1HKIA 2G41A 3RFWA 4MSPA 4DRJA 1W9VA 3ARXA 2KO7A 4URIA 1BKFA 3WL0A 4IT4A 3JYMA 3G6MA 2K8IA 3TC5A 2KGJA 2YBUA 1J6YA 4IT6A 3ARUA 4Z2JA 3KABA 1GRJA 3KCEA 5BXJA 1A7XA 1F8AB 2YBTA 1FKKA 5HT1A 1WB0A 2DG3A 3NTPA 3O5OA 1HKJA 4NNRA 4S3KA 3KADA 5DEZA 4WKFA 2XP8A 1JVWA 4P8VA 3KZ7A 5HW7A 1KT0A 1K9TA 2A3CA 4HARA 3CGMA 3JYJA 1J4IA 3IK8A 4G2PA 2WM0A 1FKDA 4QT2A 3O5RA 2F23A 2DG9A 4Q7NA 4Z2LA 4HBOA 1QZ2A 3AS2A 3O5MA 4J4OA 1HXVA 1XHGA 4JYSA 1JNDA 1T11A 4ZS6A 4W9OA 2XP9A 3O5GA 2LJ4A 4R5EA 3B9DA 3GPKA 3ALFA 5HW6A 3PA7A 3AS0A 2RURA 1W1TA 4MAVA 4MPKA 3NI6A 4QT3A 3TDBA 1FJDA 1YW5A 1FKTA 1NWRA 1QPFA 3G6LA 3KAFA 2RUDA 2ITKA 3KAGA 3WIJA 2KFWA 2PBCA 4WJXA 1NMWA 1SYTA 2DPEA 1E15A 2RQSA 2DSWA 3WD4A 3MDYB 2XPBA 3ALGA 4TYOA 2A3EA 4DRPA 1W9PA 2OLHA 2JZVA 2MF9A 3UF8A 2QF8A 4IQCA 4ODMA 4Z2IA 1W1VA 4Z2HA 2KI3A 4O2TA 2AWGA 2RSEA 1NMVA 1ROUA 2Y78A 1H0GA 3RM9A 4MTVA 2MLZA 4IPXA 4TNSA 3ARTA 3VAWA 2WK2A 1ZB5A 3WQWA 1EIBA 4S3JA 4TX0A 1FKLA 4KQZA 2XPAA 4LAYA 5DO2A 1F40A 5HWCA 2VN1A 1LG1A 4JFLA 3OOBA 3UQBA 2AOSA 2D9FA 4W9PA 5HW8A 2N87A 1W1YA 3RGCA 1FFQA 4N19A 1W9UA 1FKFA 1M5YA 1Q6IA 1CTNA 2F21A 3BMBA 4DROA 1ITXA 2ESCA 3ARQA 1LL4A 3IHZA 2WLZA 4PTMA 1RD6A 2DT0A 3EY6A 1J4HA 5JH8A 2PPPA 1FKRA 4LAVA 3GTYX 4DWSA 3UQIA 4Z2GA 3AS1A 3AQUA 4Z2KA 3WKZA 4DZ3A 3B9AA 3O5PA 4WKHA 1LJYA 3KAIA 4XAKA 4JFMA 4U84A 3ARVA 3O5DA 2ETNA 1H0IA 1Y0OA 3W4RA 4LAXA 4DRNA 4JFIA 2ZR4A 1GPFA 3RM4A 1FD9A 5DITA 1D7IA 3CHFA 4WIWA 3LUOA 4MNMA 1JCHB 1E44A 1TFVA 2G8ZA 1W1PA 2PI6A 1GOIA 4C02B 2ZQTA 1KT1A 1R9HA 2MNTA 5HBFA 4P8XA 4WK9A 1E9LA 2O92A 2KR7A 4DWSD 3ARZA 1OGBA 4GGQA 4ODRA 1EQ3A 4LAWA 1YATA 5J6EA 3AROA 3RM8A 3UQAA 4ODPA 5HUAA 4ZPTR 4W5UA 3WQVA 4HBEA 1ZBWA 4ZPWR 1ZCNA 2RUQA 4DIPA 1E6RA 1HJVA 4DWSB 3CGNA 3WD3A 2Q5AA 1E6PA 1D6OA 2PPNA 2UZ5A 1W26A 1HKMA 3B8SA 5GPGA 1JNSA 1EYMA 3O5IA 2PPOA 4TW8A 1IX5A 2DG4A 2ZQSA 2ZR5A 2M08A 3ARWA 3UI6A 3B9EA 5B8IC 1FKBA 3H9RB 4U86A 4L3NA 5HKGA 2F2DA 3JXVA 1KFWA 5D75A 1NH6A 4J4NA 2PN0A 4R0XA 4BF8A 1Q6HA 3CHEA 4IQ2A 3B7XA 1EHNA 1N1AA 1NSGA 5DIVA 2RUCA 4TW7A 1QPLA 1P5QA 4ODKA 2B31A 5HWBA 1B6CA 1ZBCA 1FFRA 1J4RA 3O5EA 2EULA 1X6NA 2M2AA 4U85A 3WH0A 4W9QA 3WD0A 1LL7A 2PV3A 4DZ2A 1ZBVA 4DRQA 3PRDA 2M1IA 2OFNA 3WL1A 3ARYA 3WD1A 3IKDA 3PRAA 5DF0A 4Q22A 3UI5A 3IKGA 2ZR6A 1PINA 3TCZA 4ODLA 4ODNA 3O5QA 1HJXA 3CZ8A 1ROTA 1L1PA 1GUVA 3OA5A 1UR8A 3ARRA 1BL4A 