3I6CA

Structure-based design of novel pin1 inhibitors (ii)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
113
structure length
113
Chain Sequence
EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-based design of novel human Pin1 inhibitors (II).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 42
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3i6cA00
1ZCNA 5I98A 5DIVA 2VCDA 2F4EA 2MLZA 3UQIA 2FAPA 1J4IA 1F8AB 3NI6A 3JYMA 3B7XA 4DZ3A 3IHZA 3O5FA 2Q5AA 3CGMA 2LKNA 2RUCA 3EY6A 4DRNA 1M5YA 2RQSA 1ROUA 2ZQSA 4JFKA 1NMWA 3NRKA 2PPNA 1FKJA 1FKKA 2RUDA 2Y78A 4LAWA 1Y0OA 1C9HA 1W26A 2RSEA 3IKDA 4J4NA 3ODKA 2MNTA 1D7IA 2N87A 3KAHA 4C02B 1HXVA 3O5RA 4GIVA 2M08A 4TW7A 4LAYA 2ZR4A 4TX0A 4U84A 3RFWA 3GPKA 2OFNA 2PV3A 3H9RB 3JXVA 2XP7A 3O5DA 3O5MA 4LAVA 4U85A 4W9PA 1FKRA 1NSGA 3O5OA 4ODOA 5B8IC 2F21A 1JVWA 4ITZA 1J6YA 3O5GA 1D7HA 3UI5A 1QPLA 2XPBA 3UI4A 1Q1CA 4MGVA 2L2SA 2MLXA 3O5EA 4W9QA 1ROTA 2ZR5A 1PINA 3VAWA 1QPFA 3UQAA 5HW8A 4GGQA 5J6EA 2M1IA 3O5QA 1BL4A 3JYJA 2RUQA 2XP8A 3KACA 4FN2A 4TW6A 2XP6A 2ZQUA 4DRQA 2LGOA 3O5KA 4JFMA 2PV1A 2XP3A 3IKGA 4ODRA 1U79A 3FAPA 2DG9A 3O5PA 1F40A 1FKIA 3KAGA 4U86A 3TC5A 2UZ5A 4DRMA 1QZ2A 1L1PA 1Q6HA 3I6CA 3RGCA 2ZQVA 4JFLA 4LAXA 5GPGA 1BKFA 1JNTA 3UI6A 5DITA 2VN1A 4ODMA 3LUOA 1A7XA 2ZR6A 2XPAA 4J4OA 2IF4A 2XP5A 4IPXA 4DH0A 4BF8A 3KABA 4DRHA 5D75A 2LJ4A 3KZ7A 4DZ2A 1FAPA 4DRIA 4JFJA 1FKLA 4DRPA 1ZK6A 2D9FA 2ITKA 4JYSA 2FKEA 1J4HA 2LPVA 4ODQA 3KADA 1N1AA 1D7JA 2JZVA 1TCOC 3O5LA 4FAPA 1EQ3A 1JNSA 1YATA 5HKGA 5HT1A 1FKSA 3PRDA 1FKGA 4G50A 5HTGA 2KI3A 5HWBA 1FKHA 1Q6UA 3KAIA 3TCZA 4G2PA 3PRBA 4TNSA 1B6CA 2M2AA 4DRJA 2KFWA 1YW5A 4QIBA 4W9OA 5HUAA 4NNRA 4N19A 4DROA 2RURA 2ZQTA 1J4RA 2F2DA 4DIPA 3UF8A 3PA7A 4R0XA 2K8IA 4ODLA 3NTPA 4DT4A 1T11A 1PBKA 2PPOA 2KGJA 5HWCA 2MLYA 2DG4A 4QT3A 5DIUA 3KAFA 4ODKA 4TW8A 1FKBA 1KT0A 1D6OA 2KR7A 3O5IA 3IK8A 4IQ2A 3KCEA 1KT1A 1R9HA 3MDYB 5HW6A 2KO7A 2XP9A 3OOBA 2MF9A 3WH0A 2DG3A 1FKFA 4TYOA 4IQCA 4MSPA 1Q6IA 1FD9A 4O2TA 2MPHA 2AWGA 3UQBA 4DRKA 1EYMA 3CGNA 1FKDA 1NMVA 5HW7A 1FJDA 2KE0A 4ODPA 2XP4A 4JFIA 1FKTA 2PBCA 2PPPA 4ODNA 4QT2A 2PV2A 3O5JA 3TDBA 1P5QA 5BXJA
chains in the Genus database with same CATH superfamily
5DIVA 2MLZA 3RM8A 2A3AA 3UQIA 1E6NA 1JNEA 2LKNA 3GU0A 1ROUA 4JFKA 1NMWA 4LAWA 1NWRA 2RSEA 3ODKA 2MNTA 1D7IA 1OGGA 1LL7A 2N87A 4GIVA 4LAYA 4TX0A 4U84A 1OGBA 4R5EA 2DT2A 3GPKA 3JXVA 3O5DA 1FKRA 4ODOA 3O5GA 1QPLA 2QF8A 3UI4A 1Q1CA 3ARXA 2MLXA 1X6NA 4MGVA 4WK9A 1PINA 1TFVA 1E6PA 1NWTA 1KFWA 2ZQUA 1OWQA 1U79A 2DG9A 3O5PA 4MNJA 4U86A 2UZ5A 4DRMA 4MPKA 1QZ2A 2ZQVA 4LAXA 4MTVA 1BKFA 2DT3A 2ETNA 1H0GA 4KR0B 1LG2A 