3I6KA

Newly identified epitope from sars-cov membrane protein complexed with hla-a*0201
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
275
structure length
273
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The membrane protein of severe acute respiratory syndrome coronavirus acts as a dominant immunogen revealed by a clustering region of novel functionally and structurally defined cytotoxic T-lymphocyte epitopes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 73
structure length 273
sequence length 275
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3i6kA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3i6kA01
4Y4FA 3UYRL 3EDFA 5DK2A 5A2LH 3SE3A 2NY0C 1OP5H 1CDBA 4OCYH 4JM4H 5HI4C 2Z4QA 3L5XL 1SM3H 2LTQB 1NGZB 3RBSA 4G8FB 2VMFA 3UTTE 5C6TH 4DN4H 1A6TB 1UWXK 4LLMA 4XP1H 4MDIB 4LARL 5IM7A 4ZUWB 3E6HB 5EC1A 5CZVL 1JF6A 5IEKB 5IMKA 5D1QB 1MH5B 2EDYA 3RWJB 2ITDA 2AJ3A 3SY0A 3D0LB 4MB4A 4JHBA 1A21A 5MHSE 1F4YH 2APFA 4Q9QL 3MGTA 5D71L 3X14A 3THMH 4G43B 1VEMA 4MGXA 4Y19D 3QDMB 5C0FB 3CH8A 1GSMA 3RNKB 3CVHA 1NCWL 4EDXB 1AXTH 3MV01 4G8GD 1TJGH 2VLMD 3WL9B 1XGRB 1MREH 4PJ8D 4PJIB 2NQCA 4JVWA 2ZKHL 1AD0A 5KANI 3WSQH 2ESVD 2HJLA 3L5HA 4PJBB 3BKYH 4L29B 1U92A 5LXGH 1OF2A 2GJJA 2W59A 2OP4H 3TT1L 3B5TA 4WRLA 5ILTL 5DRNA 4JFZH 4P4KD 3DUSB 2ILLA 2G60H 3FFCD 3THML 1IBGH 4IDJL 2R0LL 2VKXA 5DJ6B 3C08H 3S6CA 3VXTB 3B5GA 2D9QB 1A9EA 3HPLB 4OFIA 1K2DA 5GGVH 2NNAB 1UCBL 3UPAA 5LAXA 1JGVH 3WXWL 1OAZH 3D0VA 2JCCB 1JHLH 3PGCB 1J05A 4G9DA 4YNYB 5C0NC 4EDWH 1FFNB 4P2QE 3C6SB 5EUOF 4CJ1A 3QIBA 4ONHA 3FB7B 5D4QA 1TJIL 1Y0LA 5F88B 1EGJL 1CL7I 2P7TA 3SGEI 4K3DH 3V8CA 1A1OB 1F3DH 1G7MB 1SY6A 4ALAH 3PWLB 5J3HC 4PY8I 5FYKH 4ORGA 2OMBA 2VQUA 3PP4H 2HFTA 5D96B 4AQ1B 4JDVB 2A0LD 4MDIA 3FAXA 5H37G 1ONQB 3ZTNH 3CH1A 2IBZX 4QHLA 1SYSA 3TCXA 4F7EB 1ROWA 3FT4A 1Q94A 1LEGA 3OKOA 4KU1A 1JGVL 2VOTA 1OAZL 3MLUL 3H9ZA 3HLAB 1J0ZA 1C1EH 1OP5K 1PG7L 1TVHB 1ZT1A 3D39D 1NCBH 4JR9L 4QHUB 4H1LH 3BUYB 4KXZH 4Z7VF 1WBYB 3V79C 3RNKA 2COQA 1V7NH 3EYFA 4PGEA 3RVWD 1XGRA 4GQ9H 4RQQA 5C07D 4LLYA 3K4DA 3U1SL 2R1YB 2AQ1A 3BMVA 3BPCA 5K9KB 5HHOE 1A6ZB 5T3ZE 4NCDA 3IDNA 5MERA 5FUZH 2MOVA 5IMMB 2EH7H 5FOBA 2B1AH 1MHHA 1BHGA 4DKFH 4G8EB 1QBML 1N64L 3ZDXF 1HHKB 1ERNA 4NRYA 3CPLB 3LS4H 2BOBA 2W9DH 4MNGB 3RWGB 5MI0B 3MJ7B 4AEEA 3GRWA 3OZ9L 1A7QL 2HT2C 4LCYB 4AM0A 3UYPA 4QWWD 1MJ7H 3VXSA 4IMLA 3HPLA 1PKOA 1BFVL 4ZOBA 3MODL 3K2UL 3L9RB 3CZJA 4BSVA 2QL1A 4OCMC 1N0XL 1P69B 3KYMB 1NDMA 3V0WL 2FX8L 5EUOA 3DWTA 4GRLC 4M62H 1RJCA 4BQ9A 4KTEL 4DW2L 4KV5E 3DVIA 4Y8AA 5C0BD 2Z8RA 2DYPD 3SDDD 4E42B 2GHWB 4Y5YB 1Q8MA 4QRTB 1WZKA 4RAHA 5CHNB 1HXMB 4AT6A 4CAGA 5FUOH 5DZNA 4Z0XA 4WI7A 1FGVL 5HYSB 3TIEB 4F9PA 4C83A 2J5LC 4JO1L 1Q94B 3FQRA 4XXCA 4ZS6D 3IF1A 1FZKA 3IU4H 4RA0C 2CIKB 3BPOC 4M1DH 5A3ID 3E2HC 3T2NH 1ND0B 5DK0B 4NWUL 4EN3C 1F4AA 5H2BA 2B20A 2R0KL 1G1YA 5D93B 4U3HA 4D9QD 3UTQB 4NT6B 2MTPA 5DRXB 2HH0H 4MXVE 3O9WC 2F9BT 4PG2C 1T1WA 4ELMA 2ZUXA 4XCCL 3ZE0E 3K1KC 1NGPH 4TSCL 1IGTA 1JYVA 1WWWX 3HE7B 4PP1D 5IF0B 1OCWH 2DAVA 4XHQA 4FQIH 5HHVH 1MJJA 2IBZY 4HZLB 1ZANL 4KKAC 5C6WH 3QHTC 3IU4L 1KCRL 3L3JB 4TVPH 4XX1G 3KNBA 5HYJA 5F7DB 1DDHB 5DEZA 3RWGA 1JYXA 4LU5L 5IBUB 3V6OE 4AM0B 5J4MA 3P0VH 3HAEG 2YSSA 3P0YL 4OGZA 1FNGA 4N0YH 4K3EH 4NQCA 3AAZA 2AJSL 5DMYA 4H5SA 1MCDA 4J3TA 3Q1SL 4UINH 3KYMA 4GKNA 4D2NA 3AFLA 3LV3B 3KPRB 5INCA 3C2SA 1IILE 4MD5A 3B5HA 5KSUA 5HYQB 3MNZB 1MEXL 2W0PA 4S0SD 1S7TA 5HY9A 5CZXC 4XCEA 3FN0L 1A1MB 2R8SL 5E8DL 4MX7A 3S3JA 3MRHA 5FO8B 5CMAA 4F57H 3VDAA 1G9NC 4KKCD 4GUPA 1C5BL 2X4UB 2FO4B 2HRPH 1U6AL 2X42A 3MOBH 1QTYT 1XF1A 3GSRA 4PJXE 5ABDE 4QOKE 4MHHG 5HYSA 3TVMA 4G6JH 1JNHA 1DUZA 5HDQH 5HVWA 1RULL 3SE4A 4PTTB 4U6TA 2LAAA 4RZCA 2PCPB 4HXAH 1RIVH 1QKZL 4XMLL 5B3JE 3QFJE 1W0WA 5JPMB 4FZ8H 4Y19A 1WLHA 4HPYL 1CXLA 4P9HC 3LDBC 3VRLF 4P46A 3HB3D 5ALCH 3PV6B 1A4JA 3UTQA 1RZKC 4K3GA 5HHOB 2VXUL 3X3GH 5KSBE 4LVOB 3UBXB 2QR0A 2AJUH 3U83A 2IQ9L 4I5BB 2YD4A 3GSXA 1NFIA 3OX8A 2QKIB 2W1NA 4G6AD 4ZXBC 1TZHB 4JR9H 4FFWC 2XT1B 4UQ3A 2CIIB 1U8HB 4G9FD 3A6CH 3DV6A 3K2UH 5GIRA 3SE4C 1ZVYA 5CSZA 1HWHB 1MWAL 2ZUSA 3H3PL 1A7PL 3CCHA 2PYFB 3GKWH 3EJJX 1ZHNA 2PXYC 1MHCA 1CGXA 4LHUA 3G5ZA 4XVUC 3EFFB 1CG9B 4EBQH 5IVZA 3V4PH 4EUPB 3TO2A 3U9UB 1U8QB 2IQ9H 3FAWA 1OQOA 4WFEE 2YPKA 1QBLL 4WNQB 4X8XA 3LKRA 1CBVL 1EUTA 4L1HA 1D5MA 2WBJD 4X7SH 3AY4A 1TJHH 5FO9A 1KEML 4HWBH 4NP4H 1S5IH 5E8PB 4ODWB 4NRZB 3K80A 3RUGF 3FFCE 3MCG1 4GS7C 2XRAH 4N5ED 3RP1A 1J8HD 4P23A 2HTKD 4HJ0D 3VFSB 2VXSL 3TT3H 4X4YB 4HK0B 3V6FA 2FX8H 2R2BB 4GRWH 1ADQA 1CD0A 4J1UB 2JB6B 3PWJA 4RNRB 4ODVL 4P2OB 1MRCL 3OGOE 4Z7WB 2A73B 3ARFB 2EE9A 3D6GA 4Z78A 1VGKA 4S1RH 2MCPL 3ZLQC 4P2QD 2WUBL 5DRZA 1MFDL 2P1YA 1EXUA 2HT4C 3RWEA 5D1ZC 3SPVA 5L0QB 2FJHB 1QLRA 3QNZB 3HAEH 4QOKB 1K9TA 1IEAA 1ZT4B 3KXFA 5ACZA 3PV6A 4XHJC 4EXPX 4QTIL 3DHJA 1IAOA 3IVKA 1FZMB 2DWEB 5E6IC 2DWDA 5TDNA 4WWID 3GGWB 2Q7YB 1PKQA 2AP2A 3KS0J 3BRDA 3HUJF 4Y4KB 4LF3B 4POZC 3BQUC 1WAAF 4NQUA 1U3HC 2DLHA 5IESL 3TN0D 3C60A 2EZ0D 2HG5B 3ARZA 3J7HA 4P2QB 4YO0A 1QQDA 4F9PC 