3I6CA

Structure-based design of novel pin1 inhibitors (ii)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
113
structure length
113
Chain Sequence
EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of novel human Pin1 inhibitors (II).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 42
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3i6cA00
3JXVA 4TW6A 1P5QA 1FKFA 2Y78A 1JVWA 5HUAA 1PINA 3UQIA 3PRDA 4G50A 2RUQA 2FKEA 3KAHA 4BF8A 1R9HA 2RUDA 4LAXA 1EQ3A 3O5JA 1QPFA 3NI6A 4IQCA 4ODNA 2XP4A 4C02B 3I6CA 4LAYA 3KACA 2L2SA 4W9PA 4JFMA 2LKNA 2VCDA 3H9RB 4JYSA 4ODQA 5BXJA 1W26A 2VN1A 2KE0A 1FKJA 4JFLA 2OFNA 3IK8A 1HXVA 1ZCNA 2UZ5A 3ODKA 3KABA 2XPBA 3O5PA 3O5MA 4LAWA 1FKKA 1J4HA 2IF4A 1U79A 2ZR5A 3O5FA 4NNRA 4G2PA 5GPGA 1Q6UA 4TNSA 2XP6A 3O5LA 4U84A 2RSEA 5HW8A 2PV1A 4DRPA 2RUCA 4TW8A 2XP5A 3KAFA 2LJ4A 2KI3A 2ZQSA 1YATA 3MDYB 5HWBA 2RQSA 3JYMA 3VAWA 2ZQUA 2KR7A 1BL4A 4J4NA 4W9OA 4DRKA 2MPHA 1EYMA 3IKGA 4GIVA 3CGMA 2PBCA 4N19A 4U85A 2MLYA 2ZQTA 4JFJA 1C9HA 1J4RA 2LPVA 3CGNA 1JNTA 4DZ3A 2XP9A 1FJDA 1ROTA 2PV2A 4DT4A 2XPAA 3GPKA 2ZR4A 5J6EA 3KCEA 2K8IA 4JFKA 4TYOA 3KAIA 3LUOA 4DIPA 1NSGA 2DG9A 5DIVA 4DRIA 3IKDA 1FKRA 2DG3A 1Q6IA 3EY6A 3O5IA 3RFWA 4DRJA 3JYJA 4MSPA 2F4EA 2PV3A 1J6YA 4ODKA 3FAPA 1NMWA 3NRKA 3UQBA 1KT1A 3UI4A 4DRQA 1Q1CA 2KFWA 1FKDA 4MGVA 3KAGA 1FKIA 1D7HA 5HW6A 1L1PA 3O5QA 1NMVA 4ODLA 1YW5A 1ROUA 2ZR6A 5DITA 2DG4A 1FKBA 2MNTA 2FAPA 2MF9A 1QZ2A 4TX0A 4JFIA 1FAPA 1J4IA 2Q5AA 2F21A 2KGJA 5DIUA 1PBKA 2JZVA 3PA7A 1F40A 2RURA 4ODOA 4U86A 4QT2A 2LGOA 4FN2A 4IPXA 3RGCA 3O5OA 4LAVA 3PRBA 1T11A 1N1AA 3OOBA 4ODRA 4ODPA 4TW7A 4R0XA 3UI5A 3O5KA 2M08A 3B7XA 2PPNA 2PPPA 1F8AB 3NTPA 5HKGA 1D6OA 3O5GA 4O2TA 3TC5A 2XP8A 2MLXA 2D9FA 2M1IA 1QPLA 2AWGA 1FKGA 1M5YA 1Q6HA 1FKTA 1ZK6A 2ITKA 2XP7A 2ZQVA 4GGQA 4QIBA 4ITZA 1TCOC 2N87A 2KO7A 3TDBA 4DRMA 3KZ7A 4DH0A 4FAPA 5B8IC 1B6CA 5HTGA 1KT0A 1A7XA 1FKSA 4DZ2A 3UQAA 4QT3A 5HT1A 4ODMA 3TCZA 2F2DA 3O5DA 2M2AA 1JNSA 3O5RA 1FD9A 2MLZA 5I98A 1BKFA 2PPOA 1FKLA 2XP3A 1D7IA 1FKHA 4DRNA 4W9QA 5D75A 3IHZA 1D7JA 5HW7A 3UI6A 3O5EA 4IQ2A 4DROA 4DRHA 5HWCA 1Y0OA 3UF8A 3WH0A 4J4OA 3KADA
chains in the Genus database with same CATH superfamily
2G41A 4G50A 4BF8A 2AOSA 3O5JA 3PR9A 1FFRA 3KACA 4W9PA 3ARYA 4JYSA 1NH6A 2KE0A 3CH9A 4KR0B 1ZCNA 1GPFA 1LL6A 2XPBA 4QZVB 4LAWA 1U79A 2B5UB 1E6ZA 2O92A 2YBTA 1HJXA 2XP6A 4U84A 2RSEA 3WD2A 1H0GA 4WKHA 5HWBA 3JYMA 2DSUA 2MPHA 1EYMA 4GIVA 2PBCA 4IT4A 3CGNA 1ROTA 2F23A 3RM4A 1LJYA 5J6EA 1GOIA 1E15A 2K8IA 3G6MA 4JFKA 1NSGA 1X6NA 5DIVA 1NWUA 3ARRA 4DRJA 1NMWA 3ARUA 3UQBA 1KT1A 4HARA 1FKDA 1FKIA 1L1PA 1NMVA 4ODLA 2ZR6A 2KGJA 