3I6UA

Structure and activation mechanism of the chk2 dna-damage checkpoint kinase
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
413
structure length
390
Chain Sequence
TPAPWARLWALQDGFANLECVNDNYWFGRDKSCEYCFDEPLLKRTDKYRTYSKKHFRIFREVGPKNSYIAYIEDHSGNGTFVNTELVGKGKRRPLNNNSEIALSLSRNKVFVFFDLTVDDQSVYPKALRDEYIMSKTLGSGACGEVKLAFERKTCKKVAIRIISKRKFAIGLNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILGPTYLAPEVLVAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and activation mechanism of the CHK2 DNA damage checkpoint kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase Chk2
total genus 107
structure length 390
sequence length 413
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00498 FHA FHA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3i6uA03
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 3i6uA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3i6uA02
3WZKA 3UP7A 3OC1A 4BDJA 4RFYA 3NRMA 4I5PA 4CG8A 3LFEA 1B38A 1H24A 4NCTC 4E20A 4A4XA 2CGUA 4ALVA 4BC6A 3SOCA 3S0OA 3LXKA 3SXRA 4BI1A 4QMTA 5T3QA 3RHXA 2UZUE 3IGGA 3OWKA 4BZDA 4CT2A 2XJ0A 4KSPA 3NUAA 3Q3BA 3PY1A 3DKOA 3W33A 4YBJA 4U40A 2E9UA 4PL3A 4GK3A 4EI4A 4YJOA 3EFJA 5IF1A 2B52A 3RM6A 4G3EA 3VRZA 3FUPA 3EWHA 4H1MA 4XRLA 5FP6A 3PJCA 4FSYA 2R7IA 3CJFA 4BYJA 3SX9A 3RINA 3P7AA 4XG9A 4DEGA 2PE1A 3BX5A 3KVWA 3SG8A 4RJ4A 5JGAA 1XBAA 4YLJA 3W2QA 3LM5A 3DXNA 4UXQA 4APCA 2WNTA 1GNGA 3HRCA 1NT2A 4MBLA 1M7NA 4YPSA 3POOA 3QTUA 4S31A 2BCJA 3RTPA 2ETMA 4AZWA 4ENXA 5HLPA 4RVMA 2CLQA 5D7VA 3NSZA 5I4NA 2PVLA 4O7WA 4LQMA 2PY3A 2CNVA 1OECA 4ID7A 5E9EA 4WG5A 3QC4A 2W1GA 3A7GA 4MD7E 5BQ0A 4H3PA 1JKSA 4RQKA 1BKXA 5FEQA 5LVPA 3Q53A 5ICPA 4M84A 2R3QA 4AAAA 5IKWA 5DN3A 4G5JA 3MA6A 5KMLA 4TWNA 3RK5A 4B9DA 3DBEA 3L8VA 4BGQA 4QMXA 3E87A 5CASA 1JBPE 3RAIA 3G15A 5DE2A 1STCE 2ZM3A 2JBPA 2J51A 4YZDA 1O6KA 1SYKA 3EZVA 3W2OA 3FXWA 3UGCA 3M11A 3NYXA 3ALOA 4GFOA 1ZARA 4MQ2A 5AWMA 3UC3A 3NW6A 5M4IA 5IQAA 2YIXA 5ANIA 3PSBA 1Q8YA 4NM3A 3R8LA 4UMPA 4GJ2A 4O7ZA 4F1MA 4WNPA 