3SBWA 3CFBB 4Z0BL 1IC5H 3HZKB 3VFVA 1CGSH 2QQNH 5C2UB 1KULA 1U2HA 2W0KA 5BS0E 3PL6A 1IJ9A 2FWOB 5HTSA 3RKDD 3BEWB 3L5JA 3TO2B 2VDRL 1WFUA 5BJTB 5F6HI 1G84A 1TETH 3TVMC 3FB5B 4OZFB 1B6DA 2E27L 2P8LA 3RKDC 4JZNB 3ZKXB 1BX2A 1MI5D 4DOHE 3D3VA 1FNEA 3O3DA 5GRZA 5FYLH 1QR4A 5GS0D 4NHCH 3FQNA 5DD3H 1YPZB 3PV7A 4EQ2A 1HHJA 5BZDA 3RJDA 1LO4L 4KK6D 3QCVL 1GZQA 4PJ8B 4L8DB 3LH2L 3D9AL 4OCSH 5C07E 4WTZA 1JGDB 4NBXB 3UJIL 2FX9H 1ZGLM 5JDJA 4TNVF 1FYTA 3QCUL 4L8SA 5L2KA 3CC5B 5E95B 3C8KB 2Z4QB 3SE8H 4U31A 4WWKA 1J5OH 3W9DB 4HWUA 5HYJE 4G8FA 2H8PB 3HC4L 4JANB 2IFGA 5FYJD 3IJSB 4KJPC 2X70A 4HBQA 3RVTC 1HKFA 1YNLH 4RMWA 4X9HA 1CXIA 3L1OH 4OZ4A 2P43B 4OCWH 3O11B 1F58L 2X4PB 3S37H 1NGQL 1L6ZA 1ZV5A 4IIQA 3A6OA 5DJXB 3CFKB 4ALAL 4M43L 4ZS7L 3BE1H 3OAUL 4QRQA 3GKWL 4DFIA 2PO6C 4Z7OE 3BMWA 4OF7A 3STBA 1AY1L 3BISA 3E1F1 5IJKC 3SJVB 4I2XE 2W9LA 3TO4A 5CD5D 1S8DB 1UWEH 2CO6B 1I4FB 1RUKH 1KG0A 4OD1H 3D39B 4H1LG 5I1LA 5I1JH 1RU9L 2AERT 4KHXH 5L2JB 3H0TA 1MVFA 1KELH 4LFHD 4LK4A 2B7DT 4Z7UA 3T8XA 5D1XC 4ZPTA 5JIHA 2ESVA 2OI9C 3TV3H 5IOPB 3ULVD 3FB5A 1DBBL 2Q86B 3GJFA 1CLZH 3MRLA 3RWCB 2NY6D 5DEGA 5H37H 4CRPA 1I8IB 1J0JA 1J12A 2WBJA 4OLXL 4PV9B 4X4MA 3GFUA 1PZUB 5EO9A 3WIFB 2C4XA 3KS0H 3BIAX 3ZSTA 1DSFH 4PRBA 5IR1A 3S88H 1J87A 4ZYKA 3QXAB 5BZDB 3BO8B 3S35H 2VLRD 2A2QT 4ODSH 3HZMB 5GISH 1MAMH 1WBZB 5DHVB 5LAXB 5TQ0L 1T5WB 3HKFA 2HN7B 4QRSA 2HKHL 3RA7H 5GJTH 3U0TA 2MHAA 4P59H 4NQSB 4PLOB 1FE8L 3GSNL 2Z31D 2NX5B 3L5WA 2E6QA 3LMJH 5D2LF 2QQQA 1UKSA 4LSQH 1RURL 5IW1A 1MY5A 4LSPH 4N8CL 4PB9H 1XGTA 3NPZB 1QEWB 3HE6D 2N4IA 4ODTL 3BX7C 2IAMA 4UOW0 3U7YH 3QYCA 5FHBL 4LAQL 1EFXD 3WXVL 1ONQA 3QIUA 1MCWW 4FXGB 5M7QA 5DFVC 3VA6A 4S11A 4XP9L 4E5XB 2CO7B 1NCCH 1W8OA 2AABL 2D7MA 4IJ3C 3U46A 2BXYA 4XMKL 5F1IA 2R15A 3EJZD 2NY4D 1I75A 1Y6MR 3VG0L 2HFGL 3SDCB 2AVGA 1I9JL 1MPAH 1QFWH 3KYKL 3N1PC 1DVFA 5IGXH 3EDJA 1YN7B 3K2MC 3TO4B 1P4IL 3MJGX 2JJWA 2JB5L 1I4FA 3KPSD 3MRCB 2R1YA 5CILL 4CDGC 5DC9B 2ZG3A 1EZVX 4PLKC 4DN4L 1IEHA 2APVA 1GGYA 4HFUL 5C92A 2NMSA 2H2PC 5I17B 3IDNB 2P5WD 5EZJA 4PJHF 4C56B 4KV5F 1I85C 2F54E 2FIKB 4YDLC 3T0WA 4BSJA 5IOPA 4X5WA 4QOKD 4PGCB 4JQXC 3B9KC 4BZ1L 2IC2A 4WY7H 3RGVD 3FO9A 4PUBL 4EZMA 2GJ6A 3AS1A 3UTSE 1MLCB 4OIIL 4QTHB 2KPNA 4NO0D 4XPAL 1F6FB 3LZFH 2PNDA 4ZFFB 4Y4KD 5E7BA 3G9AB 2HVJB 4L4VB 4WEMB 3ZE2F 2GSGB 1RZFL 3CFJA 4R8WL 4NKMA 3I6LD 2YRLA 1TENA 4LBEA 1E6OH 1L6XA 2WY3A 2EE6A 4Y0GA 3S8WA 2HN7A 1GHFH 1AGCA 1QNZH 2W07A 4QRSB 1A7BA 3OXRB 5F9WB 1PEWA 3DROB 3ULUC 1HHGA 4LVNB 4XXDB 3MXWH 4ZUSA 3BRFA 1T7YA 3W9EA 3UYOD 2KKQA 5C2BH 4OCSL 4LLMB 3FO2B 1FC2D 3MNVA 4R2GC 1NL0H 4X9BA 5F89B 5DQDH 3UYRH 2Q8BH 2EKSB 5FKAB 3LCYA 1MH5A 4XC1H 1QBMH 3U48A 3KPRE 3ARGB 4K23H 4B5EA 2XQBL 1OGAB 1KB5L 2ZCHH 3IS0X 4QXGL 2VXQH 1B2WH 4QXWA 4XZUA 4PR5B 1GOGA 1VESA 1Z6JT 1FPTL 4RAUA 5CBEA 3TBVB 5D72L 3CVHB 4F3FA 4EDXA 5FYLD 3S5LG 2O26U 3MXWL 2UZXB 4PJIA 3CAFA 1H3PH 4LARH 5L8LB 5AG8A 2R0LH 2G5RA 4WVRA 3K1DA 4P2RD 5FO7A 4YQXL 3FB8A 4FG6D 3ZL4H 4YHPB 2VXUH 4XB8A 3L3OB 1C16A 3DX7B 3QWRD 1JN6B 2QHLA 4XC3H 4JKWA 4U6XA 3L3JA 4IHOA 4Y4FD 4AEFA 5HYIA 1D7FA 3O0RL 2IALA 4M6AA 4M61A 5GGRB 2GAZA 3SDXE 3S35X 5M94B 1SVCP 1KCGC 1OSPL 2ZKHH 3QA3A 1FFOA 4R0LC 4L4VA 1K2DB 1JL8A 4KFZC 1MCPL 3G6DL 4EI6B 3L5XH 1IEBA 2MPAH 3OKDB 3QEUA 4I48B 3EHBD 1R3IH 4OF0A 5CFHA 3KPMA 4BZ2H 4HGWA 1MJ8H 4IIQC 4LL9A 3ULUH 3LQZA 4M9PA 2EH7L 5EBMB 4XCYA 4NJAH 4D9LL 4XCEB 5KVDL 5DD1L 4PJ7F 3KDMA 1WJ3A 3QDGA 4LSDA 4HIHA 5AZ2L 1MI5E 1A22B 1KPUB 4OLVL 4G6KH 3DURB 1KJ2B 1Q0XL 1UEYA 3MNVB 3NAAH 3GSRB 1P4LB 3EYOB 3F7VA 5D71H 1OSPH 5J9PA 3RTQD 4GO6B 4F7EA 3ERYA 5IGXL 2YMXH 3OBAA 1I7RA 1A3RL 1RK0A 4TVPL 1Z3GL 1JNNH 2NZ9D 1NGXB 4Y2DD 3P30H 2IH1B 4UBDD 3BUYA 3JXAA 1OARL 3TBSB 2BMKA 4PJ5D 3G6AA 2EIEA 4DGVH 5F3BA 1H3WM 2F8OA 5GSVB 1A4JB 4DGYL 5ESAA 1DLFH 5CIPH 3NIDE 2YS4A 3SDAC 5D2NE 1IL1A 4DJMA 1VFAA 3GI8H 4I5BA 1ZLWH 2P8PB 4PRDA 4YFLI 2BVOB 5CEYB 2GCYB 3FB8B 5HVFB 1FHGA 2CIIA 2VL5A 1C16B 2R2HB 5F7NC 4NZTH 3TP4A 1AXTL 5GRUL 1OAQH 4W4OC 1HHKA 1HCVA 3GSOB 5HI5C 2XN9B 4WW2B 3MJ9A 3LN5A 3GRWL 2YK1L 3A6BH 3P40A 3TN0C 1A8JH 4UTAH 3MJ7A 3B9KD 2VKWA 2VXVH 2YXMA 2KH2B 1ZHNB 3BGFB 5C0EA 4C4KO 4ODXA 5BXFA 4ETYA 4LFHG 5D7SL 2JJVA 1LVEA 3UO1L 1VPOH 1DEEB 1U8QA 5E70A 1YYLL 3IXTA 4JFZL 2AXHA 4LVOC 4J6RH 4KJWC 3EOTH 4LEOB 2JLLA 3VMNA 2NY0B 5HGBA 1E4XI 1LE9B 4XHJD 1YN6B 3SKUD 2Z8WC 1R0AH 1IGFH 2EC9T 5E1HB 4NZTL 5GGSB 2Z92A 5JW3H 2A9NH 4AYFA 5AYQA 2FRGP 4XPBL 2ZUVA 5DEFB 5CJQL 3VGDA 4G6MH 4HFWB 4ZO7A 2L7JA 4NDMA 1NMAH 2R2BA 1MCOL 2GY5A 2IGFH 4JRYA 4QHNA 1UEMA 3MLRH 5AUMB 3SDDB 5DD3L 3D39E 5D2LE 1I7RB 3A6CL 1L7IL 3LAFA 4P99A 5B39B 5C7XL 15C8L 4P49A 4YDKH 3KPSB 4JJ5B 4I3RH 1KT2B 1EXUB 3PDDA 3C6LC 4MVBD 1DBMH 5BRZA 1WIOA 2I07A 4YE4L 2KZ1B 5F3BB 2IH3B 3MRFA 4U2YA 1IAIL 4Z77A 3OKKA 3FRPA 3ZKNC 5ITBH 5E00B 5JHDA 3IT8D 3ESVF 2BVTA 1MCNA 2NY6B 3J8F7 5DGQA 4GSDH 4PP2A 3P0VL 5IVXB 4MXQC 2VQTA 3G5YA 5IF0A 4KI5D 3MLZH 3CZFB 4HUVB 4HZLA 1N6QH 5IHUH 5L9DL 3KYAA 1JNLH 4MAYB 5HYJB 4OQTH 3LN4A 1T7VA 3CFEB 1JGUH 2WIMA 4Y4HB 2EDKA 5BV7B 4NFCA 4U1KB 1BBJA 5ISZE 5FYJU 3P2TA 