4HARA 3WL1A 1LL4A 1SR0A 3WIJA 4ODQA 1E44A 1ZBVA 1EQ3A 1FKSA 1FKGA 1IX5A 3ALGA 3AS1A 3TCZA 2WK2A 4MNMA 3W4RA 4TNSA 4W5UA 4DRJA 3GTYX 4NNRA 3G6MA 4WKFA 1J4RA 2F2DA 3PA7A 4R0XA 4ODLA 1T11A 3WKZA 2KGJA 4ML4A 3PR9A 5DIUA 4PTMA 4TW8A 2IUZA 2KR7A 2PI6A 3IK8A 3ARUA 5HW6A 1ZU8A 3WH0A 2MF9A 3G6LA 4MSPA 1Q6IA 4O2TA 1NMVA 5HW7A 2KE0A 4P8UA 4URIA 4ODPA 3ARPA 2XP4A 3AQUA 5BXJA 3BMBA 1ZCNA 4DWSA 5I98A 2DSZA 2FAPA 1J4IA 2O9OA 4DZ3A 4DRNA 2Q5AA 3EY6A 2RUCA 1GPFA 1E15A 3AS3A 4DWSC 1C9HA 4J4NA 1H0IA 3KAHA 3RFWA 2ZR4A 4LAVA 2PV3A 4Z2LA 1L1PA 2XP7A 3B9AA 1UR9A 2PN0A 1GUVA 1NSGA 2FDMA 5B8IC 2F21A 1JVWA 1J6YA 1D7HA 3WQWA 1XRVA 3VAWA 2L2SA 4IT6A 4W9QA 5HW8A 3FY1A 2XP8A 4KQZA 4JFMA 3O5KA 1UR8A 3IKGA 1ZBCA 2B5UB 3FAPA 3WQVA 1JCHB 3RGCA 4JFLA 1HJVA 3UI6A 5DITA 2VN1A 4ODMA 4J4OA 1A7XA 2IF4A 4IPXA 4BF8A 3KABA 5D75A 1FAPA 1ZK6A 2ITKA 2FKEA 2LPVA 1JNSA 5HKGA 1EIBA 4G50A 5HTGA 1E9LA 1FKHA 1WB0A 3PRBA 4W9OA 2DT0A 4N19A 2RURA 3AROA 3CHDA 1GRJA 3NTPA 1PBKA 2PPOA 5HWCA 4QT3A 4ODKA 4L3NA 3O5IA 2EULA 4IQ2A 3ALFA 3KCEA 2KO7A 3OOBA 4AY1A 4P8XA 5GQBA 2G41A 1RD6A 4DRKA 2F23A 1FKTA 4ODNA 3O5JA 4IT4A 1P5QA 2VCDA 1NH6A 4P8WA 1W9UA 5HBFA 3NI6A 2P4VA 2DSUA 3JYMA 3B7XA 3IHZA 2DSWA 1M5YA 1HJXA 2RQSA 4S3KA 3NRKA 2PPNA 1FKJA 3WD0A 1HXVA 4C02B 3WD4A 2M08A 2DSVA 2OFNA 4W9PA 4ITZA 2XPBA 3O5EA 4WIWA 1ROTA 2ZR5A 3UQAA 3ARQA 3ARYA 1ITXA 4GGQA 2M1IA 3O5QA 1BL4A 4QZVB 3JYJA 5J6EA 4Z2KA 3B9EA 2XP6A 4DRQA 4DWSD 3KAGA 4NZCA 3ARWA 1Q6HA 3I6CA 4Q7NA 3CHCA 5GPGA 2DT1A 2AOSA 5JH8A 1LJYA 2XPAA 1SYTA 4DRHA 2WLYA 2LJ4A 3KZ7A 4DZ2A 4DRIA 4JFJA 1FKLA 4UDMA 3ARTA 2D9FA 2A3EA 1W9VA 3KADA 1N1AA 4Z2JA 3O5LA 1TCOC 3WD1A 1YATA 3PRDA 3ARZA 2KI3A 5HWBA 3KAIA 4G2PA 1NWUA 3CZ8A 1B6CA 2M2AA 2KFWA 2A3CA 2OLHA 1HKIA 1HJWA 1GOIA 4ZPVR 4XAKA 2ESCA 2DG4A 4ZPTR 3KAFA 1FKBA 1KT0A 1D6OA 3ARRA 1CTNA 1R9HA 2XP9A 3AS0A 2DG3A 4TYOA 4IQCA 4DWSB 1XHGA 3RM9A 2AWGA 3UQBA 1EYMA 3CGNA 1FKDA 4ZPWR 4Z2IA 4JFIA 2PPPA 1HKMA 1WNOA 1WAWA 2F4EA 4HBEA 5DEZA 4WJXA 4MNLA 1F8AB 3O5FA 4MNKA 3CGMA 5GPRA 2ZQSA 3OA5A 1X6LA 1ZL1A 4P8VA 1FKKA 2RUDA 2Y78A 1Y0OA 1W26A 3IKDA 5DF0A 1EDQA 3O5RA 4TW7A 2YBUA 1FFQA 3H9RB 2YBTA 3B8SA 3O5MA 4U85A 1ZBWA 1ZB5A 3UI5A 1W1YA 1QPFA 1ZBKA 1E6ZA 4LGXA 3CHFA 2RUQA 3KACA 4FN2A 4TW6A 3ARVA 3EIPA 2LGOA 2PV1A 2WLZA 2WM0A 2XP3A 4ODRA 4Z2HA 1F40A 1FKIA 3FXYA 3TC5A 4ZS6A 1W1PA 1HKKA 1E6RA 1K9TA 2O92A 4S3JA 1JNTA 3BXWA 4HBOA 3WD2A 3LUOA 2ZR6A 2XP5A 4DH0A 4WKAA 1W1VA 3CHEA 1O6IA 1LQ0A 4DRPA 4JYSA 1J4HA 1VF8A 1W9PA 2B31A 1D7JA 2JZVA 4FAPA 2A3BA 3WD3A 1HKJA 5HT1A 1EHNA 3WL0A 3RMEA 1Q6UA 1YW5A 4QIBA 5HUAA 3CH9A 4DROA 2ZQTA 4DIPA 1FFRA 3UF8A 1JNDA 2K8IA 1LG1A 4DT4A 1LL6A 3AS2A 1NWSA 2MLYA 2G8ZA 3B9DA 4WKHA 5DO2A 4NSBA 3PRAA 4L72B 3RM4A 1KT1A 3MDYB 1FKFA 4Z2GA 3ARSA 1FD9A 1D2KA 2MPHA 1FJDA 4Q22A 2PBCA 3QOKA 4MAVA 4QT2A 2PV2A 2DPEA 3TDBA 1W1TA 3O5OA