4QMMA 4E5WA 3QTIA 2ZV8A 5EM7A 4NH1A 1K3QA 3P78A 4AZFA 3B8QA 1R3CA 3L8XA 2WZJA 4LFIA 4AE6A 5L2WA 5KUPA 3LHJA 5CLPA 2J0MB 2XNOA 4LI5A 4PTGA 3ORMA 3ZBFA 3L9NA 4FKIA 5IZFA 4M13A 5JGBA 5KMIA 3PPKA 1FHRA 4EOPA 3GCSA 3MFRA 4Z3VA 4NEUA 2PUPA 4F1TA 3D0EA 2A4LA 4O7RA 3ROYA 5A4QA 3WZUA 3HA6A 5I9UA 4IZAA 1JSVA 3L8PA 4YZ9A 1J7LA 3DDPA 3ZSIA 2YCRA 5DT0A 3PE2A 4OTFA 2GNLA 4S33A 4QP3A 5EK7A 4G6LA 1PY5A 3GB2A 4HGEA 5DPVA 5HESA 5K5NA 3BWFA 4E5AX 2R2PA 3O8UA 4YNEA 3SDJA 5AP1A 4RWLA 3UPZA 4GK2A 5FM2A 2YN8A 4EHGA 4YURA 4FTCA 3EL8A 3BYOA 2GHGA 5BX0A 3QQJA 5CI6A 1BMKA 5CZHA 4BCGA 3GU5A 3DFCB 2FA2A 2OWBA 4QYHA 4AWIA 2YIRA 3HLLA 4WO5A 3DQWA 4EZ3A 3K5VA 2R3FA 4JAIA 1X8BA 5B0XA 3W10A 4IM3A 5AV1A 5GJGA 2C4GA 4PPAA 4C4HA 3C4FA 4NM7A 4YLKA 3VBVA 2GQSA 4TWOA 4ANOA 4C4EA 2XK4A 2IVVA 2VO0A 2R3NA 3D2IA 2VWUA 3QA0A 4MHAA 4FZ7A 3R8MA 1J91A 3TZ8A 3LOKA 2OJJA 1F3MC 1GZNA 5LOHA 1UKIA 3I6WA 3OTVA 2YM6A 1MRVA 2P4IA 2V0DA 1XH6A 2XJ2A 3F2NA 4FTUA 4YPDA 3DJ5A 5IEYA 3R0TA 4EH3A 3OXIA 4O6LA 4L43A 1REJA 3ORZA 4N70A 4XHKB 3UMWA 3W1FA 4Y8DA 1J7UA 4AT5A 3OUNB 2WMQA 4IZ5A 5E91A 4AT4A 3FL4A 5AIRA 4XV3A 5AP3A 1XWSA 1Q41A 4IX4A 4WD5A 4XP2A 1YWRA 2X8EA 1XBBA 3LW0A 3TZ7A 4TYJA 3V5LA 3ELJA 3ZU7A 5CAPA 4IAIA 4PMTA 1GIHA 4HJOA 4J8MA 1XH9A 2C30A 1OUYA 1Q4LA 3OXZA 3SOAA 2E2BA 3BKBA 4LV5A 1PMNA 2YIQA 2JIUA 4FV5A 2JQJA 4J99A 3EOCA 4BICA 3W8LA 3HMIA 3DBFA 4PDSA 4BBFA 2KB4A 3SGCA 4R78A 4BCKA 3LJ2A 3DGKA 5EM5A 2VTJA 2CSWA 5ITAA 3LFSA 2VX1A 3O96A 5J9ZA 1A48A 4D4RA 4ZS4A 3DXPA 2W9FB 3NNWA 1KE6A 4GVJA 2BALA 3Q96A 3NDMA 2CKEA 3TL8A 3ZLSA 1YRPA 2PTKA 3FJQE 4RVKA 1OKVA 1OKYA 2WAJA 4FA2A 2KB3A 3G9LX 5DBXA 5JZJA 1YJMA 2BRFA 4FGRA 3U4WA 4PPCA 1TQPA 2Z7RA 4HZSA 3C4ZA 3GCVA 4K2RA 4QP6A 4RJ8A 1NW1A 3KREA 4O7YA 3SG9A 2WIHA 1OPKA 4PNKA 3C13A 4BHNA 5JH6A 3KQ7A 1KSWA 3UQGA 3S95A 3AT2A 1L3RE 3VS1A 4EHZA 2PK9A 5EDPA 5AAGA 4CLIA 4F9WA 4PDPA 3MSSA 5CU3A 1I09A 1YDTE 3WIGA 1UKHA 4YZNA 1SZMA 1U59A 4C62A 1ZXEA 3BLRA 4G1WA 4HPTE 3T9TA 1LGQA 4I41A 2XCKA 1CDKA 2O5KA 3LKMA 4D9TA 1PXKA 3DT1A 4JVGA 4N4SA 