5C0EB 4LMQI 5JHDE 5KVFH 4UT7L 4NJAL 4D9LH 4V1DE 5FYKU 3ARUA 1GIGL 2ZSVA 4CMMB 3QPQD 2HLFD 1UM6H 2F54D 2CRMA 4UTBH 1K3ZA 3WJJC 4OZFA 1T2XA 2HMID 5DZLA 2C4FT 4Q74A 1IM3B 3VJ6B 1RVFH 1A1MA 2BNQD 4K9EH 1CDCA 2IJ0C 4ZOEA 1F6AB 3RL2A 3CFCL 5GRXG 4GQPH 3HNSH 4KPHH 1MVUB 3VD5A 1OP3K 4N0YL 1VA9A 4CVZA 5EU6D 5F21B 3QUXB 2BY3A 4LSSL 4XPFL 3NIFE 2PR4L 3O9WA 5AUMA 4Q6IA 2DQTH 5ESVB 4FRWA 4Z5RB 5L7XL 1G7HB 4Y5YC 2W9EH 4N0UB 4YDLB 3W9DA 4OLVH 1U8OA 2I9LB 1HK6A 4TSCH 2CGRH 1UGNA 5I19L 5F9JB 1ACZA 2R4RL 1DE4B 1U8LA 4Y16C 4Z7WF 4OZ4B 2CLZB 1DANU 3GMNB 4NKQB 5D5MF 3P77B 1KJMA 5AAWA 3O4LD 5GRYA 2QQKH 4S0TD 2AI0L 4NWTH 2OS7A 4BQBA 1N2RB 3WJJA 1KFAH 4ZDHA 4M3KB 3CZFA 3L3DB 1C5DA 4HUVA 1MHPL 2M8XA 2FO1A 5FCUL 5LG1A 5D5MB 4XPTH 2XTJD 4JFFA 3LN9A 1JF1A 3TJEH 1T3FB 4PJFE 4YK4C 1KCSL 2ORBL 4XXCC 4ZFZB 1K8DA 2W65B 4Z7VB 5LGKA 4X7TA 3NA4A 4A2LA 5IB4A 4UI2A 1CGUA 1NANH 1ZLSH 1NCUA 5DT1H 1HZHH 4Y2DB 4YHZH 5ISZD 1IGML 2ZG1A 4NUJA 4KVNH 2EDRA 3MRGA 3IJYA 1XGUA 2Q86A 1AGEB 3EFDH 4RSVA 1CE1H 4WFGD 3HPJA 4LSUL 2C3VB 4TNVK 1AFVH 1CTOA 5IB1A 1KIPB 1F6AA 1INEL 4QRRB 1FO0H 4AG4L 3GSQB 2XG4A 4Q6YA 3BO8A 4AH2B 4P23B 5TH2A 1N7MH 3KHOA 3T4YB 3QUXA 3QO0B 4PJGB 3F65A 3BE1L 3PWJB 4M03A 3PWNB 3MXVL 5A1AA 4OBSA 3IFLL 5DR5H 2XXCB 4W81A 1P1ZA 1F4XL 1F4WL 1G7HA 1I8LC 4N5UA 5D2NC 1UB6A 4LKXA 4WFFD 3G04B 2DYPB 3EOAA 3ULVH 4GSDL 4JO4H 4P2OC 5T1KB 4LNRB 3T09A 1LEIA 4FABH 4NM4H 3VRLE 4JPIB 2LU7A 4LAJH 1YEEL 3TF7C 3E6FA 2VH5H 2AK4B 4KJPD 2C3GA 1WZ1L 2H26A 2C1OA 4E5XA 5IG7A 3B8YA 4OZIE 1AGBA 5AZEL 3EYUL 4FTVE 3ARBA 5EIVA 1NUNB 3O2VL 3BHBA 4YDVB 4PJ7A 5F7KC 1J1OL 1JF1B 3E3QA 4PV8B 3LS5H 2AXFA 3LEVL 5A3IC 2JE8A 1AHWC 3KPTA 4PJ5E 5LGHL 2W65A 5DO2C 5E0QA 3PL6C 1EPFA 1VSCA 4UIMB 4AEIL 1KF9B 3I3DA 4NN5B 5K93A 5C0AD 5FYLL 3BDXA 1DQML 2E7HA 3BEWA 4S1SH 3K81A 4NQDE 4RBPH 4EQ3A 5DI8A 4M7KL 2ZUTA 4DZBA 1X6NA 2AXJA 5JXAL 2H3NB 1R3HA 3CX2A 4POUB 3CSGA 5EU5B 2O5ZL 1JWUA 5TPWL 1C5CL 4XBEH 2ADGA 1I7UA 4YXLH 2VE6A 3D3VB 2QV2A 4XT1C 4Z0BH 4IOFD 3NACL 4URTB 3FQNB 1XEDA 1HHJB 5TH2B 4WUKH 1Y18A 5TJWK 1QD0A 3KR3H 4NKMB 1GGIH 2XG5A 4OSUL 3QO0A 1BOGB 4WFED 1IGCL 3HRZB 3JZ7A 1YY9D 2R69H 4HWZB 5DVOA 5D7JB 1FN4A 4CL7A 3JSSA 4QGYA 2AK1H 1IGIH 1FVDB 1BFOB 3FRUA 4XVSH 1H3XA 5A2FA 5BW7C 1NJ9A 1V05A 4L4VD 3OAUH 4TULH 1WSST 1QZ1A 1KB5B 4U1LB 1UXWB 1LEIB 4HFUH 4DCQB 4UB0H 5TFSL 2IPKB 2GI7A 3UTPE 5I15H 3R1GH 2YPVH 2BVUA 2AK4A 5J13B 3ULUD 1DVFD 2V9RA 2HLFC 4TVPD 5DWUH 3M17B 1JFMA 1K85A 4Y19E 2YZ8A 3V7AE 1F11A 3BHBB 4YDVA 5IQ9B 3W39B 1NKRA 2VLME 1F13A 3SDYH 2C3XA 5DJ0B 1MIML 3OAZH 4U1HA 3MUZ1 1Z5LB 2PTTA 3CUPB 1E0OB 4I4WA 2OL3B 4FA8A 4OD2A 1QSVA 3VXMD 1S7VA 5C3TA 3JWOL 4ISVB 2IAND 4R4BA 3O6FA 3RGVC 4GT7A 1NDGA 1N4XL 4X5XB 1KTKE 3AU1A 1NAML 3CVIH 3O3BB 4IRSA 3V5KA 3C5ZB 1Q1JL 3I02B 3FN3A 1T21A 3B6SB 1YUHA 4PTUA 3RA7L 4QRUA 2AEPH 2DLTA 4ETQB 4PLKD 4NN6B 1XF5A 4JFQA 1F3JB 5ALBH 5IMLB 1FFOB 1TJGL 2D7OA 1KEGH 1SEBB 1QSFE 2NY7H 2YD2A 1R5WB 2GFBB 5EOQH 3OWEA 4YH6A 4ZUVA 4G8GE 3QNXA 5T3ZH 3PHSA 1SY6H 5GGVY 5T5FL 3ELAT 2WINA 4PYGA 2Y1VA 3MLVH 3GSNA 2MHAB 5D7JA 1KJ2L 1JJUA 1N4XH 3VH8B 3OQ3B 4D0DA 3T08A 1A7NL 3KPPB 3SEPA 3MRQB 2MKLC 3QDGB 3QUYB 3DYMA 3C2AH 3SDAD 4WO4C 5CINH 2GIYA 4M5ZH 4HIXH 3UTZB 1AD9B 3QUKB 4AIZB 5FM4A 5C0CE 3HUJB 1LP9F 5HD8D 5EH1A 1U8IB 3LSOA 1LK2A 4FXGA 4UU9B 5DQJA 3TO4D 3SDXA 1EEZB 1OP9A 3BN9D 4O2FA 4TQEL 2EDEA 4QKXB 3T77B 2EDDA 4Y4HD 3D5OF 5D8JH 5T5FH 4ZPVA 4U1IB 2EDFA 4JCLA 2CK2A 3MOBL 2VDQL 4MSWB 2ESVE 1SM3L 4ZFGL 4LSPL 4N8CH 4PB9L 3L7EA 1T7XA 4Y1AD 3ZKXC 5ILTH 5DJ0A 4HULB 5JHLH 4DUXA 4U1HB 2GK0B 3O3AA 3MRCA 5D5ME 1CWVA 1DLHB 4DKFL 2AJYH 3BZEB 1AD0B 2P8MA 4KMTH 4A6YA 4CNIB 4HUNB 5I8OH 3CIQA 3IDJA 5F72S 2PW2B 2UY7A 1G6RL 3B9KA 3I6KA 4XBGA 3QJHA 3QWOB 4H88L 1CFNA 3MLSL 5KOMC 3LEVH 5K9QG 2X9WA 3FO9B 3I02A 1MAML 3BOVA 4PJHB 3MV8B 3GHEL 4QTHA 1LO3L 1PFCA 5DTFB 1Q9KA 5E5MA 1WUNT 4RGOL 5L88H 3RNQA 1N6QL 3B2UC 3MRKB 2V9TA 4XNMB 43C9A 4GQ9L 4MDJA 2GSGA 2ATPB 1DEEA 1EMTL 4A6YH 2KUTA 2F53B 1EBAA 1B88A 3FQUB 3PGCA 4LEOA 5IHBA 5FGSA 4LSVL 5FB8A 1KV3A 5DK3A 1G6RH 4YXLL 3Q6FA 3DO7B 3QIBB 4I0PC 4R97B 1YN6A 1TNNA 1EERB 3GSWA 1TQCC 2E3VA 5GGSA 1D5IL 1FLTX 5ISZA 1F8TH 1F02I 4YFDB 3ARDD 1I1AD 4M02A 4M8QA 1G7MA 3WUWG 1AR2A 4I8DA 5I16B 4F7CB 3QUKA 4LVEA 2J8HA 1LO0L 1MF2L 3PGDA 3FO2A 4HFWA 2V7HA 2FHFA 4C59B 5DDHA 1MJUL 5C0CD 4JDTL 3U1SH 1UB5A 3H9YA 5B39A 1OGAA 5GGTH 2VXSH 2Z8VC 3TT3L 3KLHC 1KBGH 5D93C 4KRMB 8FABB 5C0AB 3HCVB 3KPNA 5JR1L 4YDIH 1UZ8B 4WFGE 1W72H 1WK0A 5E00A 4KH2A 4LQFL 3IDXL 4HF5L 5A43C 3OAYK 3MUGB 5E6ID 3NTCL 5JPNA 4IRJD 1AR1C 5GSRA 4V1DA 2FLBT 2CDFB 2PYEA 1QACA 5I1IL 2GITA 3QSKB 4UAOB 5IVXA 3OR7A 4F2MA 3QJHB 3FQTB 3GDBA 5GRVK 1D5XB 3DX7A 4JRYE 1OWRM 5ALBL 3T2OA 2AJZB 5D6DA 1QA9A 5EOQL 43CAA 1JZ8A 4M5YL 3NA9H 3L7FB 3DXAE 5E5MB 1OHQA 2BSTB 3WMSA 3GSVA 5KVDH 3BUTA 3ARQA 3VGGA 4P9MH 5EORH 4MQ7B 4W4OA 1UZ6F 3GNML 3L9RA 1YJDC 4NUGH 4N0CD 5D2LB 2LU3A 3KXFE 3BW9B 1S7SA 5FUZL 5C0AE 4XNZB 4ZXBB 4L3EE 4PJCF 3Q5TA 5C08D 4JM2A 4KUCF 3KPMB 1U41A 5H35A 4IDJH 3RY6C 1T22A 1NBYB 1A1NB 3RZCC 1HDMB 5CGMA 4JO1H 3Q5YA 3QQ4A 1UJ3A 5ENWB 