chains in the Genus database with same CATH topology
5DIVA 2MLZA 3RM8A 2A3AA 3UQIA 1E6NA 1JNEA 2LKNA 1ROUA 4JFKA 1NMWA 4LAWA 1NWRA 2RSEA 3ODKA 2MNTA 1D7IA 1OGGA 1LL7A 2N87A 4GIVA 4LAYA 4TX0A 4U84A 1OGBA 4R5EA 2DT2A 3GPKA 3JXVA 3O5DA 1FKRA 4ODOA 3O5GA 1QPLA 2QF8A 3UI4A 1Q1CA 3ARXA 2MLXA 1X6NA 4MGVA 4WK9A 1PINA 1TFVA 1E6PA 1NWTA 1KFWA 2ZQUA 1OWQA 1U79A 2DG9A 3O5PA 4MNJA 4U86A 2UZ5A 4DRMA 4MPKA 1QZ2A 2ZQVA 4LAXA 4MTVA 1BKFA 2DT3A 1H0GA 4KR0B 1LG2A 4HARA 3WL1A 1LL4A 1SR0A 3WIJA 4ODQA 1ZBVA 1EQ3A 1FKSA 1FKGA 1IX5A 3ALGA 3AS1A 3TCZA 2WK2A 4MNMA 3W4RA 4TNSA 4W5UA 4DRJA 4NNRA 3G6MA 4WKFA 1J4RA 2F2DA 3PA7A 4R0XA 4ODLA 1T11A 3WKZA 2KGJA 4ML4A 3PR9A 5DIUA 4PTMA 4TW8A 2IUZA 2KR7A 2PI6A 3IK8A 3ARUA 5HW6A 1ZU8A 3WH0A 2MF9A 3G6LA 4MSPA 1Q6IA 4O2TA 1NMVA 5HW7A 2KE0A 4P8UA 4URIA 4ODPA 3ARPA 2XP4A 3AQUA 5BXJA 1ZCNA 4DWSA 5I98A 2DSZA 2FAPA 1J4IA 2O9OA 4DZ3A 4DRNA 2Q5AA 3EY6A 2RUCA 1GPFA 1E15A 3AS3A 4DWSC 1C9HA 4J4NA 1H0IA 3KAHA 3RFWA 2ZR4A 4LAVA 2PV3A 4Z2LA 1L1PA 2XP7A 3B9AA 1UR9A 1GUVA 1NSGA 2FDMA 5B8IC 2F21A 1JVWA 1J6YA 1D7HA 3WQWA 1XRVA 3VAWA 2L2SA 4IT6A 4W9QA 5HW8A 3FY1A 2XP8A 4KQZA 4JFMA 3O5KA 1UR8A 3IKGA 1ZBCA 3FAPA 3WQVA 3RGCA 4JFLA 1HJVA 3UI6A 5DITA 2VN1A 4ODMA 4J4OA 1A7XA 2IF4A 4IPXA 4BF8A 3KABA 5D75A 1FAPA 1ZK6A 2ITKA 2FKEA 2LPVA 1JNSA 5HKGA 1EIBA 4G50A 5HTGA 1E9LA 1FKHA 1WB0A 3PRBA 4W9OA 2DT0A 4N19A 2RURA 3AROA 3CHDA 3NTPA 1PBKA 2PPOA 5HWCA 4QT3A 4ODKA 4L3NA 3O5IA 4IQ2A 3ALFA 3KCEA 2KO7A 3OOBA 4AY1A 4P8XA 5GQBA 2G41A 1RD6A 4DRKA 1FKTA 4ODNA 3O5JA 4IT4A 1P5QA 2VCDA 1NH6A 4P8WA 1W9UA 5HBFA 3NI6A 2DSUA 3JYMA 3B7XA 3IHZA 2DSWA 1M5YA 1HJXA 2RQSA 4S3KA 3NRKA 2PPNA 1FKJA 3WD0A 1HXVA 4C02B 3WD4A 2M08A 2DSVA 2OFNA 4W9PA 4ITZA 2XPBA 3O5EA 4WIWA 1ROTA 2ZR5A 3UQAA 3ARQA 3ARYA 1ITXA 4GGQA 2M1IA 3O5QA 1BL4A 4QZVB 3JYJA 5J6EA 4Z2KA 3B9EA 2XP6A 4DRQA 4DWSD 3KAGA 4NZCA 3ARWA 1Q6HA 3I6CA 4Q7NA 3CHCA 5GPGA 2DT1A 2AOSA 5JH8A 1LJYA 2XPAA 1SYTA 4DRHA 2WLYA 2LJ4A 3KZ7A 4DZ2A 4DRIA 4JFJA 1FKLA 3ARTA 2D9FA 2A3EA 1W9VA 3KADA 1N1AA 4Z2JA 3O5LA 1TCOC 3WD1A 1YATA 3PRDA 3ARZA 2KI3A 5HWBA 3KAIA 4G2PA 1NWUA 3CZ8A 1B6CA 2M2AA 2KFWA 2A3CA 2OLHA 1HKIA 1HJWA 1GOIA 4ZPVR 4XAKA 2ESCA 2DG4A 4ZPTR 3KAFA 1FKBA 1KT0A 1D6OA 3ARRA 1CTNA 1R9HA 2XP9A 3AS0A 2DG3A 4TYOA 4IQCA 4DWSB 1XHGA 3RM9A 2AWGA 3UQBA 1EYMA 3CGNA 1FKDA 4ZPWR 4Z2IA 4JFIA 2PPPA 1HKMA 1WNOA 1WAWA 2F4EA 4HBEA 5DEZA 4WJXA 4MNLA 1F8AB 3O5FA 4MNKA 3CGMA 5GPRA 2ZQSA 3OA5A 1X6LA 1ZL1A 4P8VA 1FKKA 2RUDA 2Y78A 1Y0OA 