3ORIA 3V01A 5L2IA 2PULA 4IIRA 4BRXA 1DM2A 4XJ0A 5IUIA 3QWJA 2JEDA 3BYUA 3IDCA 4JQ7A 2X2LA 3F3TA 3QHWA 4O22A 3QRIA 2YWVA 4ZZOA 3R21A 4LMUA 3ZYAA 1SVEA 3KA0A 3Q4CA 5IISA 1OI9A 3WZJA 2XH5A 3GU6A 4USEA 4MF1A 5DI1A 3PA4A 4FIIA 1FMKA 4O0SA 3UVRA 5CT7A 5EW9A 4BWKA 1PYXA 1FINA 2BZIB 3NX8A 3PIYA 4GEOA 2JKDA 1LEZA 4MH7A 1UNLA 3KRXA 3A7FA 4U80A 5I9ZA 3ATTA 1H0VA 1UNGA 2ZM4A 3BELA 3I5ZA 4B4LA 3UIUA 4JAJA 3QRKA 3EFLA 4FNYA 1JQHA 3GUBA 3OMVA 5AP7A 3GENA 2NPQA 2UZOA 2BMCA 4RRVA 2IZRA 4D4VA 1PXJA 5B2MA 5I9YA 4XG4A 3M2WA 4FTTA 1PXOA 3MFSA 3I0OA 3WF8A 4FV0A 3R9HA 4C3RA 4QYFA 5EHOA 5CF4A 4FKVA 2ITYA 1S9JA 3B2TA 4L8MA 5IA4A 2YLFA 4KIPA 4C35A 5A6NA 5IQBA 3AT4A 4RIXA 5HD7A 5AUTA 2J4ZA 3BPRA 5ACKA 2R4BA 1YI6A 1MUOA 4PQNA 4JR3A 2QI8A 2IVUA 4FKPA 4O38A 3QQLA 3L1SA 2HENA 3VJOA 4H58A 2IO6A 3EMGA 4D5KA 3ZONA 4CFXA 4DGOA 4XRJA 4AOTA 5HTIA 4BDFA 5M4CA 1AQ1A 2JITA 4JQEA 5DH3A 4MX9A 3PWYA 5KHWA 1YHWA 1ZOGA 2C0TA 4O96A 3RCDA 2OJFE 3O8PA 2W9ZB 3Q5ZA 4MVFA 3FMLA 3OWLA 1G3NA 2JDOA 2OU7A 2YDIA 5D9HA 4WBBB 3SLSA 4LL5A 2QLQA 2A27A 4I94A 4ZLZA 1H07A 4RBLA 4BF2A 4JJRA 2PVNA 1P4FA 4U44A 5E50A 2BROA 4DG3E 2ZV9A 2YEXA 4IBMA 4BY9E 3NCZA 3VS4A 4U6RA 2J9MA 5BYYA 4D9UA 4EHVA 2JDRA 3C0HA 2R3LA 4MD8E 4AN2A 4L01A 2J0JA 3P4KA 3FV8A 4ZSGA 5KMKA 1M2RA 5AV0A 4CV8A 2YA9A 4FTOA 2F7ZE 3FY2A 3EQBA 3SRVA 3R1YA 2KTYA 3N51A 1FVTA 2OXXA 5JZNA 5DR6A 5HOAA 5L2TA 4S34A 5IEXA 2BAKA 1P4OA 2BRBA 2GFSA 2AYPA 4GT4A 5F94A 1Y6BA 4FIGA 2J0KA 4QP9A 2ITTA 3LIJA 5F95A 5TR6A 3EB0A 4YGAA 3HAVA 2UZNA 4J98A 5DA3A 4R5SA 4ASDA 3QKKA 3R30A 4OTRA 3FMEA 5AIKA 3W18A 5LMBA 4UZDA 4A9UA 3FYKX 4H3QA 1REKA 2FB8A 4HCUA 4E93A 5IQGA 4C3PA 4CD0A 2JD5A 4RIYB 3E93A 3HMOA 1YI3A 1HCLA 1OUKA 4OBOA 3UP2A 4AOJA 3PDTA 4IDTA 5DG5A 2CKQA 5K5XA 4GKIA 3R00A 5CF8A 5HQ0A 3CGFA 3EQHA 4G6NA 4BCJA 4EYJA 5FUTA 4O2PA 5HO7A 3I7BA 4UMRA 2QKWB 4NKSA 5AR2A 4ZY6A 3QCYA 3ELVA 2QNJA 5BVNA 3SXSA 2ZVAA 4L52A 4UZHA 4XLVA 2OXYA 4E4MA 1XJDA 2G2FA 4YU2A 4KSQA 2YCSA 2VZ6A 4MXZA 5CQUA 4LL0A 5HNIX 4CLJA 5EI2A 4HCVA 3R8VA 4CTCA 2XK9A 2HXQA 2C69A 