5DURB 4HIHB 5GGVL 4RDQG 1A6WH 4ZFOL 5GJSL 1GPOH 4F7CA 2QSQA 4Z18A 2AGJL 2FGZA 2V7HB 1CD1B 1P4BL 4XNXL 4GW5A 4M1CD 1PSKL 2HT3D 3IF1B 3SO3B 3G9VA 2IEPA 32C2A 4MJ5B 4WHDA 3MBEB 3QCVH 4JQIH 3UJJL 4H1LB 4P4KA 4KKNA 4WI9A 1YEGH 2XTJC 5JQHC 1SJVA 4H0GA 4MLIA 1EO8L 2NLJB 2LABA 3SCMD 5K9OA 2BVPB 3UJTL 3QI9B 7FABL 3HG1D 3V4VL 1IL1B 5GJSH 2D7TL 1ZSDA 4U6VL 5CJQH 2CDFA 2CJUH 4X8JA 3FFDA 1QUNA 2QTEA 4CVXB 4LRNH 3UXFA 1OAYH 5I1GH 3M1BA 1MUJA 3CXHJ 3CLFH 3UO1H 4O58L 1J8KA 3DSNA 4X7CC 4DEPC 4HS6A 3GSOA 4IRSC 4BSWB 2YRZA 1U0QA 1WZ1H 1CQKA 2B5IC 4WW2C 4LLAA 1G1CA 5FK9A 4JRYD 3DX8A 3FFCA 1JZ7A 1KUMA 4P9HH 3QIUC 4OD3H 5GRJH 2BSTA 4JZJC 2EXWD 2K1MA 5IB4B 2R23A 5J06A 5C09B 3WNPA 3OAYH 3DXAD 3JWNC 1NFDF 1QRNB 2E8YA 4E41A 2XZZA 2F5AH 2VERN 3IXTB 4EXKA 2D7TH 4JO3L 4PRIB 2UUDK 5GS2H 3VG9C 2GY7B 4B50A 3BKJL 5SWSB 5HJ3A 4PRHD 4HS3A 5IB3A 2ICWI 4KQ3L 5ENWA 3UPCA 2A83B 1NKOA 1C7TA 2QSCL 4D8PA 2DQGH 5T1KD 2E7CA 5ADOL 2DD8H 1DQDH 1OTTC 1YEIL 3H7LA 3P30L 1CD1A 2DQHL 3FKUS 2JJTC 4LOUC 5AG9A 1DUZB 1BOYA 1KENH 4GW5B 5T1DL 1DSFL 5T1MA 4WU5B 4FQHA 5L8JB 1PZ5A 4NQXB 4U1MA 4H1LA 5I30L 3MV9D 2CQVA 2V2TB 3LKQB 4LHUD 5EN2A 2EH8L 3TN0A 2NLJA 1WEJL 5C9JB 2IG2L 2XWTB 2QJDA 3A67H 4HQQH 1S5IL 1MJUH 1L7TL 5TE7L 4B7LA 4BZYA 4PGDA 1A02N 4L5FH 1Z9LA 1HNGA 1RZKH 4Z8FH 3CSPA 2D0HA 2YK1H 3A6BL 4PDCE 3G5YB 4DN3H 3RPIB 4F80A 1L7IH 5C7XH 4UT7H 4UQ3B 4V2BA 4JZOA 4OGXH 1JV5A 1FIGH 4JFHE 4UT6L 3FMGH 4BSWA 5IIEA 4JG1L 4PV8A 2NY4B 4P3CH 4YC2C 5AWNH 3ISWA 4IRJA 1M71B 4LVHB 2NXZC 4PJBF 1F45A 1TETL 3VXNA 3T2QA 1CG9A 2QBWA 4GRMB 1ODAA 3IAPA 4P5MB 5E2VL 3WD5H 3LRGA 2ZSVB 1XR9A 3OR6A 1J8HE 4X7FC 5C86A 1KIQA 5EU5A 3ET9F 5D7JC 5CLWA 5HBBA 1OW0A 2OR9H 2X4QB 4KGLA 4OZIA 5DUPL 5HI3D 4HCRL 5E8PA 4FTVA 5IBTL 5FOJA 2A83A 5D7KD 1ZVHA 4OZFG 3UJIH 4N9GB 1YA5A 1YEEH 2ICES 3IDMA 2R2CA 2FHBA 5TDOA 5IJVA 4OIIH 4E0RB 3X17A 4PYHA 1IAKB 3EJYD 5D7IE 4U6YA 4WU5A 1PY9A 4Z78B 5DMJB 4D9RE 2B1HH 1FZOA 4OLUL 3RY4A 5T1LD 2R4SH 3QUXD 3GJEA 5EN2B 2VUYA 5D1QD 3TWCL 3KYNA 5C9JA 3FHAA 3F12B 1UC6A 3L95B 1EJ6A 4OJFH 5BOZG 1R6VA 1H8SA 3Q48A 1IAOB 6FABH 1NGWA 5IEHA 3WCYA 5SX5K 4YXHH 3RVWC 4X98A 1RIHL 4U6HB 3RPKA 1CGSL 4NC2B 4U7MA 3AM8C 3D3VD 3VD7A 3SE3C 1ZLSL 4OI7A 4HUWA 5CBAB 5CWSA 1JV5B 3OSKA 5EIIA 1PEZA 4P2RA 3O6LH 2X7LA 3AS0A 4Y1AA 3C60B 5DJAA 2MJWA 2QADC 4KVNL 1T3FA 2O5XL 4LCCA 1MI5A 4U0RC 1Z5LA 4JDZA 1CFVH 4PFEA 4Z7VA 5EOTA 2VO5A 4WHTA 4KROD 4NFDA 3T3PE 3MRNB 3TV3L 3T3PF 2HLAA 4JFFD 2YA1A 4H20H 3TVMD 3VXRB 1LNUA 4K8RC 4D0CB 5F1NA 2RBLA 5TQ2H 1A6AA 4BUGA 4XPHL 2B39A 1XGUB 1YMHB 3UTOA 4HKBB 5HGHA 3HNTH 1T04B 4WW2F 1YMMD 1OLLA 1MFBL 1HIML 4H8WL 2HTLD 1I8KA 1F00I 1N5YL 2BDNL 3TO4C 3HG1A 3AMKA 3GSQA 4G9FB 4XP6H 4YFLF 3MZTA 1MCFA 4U3CA 4JO3H 2ZCLH 1EV2E 1P6FA 1JHTB 4PJGA 4YHZL 4M7LL 2VDRH 1JGDA 3PWNA 5DJYB 5CUSH 4ZSOB 1CLOH 2Q6WB 4Z7UE 4X7DC 5JORB 1X5KA 3A67L 3VXRD 4NPYA 5KS9B 5HHQB 1FZOB 3AROA 3T3MF 3U4EA 3U36B 3KPPA 4UILL 1UB6B 1BZ7B 4U05A 3U7YL 3VFOB 3ARXA 1DBBH 3MUHL 3GJEB 2HMIC 3G04A 3VD9A 3S4SB 2G2RB 4TNWK 5I74B 5BVPH 1QVOB 1TQBB 2VDML 4XPFH 5EC2A 4TRPH 3VWKC 1JWSB 2Y07H 4BFIB 3D9AH 3QEQB 1XGQB 4IRZH 5KSBA 5D6DC 4AEHL 2X4TB 3AS2A 2EDXA 2EIDA 3IU3A 1MREL 4U3XA 3ARBB 2YXFA 4LLQB 4JN1L 4KKBD 2AEPL 2W92A 4LCWE 4PJ7B 3VGFA 4QTIH 4QF1B 4ZAKA 3HE6C 2IANA 1UYWH 3RX7A 2CKNA 4YR6A 4UDUB 3IETB 1YNLL 1DLHA 4XCFL 1KG0B 3BZEA 2VQ1A 3S37L 5DVMA 2Z31C 2FZ3A 3O2DL 1GGTA 2VH5L 4LSTL 5JR1H 5J6GA 3C5SB 4BK4A 4FFZL 3P4LA 1L8JA 3FT2B 2CLRB 1YMHA 3QUZD 1P2CB 4XVUD 4RIRA 3OPZH 1INQA 4GG6B 4DZ8B 5JXEA 3JV0A 3QIUD 2X05A 5J1SC 2C4FU 1G7QA 2PKDA 4G9FA 1TITA 4CVUA 1QYGL 4WU7A 4LKCB 2VB5A 5I75B 4GFTB 4UV4H 4RISL 2H9GA 2I9TA 5EZLA 3DX9B 1CF8H 3HG1E 2MNUA 2VDKH 3IDGB 4JY4B 3WV0A 5TE6L 3JUZA 3U36A 4O2CB 4S1DC 1BFOA 1VENA 3IAQA 4Y5VB 4L3CB 2B4CH 3S4SA 4U1JB 3BRGC 2XN9D 1IE5A 3RWIA 5TE4H 3P4NA 2DQJL 2ENSA 4BFIA 2W0LA 3QIUB 1A0QL 4PG9B 2WIIA 1FNSH 5FM5O 3MROB 2LU4A 5E94B 3RGVB 1CT8A 4LP4A 4PJDF 1NCDL 1YC7A 1XCQB 1FSKB 4I9WD 3QIWC 4KUZL 2XKUA 4ZAKB 2PW1B 5GGRY 3CK0H 1KNOB 1DVFB 2NXYC 3OL2A 4S0UC 1U42A 1MRDL 3UTTA 3LPWA 1UH2A 3GK8H 4WY7L 1QFWI 1FNLA 1VB9A 3PUCA 2J6EA 5DJ2B 5EUKA 4JFPA 4I18A 4GRLD 2FR4B 2V2XA 3B2VL 3O3BA 4PGCA 2DMBA 3C5ZA 2ICEA 5D8JL 2OJEB 1CFVL 4HBCH 1JHLL 3B83A 2FGWL 4KKLC 5J12C 4ETQA 2OCFD 3MLWH 3INUL 3P11H 2R69L 2R1XB 5FDWA 5L9DH 5GHWH 5E4IA 2Z0BA 2CXKA 4UILH 5DHVH 5IK3A 1MQKH 2I27N 2BP3A 1S7SB 5C0RH 3F8UB 2B0SL 4B41A 2WINB 3BEVB 4X6DF 1AGCB 4IBLT 4RMRA 1MAKA 1P7QB 2G75A 4BFEA 1AR1D 1T22B 2DQCL 4WFHE 1A1NA 4O2CA 4GXVH 4P2RE 3RUGB 1LK3L 2UWEB 3MLSH 1PY4A 1A9BA 3EBAA 1W0VB 3RFZC 3QRGH 4YWGL 3W9EB 1KOAA 1WAAA 2OBGA 4K9EC 5E4EB 3WFCL 3V8OA 3ZHDA 5JOPE 5L0QC 3HUJA 3PHOA 3P4NB 3EDDA 3IXAA 4LCUB 2CUIA 1NC2B 3GSNH 4YHYB 4GMTH 3Q2CA 3WE6B 2F5BH 3I85A 5D9SB 4O9HL 4WI8A 3MOAH 3RDTD 4BKLB 4L8CB 3BH9B 4YHOL 1E6JH 4H8WC 3ULUL 5H94B 2VDMH 4RAUB 3TBVA 2GTZA 2W38A 3QQ9D 4F15C 1TXKA 1FL5B 5CZVH 3SDAB 2D7NA 4X5LA 3RBGA 2EE3A 5CSGA 5FM8A 4CNIA 1IFHL 5MEQB 4NQEE 2IG2H 1OLZA 3EZJB 4JFDB 4MCZA 4JFPB 4EIGB 5FO7B 3FOLA 3M1BB 1YC8A 1AQKL 2AXGB 4WDIA 2V2XB 4Y5XB 3D85A 