1W26A 3IKDA 5DF0A 1EDQA 3O5RA 4TW7A 2YBUA 1FFQA 3H9RB 2YBTA 3B8SA 3O5MA 4U85A 1ZBWA 1ZB5A 3UI5A 1W1YA 1QPFA 1ZBKA 1E6ZA 4LGXA 3CHFA 2RUQA 3KACA 4FN2A 4TW6A 3ARVA 2LGOA 2PV1A 2WLZA 2WM0A 2XP3A 4ODRA 4Z2HA 1F40A 1FKIA 3FXYA 3TC5A 4ZS6A 1W1PA 1HKKA 1E6RA 1K9TA 2O92A 4S3JA 1JNTA 3BXWA 4HBOA 3WD2A 3LUOA 2ZR6A 2XP5A 4DH0A 4WKAA 1W1VA 3CHEA 1O6IA 1LQ0A 4DRPA 4JYSA 1J4HA 1VF8A 1W9PA 2B31A 1D7JA 2JZVA 4FAPA 2A3BA 3WD3A 1HKJA 5HT1A 1EHNA 3WL0A 3RMEA 1Q6UA 1YW5A 4QIBA 5HUAA 3CH9A 4DROA 2ZQTA 4DIPA 1FFRA 3UF8A 1JNDA 2K8IA 1LG1A 4DT4A 1LL6A 3AS2A 1NWSA 2MLYA 2G8ZA 3B9DA 4WKHA 5DO2A 4NSBA 3PRAA 4L72B 3RM4A 1KT1A 3MDYB 1FKFA 4Z2GA 3ARSA 1FD9A 1D2KA 2MPHA 1FJDA 4Q22A 2PBCA 3QOKA 4MAVA 4QT2A 2PV2A 2DPEA 3TDBA 1W1TA 3O5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZCN A;  5I98 A;  5DIV A;  2VCD A;  2F4E A;  2MLZ A;  3UQI A;  2FAP A;  1J4I A;  1F8A B;  3NI6 A;  3JYM A;  3B7X A;  4DZ3 A;  3IHZ A;  3O5F A;  2Q5A A;  3CGM A;  2LKN A;  2RUC A;  3EY6 A;  4DRN A;  1M5Y A;  2RQS A;  1ROU A;  2ZQS A;  4JFK A;  1NMW A;  3NRK A;  2PPN A;  1FKJ A;  1FKK A;  2RUD A;  2Y78 A;  4LAW A;  1Y0O A;  1C9H A;  1W26 A;  2RSE A;  3IKD A;  4J4N A;  3ODK A;  2MNT A;  1D7I A;  2N87 A;  3KAH A;  4C02 B;  1HXV A;  3O5R A;  4GIV A;  2M08 A;  4TW7 A;  4LAY A;  2ZR4 A;  4TX0 A;  4U84 A;  3RFW A;  3GPK A;  2OFN A;  2PV3 A;  3H9R B;  3JXV A;  2XP7 A;  3O5D A;  3O5M A;  4LAV A;  4U85 A;  4W9P A;  1FKR A;  1NSG A;  3O5O A;  4ODO A;  5B8I C;  2F21 A;  1JVW A;  4ITZ A;  1J6Y A;  3O5G A;  1D7H A;  3UI5 A;  1QPL A;  2XPB A;  3UI4 A;  1Q1C A;  4MGV A;  2L2S A;  2MLX A;  3O5E A;  4W9Q A;  1ROT A;  2ZR5 A;  1PIN A;  3VAW A;  1QPF A;  3UQA A;  5HW8 A;  4GGQ A;  5J6E A;  2M1I A;  3O5Q A;  1BL4 A;  3JYJ A;  2RUQ A;  2XP8 A;  3KAC A;  4FN2 A;  4TW6 A;  2XP6 A;  2ZQU A;  4DRQ A;  2LGO A;  3O5K A;  4JFM A;  2PV1 A;  2XP3 A;  3IKG A;  4ODR A;  1U79 A;  3FAP A;  2DG9 A;  3O5P A;  1F40 A;  1FKI A;  3KAG A;  4U86 A;  3TC5 A;  2UZ5 A;  4DRM A;  1QZ2 A;  1L1P A;  1Q6H A;  3I6C A;  3RGC A;  2ZQV A;  4JFL A;  4LAX A;  5GPG A;  1BKF A;  1JNT A;  3UI6 A;  5DIT A;  2VN1 A;  4ODM A;  3LUO A;  1A7X A;  2ZR6 A;  2XPA A;  4J4O A;  2IF4 A;  2XP5 A;  4IPX A;  4DH0 A;  4BF8 A;  3KAB A;  4DRH A;  5D75 A;  2LJ4 A;  3KZ7 A;  4DZ2 A;  1FAP A;  4DRI A;  4JFJ A;  1FKL A;  4DRP A;  1ZK6 A;  2D9F A;  2ITK A;  4JYS A;  2FKE A;  1J4H A;  2LPV A;  4ODQ A;  3KAD A;  1N1A A;  1D7J A;  2JZV A;  1TCO C;  3O5L A;  4FAP A;  1EQ3 A;  1JNS A;  1YAT A;  5HKG A;  5HT1 A;  1FKS A;  3PRD A;  1FKG A;  4G50 A;  5HTG A;  2KI3 A;  5HWB A;  1FKH A;  1Q6U A;  3KAI A;  3TCZ A;  4G2P A;  3PRB