2HOGA 4QYEA 3I79A 2OZOA 2ESMA 3FZRA 1UVRA 4C59A 4JX7A 4NJDA 4UWCA 1E9HA 4FV9A 3R7IA 2XP2A 3GU7A 3QRUA 1BX6A 2C3JA 5K0KA 3GC7A 3NW5A 3MGYA 4QTAA 4PP7A 1J7IA 3DZOA 1JKLA 4BTMA 3HL7A 2PZ5A 3MYGA 5DRBA 2BKZA 2C5XA 3TUCA 4ZY5A 3HAMA 4FSMA 4DGNA 4TRLA 4WNMA 3HRBA 5AAFA 4E6QA 4RX5A 1U5QA 4UEUA 4EH8A 5JN2A 4FZDB 1JAMA 3UOLA 4KS8A 4ERWA 3ULZA 3EQPA 3FMNA 3F3UA 2WTDA 3O8TA 2WPAA 4AW0A 4EC8A 3MESA 5BYZA 3B8RA 4ITIA 2WMWA 2FSLX 2VUWA 2WQNA 4Y5QA 2G1TA 3F7WA 4CKRA 2VWYA 4PX6A 4Z9LA 4GV1A 1IA8A 4XBUA 1M17A 3I60A 4MNFA 3BU5A 1ZMUA 2YJSA 2QD9A 4ZTSA 5BYLA 4ALWA 2XM8A 3QUPA 1M14A 4GK4A 4M3QA 1XH8A 4EK6A 3PPJA 1KE9A 5KKRC 3TUDA 3CY2A 2QVSE 1H0WA 3RPYA 4WA9A 1KWPA 4XYFA 4D2RA 3R71A 2I1MA 4ZSEA 4FBXA 4BGHA 3AGMA 1CKIA 4YJNA 3DNDA 4NT4A 5GIOE 3FKNA 1ZY5A 3NNVA 4XG2A 4BVUA 4DEAA 2EB2A 3CCNA 4LM5A 4RLLA 3TNQB 5C1QB 3LLAA 1JNKA 4IZYA 3KN6A 4JLCA 4MD9E 1CSNA 1VYWA 5DVRA 3TZMA 2QC6A 2XK3A 5D7AA 4IVBA 4YC8A 3EQDA 2IJMA 4YZCA 3DLZA 4L6QA 4FR4A 1FVVA 4DH1A 4NJ3A 3KXXA 1M7QA 1H27A 3JYAA 4CRLA 4EBVA 3TDWA 3TG1A 4P90A 1K3AA 3WILA 4DT8A 5CY3A 4ZTRA 3ETAA 5L8LA 2ETKA 4E6AA 3MB6A 4EGXA 4ZMEA 3HRFA 4QO9A 2HY81 1CKPA 2WTJA 2O63A 2PVMA 3GXLA 4YJTA 3VS0A 2W4KA 3QTRA 2PE0A 2OFUA 4QP1A 3PVBA 4NCTA 3WARA 2F57A 2BUJA 3MVHA 4FV3A 1R1WA 3WF7A 3AD5A 4FG9A 4FG8A 5IMEA 1YW2A 2YIWA 2WHBA 2PVFA 4M0YA 4FV7A 2GNHA 4PL5A 4DLJA 3PA5A 5HVJA 1CM8A 4L00A 2PUNA 5HBEA 4C58A 1W98A 2C6TA 2VWBA 2Z7QA 1YDSE 1J1BA 3KULB 1MZKA 4WIHA 5ANJA 2JIVA 3R28A 4X2KA 4PWNA 1ZLTA 3BHUA 1OVEA 5C01A 3UN0A 2WTCA 4FSRA 3U51A 3MV5A 3QZIA 5LCKA 3LE6A 2QQ7A 3PXZA 2CN8A 4YHFA 5HCZA 4CXAA 2GPHA 3O50A 2OIQA 2XIRA 2Y0AA 2QO7A 3BWJA 4YJQA 4IB1A 3LJ1A 4BDIA 4TYEA 3NIEA 5CX9A 5KNJA 4BCFA 3C7QA 4O6EA 2HAKA 2HZ0A 3DU8A 5DEYA 4JRVA 5JEBA 3QU0A 1RW8A 2W06A 1JSUA 4FKQA 3IS5A 2XUUA 4FE2A 2ITQA 4Y72A 5CF6A 3COKA 1YDRE 2WU7A 3N4TA 3CPBA 4ZSJA 4HOKA 2XK8A 3BGZA 4Z7GA 5AA9A 5LCJA 2J7TA 4I3ZA 3O0GA 3KY2A 1JKKA 4F70A 4DTAA 3L9MA 5A4LA 5BVOA 4KINA 3MJ1A 3UNJA 4G16A 4FVPA 3VW8A 5GJFA 3QTQA 1GZOA 4WOVA 5J7BA 2VN9A 