1C9HA 2LGOA 2DT1A 4MNLA 2XP7A 4MGVA 5GQBA 1JNTA 4ODOA 2KE0A 1EDQA 3QOKA 2PV2A 1WAWA 1FKIA 3PR9A 2A3BA 4ML4A 2B5UB 2FDMA 3FAPA 2XP4A 1NWUA 4DRKA 1D7HA 2XP3A 2DSZA 1ZK6A 1XRVA 3O5LA 1E6NA 5HTGA 3CH9A 4QIBA 1ZL1A 4JFJA 4FN2A 4LGXA 4L72B 2MLYA 2FKEA 3ARSA 1O6IA 1LG2A 1D2KA 3I6CA 2LKNA 3EIPA 1Q1CA 4DRMA 3O5KA 1U79A 4TW6A 2F4EA 4ITZA 3O5JA 2PV1A 3FXYA 2DSVA 1PBKA 4JFKA 5GPRA 4ODQA 2IUZA 1FKSA 1WNOA 1X6LA 2XP6A 1FKHA 1HJWA 2VCDA 1HKKA 3GU0A 3NRKA 4QZVB 1OWQA 4P8UA 1OGGA 3BXWA 1VF8A 2ZQVA 1NWTA 1UR9A 1ZU8A 2L2SA 4DWSC 2O9OA 2FAPA 1NWSA 1LL6A 1ZBKA 2P4VA 2ZQUA 3KAHA 2A3AA 4NZCA 3PRBA 4G50A 2XP5A 4NSBA 4P8WA 1E6ZA 1FKJA 2DT3A 1D7JA 3ODKA 4DH0A 4UDMA 4DT4A
chains in the Genus database with same CATH topology
2LPVA 2DT2A 3UI4A 4MNKA 1FAPA 4FAPA 2WLYA 3WD2A 1SR0A 4ZPVR 3FY1A 5DIUA 2MPHA 2DSUA 3AS3A 3KACA 4DRIA 2MLXA 4DRHA 3CHDA 4KR0B 4GIVA 1LQ0A 3O5FA 3CHCA 4AY1A 5I98A 1Q6UA 3ARPA 2IF4A 1TCOC 4MNJA 1JNEA 4WKAA 1FKGA 1HKIA 2G41A 3RFWA 4MSPA 4DRJA 1W9VA 3ARXA 2KO7A 4URIA 1BKFA 3WL0A 4IT4A 3JYMA 3G6MA 2K8IA 3TC5A 2KGJA 2YBUA 1J6YA 4IT6A 3ARUA 4Z2JA 3KABA 3KCEA 5BXJA 1A7XA 1F8AB 2YBTA 1FKKA 5HT1A 1WB0A 2DG3A 3NTPA 3O5OA 1HKJA 4NNRA 4S3KA 3KADA 5DEZA 4WKFA 2XP8A 1JVWA 4P8VA 3KZ7A 5HW7A 1KT0A 1K9TA 2A3CA 4HARA 3CGMA 3JYJA 1J4IA 3IK8A 4G2PA 2WM0A 1FKDA 4QT2A 3O5RA 2DG9A 4Q7NA 4Z2LA 4HBOA 1QZ2A 3AS2A 3O5MA 4J4OA 1HXVA 1XHGA 4JYSA 1JNDA 1T11A 4ZS6A 4W9OA 2XP9A 3O5GA 2LJ4A 4R5EA 3B9DA 3GPKA 3ALFA 5HW6A 3PA7A 3AS0A 2RURA 1W1TA 4MAVA 4MPKA 3NI6A 4QT3A 3TDBA 1FJDA 1YW5A 1FKTA 1NWRA 1QPFA 3G6LA 3KAFA 2RUDA 2ITKA 3KAGA 3WIJA 2KFWA 2PBCA 4WJXA 1NMWA 1SYTA 2DPEA 1E15A 2RQSA 2DSWA 3WD4A 3MDYB 2XPBA 3ALGA 4TYOA 2A3EA 4DRPA 1W9PA 2OLHA 2JZVA 2MF9A 3UF8A 2QF8A 4IQCA 4ODMA 4Z2IA 1W1VA 4Z2HA 2KI3A 4O2TA 2AWGA 2RSEA 1NMVA 1ROUA 2Y78A 1H0GA 3RM9A 4MTVA 2MLZA 4IPXA 4TNSA 3ARTA 3VAWA 2WK2A 1ZB5A 3WQWA 1EIBA 4S3JA 4TX0A 1FKLA 4KQZA 2XPAA 4LAYA 5DO2A 1F40A 5HWCA 2VN1A 1LG1A 4JFLA 3OOBA 3UQBA 2AOSA 2D9FA 4W9PA 5HW8A 2N87A 1W1YA 3RGCA 1FFQA 4N19A 1W9UA 1FKFA 1M5YA 1Q6IA 1CTNA 2F21A 4DROA 1ITXA 2ESCA 3ARQA 1LL4A 3IHZA 2WLZA 4PTMA 1RD6A 2DT0A 3EY6A 1J4HA 5JH8A 2PPPA 1FKRA 4LAVA 4DWSA 3UQIA 4Z2GA 3AS1A 3AQUA 4Z2KA 3WKZA 4DZ3A 3B9AA 3O5PA 4WKHA 1LJYA 3KAIA 4XAKA 4JFMA 4U84A 3ARVA 3O5DA 1H0IA 1Y0OA 3W4RA 4LAXA 4DRNA 4JFIA 2ZR4A 1GPFA 3RM4A 1FD9A 5DITA 