1JCHB 1HKIA 3PA7A 1SR0A 3CHDA 4QT2A 3RGCA 4Z2IA 3PRBA 3UI5A 4Q7NA 3RMEA 2M08A 3B7XA 3NTPA 1D6OA 4S3JA 3TC5A 1ZU8A 4S3KA 2XP8A 4W5UA 2AWGA 1FKGA 4ITZA 2DSWA 1EHNA 5GPRA 4DRMA 4WJXA 3AQUA 3G6LA 4DH0A 4DWSA 1UR9A 2A3BA 1A7XA 4DZ2A 4QT3A 3TCZA 4ODMA 2F2DA 3O5DA 1FD9A 5I98A 1LG1A 2XP3A 1D2KA 3WQWA 1HKMA 4NSBA 4NZCA 3UI6A 3O5EA 4IQ2A 4DROA 3AS1A 4DRHA 5HWCA 1Y0OA 1OWQA 2A3AA 1HJWA 3JXVA 2A3CA 1FKFA 4DWSB 1JVWA 5HUAA 1GRJA 4Z2JA 3KAHA 3ARXA 4LAXA 2RUDA 1QPFA 4ODNA 4IQCA 1E6PA 3BXWA 1RD6A 4JFMA 2LKNA 2ESCA 2VCDA 3B9DA 4HBOA 3B9EA 3WIJA 2OFNA 3ODKA 3KABA 1E6RA 3O5PA 3O5MA 4NNRA 2IF4A 4ZS6A 4G2PA 1Q6UA 2PV1A 2RUCA 4TW8A 2PI6A 2LJ4A 2KI3A 3FY1A 3MDYB 4UDMA 2ZQUA 1OGGA 5HBFA 3IKGA 1WNOA 3CGMA 4Z2LA 3RM9A 2YBUA 1J4RA 2LPVA 4DZ3A 3GPKA 3W4RA 4MNLA 3KCEA 4IT6A 3LUOA 2DG9A 1W9PA 3O5IA 1Q6IA 3JYJA 2F4EA 4ODKA 3FAPA 4P8VA 5DF0A 4MGVA 2DPEA 3WD3A 5JH8A 1ROUA 2FAPA 4P8UA 1J4IA 3CHFA 2F21A 4ML4A 2FDMA 2JZVA 1F40A 2RURA 4FN2A 3GU0A 4LAVA 1H0IA 1T11A 4XAKA 4TW7A 4R0XA 4WKAA 1X6LA 3O5KA 2DT1A 2PPNA 2PPPA 5HKGA 3O5GA 3WD4A 3ARQA 2D9FA 4ZPTR 3RM8A 1W9VA 1GUVA 1Q6HA 2ETNA 2ZQVA 1CTNA 3KZ7A 4FAPA 3B8SA 5HT1A 2M2AA 1LQ0A 4L3NA 1BKFA 3AS0A 1D7IA 5HW7A 3WD0A 3ARWA 3WH0A 3KADA 3ARSA 4Q22A 4TW6A 2Y78A 2B31A 3AS3A 3UQIA 2RUQA 2FKEA 1R9HA 3ARVA 1OGBA 3NI6A 4C02B 3I6CA 4LAYA 2L2SA 4ODQA 3CHCA 1TFVA 1HXVA 2P4VA 4LGXA 4Z2GA 4MNKA 1J4HA 3O5FA 1ZBCA 2DSZA 4MPKA 4DRPA 2XP5A 4P8XA 1YATA 5DO2A 2DSVA 2KR7A 1BL4A 2MLYA 2ZQTA 4JFJA 1C9HA 1JNEA 3BMBA 4DT4A 2XPAA 3GTYX 3EIPA 1E6NA 3KAIA 4DIPA 4ZPWR 4MNJA 1FKRA 3EY6A 3RFWA 1VF8A 3ARPA 2O9OA 1J6YA 1K9TA 1W1VA 3UI4A 4DRQA 1D7HA 5HW6A 4WK9A 3O5QA 2MNTA 4MAVA 1QZ2A 4TX0A 4JFIA 1FAPA 3FXYA 2WM0A 5DIUA 1PBKA 1ZBVA 1N1AA 4ODRA 1W1TA 3WKZA 1FFQA 3WL1A 1EDQA 1EIBA 1JNDA 1QPLA 4URIA 1ZK6A 1ITXA 2KO7A 3TDBA 5B8IC 5HTGA 1KT0A 2WLYA 1FKSA 2QF8A 3UQAA 3ALGA 1E9LA 2PPOA 1FKHA 2PN0A 5D75A 3IHZA 3UF8A 4ZPVR 1O6IA 1P5QA 4MNMA 5DEZA 1PINA 3PRDA 4HBEA 1EQ3A 1NWRA 2XP4A 1UR8A 2WLZA 4Z2KA 2DT2A 3H9RB 5BXJA 1W26A 2VN1A 1ZB5A 1KFWA 1FKJA 4JFLA 3AROA 3IK8A 2UZ5A 1HKKA 4Z2HA 4DWSC 1FKKA 2ZR5A 2DT3A 5GPGA 4DWSD 2DT0A 3WQVA 4TNSA 3O5LA 1W1PA 5HW8A 1IX5A 3KAFA 2ZQSA 3CHEA 1LL4A 4AY1A 1XHGA 2RQSA 3VAWA 4J4NA 4W9OA 1NWTA 2OLHA 4MTVA 4DRKA 2WK2A 1SYTA 5GQBA 1NWSA 4KQZA 4N19A 1ZBKA 4U85A 2IUZA 1JNTA 2XP9A 4P8WA 1FJDA 1ZL1A 2PV2A 2ZR4A 4TYOA 3QOKA 4DRIA 3IKDA 2DG3A 1XRVA 3ALFA 3OA5A 4PTMA 4MSPA 2PV3A 3ARZA 3NRKA 3WD1A 1Q1CA 2KFWA 3KAGA 1YW5A 5DITA 2DG4A 1FKBA 3PRAA 2MF9A 1E44A 2Q5AA 2EULA 4ODOA 4U86A 2LGOA 4IPXA 1LG2A 3O5OA 1WB0A 3OOBA 3CZ8A 4ODPA 3AS2A 2G8ZA 1F8AB 4R5EA 4O2TA 1HKJA 2MLXA 2A3EA 2M1IA 1WAWA 2ITKA 1M5YA 1FKTA 4QIBA 3WL0A 2XP7A 4GGQA 1TCOC 2N87A 1W1YA 4L72B 1HJVA 1B6CA 3ARTA 1LL7A 1JNSA 1W9UA 3O5RA 3B9AA 2MLZA 1FKLA 4WKFA 4DRNA 4W9QA 1D7JA 1ZBWA 4WIWA 4J4OA