2OZAB 1Q62A 4D58A 4F6SA 4F7JA 2Y7JA 1ZAOA 3F5GA 4FZAB 2PVKA 4G9CA 4DGMA 5ANEA 3DAJA 1FGKA 3MY5A 5AR8A 4EK3A 3OROA 4YO6A 3WI6A 4O91A 2X6DA 4FL3A 4GT5A 1HCKA 3F2AA 4QMSA 4MXXA 2W99B 3R7OA 5IH4A 4BDHA 4FSWA 4DEEA 3CXWA 4E8AA 1GAGA 3BQCA 4IVDA 3JY9A 3R83A 3C9WA 2WTKB 4UBAA 3QF9A 3BCEA 4O21A 4I0SA 2VU3A 1SM2A 2QURA 4EH9A 4JL9A 3KF4A 2QONA 4L3JA 2FYSA 1Q8UA 1OMWA 4ZJIA 4HNFA 2JLDA 3CIKA 2EXEA 5A6OA 2J0IA 4QQJA 1IR3A 2VTTA 4AW2A 4GT3A 4BCHA 4DTKA 2XNGA 4JXFA 2UW4A 4MBJA 4I20A 4MXCA 4B8MA 4C37A 3IQ7A 3NIZA 4U0IA 3FKOA 1ZYSA 4USDA 3C5UA 4MCVA 4PDYA 2RF9A 5L6PA 2H6DA 3PE1A 3V6RA 2JDSA 3UOJA 3VVHA 2BKKA 2RFSA 1QPJA 3NEWA 4IC7A 2BZKB 4ZTHA 4UN0C 4FTJA 1VJYA 3MVLA 3PJ3A 3Q2JA 4EJNA 5JQ5A 3W16A 3U9NA 2EU9A 2RKUA 4BN1A 3GNIB 5E8WA 3KL8A 1AD5A 5CI7A 4AOIA 2YITA 3NCGA 1FPUA 4NZWB 5DT4A 5EH0A 4IWDA 4G3DA 3KB7A 3V5QA 5JT2A 4U45A 5DHJA 2C6EA 2WGJA 3KK9A 3MTFA 4FKJA 4HYHA 4FSZA 5E4HA 1Q8TA 1H08A 3EFWA 3KVXA 5J8IA 4EH4A 1S9IA 4HYIA 5CXHA 3DBCA 3F82A 4D28A 4ASZA 4BB4A 4B0GA 3U6IA 1IASA 3OUNA 4IW0A 3FBVA 3RP9A 4FV6A 3FY0A 3T3UA 3GC8A 5HORA 4P5ZA 5HLWA 3WF5A 4DCAA 4KRCA 4FOCA 3VHEA 4D2TA 1UU7A 4K8AA 2B7AA 3LQ8A 4BFMA 1WVYA 4FL1A 2Z02A 5KZIA 5F9EA 4Q2AA 3A7HA 1QCFA 4RA5A 3EN9A 5ACBC 5ETFA 3UODA 5IU2A 5J79A 4R1YA 1ZOHA 3E7VA 3ELSA 4ANLA 2CKPA 3P86A 2CMWA 3HVCA 4U41A 5K4IA 4GKHA 3TT0A 1NVQA 2JDVA 5DT3A 1P2AA 5A46A 3GC0A 4FG7A 4FT9A 4E7WA 4X3FA 5AR5A 4F0FA 2YAAA 4JBOA 3QGYA 4XG8A 2UZWE 3HEGA 1IRKA 1YOLA 5KKRB 5AA8A 4YTCA 2QU6A 4USFA 3FQEA 3H4JA 3JR1A 4FEQA 3TNHA 4BBMA 3W8QA 1G6GA 2HZ4A 4CQEA 2CCHA 3OVVA 4FIHA 2A2AA 3DTWA 4JDHA 3QAME 4ZZMA 3S2PA 3KRLA 4ZY4A 5H3QA 4XS2A 4AF3A 1XR1A 3QD2B 4ZTQA 3RCJA 3ZCLA 4ASXA 2XKCA 2UW0A 5EOBA 5CEIA 3ZZWA 4O82A 4E4NA 4UMUA 3KF7A 3MH0A 4FYNA 4J95A 4FNWA 4L46A 2RGPA 4ANNA 3RALA 3DS6A 5I9XA 3GQLA 4EYMA 5EG3A 4IZ7A 3D5WA 3ZFXA 3FZPA 4G9RA 4ANSA 3Q9ZA 3RPVA 3Q4UA 4M0ZA 4F0IA 4X2NA 2BZHB 2OI4X 5HIDA 3Q5IA 5IQEA 4U8ZA 3HX4A 4A9TA 2GTNA 4QD6A 3U54A 3TACA 4H05A 3QCSA 4UV0A 4FMQA 2RFNA 5AUWA 3TV6A 2VNWA 2O0UA 4DFLA 