1QRKA 4LPXA 5INDA 3DTXB 2IALB 2D7PA 5DTFA 3KLSA 2YD7A 5E2JA 3RNQB 4LRIC 4GBXD 4DW2H 2F19H 3MRKA 4RWHA 5D2NB 5B38A 1T03L 2XXMB 5C09A 3X3FH 3WFDL 2Y72A 4YHKL 1K6QL 2F53A 4GW4A 4JREC 1X4YA 5EZOL 2AV7A 4KKLD 3RL1A 3NBNA 3RIFF 3BEVA 4JFEA 3ROOB 4NRXA 5C0IA 1JPFB 2GUOB 2JJSC 1N64H 1M7DB 5ID0A 1EO8H 3VD4A 4K07A 2DM2A 1TVDA 2AQ3A 4XVJL 3T0EE 1A5FL 2AJVL 1BFSA 5JA9A 2FH8A 4FFYH 2AEQH 5T33H 3ILQC 4HD9A 1D6VH 4XWGL 1HKLL 1NLBH 4X80L 3DGGA 5DUPH 4LCUA 1N5AB 3DV4A 1T20A 5D7SH 3W5NA 4Z76B 1OD9A 2P5WB 4YHML 3FO1A 3DRTB 3HI6H 1CGWA 3VMOA 1RJZB 4FQHB 1CIDA 5EPMA 3WE6A 4HS8H 4FFVC 4U1MB 1QP1A 1SJHB 3SGEH 3BH9A 3V5HB 3OGCA 3MO1A 5H94A 4AJ0A 3AY4C 4FQIL 2XWTA 1WBXB 2RGSA 3L5IA 2LV4A 4KK8D 1GC1C 4WO4D 1UZ8A 3QEGL 3SDAA 3B2VH 3NGBB 3MUGA 4XB7A 5L8KB 4IOIB 1VFAB 4GKZA 3HC0B 1CGTA 3KLDA 5LWYL 2C5DC 2PYEB 3I6GA 3RIAF 2DQFB 2BC4B 2FGWH 2N7AA 3KYOB 5BVJB 4XNXH 2DQIH 4OCLC 5J6HB 1OSZA 1WWCA 1ETZB 4MNHA 1DVFC 2NXYB 4Y16B 4DFHA 1PSKH 1MRDH 1A3LH 1KN2L 1J0HA 2RCSL 3QJFB 4OGYL 2CR6A 4NKOA 2VJXA 1Q72L 5CEXA 2J4WH 4G80A 1I1AB 5JHDD 3F7PC 3LEXB 4LSVH 1MQ8A 5I2IB 1CVRA 4MCYA 4HSQA 1S7UB 1FG2A 3QHFL 1KTLA 1Q9WA 4MXQA 1KJVA 3TBTA 4NRXB 5C0IB 5L2KE 4PRAB 4WV1B 4LRNL 1DN0B 1UM5L 2YR3A 3ZYJA 1JZ3A 1KCRH 5I66B 3QB7C 3CSBA 1AJ7H 1EO5A 1XMWA 3HMXL 5LVEA 1HDMA 5BO1H 2APXA 1L9NA 1A3LL 1KN2H 3B9DA 5CCKH 1RIVL 5I1KL 2WMPA 4M6ML 4YDKL 3BQUA 4GMTL 3DMMA 3EAKA 5F6IB 1Q72H 2QEJA 1I1YA 4IDLA 4WV1C 1VKXA 5IJVB 5ADPH 3MRIA 4HEPG 4UMGA 1G7JB 2OXGA 3RWFB 4NN6C 1JWMB 5HI5D 3GHBH 2XFXA 4FQQB 1A4KA 4FS0A 4K71B 5E2WL 1U3YA 4WCYH 1KB9J 5D1QC 3W0WB 4KZEH 1KT2A 4P4KB 4MD0B 3G6JF 2LE9A 3ZTJG 2CRZA 1TFHA 2VDPH 3KYNB 3F6IA 4HWEL 3OKKB 3OAZK 4YHYC 2YOCA 3ULVF 5IM7B 4UQ2B 1GGBL 2ZOLA 5F3HB 3JWDC 1RZJL 1NGWB 3RVUD 5D1QA 3SKOA 1UQSB 3SQOL 3RWJA 4TUOA 2FBJH 1DBAH 4OZGF 3DVNA 1NMBH 4LEXH 4PJDE 2EDWA 5GRJL 5T1LA 1C12A 1DFBL 4LSSH 2FNBA 3KYOA 4MNQB 1B0GB 1A6VH 2DLGA 1GGCL 4PGBA 5E7FA 4J3XA 5HYFA 2EKJA 5CAYB 3GHBL 1DBML 4HUXB 1IBGL 3BGMB 1BEYL 2MQ3A 3PGFH 4OCXL 4LCCB 1ZHBB 3Q3GA 3CFEA 4XNYL 4KDTA 1MCLA 1E4XH 3E2HA 2NY1D 2CDGB 4PJBA 4RGNB 5HHMA 2K3TA 5FA3B 3GIZH 1LE5B 3BWUC 2NY5H 2NTFB 5J8OA 3VXRA 2OQJA 1S9VA 3TESA 1R3JB 2OZ4A 1UZ6E 5I74C 1LO2L 4NQTA 1T5XA 3BP4B 3I3BA 4OLYH 4AG4H 4W6XB 3MTRA 4JY5H 2PO6A 1MRCH 2X4RA 2H32B 4JY6B 2DQTL 3U7AA 3WHE1 2E7LC 3KLHD 4MS8A 4LDLB 2ATKA 4H26B 1YYLH 2GT9B 1A6UH 1J05B 2R39A 4M6NH 4F7TA 5EU3B 3MRIB 3VGBA 4NZJA 1I9RH 1PAMA 4R9HA 1BD2A 4JM2F 2HTLC 3FB7A 3GBML 3MA9H 3C09C 2OZ4H 2P7TB 4JO4L 2AV1A 2NW2B 2VITB 4ELKA 4Z5RA 5HI3C 4JQXA 1A1OA 3PJSB 4L8BA 1WC7A 3PNWA 5IMOA 2OK0H 1FJ1B 3RTQC 1HH9A 5D7LA 2GYSA 4FQXD 35C8L 2CUMA 1HKLH 1NLBL 4X80H 1P5UA 2ZOKB 5E08L 5F9WC 1I7TB 4TPRH 4UQ2A 1T0NA 5E24E 2CLVA 5HYSG 4NKIH 3SKOB 1M7IA 3I9GH 4PRPB 3MV9A 1XGQA 4K7PL 5HPMB 3RZWA 2J1KA 3L3GB 2VABA 4O00A 3WDJA 3KLAA 2A74A 1HQRA 4QHUA 3DI2B 3NFPA 1H0DA 1C5DB 1ORSA 3C60C 1HYSC 1T0MA 3UTSA 4R0LA 1U3ZA 2V5TA 2F15A 3JTSA 5FGBC 4TQEH 2G9HA 4UUJB 5CEZD 5MEOB 2K7PA 5I0ZA 4R96A 4X7SL 3NN8B 5C0JB 2AJUL 4IRJB 5ACLA 2ED8A 2EC8A 4L3EB 1A6ZA 2CDGA 4KK6C 4XAKE 4PBVC 1OAYL 3F62A 5I1GL 4FABL 2WNGA 5F7EH 2P47B 3WFBL 1MHHB 3C5SA 1XF4A 1AH1A 2A9MH 2N7BA 2PXYD 2H2SD 3OV6A 4M8VA 4R90L 2FX7H 3MRGB 5FYKD 3BT2H 1G0DA 4NO3A 2J4WL 5FCSH 4J4PC 1WITA 3S96B 4FMKA 3UBXI 2FX9L 4OIBA 2DQHH 3F7RA 1F2XK 3MRJB 5KVFL 4N1HB 1F4WH 1JYNA 2R4SL 3V95A 1FQ9C 4AEHH 2YWYA 4H0IA 4HBCL 4WHYH 3D87B 4LKCA 4Q9RH 4WFFE 5E6IA 3ZKMD 3TJHA 3DX9A 4N5EC 4ENED 3ZTJH 5ETUA 4JLRA 2VRAA 4HT1H 5I8KL 1CLYL 1MIEL 4OCWL 4PRHB 4S1DD 3OKLB 2A9ML 2PF6A 3IJHB 1HH6B 3VI3E 3BXNA 2YC1B 5DD6A 4TSAH 3VWJB 3TBYA 4XGZB 3SQOH 2XRAL 1AFVL 3P0GB 5B3JF 4EI5B 2YPLE 3BAEL 3EIFA 3EOAB 3D69A 4I77H 1QRND 5B22A 3UZVB 1FLRL 4PJAA 4GJTB 4ZUWA 1IQWL 1VADB 1U58B 4WEUD 5IMKB 4TUJA 4NO0A 1FZKB 3CFDA 3HRPA 1NSNH 3ARBC 4R4FH 4HH9B 3KPRD 4RAVB 3HS0B 1ZANH 1AGBB 5DK0A 4JAMA 4G43A 4U33A 5DR5L 4JRXE 5I71C 2NY4C 5C08A 1BQLH 3H42L 2JELL 1XGYH 2X7LB 1KNOA 4ZUTA 4JDTH 2G9HB 4UUJA 5F96L 4NQDD 1ED3B 1I3RB 1T4KB 1PDKA 1T7WA 2EIZB 3PWPB 1E6JL 5CEZE 4EI5D 4G8GA 1LP9E 2DLEA 4RFNC 4P3WA 3MMEA 4GW1A 4MJID 5JW4R 4XP4H 4HF5H 4ACPA 1QO3B 5CJXA 4DZBB 1EBPA 1R3HB 1FP5A 3O6LL 4KK9D 4C58B 4LIQH 1E4KA 3AS3A 3H9HB 4M6NL 3M45A 5DFVD 2W0FB 1JFQH 4LQ1A 4OUUB 1A14L 4XP5L 1QLFB 2E7MA 1JGEB 1X5YA 5CGYD 3LV3A 3RI5K 1FFNA 5I1AA 4IRJC 4PJDA 2MQCA 2BSED 1V3MA 4LLUA 4GRWF 3BD4A 4PLJD 4Z7NE 1KPRA 5F88A 5JXAH 3HFML 3VFNA 3IJHA 5CMAB 4QHMB 1HH6A 4HUUA 1QHOA 2H45A 2R56L 1XGPA 4X4ME 4XRCB 4ZXBD 5ID1A 2BDNH 5CEZL 3D69B 2V5SA 4D3CH 1JTTA 5EOCH 4JHWH 2XZCL 4KVCL 2WP3O 4PJAB 4ERSL 1YEDA 3C9NA 4P0DA 5JW4N 2G5BA 3PHOB 4N0CC 1SYSB 4I3SH 3ALPA 1BREA 1B2WL 2GQHA 3PQYE 4OB5L 5I8EB 4FQPA 3F5WB 3BDYL 5HHXH 5EDXA 4F37K 3LVEA 1B0RB 4UNVA 4GG8B 2DDQL 3PWVB 1CF8L 3RTQB 5MP6H 2HFFA 3D2UA 5C0GB 4JPWH 5I1HH 1UJ3C 4ZUTB 3N50A 4U0QB 2B4CC 5DXWA 4YR6B 3UBXA 4QCIA 3GM0A 3ARVA 4HLJA 3SKMA 2OL3A 3TJHD 5DURD 2B0SH 1CGVA 2FZ3B 4UT9L 1SBSH 3EYQC 1PG7H 4Q0XL 1AC0A 3STLA 4OV5A 3MJ6A 1LD9B 3O4OC 3TEUA 1T80A 3UZQA 3VGAC 3QQNA 4G8IA 4RGNE 1XIWD 2VIRB 2VDKL 