chains in the Genus database with same CATH topology
2G41A 4G50A 4BF8A 2AOSA 3O5JA 3PR9A 1FFRA 3KACA 4W9PA 3ARYA 4JYSA 1NH6A 2KE0A 3CH9A 4KR0B 1ZCNA 1GPFA 1LL6A 2XPBA 4QZVB 4LAWA 1U79A 1E6ZA 2O92A 2YBTA 1HJXA 2XP6A 4U84A 2RSEA 3WD2A 1H0GA 4WKHA 5HWBA 3JYMA 2DSUA 2MPHA 1EYMA 4GIVA 2PBCA 4IT4A 3CGNA 1ROTA 3RM4A 1LJYA 5J6EA 1GOIA 1E15A 2K8IA 3G6MA 4JFKA 1NSGA 1X6NA 5DIVA 1NWUA 3ARRA 4DRJA 1NMWA 3ARUA 3UQBA 1KT1A 4HARA 1FKDA 1FKIA 1L1PA 1NMVA 4ODLA 2ZR6A 2KGJA 1HKIA 3PA7A 1SR0A 3CHDA 4QT2A 3RGCA 4Z2IA 3PRBA 3UI5A 4Q7NA 3RMEA 2M08A 3B7XA 3NTPA 1D6OA 4S3JA 3TC5A 1ZU8A 4S3KA 2XP8A 4W5UA 2AWGA 1FKGA 4ITZA 2DSWA 1EHNA 5GPRA 4DRMA 4WJXA 3AQUA 3G6LA 4DH0A 4DWSA 1UR9A 2A3BA 1A7XA 4DZ2A 4QT3A 3TCZA 4ODMA 2F2DA 3O5DA 1FD9A 5I98A 1LG1A 2XP3A 1D2KA 3WQWA 1HKMA 4NSBA 4NZCA 3UI6A 3O5EA 4IQ2A 4DROA 3AS1A 4DRHA 5HWCA 1Y0OA 1OWQA 2A3AA 1HJWA 3JXVA 2A3CA 1FKFA 4DWSB 1JVWA 5HUAA 4Z2JA 3KAHA 3ARXA 4LAXA 2RUDA 1QPFA 4ODNA 4IQCA 1E6PA 3BXWA 1RD6A 4JFMA 2LKNA 2ESCA 2VCDA 3B9DA 4HBOA 3B9EA 3WIJA 2OFNA 3ODKA 3KABA 1E6RA 3O5PA 3O5MA 4NNRA 2IF4A 4ZS6A 4G2PA 1Q6UA 2PV1A 2RUCA 4TW8A 2PI6A 2LJ4A 2KI3A 3FY1A 3MDYB 2ZQUA 1OGGA 5HBFA 3IKGA 1WNOA 3CGMA 4Z2LA 3RM9A 2YBUA 1J4RA 2LPVA 4DZ3A 3GPKA 3W4RA 4MNLA 3KCEA 4IT6A 3LUOA 2DG9A 1W9PA 3O5IA 1Q6IA 3JYJA 2F4EA 4ODKA 3FAPA 4P8VA 5DF0A 4MGVA 2DPEA 3WD3A 5JH8A 1ROUA 2FAPA 4P8UA 1J4IA 3CHFA 2F21A 4ML4A 2FDMA 2JZVA 1F40A 2RURA 4FN2A 4LAVA 1H0IA 1T11A 4XAKA 4TW7A 4R0XA 4WKAA 1X6LA 3O5KA 2DT1A 2PPNA 2PPPA 5HKGA 3O5GA 3WD4A 3ARQA 2D9FA 4ZPTR 3RM8A 1W9VA 1GUVA 1Q6HA 2ZQVA 1CTNA 3KZ7A 4FAPA 3B8SA 5HT1A 2M2AA 1LQ0A 4L3NA 1BKFA 3AS0A 1D7IA 5HW7A 3WD0A 3ARWA 3WH0A 3KADA 3ARSA 4Q22A 4TW6A 2Y78A 2B31A 3AS3A 3UQIA 2RUQA 2FKEA 1R9HA 3ARVA 1OGBA 3NI6A 4C02B 3I6CA 4LAYA 2L2SA 4ODQA 3CHCA 1TFVA 1HXVA 4LGXA 4Z2GA 4MNKA 1J4HA 3O5FA 1ZBCA 2DSZA 4MPKA 4DRPA 2XP5A 4P8XA 1YATA 5DO2A 2DSVA 2KR7A 1BL4A 2MLYA 2ZQTA 4JFJA 1C9HA 1JNEA 4DT4A 2XPAA 1E6NA 3KAIA 4DIPA 4ZPWR 4MNJA 1FKRA 3EY6A 3RFWA 1VF8A 3ARPA 2O9OA 1J6YA 1K9TA 1W1VA 3UI4A 4DRQA 1D7HA 5HW6A 4WK9A 3O5QA 2MNTA 4MAVA 1QZ2A 4TX0A 4JFIA 1FAPA 3FXYA 2WM0A 5DIUA 1PBKA 1ZBVA 1N1AA 4ODRA 1W1TA 3WKZA 1FFQA 3WL1A 1EDQA 1EIBA 1JNDA 1QPLA 4URIA 1ZK6A 1ITXA 2KO7A 3TDBA 5B8IC 5HTGA 1KT0A 2WLYA 1FKSA 2QF8A 3UQAA 3ALGA 1E9LA 2PPOA 1FKHA 5D75A 3IHZA 3UF8A 4ZPVR 1O6IA 1P5QA 4MNMA 5DEZA 1PINA 3PRDA 4HBEA 1EQ3A 1NWRA 2XP4A 1UR8A 2WLZA 4Z2KA 2DT2A 3H9RB 5BXJA 1W26A 2VN1A 1ZB5A 1KFWA 1FKJA 4JFLA 3AROA 3IK8A 2UZ5A 