4DFBA 3PZHA 2FSOX 2HIWA 2CSNA 4OW8A 3DK3A 3VN9A 4DFYA 5CNNA 4YJPA 2PZYA 3ET7A 4M68A 2F4JA 3CQUA 4S30A 5FTOA 1IEPA 4PMMA 3T3VA 3W2SA 5JSMA 3CKWA 3AD4A 4I0TA 1W84A 5LQFA 3UOHA 2WELA 4GUEA 4O2ZA 5AR3A 3NR9A 4QTCA 3IONA 3PSCA 3Q9XA 3UVPA 4DCEA 2Z7SA 2VTNA 4RIOA 4HZRA 1WAKA 3VF8A 4ZSAA 3F5PA 1K3JA 1IA9A 2NNWB 1BUHA 4LG4A 5EKOA 4QMOA 1XBCA 3NPCA 3CTQA 2XK7A 3EL7A 3GU4A 2WMRA 3PJ2A 2CHLA 4FKRA 4RJ6A 5LVMA 4FODA 5EYCA 5C8KA 4QP2A 2XCHA 3VBYA 3R7YA 2VTRA 1YHVA 3H0YA 4M69B 5T68A 5CSWA 4BL1A 3R9RA 4C33A 4JDIA 3EYGA 1VR2A 2WMSA 4E4XA 5IUGA 5C4KA 5HCXA 1YQJA 2RG6A 2VTLA 3JXWA 4I23A 4RC3A 2QOIA 5CEQA 4EKLA 4OT5A 1WBWA 2QHNA 3V5TA 4ONAA 3E8EA 4ZJJA 4ALUA 2WMVA 3UNKA 1W7HA 3QA8A 4IAAA 4M66A 1ZZLA 3ORLA 1J3HA 1ERKA 4XX9A 4X21A 3VA4A 4FEWA 3A4OX 2X2KA 4W4VA 5K3YA 3ODZX 2R3RA 1PXIA 3OOGA 4EH5A 3VPYA 3CSVA 3E64A 5F1ZA 4CGAA 5K9IA 3OHTA 3R9OA 3REPA 4HVHA 5KMNA 4NUSA 4OTWA 4YTHA 5GJDA 4FV8A 5FXSA 1LUFA 1Q3WA 1OKWA 1T45A 1NA7A 3NNXA 3HNGA 3PFQA 1WFCA 2GNGA 3ORNA 5DFPA 3VULA 3LXNA 2Y6MA 2P33A 4LV8A 5HIEA 2XRUA 2KULA 4ZLOA 4IAKA 2WMAA 4FSTA 4OUCA 3AXWA 3SVVA 3UZRA 1NVSA 2V7AA 2Z8CA 4EJQA 4G2SA 3GI3A 2VWVA 5HVKA 2IW8A 3R1QA 3D9VA 3ZUVA 3KK8A 4MBIA 5DJOA 2XYUA 3PVGA 2YABA 4AG8A 4BI2A 4ZTMA 1FHQA 2UVYA 3QQFA 2FH9A 1ZWSA 2E9NA 5CU2A 2C3KA 3UTOA 1J4QA 3D4QA 4G34A 4Z7HA 2I0EA 4MXAA 4MAOA 3AGLA 3VRYA 3ACKA 1R21A 2OIBA 2VO6A 5AUVA 5KO1A 2YAKA 1WVXA 5L2SA 4ORKA 5CVGA 1UU3A 4PRJA 4RLKA 5CSHA 3R7EA 2JKOA 2R64A 3UO4A 2H34A 3C4CA 5FBNC 3RAWA 4AACA 4C8BA 4J8NA 4BHZA 4BDEA 5IQIA 3KXZA 2OF4A 3ZXZA 3LCTA 1NY3A 1PHKA 2XRWA 5HHWA 4M7IA 4ZJVA 4V0GB 4XV2A 2DYLA 4XEYA 2C6MA 3KN5A 4W9WA 3POZA 3K3JA 4U7ZA 4WSQA 5EM6A 2C3IB 3V5WA 4CNHA 1W82A 2XIKA 3KXHA 4X7QA 4R77A 3OCSA 3HX1A 2HZNA 5LMAA 2BTRA 1UHTA 4U79A 2HW6A 4EK4A 3K54A 1R39A 3LQ5A 5TF9A 2OJIA 3CC6A 4GFMA 4OTQA 2Y8OA 4M69A 3WYXA 5HI2A 3FZSA 4ZK5A 1Q8WA 3FI4A 1WCCA 1OITA 2GNJA 5KMOA 1GJOA 3R04A 4LOOA 3L8SA 3NW7A 4W8EA 4YTFA 4EEVA 2VTHA 4KS7A 5IDPA 2UW8A 2XT9B 3FZ1A 4LUEA 5HX8A 1IAJA 4BCPA 1YVJA 1UV5A 3TJDA 3V8SA 