A;  4TNS A;  1B6C A;  2M2A A;  4DRJ A;  2KFW A;  1YW5 A;  4QIB A;  4W9O A;  5HUA A;  4NNR A;  4N19 A;  4DRO A;  2RUR A;  2ZQT A;  1J4R A;  2F2D A;  4DIP A;  3UF8 A;  3PA7 A;  4R0X A;  2K8I A;  4ODL A;  3NTP A;  4DT4 A;  1T11 A;  1PBK A;  2PPO A;  2KGJ A;  5HWC A;  2MLY A;  2DG4 A;  4QT3 A;  5DIU A;  3KAF A;  4ODK A;  4TW8 A;  1FKB A;  1KT0 A;  1D6O A;  2KR7 A;  3O5I A;  3IK8 A;  4IQ2 A;  3KCE A;  1KT1 A;  1R9H A;  3MDY B;  5HW6 A;  2KO7 A;  2XP9 A;  3OOB A;  2MF9 A;  3WH0 A;  2DG3 A;  1FKF A;  4TYO A;  4IQC A;  4MSP A;  1Q6I A;  1FD9 A;  4O2T A;  2MPH A;  2AWG A;  3UQB A;  4DRK A;  1EYM A;  3CGN A;  1FKD A;  1NMV A;  5HW7 A;  1FJD A;  2KE0 A;  4ODP A;  2XP4 A;  4JFI A;  1FKT A;  2PBC A;  2PPP A;  4ODN A;  4QT2 A;  2PV2 A;  3O5J A;  3TDB A;  1P5Q A;  5BXJ A; 
#chains in the Genus database with same CATH topology
 5DIV A;  2MLZ A;  3RM8 A;  2A3A A;  3UQI A;  1E6N A;  1JNE A;  2LKN A;  3GU0 A;  1ROU A;  4JFK A;  1NMW A;  4LAW A;  1NWR A;  2RSE A;  3ODK A;  2MNT A;  1D7I A;  1OGG A;  1LL7 A;  2N87 A;  4GIV A;  4LAY A;  4TX0 A;  4U84 A;  1OGB A;  4R5E A;  2DT2 A;  3GPK A;  3JXV A;  3O5D A;  1FKR A;  4ODO A;  3O5G A;  1QPL A;  2QF8 A;  3UI4 A;  1Q1C A;  3ARX A;  2MLX A;  1X6N A;  4MGV A;  4WK9 A;  1PIN A;  1TFV A;  1E6P A;  1NWT A;  1KFW A;  2ZQU A;  1OWQ A;  1U79 A;  2DG9 A;  3O5P A;  4MNJ A;  4U86 A;  2UZ5 A;  4DRM A;  4MPK A;  1QZ2 A;  2ZQV A;  4LAX A;  4MTV A;  1BKF A;  2DT3 A;  2ETN A;  1H0G A;  4KR0 B;  1LG2 A;  4HAR A;  3WL1 A;  1LL4 A;  1SR0 A;  3WIJ A;  4ODQ A;  1E44 A;  1ZBV A;  1EQ3 A;  1FKS A;  1FKG A;  1IX5 A;  3ALG A;  3AS1 A;  3TCZ A;  2WK2 A;  4MNM A;  3W4R A;  4TNS A;  4W5U A;  4DRJ A;  3GTY X;  4NNR A;  3G6M A;  4WKF A;  1J4R A;  2F2D A;  3PA7 A;  4R0X A;  4ODL A;  1T11 A;  3WKZ A;  2KGJ A;  4ML4 A;  3PR9 A;  5DIU A;  4PTM A;  4TW8 A;  2IUZ A;  2KR7 A;  2PI6 A;  3IK8 A;  3ARU A;  5HW6 A;  1ZU8 A;  3WH0 A;  2MF9 A;  3G6L A;  4MSP A;  1Q6I A;  4O2T A;  1NMV A;  5HW7 A;  2KE0 A;  4P8U A;  4URI A;  4ODP A;  3ARP A;  2XP4 A;  3AQU A;  5BXJ A;  3BMB A;  1ZCN A;  4DWS A;  5I98 A;  2DSZ A;  2FAP A;  1J4I A;  2O9O A;  4DZ3 A;  4DRN A;  2Q5A A;  3EY6 A;  2RUC A;  1GPF A;  1E15 A;  3AS3 A;  4DWS C;  1C9H A;  4J4N A;  1H0I A;  3KAH A;  3RFW A;  2ZR4 A;  4LAV A;  2PV3 A;  4Z2L A;  1L1P A;  2XP7 A;  3B9A A;  1UR9 A;  2PN0 A;  1GUV A;  1NSG A;  2FDM A;  5B8I C;  2F21 A;  1JVW A;  1J6Y A;  1D7H A;  3WQW A;  1XRV A;  3VAW A;  2L2S A;  4IT6 A;  4W9Q A;  5HW8 A;  3FY1 A;  2XP8 A;  4KQZ A;  4JFM A;  3O5K A;  1UR8 A;  3IKG A;  1ZBC A;  2B5U B;  3FAP A;  3WQV A;  1JCH B;  3RGC A;  4JFL A;  1HJV A;  