1HKKA 4Z2HA 4DWSC 1FKKA 2ZR5A 2DT3A 5GPGA 4DWSD 2DT0A 3WQVA 4TNSA 3O5LA 1W1PA 5HW8A 1IX5A 3KAFA 2ZQSA 3CHEA 1LL4A 4AY1A 1XHGA 2RQSA 3VAWA 4J4NA 4W9OA 1NWTA 2OLHA 4MTVA 4DRKA 2WK2A 1SYTA 5GQBA 1NWSA 4KQZA 4N19A 1ZBKA 4U85A 2IUZA 1JNTA 2XP9A 4P8WA 1FJDA 1ZL1A 2PV2A 2ZR4A 4TYOA 3QOKA 4DRIA 3IKDA 2DG3A 1XRVA 3ALFA 3OA5A 4PTMA 4MSPA 2PV3A 3ARZA 3NRKA 3WD1A 1Q1CA 2KFWA 3KAGA 1YW5A 5DITA 2DG4A 1FKBA 3PRAA 2MF9A 2Q5AA 4ODOA 4U86A 2LGOA 4IPXA 1LG2A 3O5OA 1WB0A 3OOBA 3CZ8A 4ODPA 3AS2A 2G8ZA 1F8AB 4R5EA 4O2TA 1HKJA 2MLXA 2A3EA 2M1IA 1WAWA 2ITKA 1M5YA 1FKTA 4QIBA 3WL0A 2XP7A 4GGQA 1TCOC 2N87A 1W1YA 4L72B 1HJVA 1B6CA 3ARTA 1LL7A 1JNSA 1W9UA 3O5RA 3B9AA 2MLZA 1FKLA 4WKFA 4DRNA 4W9QA 1D7JA 1ZBWA 4WIWA 4J4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JXV A;  4TW6 A;  1P5Q A;  1FKF A;  2Y78 A;  1JVW A;  5HUA A;  1PIN A;  3UQI A;  3PRD A;  4G50 A;  2RUQ A;  2FKE A;  3KAH A;  4BF8 A;  1R9H A;  2RUD A;  4LAX A;  1EQ3 A;  3O5J A;  1QPF A;  3NI6 A;  4IQC A;  4ODN A;  2XP4 A;  4C02 B;  3I6C A;  4LAY A;  3KAC A;  2L2S A;  4W9P A;  4JFM A;  2LKN A;  2VCD A;  3H9R B;  4JYS A;  4ODQ A;  5BXJ A;  1W26 A;  2VN1 A;  2KE0 A;  1FKJ A;  4JFL A;  2OFN A;  3IK8 A;  1HXV A;  1ZCN A;  2UZ5 A;  3ODK A;  3KAB A;  2XPB A;  3O5P A;  3O5M A;  4LAW A;  1FKK A;  1J4H A;  2IF4 A;  1U79 A;  2ZR5 A;  3O5F A;  4NNR A;  4G2P A;  5GPG A;  1Q6U A;  4TNS A;  2XP6 A;  3O5L A;  4U84 A;  2RSE A;  5HW8 A;  2PV1 A;  4DRP A;  2RUC A;  4TW8 A;  2XP5 A;  3KAF A;  2LJ4 A;  2KI3 A;  2ZQS A;  1YAT A;  3MDY B;  5HWB A;  2RQS A;  3JYM A;  3VAW A;  2ZQU A;  2KR7 A;  1BL4 A;  4J4N A;  4W9O A;  4DRK A;  2MPH A;  1EYM A;  3IKG A;  4GIV A;  3CGM A;  2PBC A;  4N19 A;  4U85 A;  2MLY A;  2ZQT A;  4JFJ A;  1C9H A;  1J4R A;  2LPV A;  3CGN A;  1JNT A;  4DZ3 A;  2XP9 A;  1FJD A;  1ROT A;  2PV2 A;  4DT4 A;  2XPA A;  3GPK A;  2ZR4 A;  5J6E A;  3KCE A;  2K8I A;  4JFK A;  4TYO A;  3KAI A;  3LUO A;  4DIP A;  1NSG A;  2DG9 A;  5DIV A;  4DRI A;  3IKD A;  1FKR A;  2DG3 A;  1Q6I A;  3EY6 A;  3O5I A;  3RFW A;  4DRJ A;  3JYJ A;  4MSP A;  2F4E A;  2PV3 A;  1J6Y A;  4ODK A;  3FAP A;  1NMW A;  3NRK A;  3UQB A;  1KT1 A;  3UI4 A;  4DRQ A;  1Q1C A;  2KFW A;  1FKD A;  4MGV A;  3KAG A;  1FKI A;  1D7H A;  5HW6 A;  1L1P A;  3O5Q A;  1NMV A;  4ODL A;  1YW5 A;  1ROU A;  2ZR6 A;  5DIT A;  2DG4 A;  1FKB A;  2MNT A;  2FAP A;  2MF9 A;  1QZ2 A;  4TX0 A;  4JFI A;  1FAP A;  1J4I A;  2Q5A A;  2F21 A;  2KGJ A;  5DIU A;  1PBK A;  2JZV A;  3PA7 A;  1F40 A;  2RUR A;  4ODO A;  4U86 A;  4QT2 A;  2LGO A;  4FN2 A;  4IPX A;  3RGC A;  3O5O A;  4LAV A;  3PRB A;  1T11 A;  1N1A A;  3OOB A;  4ODR