2W7XA 4TWPA 4XOYA 4D4YA 3DKGA 5I3RA 2PHKA 2XNPA 3K5UA 3LMIA 3LFAA 2C6IA 3GC9A 4FUYA 4C38A 3GOKA 1JKTA 4I5MA 3VUGA 4KKEA 4RVTA 2OW3A 4OAVB 4PTEA 3ZO1A 2XKEA 4G3CA 5AADA 2AC5A 4IMYA 4EC9A 3DJ7A 3K2LA 3MH3A 2QKRA 4IX3A 4WG4A 3NUPA 3IK3A 3QGWA 5K0XA 5HBHA 4PMSA 3I4BA 4ACGA 4UB7A 1QMZA 4YJSA 5IA0A 1OPJA 4ZOGA 4NTSA 2J5EA 2C5OA 2DUVA 2ERKA 4UX9A 4DC2A 4FX3A 3LAUA 2BAJA 5EW3A 3Q32A 3ZC5A 3FQHA 4I1ZA 3RPSA 5E8UA 2H9VA 5CSXA 4FC0A 1GZ8A 4E26A 3V5PA 3TTJA 4GIIA 4AZTA 5L6WL 3I6UA 4KAOA 5AUXA 4ANQA 3CPCA 4X2GA 5EYMA 2AFFA 5A4EA 4FSQA 1DAWA 1OL2A 2F2UA 2DWBA 4UYAA 3QCXA 3RK9A 4I24A 4RWJA 1TKIA 4IAYA 4YC6A 2X1NA 3R8PA 3NMUF 4P7EA 5KE0A 3W32A 1LEWA 3QX2A 4WSYA 3VS7A 4YR8A 1Y6AA 5HNGA 5BVWA 2OGVA 3DK6A 2E9OA 2X6EA 2WOUA 1QU5A 2BRGA 2O2UA 3Q9YA 3EKNA 3UIXA 4AX8A 4JONA 2GS7A 4FK3A 2C6OA 2ITUA 4R3RA 3G2FA 4WNKA 5CSVA 3ZLYA 5AR4A 4JS8A 4RJ3A 3OEFX 3TDVA 1WVWA 2V5QA 3F3ZA 4A0EA 2QOOA 3CEKA 3R2BA 4L44A 1J4OA 3FMDA 4KBKA 5M4FA 3JVSA 1UNHA 5E1EA 2BDJA 2JKQA 2PZIA 4CT1A 3D14A 4RX9A 3MY1A 2O3PA 1RE8A 4QPAA 5C4LA 5C8NA 2CKOA 4W4YA 2V22A 2B1PA 3CY3A 3PUPA 5EFQA 1CTPE 2ITOA 3VS3A 4XLIA 2PMOX 4E3CA 2A0TA 1I44A 5I9VA 4OT6A 4HCTA 3H3CA 1KE7A 4IAFA 5L2QA 4O0YA 3FSKA 5FTQA 3ZSGA 1M52A 2CLXA 4J97A 4K18A 3VNTA 4DGLC 2R3IA 3NVMB 2GHMA 4D2SA 3DV3A 3ORPA 4AA0A 2UW7A 3D5XA 5KBQA 2UVXA 1OIRA 5IA5A 5A3XA 5IQHA 4FTRA 4G5PA 4FF8A 2PYWA 4DLIA 4XP0A 2WMTA 3EIDA 3QHRA 4NM0A 3KMWA 4QPSA 3TIYA 2ITPA 3BLHA 2ITWA 4XUFA 2O65A 3F6XA 3FYJX 3RAKA 3PXFA 3PWDA 1W83A 2X9FA 5HG7A 1U54B 3TV4A 4FKSA 1NXKA 3ENHA 4OR5A 5HE3A 5IPJA 2W3OA 2ZMDA 1HOWA 5LVNA 5J5TA 4CMOA 4NFNA 3I0NA 3FLNC 2CGXA 2JDTA 4KABA 2VAGA 2ZB1A 3U6HA 3QYWA 1BL7A 3AC8A 4I93A 5F20A 4FZ6A 4PP9A 4BIEA 3GFEA 3FXXA 2A1AB 4C36A 4ZAUA 5FWKK 3LPBA 3KCFA 2XNBA 4A9SA 1F0QA 3BBWA 5KHXA 3M1SA 3EN6A 2VTMA 4L3PA 4BKZA 4FT5A 2QR8A 2NRYA 3IW6A 3Q60A 1K2MA 5AAEA 1BLXA 4K11A 4O81A 4L53A 5KMMA 4BCIA 2H96A 4QT1A 4C4JA 5KZ0A 3R8UA 2XYNA 5L3AA 5EQPA 3TM0A 3MS9A 1H01A 4IADA 4FEUA 5IG1A 3TCPA 4A7CA 3RMFA 2VX0A 4QQTA 4KIOA 3ZSHA 