3UI6 A;  5DIT A;  2VN1 A;  4ODM A;  4J4O A;  1A7X A;  2IF4 A;  4IPX A;  4BF8 A;  3KAB A;  5D75 A;  1FAP A;  1ZK6 A;  2ITK A;  2FKE A;  2LPV A;  1JNS A;  5HKG A;  1EIB A;  4G50 A;  5HTG A;  1E9L A;  1FKH A;  1WB0 A;  3PRB A;  4W9O A;  2DT0 A;  4N19 A;  2RUR A;  3ARO A;  3CHD A;  1GRJ A;  3NTP A;  1PBK A;  2PPO A;  5HWC A;  4QT3 A;  4ODK A;  4L3N A;  3O5I A;  2EUL A;  4IQ2 A;  3ALF A;  3KCE A;  2KO7 A;  3OOB A;  4AY1 A;  4P8X A;  5GQB A;  2G41 A;  1RD6 A;  4DRK A;  2F23 A;  1FKT A;  4ODN A;  3O5J A;  4IT4 A;  1P5Q A;  2VCD A;  1NH6 A;  4P8W A;  1W9U A;  5HBF A;  3NI6 A;  2P4V A;  2DSU A;  3JYM A;  3B7X A;  3IHZ A;  2DSW A;  1M5Y A;  1HJX A;  2RQS A;  4S3K A;  3NRK A;  2PPN A;  1FKJ A;  3WD0 A;  1HXV A;  4C02 B;  3WD4 A;  2M08 A;  2DSV A;  2OFN A;  4W9P A;  4ITZ A;  2XPB A;  3O5E A;  4WIW A;  1ROT A;  2ZR5 A;  3UQA A;  3ARQ A;  3ARY A;  1ITX A;  4GGQ A;  2M1I A;  3O5Q A;  1BL4 A;  4QZV B;  3JYJ A;  5J6E A;  4Z2K A;  3B9E A;  2XP6 A;  4DRQ A;  4DWS D;  3KAG A;  4NZC A;  3ARW A;  1Q6H A;  3I6C A;  4Q7N A;  3CHC A;  5GPG A;  2DT1 A;  2AOS A;  5JH8 A;  1LJY A;  2XPA A;  1SYT A;  4DRH A;  2WLY A;  2LJ4 A;  3KZ7 A;  4DZ2 A;  4DRI A;  4JFJ A;  1FKL A;  4UDM A;  3ART A;  2D9F A;  2A3E A;  1W9V A;  3KAD A;  1N1A A;  4Z2J A;  3O5L A;  1TCO C;  3WD1 A;  1YAT A;  3PRD A;  3ARZ A;  2KI3 A;  5HWB A;  3KAI A;  4G2P A;  1NWU A;  3CZ8 A;  1B6C A;  2M2A A;  2KFW A;  2A3C A;  2OLH A;  1HKI A;  1HJW A;  1GOI A;  4ZPV R;  4XAK A;  2ESC A;  2DG4 A;  4ZPT R;  3KAF A;  1FKB A;  1KT0 A;  1D6O A;  3ARR A;  1CTN A;  1R9H A;  2XP9 A;  3AS0 A;  2DG3 A;  4TYO A;  4IQC A;  4DWS B;  1XHG A;  3RM9 A;  2AWG A;  3UQB A;  1EYM A;  3CGN A;  1FKD A;  4ZPW R;  4Z2I A;  4JFI A;  2PPP A;  1HKM A;  1WNO A;  1WAW A;  2F4E A;  4HBE A;  5DEZ A;  4WJX A;  4MNL A;  1F8A B;  3O5F A;  4MNK A;  3CGM A;  5GPR A;  2ZQS A;  3OA5 A;  1X6L A;  1ZL1 A;  4P8V A;  1FKK A;  2RUD A;  2Y78 A;  1Y0O A;  1W26 A;  3IKD A;  5DF0 A;  1EDQ A;  3O5R A;  4TW7 A;  2YBU A;  1FFQ A;  3H9R B;  2YBT A;  3B8S A;  3O5M A;  4U85 A;  1ZBW A;  1ZB5 A;  3UI5 A;  1W1Y A;  1QPF A;  1ZBK A;  1E6Z A;  4LGX A;  3CHF A;  2RUQ A;  3KAC A;  4FN2 A;  4TW6 A;  3ARV A;  3EIP A;  2LGO A;  2PV1 A;  2WLZ A;  2WM0 A;  2XP3 A;  4ODR A;  4Z2H A;  1F40 A;  1FKI A;  3FXY A;  3TC5 A;  4ZS6 A;  1W1P A;  1HKK A;  1E6R A;  1K9T A;  2O92 A;  4S3J A;  1JNT A;  3BXW A;  4HBO A;  3WD2 A;  3LUO A;  2ZR6 A;  2XP5 A;  4DH0 A;  4WKA A;  1W1V A;  3CHE A;  1O6I A;  1LQ0 A;  4DRP A;  4JYS A;  1J4H A;  1VF8 A;  1W9P A;  2B31 A;  1D7J A;  2JZV A;  4FAP A;  2A3B A;  3WD3 A;  1HKJ A;  5HT1 A;  1EHN A;  