A;  4ODP A;  4TW7 A;  4R0X A;  3UI5 A;  3O5K A;  2M08 A;  3B7X A;  2PPN A;  2PPP A;  1F8A B;  3NTP A;  5HKG A;  1D6O A;  3O5G A;  4O2T A;  3TC5 A;  2XP8 A;  2MLX A;  2D9F A;  2M1I A;  1QPL A;  2AWG A;  1FKG A;  1M5Y A;  1Q6H A;  1FKT A;  1ZK6 A;  2ITK A;  2XP7 A;  2ZQV A;  4GGQ A;  4QIB A;  4ITZ A;  1TCO C;  2N87 A;  2KO7 A;  3TDB A;  4DRM A;  3KZ7 A;  4DH0 A;  4FAP A;  5B8I C;  1B6C A;  5HTG A;  1KT0 A;  1A7X A;  1FKS A;  4DZ2 A;  3UQA A;  4QT3 A;  5HT1 A;  4ODM A;  3TCZ A;  2F2D A;  3O5D A;  2M2A A;  1JNS A;  3O5R A;  1FD9 A;  2MLZ A;  5I98 A;  1BKF A;  2PPO A;  1FKL A;  2XP3 A;  1D7I A;  1FKH A;  4DRN A;  4W9Q A;  5D75 A;  3IHZ A;  1D7J A;  5HW7 A;  3UI6 A;  3O5E A;  4IQ2 A;  4DRO A;  4DRH A;  5HWC A;  1Y0O A;  3UF8 A;  3WH0 A;  4J4O A;  3KAD A; 
#chains in the Genus database with same CATH topology
 2G41 A;  4G50 A;  4BF8 A;  2AOS A;  3O5J A;  3PR9 A;  1FFR A;  3KAC A;  4W9P A;  3ARY A;  4JYS A;  1NH6 A;  2KE0 A;  3CH9 A;  4KR0 B;  1ZCN A;  1GPF A;  1LL6 A;  2XPB A;  4QZV B;  4LAW A;  1U79 A;  2B5U B;  1E6Z A;  2O92 A;  2YBT A;  1HJX A;  2XP6 A;  4U84 A;  2RSE A;  3WD2 A;  1H0G A;  4WKH A;  5HWB A;  3JYM A;  2DSU A;  2MPH A;  1EYM A;  4GIV A;  2PBC A;  4IT4 A;  3CGN A;  1ROT A;  2F23 A;  3RM4 A;  1LJY A;  5J6E A;  1GOI A;  1E15 A;  2K8I A;  3G6M A;  4JFK A;  1NSG A;  1X6N A;  5DIV A;  1NWU A;  3ARR A;  4DRJ A;  1NMW A;  3ARU A;  3UQB A;  1KT1 A;  4HAR A;  1FKD A;  1FKI A;  1L1P A;  1NMV A;  4ODL A;  2ZR6 A;  2KGJ A;  1JCH B;  1HKI A;  3PA7 A;  1SR0 A;  3CHD A;  4QT2 A;  3RGC A;  4Z2I A;  3PRB A;  3UI5 A;  4Q7N A;  3RME A;  2M08 A;  3B7X A;  3NTP A;  1D6O A;  4S3J A;  3TC5 A;  1ZU8 A;  4S3K A;  2XP8 A;  4W5U A;  2AWG A;  1FKG A;  4ITZ A;  2DSW A;  1EHN A;  5GPR A;  4DRM A;  4WJX A;  3AQU A;  3G6L A;  4DH0 A;  4DWS A;  1UR9 A;  2A3B A;  1A7X A;  4DZ2 A;  4QT3 A;  3TCZ A;  4ODM A;  2F2D A;  3O5D A;  1FD9 A;  5I98 A;  1LG1 A;  2XP3 A;  1D2K A;  3WQW A;  1HKM A;  4NSB A;  4NZC A;  3UI6 A;  3O5E A;  4IQ2 A;  4DRO A;  3AS1 A;  4DRH A;  5HWC A;  1Y0O A;  1OWQ A;  2A3A A;  1HJW A;  3JXV A;  2A3C A;  1FKF A;  4DWS B;  1JVW A;  5HUA A;  1GRJ A;  4Z2J A;  3KAH A;  3ARX A;  4LAX A;  2RUD A;  1QPF A;  4ODN A;  4IQC A;  1E6P A;  3BXW A;  1RD6 A;  4JFM A;  2LKN A;  2ESC A;  2VCD A;  3B9D A;  4HBO A;  3B9E A;  3WIJ A;  2OFN A;  3ODK A;  3KAB A;  1E6R A;  3O5P A;  3O5M A;  4NNR A;  2IF4 A;  4ZS6 A;  4G2P A;  1Q6U A;  2PV1 A;  2RUC A;  4TW8 A;  2PI6 A;  2LJ4 A;  2KI3 A;  3FY1 A;  3MDY B;  4UDM A;  2ZQU A;  1OGG A;  5HBF A;  3IKG A;  1WNO A;  3CGM A;  4Z2L A;  3RM9 A;  2YBU A;  1J4R A;  2LPV A;  4DZ3 