1D7IA 3CHFA 4WIWA 3LUOA 4MNMA 1TFVA 2G8ZA 1W1PA 2PI6A 1GOIA 4C02B 2ZQTA 1KT1A 1R9HA 2MNTA 5HBFA 4P8XA 4WK9A 1E9LA 2O92A 2KR7A 4DWSD 3ARZA 1OGBA 4GGQA 4ODRA 1EQ3A 4LAWA 1YATA 5J6EA 3AROA 3RM8A 3UQAA 4ODPA 5HUAA 4ZPTR 4W5UA 3WQVA 4HBEA 1ZBWA 4ZPWR 1ZCNA 2RUQA 4DIPA 1E6RA 1HJVA 4DWSB 3CGNA 3WD3A 2Q5AA 1E6PA 1D6OA 2PPNA 2UZ5A 1W26A 1HKMA 3B8SA 5GPGA 1JNSA 1EYMA 3O5IA 2PPOA 4TW8A 1IX5A 2DG4A 2ZQSA 2ZR5A 2M08A 3ARWA 3UI6A 3B9EA 5B8IC 1FKBA 3H9RB 4U86A 4L3NA 5HKGA 2F2DA 3JXVA 1KFWA 5D75A 1NH6A 4J4NA 4R0XA 4BF8A 1Q6HA 3CHEA 4IQ2A 3B7XA 1EHNA 1N1AA 1NSGA 5DIVA 2RUCA 4TW7A 1QPLA 1P5QA 4ODKA 2B31A 5HWBA 1B6CA 1ZBCA 1FFRA 1J4RA 3O5EA 1X6NA 2M2AA 4U85A 3WH0A 4W9QA 3WD0A 1LL7A 2PV3A 4DZ2A 1ZBVA 4DRQA 3PRDA 2M1IA 2OFNA 3WL1A 3ARYA 3WD1A 3IKDA 3PRAA 5DF0A 4Q22A 3UI5A 3IKGA 2ZR6A 1PINA 3TCZA 4ODLA 4ODNA 3O5QA 1HJXA 3CZ8A 1ROTA 1L1PA 1GUVA 3OA5A 1UR8A 3ARRA 1BL4A 1C9HA 2LGOA 2DT1A 4MNLA 2XP7A 4MGVA 5GQBA 1JNTA 4ODOA 2KE0A 1EDQA 3QOKA 2PV2A 1WAWA 1FKIA 3PR9A 2A3BA 4ML4A 2FDMA 3FAPA 2XP4A 1NWUA 4DRKA 1D7HA 2XP3A 2DSZA 1ZK6A 1XRVA 3O5LA 1E6NA 5HTGA 3CH9A 4QIBA 1ZL1A 4JFJA 4FN2A 4LGXA 4L72B 2MLYA 2FKEA 3ARSA 1O6IA 1LG2A 1D2KA 3I6CA 2LKNA 1Q1CA 4DRMA 3O5KA 1U79A 4TW6A 2F4EA 4ITZA 3O5JA 2PV1A 3FXYA 2DSVA 1PBKA 4JFKA 5GPRA 4ODQA 2IUZA 1FKSA 1WNOA 1X6LA 2XP6A 1FKHA 1HJWA 2VCDA 1HKKA 3NRKA 4QZVB 1OWQA 4P8UA 1OGGA 3BXWA 1VF8A 2ZQVA 1NWTA 1UR9A 1ZU8A 2L2SA 4DWSC 2O9OA 2FAPA 1NWSA 1LL6A 1ZBKA 2ZQUA 3KAHA 2A3AA 4NZCA 3PRBA 4G50A 2XP5A 4NSBA 4P8WA 1E6ZA 1FKJA 2DT3A 1D7JA 3ODKA 4DH0A 3RMEA 4DT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LPV A;  1D7I A;  3NI6 A;  5DIT A;  2PV3 A;  4QT3 A;  3UI4 A;  3TDB A;  3LUO A;  1FJD A;  1FAP A;  1YW5 A;  1FKT A;  4DZ2 A;  4FAP A;  1QPF A;  4DRQ A;  3PRD A;  2M1I A;  2OFN A;  3KAF A;  2RUD A;  5DIU A;  2MPH A;  2ITK A;  3KAG A;  2KFW A;  2PBC A;  3KAC A;  3IKD A;  4DRI A;  3UI5 A;  1NMW A;  3IKG A;  2ZR6 A;  4C02 B;  1PIN A;  2MLX A;  4DRH A;  3TCZ A;  2ZQT A;  1KT1 A;  1R9H A;  4GIV A;  4ODL A;  4ODN A;  3O5Q A;  2MNT A;  2RQS A;  3MDY B;  3O5F A;  2XPB A;  1ROT A;  4TYO A;  1L1P A;  5I98 A;  4DRP A;  1Q6U A;  1BL4 A;  1C9H A;  2JZV A;  2LGO A;  2KR7 A;  2MF9 A;  3UF8 A;  2XP7 A;  2IF4 A;  1TCO C;  4IQC A;  4MGV A;  1JNT A;  4ODM A;  4ODO A;  4GGQ A;  3WH0 A;  1FKG A;  2KE0 A;  4ODR