3DTXA 2VLLA 4DZ8A 2JJTA 3MLPA 3QUZB 3BYYA 4G42B 3SE9L 2VLJB 4Q6IC 3VWJC 3U4AA 3KJ4C 4QRPA 4BZ2L 2AS5M 1U8MB 1QLFA 1T1XA 2WZPD 4Y1AE 3VXUD 5BS0D 2O5YL 3HI5L 2I9TB 2NY6C 4PJDB 1AP2B 1TCMA 1KCKA 3GSNB 2D31A 2XZQH 1NUFA 1CK0L 4MB5A 1KJ3L 1XIWA 4L4TE 1IQWH 5E2TL 1WF5A 1QPPA 3MYJA 2G60L 3QUMA 3E3QE 2DTSA 1H3GA 4OZGA 1H3UA 1MCEA 1EGJA 4MA3B 4LCCC 4MZ3A 1PYWB 4KROB 1EFXA 1A6PA 1N5AA 5IB2A 1A3QA 3CX5J 1SY6L 4L8SC 3FQRB 4M00A 5GHWL 3FOMA 3L3HB 4RGNC 1E4WH 3MV8D 2ITCA 1ZLUK 1XF3B 3AB0C 2BSRA 1LMKA 3BP5A 3RTQA 1QLRB 4FMFA 3E0GA 4FFEX 3HZVA 1X4XA 1CFSA 2B4CL 1BVZA 2YKLL 4WTXA 2AQ2A 5GS3A 3F7YB 5FYKL 3NABL 4WI5A 3SBWC 3T0EA 4R7NB 4R4ND 3GB7B 1JPTL 1S78D 2P8MB 1M05B 3DUUB 4NBYB 3HC0A 5EZOH 1M6OB 3OPZL 1TZGH 3VXSE 5EUKB 3WUZA 1RUML 3H42H 4ZO6A 5BVJA 4OQTA 3STLB 2FR4A 1CDIA 2CXGA 1JZ4A 1QPXA 1ETZA 4L9DA 2ZUQB 4L5FL 3P0YH 3TBWA 4RGMC 1DBKH 1V3JA 3CFBA 3N1GC 4LGRB 2DBJA 3IFOA 2AJSH 4N8VA 4LLDA 3LEYH 4KDWA 2VLLB 4MLSA 4Y4HC 1RY7B 1J0IA 3VXOA 4CW1A 1CE6B 2ERJC 1I1AA 2GTWB 3QWQB 3N85H 1EJOL 2ZG2A 5E8NB 2EO9A 3OJ2C 3KXFD 2X4SB 3I75B 1BZ9B 4W6WB 4UDTA 5F1SA 3ZYZA 1UJTA 3QXTA 3H3KA 1KTLB 3U0PB 4DVBB 3QCUH 5E6YA 1H8OA 4PJ8C 1HHIB 1OPGL 5CJ8A 2J8UE 4MAYC 4MX7B 4DEPB 5FYKE 3QXDA 3ZDYF 4JKPL 2F54A 3MYJB 3KGRA 4N9OB 3RAJL 4YGVB 5CJBA 3MACH 3K7UA 3U7WL 3TH4T 4GAYB 1T83C 3QEHB 1GZQB 4EJ1C 3PP3K 4RISH 3Q1SH 3WNLA 5J11B 3TYFB 3B43A 3SGKC 1S3KL 2XTJE 3TVMB 2BCKB 5HDBF 5E9DA 4PJAE 5IROA 3C5JB 5MI0C 4DQOH 2VLKE 1MNUH 2OJZL 4ZFOB 1T83A 5D6CB 1NFDA 5D9SA 4HAGA 5DHYB 3WUWA 4OV6F 3W0WA 5HHNB 3BQUD 1F6LL 5F9OL 1O7SA 1CICD 3QXWA 4R7NA 5K59F 2ICWA 1OTSC 4OZIF 5DD5H 3FT3B 2D0FA 4O58H 3OX8B 1NFIB 2VDNL 1AC6A 1M05A 1R3LA 3DUUA 3VCLA 4H25A 3TPUB 5KTEL 3OHXB 5J0BA 2EDQA 2GITB 1U36A 1RAMA 3UDWA 1G7PB 4OJFL 4MNQA 2IADB 5F7HA 4FXLA 1DL7L 3MV7E 2R0ZL 1MNUL 3PP4L 4YXHL 2WBWB 3NPSB 2Z91A 4M4RA 4MA1B 5TDPB 2VL4A 4LLDB 1RI8A 1O5DT 4XNZC 4HDIA 4HJ0C 3L7FA 3VRIA 2DM7A 5C08E 3S35L 5EBWB 3H8NA 3WN5B 3KPQA 3RX5A 4Q0XH 4ZPTB 1MWAB 4GXVL 2X41A 4YPGB 1ULVA 3GIVB 3LKSA 2JKXA 4MNQD 4GW4B 4YPJA 3ZE1F 2V7NB 2BRRH 4X6CE 4ZXBA 2ADFL 5CZXD 5DMIH 4K3JH 4WJ5B 4GMSH 1M7DA 1RJLB 4LCIH 5FUCE 5ITFB 5JOPD 1UJ3B 4OLWH 4K2UH 4NSKA 4RMQA 1IM9B 3MA7A 3HZMA 3TIDB 1LILA 4PLNC 1S9WA 1EEYB 4Y4FB 3TYFA 5J1AB 3GJFH 5FIEA 4DVRH 1T20B 3C5JA 1TMCA 1CBVH 1NEUA 3RX8A 3MRMB 5J56B 5D6CA 1RK1A 3QRFM 1DQJA 1OGTA 5KSAB 1OL0A 1SJHA 2OR8A 3OGCB 1GOHA 1LQSR 1NCWH 1HH9B 1WIPA 1A6TA 5D7LB 4DK6A 1CFTA 2XPGB 1M4KA 1RZKL 4FQLH 3AVEA 5K9OB 4QYOA 4KQ3H 3V5DA 1CU4H 2LVCA 2BERA 1T0NB 5DMGC 4MWFA 5HHOD 2QQLL 2XY2A 1LP9B 1M7IB 1TVBA 1PG7W 1Z9MA 2D9CA 5CS7A 4IOIA 3HHRB 5CIPA 1JNNL 3I6GB 5F1IB 3MGTB 3HI1B 1QR1A 3SDCA 3VW3L 3ZDYE 3WO3B 3H3BC 1ORSB 2Y07L 4CUCA 1H3VA 1F90L 3DETD 2F8XC 4ZTPL 4R0LB 1O7VA 3DBXB 2JJSA 2VN7A 4QT5A 4GRWB 5KSAD 5TGBB 4EUPG 4G80B 3RVTD 3VFUB 2FHCA 4M93B 4PRPD 3KPQB 5EZJB 5GS0L 2R0WH 2EECA 1RUMH 3QISA 1UACL 1MWAA 3MC0A 1QRNA 4E41B 3LKSB 1H9VA 3RAJH 3CDGB 1JPGA 2YUXA 4FOMA 3W2DH 5GZND 3ARTA 3U7WH 3MLRL 4DN3L 1DN0A 1BX2B 2NY2D 1RJLA 4NJ9L 3F58L 1P6AB 5HJ3B 3CSYB 15C8H 5D7KE 3ULUF 1MWAH 4K94L 1A7PH 1CD8A 1VCAA 4UT6H 2FJGB 4YIQB 2FJFA 4NHUA 2NNAA 5BRZE 3P9MA 1YY8A 4L8DA 1N3NA 3N0PB 4XNYH 5JW4M 1QFUH 4RFEB 1K5NB 5IWLC 2XA8H 3P9LA 3AMLA 4RMTA 4G9DB 4O4YH 5ERWA 5CP3A 5DUBB 4AY0A 2Q1EA 4PJ9C 4YZFE 2I5YL 3O41B 3CC5A 5DQ9B 2EC9U 4FQQA 4JN2A 4CDHA 5EO0B 3T0ED 1PGRB 2EDOA 1CDYA 1ADQL 2C3HA 3MLZL 3QWRA 2F53E 5J11C 2F74A 2VDOL 5E8OB 2XPGA 1QSFA 1XCTA 2BVYA 5ADOH 1AE6L 1OD7A 3RU8H 5BQ7B 5F3HA 4PY7B 3FT4B 4OZFH 3CFKA 5J57B 4NNPL 2D4DA 1S7XA 3H7BB 4DGIH 3HE7C 4QRQB 5CP3H 4ZD3H 3MV7B 5DRWA 1DR9A 2WLZA 4GKOA 3HS0A 3HI1A 1BVKA 5T3XH 3UC0H 3MCKB 2XWBA 1RZJC 4LPUA 3BJ91 5BMFH 5CBEB 4NC1C 4L9LC 1UM6L 3NFSH 1T2QL 2MWCA 25C8H 3DBXA 3PE9A 7FABH 4LLYB 3ZKQD 3I84A 2APBA 3QIWB 2CK0L 2NZ9C 3Q3GB 4CU8A 5KZCB 4MAUH 4MXVF 1HILA 3CJJA 3DVGB 1T4KA 2E27H 3ZE0F 4QRRD 1ZA6A 3U4BH 5HHMB 5MERB 5EUOE 1D9KC 3MREA 4M43H 3VXNB 5J3HD 2FBJL 5HPOA 1AJ7L 4GW1B 1U2CA 2AEWA 2ARJQ 2OQJB 3CDGA 4NKDB 5BW7A 4ODUB 3L3KB 3FONB 3DYPA 3S88L 2BOBB 3R0MA 1KN4L 1JZ6A 3BAEH 3E8UH 4OD3L 4MXWL 2X4RB 4KZDH 2GAZB 2X4QA 4OZIB 4ONOA 3QXUA 2W0FA 2SEBB 4D9RD 4EI6A 1JPSL 4OZHA 3KPOA 3EZ8A 5I76A 4NQEB 4RFEA 3V6ZA 5DS8B 3P9LB 4E0RA 3RVUC 4F7TB 3SGDH 4DAGL 2BJML 1G0YR 5LQBL 5E2VH 3VXRE 3WD5L 4LLUB 4PJCB 6FABL 3L5WB 4G6FD 4NKIL 1XGYL 3DPBA 4OLYL 2VITA 3QFJD 4JN2B 4AIOA 3DGCR 4EVNA 4XPHH 1PBYA 2QSVA 3PJSA 4UB0L 5TFSH 1XGTB 4B53A 5EWIL 2IFFH 5F96H 1BD2D 3ARWA 3K4AA 3IYLW 1J1OH 5IEKA 2DM4A 3ZDXE 3VG0H 3X12A 2PN5A 4X98B 1RK0B 3IS1X 3WIHL 5B21A 5FKPB 3DMMC 1FFPB 1QFHA 4N0FB 3RVVC 5I30H 4M7LH 1OTUD 5CSBA 1SEQH 2RHEA 1KSRA 4KHXL 2DOCA 1RUQH 2NXYD 3LQAL 1T7ZA 4G6FB 5GSVA 4P2RB 3BZFA 4JPKL 5JUEH 4M6OH 4LSTH 2HFEA 3EGSB 4UZGA 4MMXC 4L3EA 5B4MC 4X6FA 4WHTB 4YZFF 3MREB 4C56A 1BAFL 1FORL 3NIGF 4PUBH 3GBNH 1MJJB 2D2OA 2EDBA 3ZHLA 4KTDL 4HKJA 1CR9H 2EXYD 1DCLA 3QDJA 2W91A 1PW3A 5C0DA 3MXVH 4Q9RL 2JIXB 2XYCA 2Z31A 3G5XB 1AY1H 4GXUN 5TQ0H 1P7KA 4N8PA 4LASH 1I8KB 2JELH 3GIZL 1Z9SA 3QUZA 1FNGB 2HVJA 5A2KH 2EYRB 