A;  3GPK A;  3W4R A;  4MNL A;  3KCE A;  4IT6 A;  3LUO A;  2DG9 A;  1W9P A;  3O5I A;  1Q6I A;  3JYJ A;  2F4E A;  4ODK A;  3FAP A;  4P8V A;  5DF0 A;  4MGV A;  2DPE A;  3WD3 A;  5JH8 A;  1ROU A;  2FAP A;  4P8U A;  1J4I A;  3CHF A;  2F21 A;  4ML4 A;  2FDM A;  2JZV A;  1F40 A;  2RUR A;  4FN2 A;  3GU0 A;  4LAV A;  1H0I A;  1T11 A;  4XAK A;  4TW7 A;  4R0X A;  4WKA A;  1X6L A;  3O5K A;  2DT1 A;  2PPN A;  2PPP A;  5HKG A;  3O5G A;  3WD4 A;  3ARQ A;  2D9F A;  4ZPT R;  3RM8 A;  1W9V A;  1GUV A;  1Q6H A;  2ETN A;  2ZQV A;  1CTN A;  3KZ7 A;  4FAP A;  3B8S A;  5HT1 A;  2M2A A;  1LQ0 A;  4L3N A;  1BKF A;  3AS0 A;  1D7I A;  5HW7 A;  3WD0 A;  3ARW A;  3WH0 A;  3KAD A;  3ARS A;  4Q22 A;  4TW6 A;  2Y78 A;  2B31 A;  3AS3 A;  3UQI A;  2RUQ A;  2FKE A;  1R9H A;  3ARV A;  1OGB A;  3NI6 A;  4C02 B;  3I6C A;  4LAY A;  2L2S A;  4ODQ A;  3CHC A;  1TFV A;  1HXV A;  2P4V A;  4LGX A;  4Z2G A;  4MNK A;  1J4H A;  3O5F A;  1ZBC A;  2DSZ A;  4MPK A;  4DRP A;  2XP5 A;  4P8X A;  1YAT A;  5DO2 A;  2DSV A;  2KR7 A;  1BL4 A;  2MLY A;  2ZQT A;  4JFJ A;  1C9H A;  1JNE A;  3BMB A;  4DT4 A;  2XPA A;  3GTY X;  3EIP A;  1E6N A;  3KAI A;  4DIP A;  4ZPW R;  4MNJ A;  1FKR A;  3EY6 A;  3RFW A;  1VF8 A;  3ARP A;  2O9O A;  1J6Y A;  1K9T A;  1W1V A;  3UI4 A;  4DRQ A;  1D7H A;  5HW6 A;  4WK9 A;  3O5Q A;  2MNT A;  4MAV A;  1QZ2 A;  4TX0 A;  4JFI A;  1FAP A;  3FXY A;  2WM0 A;  5DIU A;  1PBK A;  1ZBV A;  1N1A A;  4ODR A;  1W1T A;  3WKZ A;  1FFQ A;  3WL1 A;  1EDQ A;  1EIB A;  1JND A;  1QPL A;  4URI A;  1ZK6 A;  1ITX A;  2KO7 A;  3TDB A;  5B8I C;  5HTG A;  1KT0 A;  2WLY A;  1FKS A;  2QF8 A;  3UQA A;  3ALG A;  1E9L A;  2PPO A;  1FKH A;  2PN0 A;  5D75 A;  3IHZ A;  3UF8 A;  4ZPV R;  1O6I A;  1P5Q A;  4MNM A;  5DEZ A;  1PIN A;  3PRD A;  4HBE A;  1EQ3 A;  1NWR A;  2XP4 A;  1UR8 A;  2WLZ A;  4Z2K A;  2DT2 A;  3H9R B;  5BXJ A;  1W26 A;  2VN1 A;  1ZB5 A;  1KFW A;  1FKJ A;  4JFL A;  3ARO A;  3IK8 A;  2UZ5 A;  1HKK A;  4Z2H A;  4DWS C;  1FKK A;  2ZR5 A;  2DT3 A;  5GPG A;  4DWS D;  2DT0 A;  3WQV A;  4TNS A;  3O5L A;  1W1P A;  5HW8 A;  1IX5 A;  3KAF A;  2ZQS A;  3CHE A;  1LL4 A;  4AY1 A;  1XHG A;  2RQS A;  3VAW A;  4J4N A;  4W9O A;  1NWT A;  2OLH A;  4MTV A;  4DRK A;  2WK2 A;  1SYT A;  5GQB A;  1NWS A;  4KQZ A;  4N19 A;  1ZBK A;  4U85 A;  2IUZ A;  1JNT A;  2XP9 A;  4P8W A;  1FJD A;  1ZL1 A;  2PV2 A;  2ZR4 A;  4TYO A;  3QOK A;  4DRI A;  3IKD A;  2DG3 A;  1XRV A;  3ALF A;  3OA5 A;  4PTM A;  4MSP A;  2PV3 A;  3ARZ A;  3NRK A;  3WD1 A;  1Q1C A;  2KFW A;  3KAG A;  1YW5 A;  5DIT A;  2DG4 A;  1FKB A;  3PRA A;  2MF9 A;  1E44 A;  2Q5A A;  2EUL A;  4ODO A;  4U86 