A;  1EQ3 A;  2PV2 A;  4LAW A;  1YAT A;  1FKI A;  5J6E A;  3RFW A;  4MSP A;  3UQA A;  2KI3 A;  4O2T A;  2AWG A;  4ODP A;  4DRJ A;  2RSE A;  5HUA A;  1NMV A;  1ROU A;  2KO7 A;  2Y78 A;  3FAP A;  1BKF A;  2XP4 A;  2MLZ A;  3JYM A;  4IPX A;  4N19 A;  2K8I A;  1ZCN A;  4TNS A;  3TC5 A;  4DT4 A;  2KGJ A;  2RUQ A;  4DRK A;  1D7H A;  2XP3 A;  3VAW A;  1ZK6 A;  1J6Y A;  3KAB A;  3O5L A;  5HTG A;  4DIP A;  3KCE A;  5BXJ A;  1A7X A;  1F8A B;  3CGN A;  4QIB A;  2Q5A A;  1FKK A;  4TX0 A;  5HT1 A;  4JFJ A;  4FN2 A;  2DG3 A;  2MLY A;  1D6O A;  1FKL A;  2XPA A;  3NTP A;  3O5O A;  4LAY A;  4NNR A;  1F40 A;  2FKE A;  2PPN A;  2UZ5 A;  3KAD A;  5HWC A;  2VN1 A;  3I6C A;  2XP8 A;  4JFL A;  1JVW A;  3OOB A;  1W26 A;  3UQB A;  2D9F A;  3KZ7 A;  2LKN A;  4W9P A;  5HW8 A;  5HW7 A;  1Q1C A;  2N87 A;  1KT0 A;  5GPG A;  3O5K A;  3RGC A;  4DRM A;  1U79 A;  4TW6 A;  1JNS A;  1EYM A;  2F4E A;  4ITZ A;  3CGM A;  3JYJ A;  1FKF A;  1M5Y A;  1J4I A;  1Q6I A;  2PPO A;  2PV1 A;  3IK8 A;  3O5J A;  1PBK A;  4TW8 A;  2DG4 A;  2ZQS A;  4JFK A;  4ODQ A;  2ZR5 A;  2F21 A;  1FKS A;  2M08 A;  4G2P A;  1FKD A;  4QT2 A;  3O5R A;  2XP6 A;  4DRO A;  1FKH A;  3O5I A;  2VCD A;  3UI6 A;  3IHZ A;  5B8I C;  2DG9 A;  3NRK A;  1FKB A;  3H9R B;  4U86 A;  1QZ2 A;  3EY6 A;  2F2D A;  1J4H A;  5HKG A;  3O5M A;  4J4O A;  1HXV A;  3JXV A;  4JYS A;  1T11 A;  2ZQV A;  2PPP A;  1FKR A;  5D75 A;  4LAV A;  4W9O A;  2XP9 A;  3UQI A;  2L2S A;  2FAP A;  4J4N A;  4R0X A;  4BF8 A;  1Q6H A;  3O5P A;  3O5G A;  4IQ2 A;  2LJ4 A;  4DZ3 A;  3B7X A;  1N1A A;  3KAI A;  1NSG A;  2ZQU A;  3GPK A;  2RUC A;  3KAH A;  1QPL A;  4JFM A;  4TW7 A;  4U84 A;  5DIV A;  3O5D A;  1P5Q A;  3PRB A;  4ODK A;  5HW6 A;  4G50 A;  2XP5 A;  1Y0O A;  5HWB A;  1B6C A;  3PA7 A;  1FKJ A;  4LAX A;  1J4R A;  4JFI A;  4DRN A;  3O5E A;  2RUR A;  2ZR4 A;  1D7J A;  3ODK A;  4DH0 A;  1FD9 A;  2M2A A;  4U85 A;  4W9Q A; 
#chains in the Genus database with same CATH topology
 2LPV A;  2DT2 A;  3UI4 A;  4MNK A;  1FAP A;  4FAP A;  2WLY A;  3WD2 A;  1SR0 A;  4ZPV R;  3FY1 A;  5DIU A;  2MPH A;  2DSU A;  3AS3 A;  3KAC A;  4DRI A;  2MLX A;  4DRH A;  3CHD A;  4KR0 B;  4GIV A;  1LQ0 A;  3O5F A;  3CHC A;  3RME A;  4AY1 A;  5I98 A;  1Q6U A;  3ARP A;  2IF4 A;  1TCO C;  4MNJ A;  1JNE A;  4WKA A;  1FKG A;  1HKI A;  2G41 A;  3RFW