3AAZB 3HC4H 4PY8J 4OF3A 3CFJB 4OAWA 5MENA 2V17H 1U8MA 4KKCC 1FH5H 3BZ4B 2V6HA 3ABZA 5DS8A 1NEZG 1EGJH 1DUYB 1KC5L 5HGBB 2P5EB 5HY9B 1Y0LB 1FSKC 4PRHA 3SOBL 1HHGB 2QQNL 2DQDL 4RFOH 3V4UH 3GMPA 4FFZH 3U4EB 4XP4L 1XIWB 4HCRA 3BPNB 5DD6B 1UWGH 5EU4B 4M9OA 4UBDC 4MXQD 4RA3A 2CKBH 2Z35B 3B9EA 4KJWD 1EEQA 1YZZA 4OZGB 5EC2B 1RUAL 1XF2B 2AW2A 3SDDA 1JWSA 2ZCHL 4OI9A 4QXGH 4PJ5A 1EFXB 4Y7MA 5TE6H 1OQXA 5IB2B 4GBXB 2A6JB 1NCTA 4F58H 3V0AC 2Y36H 1I3GH 1FVCA 3ETBF 1J0YA 4WIQA 3QZWA 4PR5A 5IWLA 1NLDH 3IU3B 2X1PA 1VDGA 35C8H 4Y19B 4JKKA 1X7QA 1WBYA 1BBDL 4AL8H 3MBXL 2QADB 3T4AB 5AYUH 3MCLH 3PWUA 1JGUL 3MRRB 1G6RA 1ZHLA 2KZWA 3CVIL 3DHMA 1CICC 3BH8A 3BPCB 4PJFF 2GJ6E 2X4OA 4X0KB 4QGTA 3GSXB 1RZIA 3EO0A 4M7LT 1HE7A 3PHQA 4KWUA 4YHNA 2YPLB 3O0RH 3KR3L 3ARFD 3IDYC 3QFJA 1Z0MA 3VI4F 1HNFA 1MHEA 3N1QC 1B90A 4RGOH 5L88L 4PJEA 4G59A 3P3YA 1K8IA 1OM3H 3HA0A 1J88A 4JM4L 5E2UL 4LLWA 1S9YA 5C71A 3MLVL 3MZGB 4GG6A 5FFLA 2EYRA 4U1GB 1N59B 5HGDB 5E8NA 4JB9L 3SDDC 5MENB 4S1SL 3R06B 1JGEA 3OKDA 1J1PL 4P2OD 4TSAL 4TTDC 3E3QC 4D3CL 4JHWL 5IBLC 1NH6A 4ZODA 5EUOB 3HNTL 5IT2H 4XI5C 2P5EA 1Y6NR 5EBMA 3FRPG 1D5MB 3VJ6A 5E03A 2J3SA 4YBHA 2W60B 2IF7A 3OTTA 3GMMB 5KSBF 5K59E 4L3AA 2BVEA 3QDHA 1IC4L 3DX6B 5SWZA 1ZT7B 3H6JA 1MVUA 2R4RH 4XRCA 2V2WA 2I25N 5JIIA 3TFKC 2CRYA 3JV4A 4HHAA 4HK0A 4DAGH 1N8ZB 2VNCA 4P2OA 3ZDZE 3BFOA 4ZOCA 4OLXH 4C55A 1CT8B 3RDTB 1NFDB 4KK5C 1Q38A 2UWEE 1PQZA 3PDOA 1DBKL 4QLRA 5DVLA 1X7QB 4UOW1 1WGOA 4LQFH 4XNQA 5AAMA 5DJ8B 2VTFA 3T1WA 1T1ZA 5CINL 1DE4A 2IMNA 5ESAB 1U8LB 1UM4H 5E9DD 3ZE1E 5I15L 2Q7YA 2X4OB 4MAYD 4PB0L 3SKMB 4LF3A 4NO2A 4S1QH 5D7LD 2J6EL 5DQDL 5IQ7L 4BYHA 1N2RA 2GCYA 5T3XE 3PIQA 4O51A 3WFZA 4JRXB 4NM8H 4I18B 4M5YH 3RVXC 1NAMB 3UCRA 3OMZA 4K23L 4HIJA 4NWUH 2OM5A 3BIKA 2C7UA 4XH2A 3MJ8A 2HG5A 4A6YL 3LN5B 2F5BL 5DHXB 4LLVB 4PBXA 3MACL 1K8DB 3QUXC 3VWJD 1DFBH 2YN5A 2YSSB 1K6QH 2APTA 1TNMA 2F8VA 1B0WA 3RJQB 4NQCB 1IM9D 3FZUC 1IQDB 1BFTA 3QDGE 3O2DA 4LIQE 5GZNC 1T1XB 3R06A 2EDNA 2PXYB 1FFQA 4PREB 1UKTA 1R0AL 4S10A 1H5BC 3I2CL 3U79A 5KBNC 1YQVH 3MGOA 1BM3L 5K9JL 4M7ZB 3WKML 4WJ5A 1P7QA 2G75B 3R0NA 1J1XH 2WWKO 4GRLB 3NCBB 5JXED 5F9OH 5A2JH 1KIPA 2Z93B 5T3ZD 2UWEA 2H1PH 3QUMB 1AGFB 2V2WB 2V17L 1WFTA 2FO4A 4ELMF 4HWNA 3MPCA 5D72H 4K7FA 1RZ8A 3G6JA 4JRYB 1T89C 1BBDH 1PYWA 4JQIL 1YECL 1HINH 3QUYD 4ZS7H 4KY1L 4HPOH 3L3HA 2X40A 2NR6D 5CGTA 3O2VH 2BSRB 2BY0A 5BRZB 2CKBL 4GOSA 2I07B 4J7RA 1MCSA 2DIAA 1ZMYA 3BN3B 3FO0H 4P46B 3MRFB 3TPKA 1OPGH 2DQUH 3SO3C 1BPVA 1F8TL 5ESQB 3WIIH 2OL3H 3JTCA 2Y6SC 2IAMD 5JHDB 5LBSL 3V5DB 4R97C 5GS0H 4JPIA 3V52H 5IFJA 2C1PB 3BIBX 1G7IB 1NGYA 2M2DA 3QO1B 4HLZH 5CIPB 3BESR 1NCDH 2EICA 3PIQB 4TUKH 3EOBB 5E2UH 3VE0B 3O45B 4KHTL 4UIKL 2VR4A 4BUHA 3FOLB 5GS2D 1BIHA 1YDPA 4HC1A 5GGTL 5DYOB 3P4MB 5T3XD 1PX4A 2M26A 3TBWB 3LOWA 4OLWL 2VZ1A 1OT1A 3IRZA 4N1CA 4ZNEE 1FCGA 4JPVH 4LPWA 4NZDA 4UOJA 4Y4HA 1B9ZA 1U8NB 2X1QA 2A6DA 3IGAB 5INDB 4J3UA 2FATL 4BFBD 5TGBA 4LVHC 2IQAA 1CE6A 1BJ1H 4OBRA 2D4FA 4WUUB 4F33B 2R2EB 2GTWA 5AZ2H 3ULVE 4UTBL 1GOFA 2AJVH 2RFXB 3BKCL 1BZ9A 1NBVL 4OGAD 1CTNA 3BKJH 2X89D 2A6IA 3GJFB 3MRLB 4WNQA 3RWCA 3MGOB 4L4TD 3ECBA 4LHJB 5CCKL 5J1TC 5ID0B 2R9HC 2Z93A 4M1DL 3TLRA 4NRZA 3T2NL 1CQYA 3AREC 1KLGA 5I18L 4JPVL 5K9QI 3EYVB 5ICZA 3ZE2E 3D3VE 3QH3B 1NC4B 4JG0H 5C0RL 4J1UA 1TIUA 4PGJA 3WLBB 4NQCE 2BCKA 2VLKA 3ARED 3NIFF 4HWZA 4JE4B 4APQB 2XWJA 3VW3H 1R5VB 5ESVA 3O41A 1ZEAL 8CGTA 4W6YB 4EEEA 2DQCH 1RZ7H 4ODHH 4ZFOA 3DRTA 1FVDA 4NP4L 4QEGA 4PJEE 3SPVB 1U8OB 2JTDA 1NJ9B 2I9LA 4JFFE 5HHVL 3MODH 4X7EC 2FEEL 1JPTH 1VHPA 4IRSD 1D6EB 2OTWB 3QZWG 4FFYL 5ESQA 3ULVC 2PTUA 5KVEL 1AXSB 4NM8L 3CU7A 2QQKL 3GRWH 1ZLWK 3LPGA 5EULV 4I0PA 3KPLA 2WUCL 4HUKB 1J7VR 3R8BB 4PY7A 1WT5C 4OFVA 5F6IC 4L4VE 2ICWB 1RMFH 5EWIH 1GL4B 3RHWF 4H25B 3TPUA 3U46B 1S7XB 3H7BA 5L6YH 3MV7A 1G7PA 3Q6GL 3PQYB 5F6HJ 5JTWA 2Z8SA 1ZE3C 3KPSE 1NPUA 3F58H 5C0FA 5I9QB 2J5LB 4KI1A 4Y16A 4Y88A 1CXHA 4JHZA 4O5LH 1QBAA 4OFKA 1YEKL 2LAGB 4K7PY 5BV7C 3G5VB 5KVGL 1IFHH 1YNTB 2VYRE 3VXQA 1P53A 3LEXA 3QEQE 1ACYL 2EYSA 2H41A 2VDNH 2RFXA 3O3EB 3V7MA 3VFTB 2RB8A 1S7UA 5BJTA 4KROC 1O0VA 1FG2B 4XNUH 3TPUE 3V5KB 5I6XC 4BK5A 2OP4L 4NHCL 3MLTA 3SCMC 1WTLA 1I9IH 1KCSH 1I1FB 5I66A 1T2JA 5IW6A 1FNEB 3O3DB 4BQ8A 2VISA 1QKZH 4XMLH 3WFEH 4Q2ZB 1TZIA 1L4IA 5FGBA 4HKXA 1LDPL 4NSKB 1SEBA 2VLJD 4HPOL 4QXTA 5T5NG 4OZHB 2BNUA 4ZUVB 1S9WB 1S7RA 3P4OA 4P4RA 3ZTNL 3D18A 4MD4B 5DMKB 4YUEH 2P49B 4NQDA 5J1AA 5E56A 5LCVL 2VLKB 1OVZA 5GGQH 4APQA 1FYTB 5T3XL 3U9PH 1P7QD 5DFWH 3MX0A 3GBLA 4D0DB 1QSFD 4J23A 3MRQA 1I8MA 1BMGA 1UM5H 4EVNB 1JUFA 3VXMB 2H8PA 4JANA 3IJSA 1AGDA 3DO3A 1P84J 1RPQA 1S5HA 2VZUA 4JFDE 5FV1L 1AD9A 4NCC1 4AIZA 3NIGE 1OP3H 2XNAB 1YNKL 4YJZL 3CH1B 1SMAA 1U8IA 1P4BH 3LSOB 2Y5EA 4UU9A 4QHLB 2EKSA 5A16B 1SJEA 1HEZB 2C1OB 4TUOB 5FKPA 4U1IA 5T1LB 1FFPA 3UX9B 1B0GA 4WO4B 4LVNC 2EZ0C 1OAUL 4EN3D 4X9IA 4ZUUB 4FG6C 4LSRL 3VI3F 1A7QH 2H6PB 5EU6A 1AIFA 5C8JB 5DSCB 5K9KA 4U6VH 3GMQA 4CBPA 1UFUA 2QHRL 1E27B 1YNTA 4K3HA 4NZRL 5FA3A 2DLFL 3GSUA 1MJ8L 2DI7A 3NZ8B 3FB6A 3SKNB 1OGAE 1N7ML 1I8IA 5IVXF 1K3IA 