A;  2LGO A;  4IPX A;  1LG2 A;  3O5O A;  1WB0 A;  3OOB A;  3CZ8 A;  4ODP A;  3AS2 A;  2G8Z A;  1F8A B;  4R5E A;  4O2T A;  1HKJ A;  2MLX A;  2A3E A;  2M1I A;  1WAW A;  2ITK A;  1M5Y A;  1FKT A;  4QIB A;  3WL0 A;  2XP7 A;  4GGQ A;  1TCO C;  2N87 A;  1W1Y A;  4L72 B;  1HJV A;  1B6C A;  3ART A;  1LL7 A;  1JNS A;  1W9U A;  3O5R A;  3B9A A;  2MLZ A;  1FKL A;  4WKF A;  4DRN A;  4W9Q A;  1D7J A;  1ZBW A;  4WIW A;  4J4O A; 
#chains in the Genus database with same CATH homology
 2G41 A;  4G50 A;  4BF8 A;  2AOS A;  3O5J A;  3PR9 A;  1FFR A;  3KAC A;  4W9P A;  3ARY A;  4JYS A;  1NH6 A;  2KE0 A;  3CH9 A;  4KR0 B;  1ZCN A;  1GPF A;  1LL6 A;  2XPB A;  4QZV B;  4LAW A;  1U79 A;  1E6Z A;  2O92 A;  2YBT A;  1HJX A;  2XP6 A;  4U84 A;  2RSE A;  3WD2 A;  1H0G A;  4WKH A;  5HWB A;  3JYM A;  2DSU A;  2MPH A;  1EYM A;  4GIV A;  2PBC A;  4IT4 A;  3CGN A;  1ROT A;  3RM4 A;  1LJY A;  5J6E A;  1GOI A;  1E15 A;  2K8I A;  3G6M A;  4JFK A;  1NSG A;  1X6N A;  5DIV A;  1NWU A;  3ARR A;  4DRJ A;  1NMW A;  3ARU A;  3UQB A;  1KT1 A;  4HAR A;  1FKD A;  1FKI A;  1L1P A;  1NMV A;  4ODL A;  2ZR6 A;  2KGJ A;  1HKI A;  3PA7 A;  1SR0 A;  3CHD A;  4QT2 A;  3RGC A;  4Z2I A;  3PRB A;  3UI5 A;  4Q7N A;  3RME A;  2M08 A;  3B7X A;  3NTP A;  1D6O A;  4S3J A;  3TC5 A;  1ZU8 A;  4S3K A;  2XP8 A;  4W5U A;  2AWG A;  1FKG A;  4ITZ A;  2DSW A;  1EHN A;  5GPR A;  4DRM A;  4WJX A;  3AQU A;  3G6L A;  4DH0 A;  4DWS A;  1UR9 A;  2A3B A;  1A7X A;  4DZ2 A;  4QT3 A;  3TCZ A;  4ODM A;  2F2D A;  3O5D A;  1FD9 A;  5I98 A;  1LG1 A;  2XP3 A;  1D2K A;  3WQW A;  1HKM A;  4NSB A;  4NZC A;  3UI6 A;  3O5E A;  4IQ2 A;  4DRO A;  3AS1 A;  4DRH A;  5HWC A;  1Y0O A;  1OWQ A;  2A3A A;  1HJW A;  3JXV A;  2A3C A;  1FKF A;  4DWS B;  1JVW A;  5HUA A;  4Z2J A;  3KAH A;  3ARX A;  4LAX A;  2RUD A;  1QPF A;  4ODN A;  4IQC A;  1E6P A;  3BXW A;  1RD6 A;  4JFM A;  2LKN A;  2ESC A;  2VCD A;  3B9D A;  4HBO A;  3B9E A;  3WIJ A;  2OFN A;  3ODK A;  3KAB A;  1E6R A;  3O5P A;  3O5M A;  4NNR A;  2IF4 A;  4ZS6 A;  4G2P A;  1Q6U A;  2PV1 A;  2RUC A;  4TW8 A;  2PI6 A;  2LJ4 A;  2KI3 A;  3FY1 A;  3MDY B;  2ZQU A;  1OGG A;  5HBF A;  3IKG A;  1WNO A;  3CGM A;  4Z2L A;  3RM9 A;  2YBU A;  1J4R A;  2LPV A;  4DZ3 A;  3GPK A;  3W4R A;  4MNL A;  3KCE A;  4IT6 A;  3LUO A;  2DG9 A;  1W9P A;  3O5I A;  1Q6I A;  3JYJ A;  2F4E A;  4ODK A;  3FAP A;  4P8V A;  5DF0 A;  4MGV A;  2DPE A;  3WD3 A;  5JH8 A;  1ROU A;  2FAP A;  4P8U A;  1J4I A;  3CHF A;  2F21 A;  4ML4 A;  2FDM A;  2JZV A;  1F40 A;  2RUR A;  4FN2 A;  4LAV A;  1H0I A;  1T11 A;  4XAK A;  4TW7 A;  4R0X A;  4WKA A;  1X6L A;  3O5K A;  2DT1 A;  2PPN