A;  4MSP A;  4DRJ A;  1W9V A;  3ARX A;  2KO7 A;  4URI A;  1BKF A;  3WL0 A;  4IT4 A;  3JYM A;  3G6M A;  2K8I A;  3TC5 A;  2KGJ A;  2YBU A;  1J6Y A;  4IT6 A;  3ARU A;  4Z2J A;  3KAB A;  1GRJ A;  3KCE A;  5BXJ A;  1A7X A;  1F8A B;  2YBT A;  1FKK A;  5HT1 A;  1WB0 A;  2DG3 A;  3NTP A;  3O5O A;  1HKJ A;  4NNR A;  4S3K A;  3KAD A;  5DEZ A;  4WKF A;  2XP8 A;  1JVW A;  4P8V A;  3KZ7 A;  5HW7 A;  1KT0 A;  1K9T A;  2A3C A;  4HAR A;  3CGM A;  3JYJ A;  1J4I A;  3IK8 A;  4G2P A;  2WM0 A;  1FKD A;  4QT2 A;  3O5R A;  2F23 A;  2DG9 A;  4Q7N A;  4Z2L A;  4HBO A;  1QZ2 A;  3AS2 A;  3O5M A;  4J4O A;  1HXV A;  1XHG A;  4JYS A;  1JND A;  1T11 A;  4ZS6 A;  4W9O A;  2XP9 A;  3O5G A;  2LJ4 A;  4R5E A;  3B9D A;  3GPK A;  3ALF A;  5HW6 A;  3PA7 A;  3AS0 A;  2RUR A;  1W1T A;  4MAV A;  4MPK A;  3NI6 A;  4QT3 A;  3TDB A;  1FJD A;  1YW5 A;  1FKT A;  1NWR A;  1QPF A;  3G6L A;  3KAF A;  2RUD A;  2ITK A;  3KAG A;  3WIJ A;  2KFW A;  2PBC A;  4WJX A;  1NMW A;  1SYT A;  2DPE A;  1E15 A;  2RQS A;  2DSW A;  3WD4 A;  3MDY B;  2XPB A;  3ALG A;  4TYO A;  2A3E A;  4DRP A;  1W9P A;  2OLH A;  2JZV A;  2MF9 A;  3UF8 A;  2QF8 A;  4IQC A;  4ODM A;  4Z2I A;  1W1V A;  4Z2H A;  2KI3 A;  4O2T A;  2AWG A;  2RSE A;  1NMV A;  1ROU A;  2Y78 A;  1H0G A;  3RM9 A;  4MTV A;  2MLZ A;  4IPX A;  4TNS A;  3ART A;  3VAW A;  2WK2 A;  1ZB5 A;  3WQW A;  1EIB A;  4S3J A;  4TX0 A;  1FKL A;  4KQZ A;  2XPA A;  4LAY A;  5DO2 A;  1F40 A;  5HWC A;  2VN1 A;  1LG1 A;  4JFL A;  3OOB A;  3UQB A;  2AOS A;  2D9F A;  4W9P A;  5HW8 A;  2N87 A;  1W1Y A;  3RGC A;  1FFQ A;  4N19 A;  1W9U A;  1FKF A;  1M5Y A;  1Q6I A;  1CTN A;  2F21 A;  3BMB A;  4DRO A;  1ITX A;  2ESC A;  3ARQ A;  1LL4 A;  3IHZ A;  2WLZ A;  4PTM A;  1RD6 A;  2DT0 A;  3EY6 A;  1J4H A;  5JH8 A;  2PPP A;  1FKR A;  4LAV A;  3GTY X;  4DWS A;  3UQI A;  4Z2G A;  3AS1 A;  3AQU A;  4Z2K A;  3WKZ A;  4DZ3 A;  3B9A A;  3O5P A;  4WKH A;  1LJY A;  3KAI A;  4XAK A;  4JFM A;  4U84 A;  3ARV A;  3O5D A;  2ETN A;  1H0I A;  1Y0O A;  3W4R A;  4LAX A;  4DRN A;  4JFI A;  2ZR4 A;  1GPF A;  3RM4 A;  1FD9 A;  5DIT A;  1D7I A;  3CHF A;  4WIW A;  3LUO A;  4MNM A;  1JCH B;  1E44 A;  1TFV A;  2G8Z A;  1W1P A;  2PI6 A;  1GOI A;  4C02 B;  2ZQT A;  1KT1 A;  1R9H A;  2MNT A;  5HBF A;  4P8X A;  4WK9 A;  1E9L A;  2O92 A;  2KR7 A;  4DWS D;  3ARZ A;  