3WL0 A;  3RME A;  1Q6U A;  1YW5 A;  4QIB A;  5HUA A;  3CH9 A;  4DRO A;  2ZQT A;  4DIP A;  1FFR A;  3UF8 A;  1JND A;  2K8I A;  1LG1 A;  4DT4 A;  1LL6 A;  3AS2 A;  1NWS A;  2MLY A;  2G8Z A;  3B9D A;  4WKH A;  5DO2 A;  4NSB A;  3PRA A;  4L72 B;  3RM4 A;  1KT1 A;  3MDY B;  1FKF A;  4Z2G A;  3ARS A;  1FD9 A;  1D2K A;  2MPH A;  1FJD A;  4Q22 A;  2PBC A;  3QOK A;  4MAV A;  4QT2 A;  2PV2 A;  2DPE A;  3TDB A;  1W1T A;  3O5O A; 
#chains in the Genus database with same CATH homology
 5DIV A;  2MLZ A;  3RM8 A;  2A3A A;  3UQI A;  1E6N A;  1JNE A;  2LKN A;  1ROU A;  4JFK A;  1NMW A;  4LAW A;  1NWR A;  2RSE A;  3ODK A;  2MNT A;  1D7I A;  1OGG A;  1LL7 A;  2N87 A;  4GIV A;  4LAY A;  4TX0 A;  4U84 A;  1OGB A;  4R5E A;  2DT2 A;  3GPK A;  3JXV A;  3O5D A;  1FKR A;  4ODO A;  3O5G A;  1QPL A;  2QF8 A;  3UI4 A;  1Q1C A;  3ARX A;  2MLX A;  1X6N A;  4MGV A;  4WK9 A;  1PIN A;  1TFV A;  1E6P A;  1NWT A;  1KFW A;  2ZQU A;  1OWQ A;  1U79 A;  2DG9 A;  3O5P A;  4MNJ A;  4U86 A;  2UZ5 A;  4DRM A;  4MPK A;  1QZ2 A;  2ZQV A;  4LAX A;  4MTV A;  1BKF A;  2DT3 A;  1H0G A;  4KR0 B;  1LG2 A;  4HAR A;  3WL1 A;  1LL4 A;  1SR0 A;  3WIJ A;  4ODQ A;  1ZBV A;  1EQ3 A;  1FKS A;  1FKG A;  1IX5 A;  3ALG A;  3AS1 A;  3TCZ A;  2WK2 A;  4MNM A;  3W4R A;  4TNS A;  4W5U A;  4DRJ A;  4NNR A;  3G6M A;  4WKF A;  1J4R A;  2F2D A;  3PA7 A;  4R0X A;  4ODL A;  1T11 A;  3WKZ A;  2KGJ A;  4ML4 A;  3PR9 A;  5DIU A;  4PTM A;  4TW8 A;  2IUZ A;  2KR7 A;  2PI6 A;  3IK8 A;  3ARU A;  5HW6 A;  1ZU8 A;  3WH0 A;  2MF9 A;  3G6L A;  4MSP A;  1Q6I A;  4O2T A;  1NMV A;  5HW7 A;  2KE0 A;  4P8U A;  4URI A;  4ODP A;  3ARP A;  2XP4 A;  3AQU A;  5BXJ A;  1ZCN A;  4DWS A;  5I98 A;  2DSZ A;  2FAP A;  1J4I A;  2O9O A;  4DZ3 A;  4DRN A;  2Q5A A;  3EY6 A;  2RUC A;  1GPF A;  1E15 A;  3AS3 A;  4DWS C;  1C9H A;  4J4N A;  1H0I A;  3KAH A;  3RFW A;  2ZR4 A;  4LAV A;  2PV3 A;  4Z2L A;  1L1P A;  2XP7 A;  3B9A A;  1UR9 A;  1GUV A;  1NSG A;  2FDM A;  5B8I C;  2F21 A;  1JVW A;  1J6Y A;  1D7H A;  3WQW A;  1XRV A;  3VAW A;  2L2S A;  4IT6 A;  4W9Q A;  5HW8 A;  3FY1 A;  2XP8 A;  4KQZ A;  4JFM A;  3O5K A;  1UR8 A;  3IKG A;  1ZBC A;  3FAP A;  3WQV A;  3RGC A;  4JFL A;  1HJV A;  3UI6 A;  5DIT A;  2VN1 A;  4ODM A;  4J4O A;  1A7X A;  2IF4 A;  4IPX A;  4BF8 A;  3KAB A;  5D75 A;  1FAP A;  1ZK6 A;  2ITK A;  2FKE A;  2LPV A;  1JNS A;  5HKG A;  1EIB A;  4G50 A;  5HTG A;  1E9L A;  1FKH A;  1WB0 A;  3PRB A;  4W9O A;  2DT0 A;  4N19 A;  2RUR A;  3ARO A;  3CHD A;  3NTP A;  1PBK A;  2PPO A;  5HWC A;  4QT3 A;  4ODK A;  4L3N A;  3O5I A;  4IQ2 A;  3ALF A;  3KCE A;  2KO7 A;  3OOB A;  4AY1 A;  4P8X A;  