A;  2PPP A;  5HKG A;  3O5G A;  3WD4 A;  3ARQ A;  2D9F A;  4ZPT R;  3RM8 A;  1W9V A;  1GUV A;  1Q6H A;  2ZQV A;  1CTN A;  3KZ7 A;  4FAP A;  3B8S A;  5HT1 A;  2M2A A;  1LQ0 A;  4L3N A;  1BKF A;  3AS0 A;  1D7I A;  5HW7 A;  3WD0 A;  3ARW A;  3WH0 A;  3KAD A;  3ARS A;  4Q22 A;  4TW6 A;  2Y78 A;  2B31 A;  3AS3 A;  3UQI A;  2RUQ A;  2FKE A;  1R9H A;  3ARV A;  1OGB A;  3NI6 A;  4C02 B;  3I6C A;  4LAY A;  2L2S A;  4ODQ A;  3CHC A;  1TFV A;  1HXV A;  4LGX A;  4Z2G A;  4MNK A;  1J4H A;  3O5F A;  1ZBC A;  2DSZ A;  4MPK A;  4DRP A;  2XP5 A;  4P8X A;  1YAT A;  5DO2 A;  2DSV A;  2KR7 A;  1BL4 A;  2MLY A;  2ZQT A;  4JFJ A;  1C9H A;  1JNE A;  4DT4 A;  2XPA A;  1E6N A;  3KAI A;  4DIP A;  4ZPW R;  4MNJ A;  1FKR A;  3EY6 A;  3RFW A;  1VF8 A;  3ARP A;  2O9O A;  1J6Y A;  1K9T A;  1W1V A;  3UI4 A;  4DRQ A;  1D7H A;  5HW6 A;  4WK9 A;  3O5Q A;  2MNT A;  4MAV A;  1QZ2 A;  4TX0 A;  4JFI A;  1FAP A;  3FXY A;  2WM0 A;  5DIU A;  1PBK A;  1ZBV A;  1N1A A;  4ODR A;  1W1T A;  3WKZ A;  1FFQ A;  3WL1 A;  1EDQ A;  1EIB A;  1JND A;  1QPL A;  4URI A;  1ZK6 A;  1ITX A;  2KO7 A;  3TDB A;  5B8I C;  5HTG A;  1KT0 A;  2WLY A;  1FKS A;  2QF8 A;  3UQA A;  3ALG A;  1E9L A;  2PPO A;  1FKH A;  5D75 A;  3IHZ A;  3UF8 A;  4ZPV R;  1O6I A;  1P5Q A;  4MNM A;  5DEZ A;  1PIN A;  3PRD A;  4HBE A;  1EQ3 A;  1NWR A;  2XP4 A;  1UR8 A;  2WLZ A;  4Z2K A;  2DT2 A;  3H9R B;  5BXJ A;  1W26 A;  2VN1 A;  1ZB5 A;  1KFW A;  1FKJ A;  4JFL A;  3ARO A;  3IK8 A;  2UZ5 A;  1HKK A;  4Z2H A;  4DWS C;  1FKK A;  2ZR5 A;  2DT3 A;  5GPG A;  4DWS D;  2DT0 A;  3WQV A;  4TNS A;  3O5L A;  1W1P A;  5HW8 A;  1IX5 A;  3KAF A;  2ZQS A;  3CHE A;  1LL4 A;  4AY1 A;  1XHG A;  2RQS A;  3VAW A;  4J4N A;  4W9O A;  1NWT A;  2OLH A;  4MTV A;  4DRK A;  2WK2 A;  1SYT A;  5GQB A;  1NWS A;  4KQZ A;  4N19 A;  1ZBK A;  4U85 A;  2IUZ A;  1JNT A;  2XP9 A;  4P8W A;  1FJD A;  1ZL1 A;  2PV2 A;  2ZR4 A;  4TYO A;  3QOK A;  4DRI A;  3IKD A;  2DG3 A;  1XRV A;  3ALF A;  3OA5 A;  4PTM A;  4MSP A;  2PV3 A;  3ARZ A;  3NRK A;  3WD1 A;  1Q1C A;  2KFW A;  3KAG A;  1YW5 A;  5DIT A;  2DG4 A;  1FKB A;  3PRA A;  2MF9 A;  2Q5A A;  4ODO A;  4U86 A;  2LGO A;  4IPX A;  1LG2 A;  3O5O A;  1WB0 A;  3OOB A;  3CZ8 A;  4ODP A;  3AS2 A;  2G8Z A;  1F8A B;  4R5E A;  4O2T A;  1HKJ A;  2MLX A;  2A3E A;  2M1I A;  1WAW A;  2ITK A;  1M5Y A;  1FKT A;  4QIB A;  3WL0 A;  2XP7 A;  4GGQ A;  1TCO C;  2N87 A;  1W1Y A;  4L72 B;  1HJV A;  1B6C A;  3ART A;  1LL7 A;  1JNS A;  1W9U A;  3O5R A;  3B9A A;  2MLZ A;  1FKL A;  4WKF A;  4DRN A;  4W9Q A;  1D7J A;  1ZBW A;  4WIW A;  4J4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...