1OGB A;  4GGQ A;  4ODR A;  1EQ3 A;  4LAW A;  1YAT A;  5J6E A;  3ARO A;  3RM8 A;  3UQA A;  4ODP A;  5HUA A;  4ZPT R;  4W5U A;  3WQV A;  4HBE A;  1ZBW A;  4ZPW R;  1ZCN A;  2RUQ A;  4DIP A;  1E6R A;  1HJV A;  4DWS B;  3CGN A;  3WD3 A;  2Q5A A;  1E6P A;  1D6O A;  2PPN A;  2UZ5 A;  1W26 A;  1HKM A;  3B8S A;  5GPG A;  1JNS A;  1EYM A;  3O5I A;  2PPO A;  4TW8 A;  1IX5 A;  2DG4 A;  2ZQS A;  2ZR5 A;  2M08 A;  3ARW A;  3UI6 A;  3B9E A;  5B8I C;  1FKB A;  3H9R B;  4U86 A;  4L3N A;  5HKG A;  2F2D A;  3JXV A;  1KFW A;  5D75 A;  1NH6 A;  4J4N A;  2PN0 A;  4R0X A;  4BF8 A;  1Q6H A;  3CHE A;  4IQ2 A;  3B7X A;  1EHN A;  1N1A A;  1NSG A;  5DIV A;  2RUC A;  4TW7 A;  1QPL A;  1P5Q A;  4ODK A;  2B31 A;  5HWB A;  1B6C A;  1ZBC A;  1FFR A;  1J4R A;  3O5E A;  2EUL A;  1X6N A;  2M2A A;  4U85 A;  3WH0 A;  4W9Q A;  3WD0 A;  1LL7 A;  2PV3 A;  4DZ2 A;  1ZBV A;  4DRQ A;  3PRD A;  2M1I A;  2OFN A;  3WL1 A;  3ARY A;  3WD1 A;  3IKD A;  3PRA A;  5DF0 A;  4Q22 A;  3UI5 A;  3IKG A;  2ZR6 A;  1PIN A;  3TCZ A;  4ODL A;  4ODN A;  3O5Q A;  1HJX A;  3CZ8 A;  1ROT A;  1L1P A;  1GUV A;  3OA5 A;  1UR8 A;  3ARR A;  1BL4 A;  1C9H A;  2LGO A;  2DT1 A;  4MNL A;  2XP7 A;  4MGV A;  5GQB A;  1JNT A;  4ODO A;  2KE0 A;  1EDQ A;  3QOK A;  2PV2 A;  1WAW A;  1FKI A;  3PR9 A;  2A3B A;  4ML4 A;  2B5U B;  2FDM A;  3FAP A;  2XP4 A;  1NWU A;  4DRK A;  1D7H A;  2XP3 A;  2DSZ A;  1ZK6 A;  1XRV A;  3O5L A;  1E6N A;  5HTG A;  3CH9 A;  4QIB A;  1ZL1 A;  4JFJ A;  4FN2 A;  4LGX A;  4L72 B;  2MLY A;  2FKE A;  3ARS A;  1O6I A;  1LG2 A;  1D2K A;  3I6C A;  2LKN A;  3EIP A;  1Q1C A;  4DRM A;  3O5K A;  1U79 A;  4TW6 A;  2F4E A;  4ITZ A;  3O5J A;  2PV1 A;  3FXY A;  2DSV A;  1PBK A;  4JFK A;  5GPR A;  4ODQ A;  2IUZ A;  1FKS A;  1WNO A;  1X6L A;  2XP6 A;  1FKH A;  1HJW A;  2VCD A;  1HKK A;  3GU0 A;  3NRK A;  4QZV B;  1OWQ A;  4P8U A;  1OGG A;  3BXW A;  1VF8 A;  2ZQV A;  1NWT A;  1UR9 A;  1ZU8 A;  2L2S A;  4DWS C;  2O9O A;  2FAP A;  1NWS A;  1LL6 A;  1ZBK A;  2P4V A;  2ZQU A;  3KAH A;  2A3A A;  4NZC A;  3PRB A;  4G50 A;  2XP5 A;  4NSB A;  4P8W A;  1E6Z A;  1FKJ A;  2DT3 A;  1D7J A;  3ODK A;  4DH0 A;  4UDM A;  4DT4 A; 
#chains in the Genus database with same CATH homology