5GQB A;  2G41 A;  1RD6 A;  4DRK A;  1FKT A;  4ODN A;  3O5J A;  4IT4 A;  1P5Q A;  2VCD A;  1NH6 A;  4P8W A;  1W9U A;  5HBF A;  3NI6 A;  2DSU A;  3JYM A;  3B7X A;  3IHZ A;  2DSW A;  1M5Y A;  1HJX A;  2RQS A;  4S3K A;  3NRK A;  2PPN A;  1FKJ A;  3WD0 A;  1HXV A;  4C02 B;  3WD4 A;  2M08 A;  2DSV A;  2OFN A;  4W9P A;  4ITZ A;  2XPB A;  3O5E A;  4WIW A;  1ROT A;  2ZR5 A;  3UQA A;  3ARQ A;  3ARY A;  1ITX A;  4GGQ A;  2M1I A;  3O5Q A;  1BL4 A;  4QZV B;  3JYJ A;  5J6E A;  4Z2K A;  3B9E A;  2XP6 A;  4DRQ A;  4DWS D;  3KAG A;  4NZC A;  3ARW A;  1Q6H A;  3I6C A;  4Q7N A;  3CHC A;  5GPG A;  2DT1 A;  2AOS A;  5JH8 A;  1LJY A;  2XPA A;  1SYT A;  4DRH A;  2WLY A;  2LJ4 A;  3KZ7 A;  4DZ2 A;  4DRI A;  4JFJ A;  1FKL A;  3ART A;  2D9F A;  2A3E A;  1W9V A;  3KAD A;  1N1A A;  4Z2J A;  3O5L A;  1TCO C;  3WD1 A;  1YAT A;  3PRD A;  3ARZ A;  2KI3 A;  5HWB A;  3KAI A;  4G2P A;  1NWU A;  3CZ8 A;  1B6C A;  2M2A A;  2KFW A;  2A3C A;  2OLH A;  1HKI A;  1HJW A;  1GOI A;  4ZPV R;  4XAK A;  2ESC A;  2DG4 A;  4ZPT R;  3KAF A;  1FKB A;  1KT0 A;  1D6O A;  3ARR A;  1CTN A;  1R9H A;  2XP9 A;  3AS0 A;  2DG3 A;  4TYO A;  4IQC A;  4DWS B;  1XHG A;  3RM9 A;  2AWG A;  3UQB A;  1EYM A;  3CGN A;  1FKD A;  4ZPW R;  4Z2I A;  4JFI A;  2PPP A;  1HKM A;  1WNO A;  1WAW A;  2F4E A;  4HBE A;  5DEZ A;  4WJX A;  4MNL A;  1F8A B;  3O5F A;  4MNK A;  3CGM A;  5GPR A;  2ZQS A;  3OA5 A;  1X6L A;  1ZL1 A;  4P8V A;  1FKK A;  2RUD A;  2Y78 A;  1Y0O A;  1W26 A;  3IKD A;  5DF0 A;  1EDQ A;  3O5R A;  4TW7 A;  2YBU A;  1FFQ A;  3H9R B;  2YBT A;  3B8S A;  3O5M A;  4U85 A;  1ZBW A;  1ZB5 A;  3UI5 A;  1W1Y A;  1QPF A;  1ZBK A;  1E6Z A;  4LGX A;  3CHF A;  2RUQ A;  3KAC A;  4FN2 A;  4TW6 A;  3ARV A;  2LGO A;  2PV1 A;  2WLZ A;  2WM0 A;  2XP3 A;  4ODR A;  4Z2H A;  1F40 A;  1FKI A;  3FXY A;  3TC5 A;  4ZS6 A;  1W1P A;  1HKK A;  1E6R A;  1K9T A;  2O92 A;  4S3J A;  1JNT A;  3BXW A;  4HBO A;  3WD2 A;  3LUO A;  2ZR6 A;  2XP5 A;  4DH0 A;  4WKA A;  1W1V A;  3CHE A;  1O6I A;  1LQ0 A;  4DRP A;  4JYS A;  1J4H A;  1VF8 A;  1W9P A;  2B31 A;  1D7J A;  2JZV A;  4FAP A;  2A3B A;  3WD3 A;  1HKJ A;  5HT1 A;  1EHN A;  3WL0 A;  3RME A;  1Q6U A;  1YW5 A;  4QIB A;  5HUA A;  3CH9 A;  4DRO A;  2ZQT A;  4DIP A;  1FFR A;  3UF8 A;  1JND A;  2K8I A;  1LG1 A;  4DT4 A;  1LL6 A;  3AS2 A;  1NWS A;  2MLY A;  2G8Z A;  3B9D A;  4WKH A;  5DO2 A;  4NSB A;  3PRA A;  4L72 B;  3RM4 A;  1KT1 A;  3MDY B;  1FKF A;  4Z2G A;  3ARS A;  1FD9 A;  1D2K A;  2MPH A;  1FJD A;  4Q22 A;  2PBC A;  3QOK A;  4MAV A;  4QT2 A;  2PV2 A;  2DPE A;  3TDB A;  1W1T A;  3O5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...