3WJLC 3O6KH 1ZVSA 2H32A 5SX4H 3UDWC 4KJQD 1XIWC 3QHZH 4I0PD 4IMLB 3QA3B 5D1XA 1XAUA 1KPVA 3MGAA 43C9B 2FJGA 2FJFB 1CICB 4MYWB 3G08B 4BSVB 4EOWH 2ATKB 1YY8B 5JDSA 1S7RB 1BWWA 1BOGA 4X6DE 3QEUB 5I75C 5TE7H 3WS3B 2Q87A 4NQSA 3C5ZD 3Q6FB 1FN4B 3DO7A 2ERJB 3ALWA 4N0RA 4XCYB 1I9EA 3RVXD 1MCWM 2AI0H 4NWTL 3JV5A 3HE6B 4D94A 1IVLA 3TGXA 5D1ZD 1ZAGA 4E42A 7CGTA 1IKFL 1ORQA 4I13B 2Q8AH 1YEIH 3BI9X 2VR5A 3TJEL 5EZIL 3SGKA 1P4LA 3N1MC 4LOUD 4KDTC 2CLVB 3LKNB 5DD0L 2A6JA 2ITDB 1UB5B 4KXZI 5F9AC 3SKJH 1CFQB 1RSFA 3ZKSD 2A1WH 1NCNA 1FYTE 4P23C 5IQ9A 2XWBB 1NANI 3W39A 4Z7NF 3T4AA 5LGJB 4YFEA 4ZUUA 2FX7L 4HWBA 5JW5B 2OR9L 2APWA 5C8JA 3JTTB 3QAZB 1T1WB 2DLIA 5DGRA 1HN1A 4X9GA 4PRDB 2BVOA 4OFYA 1KC5H 5DWUL 4XMKH 4YHNB 3EYSL 1CL7H 1J10A 1HCFX 2R2HA 2V5RA 4M7JL 1J11A 3GSUB 1NFDE 3FN9A 4KKBC 3SKJL 3KNBB 1NFKA 1JFQL 3FONA 4WW2A 4Q58C 3TNNA 3B6SA 1DDHA 5GRVL 1T2QH 1ZVSB 3W0WD 4LLWB 3B9AA 5BV7L 1DANT 3F7QA 1N59A 5HGDA 1RIUH 1G7LB 5D2LA 3VWKD 4ZNEA 4HIIB 4OLZH 1MCOH 2XTLA 2P4AB 3UEZA 3RWHA 3RGHA 4MJIA 3L1OL 4YNYA 5DA0B 5INCB 2R56H 5H35B 2AKRA 3O9WD 1Q1JH 1K4CB 3QUZC 4ONHB 3V9FA 4TRPL 5IV2B 1NBYA 2BNQA 4JEGB 1NUGA 1H15A 5IBTH 1DTUA 2P45B 2VAAA 3VGAB 5DT1L 4XGZA 1PKQE 2NY3B 1HZHL 4EI5A 4DUWA 1L0QA 2GSIB 4GBXC 4OLEA 5FXCH 3C8DA 1RUQL 4NDMB 3VWKA 3ARGD 4WW1A 3GMLB 2VDLL 4X4ZA 1JNHB 3LKNA 5F7MC 4TUJB 3NCJL 1Z2KA 1FH5L 3W82A 4ZPVB 2CK0H 3MBEA 3TYGH 1MSPA 4WUUD 3MLYH 1ZT1B 3C2AL 4GS7B 1S3KH 2VLRE 1HINL 4M7KH 5F9DC 6CGTA 2C9AA 3H3PH 3V6OC 3BZFB 5F7WC 4QRRE 3V2AR 1DQTA 1B4JL 3O3AB 1Y6KR 4QRPE 1BLNA 1X5JA 1ED3A 4A6YB 1JK8B 5C0CA 4PP2B 4G8GB 2XZCH 4KVCH 3NCMA 1TZHA 4HLZG 1KCVH 3UC0L 2XQBH 4LP5A 1MUJB 4AENA 1JN6A 1CFNB 5D1ZA 4F58L 4IHOB 3QXVA 3S34H 3LB6D 5C0DB 4PJHA 3LN4B 2FCBA 3QQ3B 4LLVA 5GS1B 5FK9B 2ZPKH 2Z31B 3GO1H 1BJ1J 3VH8G 1P7KB 4KHTH 4UIKH 1MIMH 3VXSB 1UADC 2R23B 4LHUB 1X5HA 5F7EL 2EDHA 3C09B 3D25B 1WIUA 1IQDA 2JIXD 2XZQL 4U4BA 1JHKH 2PXYA 4M5ZL 4PREA 4NNYB 4HIXL 4LAQH 4Q7DA 3VMPA 3O6KL 2VSDA 3MFFB 2AKRB 3VFMA 5FB8B 3AXLB 3ZHKA 4XX1E 5I0DA 3EW3B 3K46A 1NCCL 2ZZUT 3O8XB 4HJJL 5IB3B 3GMPB 5ISZB 4JHAH 5JZ7D 3TA3B 3QDME 5EU4A 4D8PB 2ADJA 2DF3A 1YYML 5ID1B 3DURA 3HNVH 2GSIA 4CVZB 5CHNA 1KJ2A 1HYSD 3MBXH 4KRPC 3VWKB 4N0CA 3ILPA 1Q9OB 1YEDB 3C9NB 4WW1B 5LQBH 1KEGL 3KVQA 4BA8A 5BS0A 3TIEA 4Z7WA 4O02L 1QSZA 1V3LA 5T1MB 3UTSD 3IFNL 3SJVE 1EHLH 1ZWIA 3LRSA 2MKWA 1IZJA 5EB9A 2J8OA 4NQXA 3HFMH 1WCQA 4EKXA 3MRPA 4XBPA 2BVQB 2BMKB 1EIBA 8FABA 2J8UF 2HJKB 1IEAB 1FLRH 5DJZB 4HKZA 5FECB 1KJ3H 1IC5L 3QUMH 1TPXC 3VXME 5I1IH 2DWDB 3N9GH 1CI5A 1AKJD 4OZGE 5JXEC 3KJ6H 1PVHA 4X0KA 2P8PA 1NGYB 3QO1A 1SEQL 4PD4J 5HDBE 4BFGA 4FQLL 4AENB 2VL5B 5DO2D 3MUY1 3BZDA 1X5FA 5D5MA 1FBIH 2XN9A 5IIEB 4X6BA 5JNYB 1QQDB 3FZUD 2UYLB 1K8IB 3QI9D 2BOCB 3LB6C 3O2WH 3WFDH 3BPOB 4ONFH 3GSVB 2CH8A 2WWMD 4G42A 3D25A 4RWYH 4Q9QH 1VFUA 3GJFK 4Y2DA 2X09A 5C1MB 4M4PA 4QWWC 1ZXQA 4PB0H 1XR8A 2VSCA 3IJYB 1IGFL 3OR6B 4XAWH 2J6EH 3VFMB 5IVXE 2B1HL 2QLVB 5I73C 1LE9A 1AP2A 2BHYA 1WFOA 3DETC 3NCCB 5FEBA 3QQ4B 3MOQA 3GMMA 1OGAD 4DKEH 3DX6A 4MQXC 5KOVC 1W72A 5DEFA 1WCBB 1U95A 1ZGLA 3JV4B 1HOCB 5EIQA 5E1AB 3M8OH 3D48R 2Q20A 5SX5H 1ZHKA 1KLFA 2XWJB 1JVKA 3ZSSA 3WNMA 4AIXA 1IRAY 1ZWIB 3LRSB 4KRLB 1EHXA 4HXBH 1LO5B 1JF5A 3U0WH 2NY3C 5DFTA 3QULA 4WWKB 4LKXB 4Y16D 5LJYH 1PQZB 3PDOB 4JO2L 1XF3A 2F58L 4F57L 4PRIE 2DTMH 1TZGL 1OT2A 3V4VH 5T1KA 1C5BH 3L3IB 5DJ8A 4ERSH 2FSEB 1QG3A 1INDH 3QI9A 5SX4I 1Z0NA 1NBQA 2JJUA 5E99L 3DUHA 3VDBA 5C9KA 4AEIH 3FQWA 3BKCH 3QIBC 2QR0B 1X5ZA 4I0PB 4RX4A 3T0EB 4P2YA 1PX3A 4IIQB 5DJXA 3AREB 3GB7A 2DIJA 4WEBH 4NO2B 1NBZA 4YHLL 3WDHA 1M6OA 1BIIB 2HT4D 3IRPX 1EJOH 4XP1L 4OQTL 4Q9CA 2K7QA 5EIIB 12E8L 3MRDA 3PABA 3AM8A 4ZSOE 4AMKH 4MA8L 4F7PA 2OI9A 4X6BB 1JZ2A 4MB3A 5CSZB 4D9QE 1JBJA 2UYLA 1MI5B 5H8DA 1BF2A 1F42A 1JE6A 2J8UA 3MRBB 3QHFH 2DQUL 9CGTA 4XP6L 3IKCB 3BGAA 2OL3L 3SCMB 3P73A 3O6FC 5L2JA 1A5FH 3K4ZA 1KYOK 1HYRC 4G7YL 3U9UA 5IUSA 4YK4B 3B8SA 3HUJE 5D96C 5HVGB 2YPKB 2NYYD 3SN6N 4YHLH 3Q5OA 3WHE0 1V7ML 1C08B 2WBJB 2ADGB 3BKYL 4U49A 4HS3B 4OFYD 4YGAB 3WIFA 3SE9H 3WNOA 3ESUF 5IR1B 5JQ6H 1DN2A 5I6XB 3W0WE 1ZGLB 3VFSA 4DGVL 3S98A 3QIWD 5FHAH 1HOCA 5FYLE 2AJXH 3V6FB 1FVEA 2ZSWB 4IRZL 3LIZH 4OM0L 4OKVA 3REWB 4ODSL 3U0TB 3FL7A 4XMPL 3NTCH 3I2CH 5DJDB 3MNWB 2XQYK 4RMUA 3WO4B 4JREB 1BM3H 5K9JH 1FYHB 3WLWD 5F70A 5I19H 3ZYIA 5B38G 4N0UA 3C6LA 5EU7E 2R29H 3WBDA 1AQKH 3TN0B 4FXKB 4QOKA 3VRJA 3UTPD 5F9JA 1EMTH 1ZT4A 3KXFB 2HRLA 2JCCE 2FSEA 1G9ML 1OTSD 2YUVA 5BZWB 1V3KA 2PR4H 5KSBB 2C1PA 1NEZB 4NN7C 4KTEH 3FT3A 1JPST 2VXTH 3OKNA 3ZMRA 1WV7T 4PGZA 4DQOL 3RPIA 1BIIA 3LIZL 4X6CF 2VZTA 4JG1H 4NUGL 4XP9H 3O45A 4YHKH 4P57A 5HVHC 3HN3A 4KKAD 3P4MA 4F7PB 3SQBA 4WUUE 4NN7B 3LZFL 4I9WE 3WL9A 2PTTB 1B6UA 2H6PA 3NZHH 2A6DB 3IGAA 2NY1B 5TF1H 2R8SH 3UJTH 5IQ7H 2AK4D 2R2EA 4ISVA 1YQ2A 5D7LE 4LPCA 5J6GB 1HSBA 5CILH 4NOFA 2FIKA 4X5XA 4XPGH 5I1KH 4J3VA 1W2KT 2FL5A 2A6IB 1J8HB 4H0HB 1DL7H 4RIRB 2ID5A 5IROC 1BECA 4NGHH 4X9FA 5C07B 3STZA 4JZNA 3HPJB 1B4RA 1YUHB 3HI6L 4OF8A 2ORBH 5SWSD 5E6ZA 1TQCB 4WTZG 5T1DH 1CL7L 1YPZA 4ZTPH 1VGEL