 2LPV A;  2DT2 A;  3UI4 A;  4MNK A;  1FAP A;  4FAP A;  2WLY A;  3WD2 A;  1SR0 A;  4ZPV R;  3FY1 A;  5DIU A;  2MPH A;  2DSU A;  3AS3 A;  3KAC A;  4DRI A;  2MLX A;  4DRH A;  3CHD A;  4KR0 B;  4GIV A;  1LQ0 A;  3O5F A;  3CHC A;  4AY1 A;  5I98 A;  1Q6U A;  3ARP A;  2IF4 A;  1TCO C;  4MNJ A;  1JNE A;  4WKA A;  1FKG A;  1HKI A;  2G41 A;  3RFW A;  4MSP A;  4DRJ A;  1W9V A;  3ARX A;  2KO7 A;  4URI A;  1BKF A;  3WL0 A;  4IT4 A;  3JYM A;  3G6M A;  2K8I A;  3TC5 A;  2KGJ A;  2YBU A;  1J6Y A;  4IT6 A;  3ARU A;  4Z2J A;  3KAB A;  3KCE A;  5BXJ A;  1A7X A;  1F8A B;  2YBT A;  1FKK A;  5HT1 A;  1WB0 A;  2DG3 A;  3NTP A;  3O5O A;  1HKJ A;  4NNR A;  4S3K A;  3KAD A;  5DEZ A;  4WKF A;  2XP8 A;  1JVW A;  4P8V A;  3KZ7 A;  5HW7 A;  1KT0 A;  1K9T A;  2A3C A;  4HAR A;  3CGM A;  3JYJ A;  1J4I A;  3IK8 A;  4G2P A;  2WM0 A;  1FKD A;  4QT2 A;  3O5R A;  2DG9 A;  4Q7N A;  4Z2L A;  4HBO A;  1QZ2 A;  3AS2 A;  3O5M A;  4J4O A;  1HXV A;  1XHG A;  4JYS A;  1JND A;  1T11 A;  4ZS6 A;  4W9O A;  2XP9 A;  3O5G A;  2LJ4 A;  4R5E A;  3B9D A;  3GPK A;  3ALF A;  5HW6 A;  3PA7 A;  3AS0 A;  2RUR A;  1W1T A;  4MAV A;  4MPK A;  3NI6 A;  4QT3 A;  3TDB A;  1FJD A;  1YW5 A;  1FKT A;  1NWR A;  1QPF A;  3G6L A;  3KAF A;  2RUD A;  2ITK A;  3KAG A;  3WIJ A;  2KFW A;  2PBC A;  4WJX A;  1NMW A;  1SYT A;  2DPE A;  1E15 A;  2RQS A;  2DSW A;  3WD4 A;  3MDY B;  2XPB A;  3ALG A;  4TYO A;  2A3E A;  4DRP A;  1W9P A;  2OLH A;  2JZV A;  2MF9 A;  3UF8 A;  2QF8 A;  4IQC A;  4ODM A;  4Z2I A;  1W1V A;  4Z2H A;  2KI3 A;  4O2T A;  2AWG A;  2RSE A;  1NMV A;  1ROU A;  2Y78 A;  1H0G A;  3RM9 A;  4MTV A;  2MLZ A;  4IPX A;  4TNS A;  3ART A;  3VAW A;  2WK2 A;  1ZB5 A;  3WQW A;  1EIB A;  4S3J A;  4TX0 A;  1FKL A;  4KQZ A;  2XPA A;  4LAY A;  5DO2 A;  1F40 A;  5HWC A;  2VN1 A;  1LG1 A;  4JFL A;  3OOB A;  3UQB A;  2AOS A;  2D9F A;  4W9P A;  5HW8 A;  2N87 A;  1W1Y A;  3RGC A;  1FFQ A;  4N19 A;  1W9U A;  1FKF A;  1M5Y A;  1Q6I A;  1CTN A;  2F21 A;  4DRO A;  1ITX A;  2ESC A;  3ARQ A;  1LL4 A;  3IHZ A;  2WLZ A;  4PTM A;  1RD6 A;  2DT0 A;  3EY6 A;  1J4H A;  5JH8 A;  2PPP A;  1FKR A;  4LAV A;  4DWS A;  3UQI A;  4Z2G A;  3AS1 A;  3AQU A;  4Z2K A;  3WKZ A;  4DZ3 A;  3B9A A;  3O5P A;  4WKH A;  1LJY A;  3KAI A;  4XAK A;  4JFM A;  4U84 A;  3ARV A;  3O5D A;  1H0I A;  1Y0O A;  3W4R A;  4LAX A;  4DRN A;  4JFI A;  2ZR4 A;  1GPF A;  3RM4 A;  1FD9 A;  5DIT A;  1D7I A;  3CHF A;  4WIW A;  3LUO A;  4MNM A;  1TFV A;  2G8Z A;  1W1P A;  2PI6 A;  1GOI A;  4C02 B;  2ZQT A;  1KT1 A;  1R9H A;  2MNT A;  5HBF A;  4P8X A;  4WK9 A;  1E9L A;  2O92 A;  2KR7 A;  4DWS D;  3ARZ A;  1OGB A;  4GGQ A;  4ODR A;  1EQ3 A;  4LAW A;  1YAT A;  5J6E A;  3ARO A;  3RM8 A;  3UQA A;  4ODP A;  5HUA A;  4ZPT R;  4W5U A;  3WQV A;  4HBE A;  1ZBW A;  4ZPW R;  1ZCN A;  2RUQ A;  4DIP A;  1E6R A;  1HJV A;  4DWS B;  3CGN A;  3WD3 A;  2Q5A A;  1E6P A;  1D6O A;  2PPN A;  2UZ5 A;  1W26 A;  1HKM A;  3B8S A;  5GPG A;  1JNS A;  1EYM A;  3O5I A;  2PPO A;  4TW8 A;  1IX5 A;  2DG4 A;  2ZQS A;  2ZR5 A;  2M08 A;  3ARW A;  3UI6 A;  3B9E A;  5B8I C;  1FKB A;  3H9R B;  4U86 A;  4L3N A;  5HKG A;  2F2D A;  3JXV A;  1KFW A;  5D75 A;  1NH6 A;  4J4N A;  4R0X A;  4BF8 A;  1Q6H A;  3CHE A;  4IQ2 A;  3B7X A;  1EHN A;  1N1A A;  1NSG A;  5DIV A;  2RUC A;  4TW7 A;  1QPL A;  1P5Q A;  4ODK A;  2B31 A;  5HWB A;  1B6C A;  1ZBC A;  1FFR A;  1J4R A;  3O5E A;  1X6N A;  2M2A A;  4U85 A;  3WH0 A;  4W9Q A;  3WD0 A;  1LL7 A;  2PV3 A;  4DZ2 A;  1ZBV A;  4DRQ A;  3PRD A;  2M1I A;  2OFN A;  3WL1 A;  3ARY A;  3WD1 A;  3IKD A;  3PRA A;  5DF0 A;  4Q22 A;  3UI5 A;  3IKG A;  2ZR6 A;  1PIN A;  3TCZ A;  4ODL A;  4ODN A;  3O5Q A;  1HJX A;  3CZ8 A;  1ROT A;  1L1P A;  1GUV A;  3OA5 A;  1UR8 A;  3ARR A;  1BL4 A;  1C9H A;  2LGO A;  2DT1 A;  4MNL A;  2XP7 A;  4MGV A;  5GQB A;  1JNT A;  4ODO A;  2KE0 A;  1EDQ A;  3QOK A;  2PV2 A;  1WAW A;  1FKI A;  3PR9 A;  2A3B A;  4ML4 A;  2FDM A;  3FAP A;  2XP4 A;  1NWU A;  4DRK A;  1D7H A;  2XP3 A;  2DSZ A;  1ZK6 A;  1XRV A;  3O5L A;  1E6N A;  5HTG A;  3CH9 A;  4QIB A;  1ZL1 A;  4JFJ A;  4FN2 A;  4LGX A;  4L72 B;  2MLY A;  2FKE A;  3ARS A;  1O6I A;  1LG2 A;  1D2K A;  3I6C A;  2LKN A;  1Q1C A;  4DRM A;  3O5K A;  1U79 A;  4TW6 A;  2F4E A;  4ITZ A;  3O5J A;  2PV1 A;  3FXY A;  2DSV A;  1PBK A;  4JFK A;  5GPR A;  4ODQ A;  2IUZ A;  1FKS A;  1WNO A;  1X6L A;  2XP6 A;  1FKH A;  1HJW A;  2VCD A;  1HKK A;  3NRK A;  4QZV B;  1OWQ A;  4P8U A;  1OGG A;  3BXW A;  1VF8 A;  2ZQV A;  1NWT A;  1UR9 A;  1ZU8 A;  2L2S A;  4DWS C;  2O9O A;  2FAP A;  1NWS A;  1LL6 A;  1ZBK A;  2ZQU A;  3KAH A;  2A3A A;  4NZC A;  3PRB A;  4G50 A;  2XP5 A;  4NSB A;  4P8W A;  1E6Z A;  1FKJ A;  2DT3 A;  1D7J A;  3ODK A;  4DH0 A;  3RME A;  4DT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...