3PRFA 4DEDA 4IH8A 4ZMFA 4BIDA 1A9UA 1QL6A 2VTQA 3DKCA 4R7HA 5LARA 2HW7A 3GOPA 5CT0A 2PU8A 3P23A 2Y4IB 3QD4A 4IFGA 4I4EA 3FPQA 4IJ9A 2GQRA 2PL0A 4IB3A 3D83A 4R8QA 2Q0NA 3UPXA 5A14A 5E92A 3VHKA 4NTTA 4TPTA 2J50A 4HVSA 3QFVA 2CNQA 4WKQA 4XCUA 3HDMA 3UMXA 2CN5A 3KGAA 5ETAA 5AM7A 1GXCA 2XF0A 5FEDA 4DT9A 3F66A 3OG7A 3EQRA 3VF9A 5IUHA 5CU6A 3D15A 5CEKA 3MPMA 4JI9A 2YWPA 1GIJA 3A61A 5AUZA 3AG9A 3GBZA 4IWPA 2IPXA 2YACA 3QXOA 3BV2A 4DINA 4I6QA 1PRYA 3A99A 3HUBA 3GP0A 5C03A 4ACCA 3MB7A 2GTMA 3PZEA 1PKDA 4QP4A 4BYIA 3QQUA 4L9IA 4D0WA 4EOQA 3I5NA 4BZNA 2JAMA 3VC4A 4AFEA 2WFYA 3D7ZA 4BWPA 3MJ2A 5HCYA 4A9RA 3ODYX 3UNNA 4O83A 4J71A 3VBTA 2KKLA 2GHLA 5J87A 5HVYA 5AP2A 5JRQA 3HA8A 3V51A 3OZ6A 4AFJA 4IWOA 3A8XA 5I3OA 4D1XA 2BVAA 1CMKE 4PL4A 3F3WA 2YDKA 5D41A 4QTBA 2JFLA 3RJCA 3VUMA 3LQ3A 3KCKA 5HBJA 4FEXA 3W2RA 2BPMA 4CKIA 5HICA 2UZDA 3FXZA 4X6RA 1JPAA 1ZYJA 5CWZA 5EDQA 2OSCA 4K33A 4A4OA 3BBTB 2G2HA 1PJKA 1W8CA 5G1XA 2P3GX 3PLAE 1QPCA 4GL9A 3RKBA 5E8TA 2XS0A 2H8HA 3IKAA 4O0XA 2VRXA 3DAKA 5FDXA 3O71A 4QMUA 2YERA 2FSMX 4PDOA 4EONA 4Q5HA 2QOFA 4G31A 1RJBA 5F4NA 5BMMA 1G8SA 4TN6A 2YM5A 3A4PA 4U5JA 1WBSA 3RPOA 2WEVA 3OXTA 3HP2A 4OTIA 4V05A 2VTSA 5AP5A 3MDYA 3UNZA 4ENYA 5C26A 5HE1A 5DMZA 5JMSA 4XG6A 5HIBA 4KKHA 5AMNA 4PY1A 4O1OA 3UYTA 3NYOA 4F9CA 1PXNA 3PXQA 5EYKA 4FTMA 2GMXA 2IWIA 5HTBA 3KXGA 3VAPA 3MVMA 3ORKA 4GYGA 5BVEA 5BVKA 2YZLA 1SNXA 1GIIA 2VTOA 5IA1A 1OL6A 3RI1A 5E1SA 2JAVA 4GU6A 1F5QA 4ZIMA 2EWAA 3ZXTA 4N6YA 4D0XA 5A4TA 5BUJA 1CKJA 5H2UA 4BI0A 2KFUA 3T8OA 3EN4A 3MI9A 3FMMA 1KV2A 4N6ZA 4FT3A 5TKDA 4GMYA 4I6FA 5M55A 1J4KA 3E3PA 3FKLA 3FI2A 4GUBA 3W2CA 2YJRA 4O7LA 3R22A 4I4FA 2BTSA 3FLSA 3KXNA 4OTDA 4FV1A 2C68A 1PXMA 1K2NA 2OK1A 3E8NA 4UWBA 2VTIA 2XNEA 4R7IA 2GS2A 3GEQA 2LGCA 5CTPA 5H8GA 4HVDA 3RZFA 4IM0A 4EQCA 2J2IB 5FTGA 4EORA 2F2CB 2JQLA 5CVFA 2I7QA 2OKRA 5A9UA 3CTJA 3R63A 4WHZA 1ZYLA 2WOTA 4CYJA 4IQ6A 1XKKA 2OJGA 1WBTA 4L45A 3C5IA 2BDFA 1MP8A 4O0TA 1GZKA 2OH0E 2PVRA 3P79A 4L7SA 5JK3A 3CTHA 3TKUA 2C5NA 4AA4A 3VS6A 3VIDA 3E3BX 4TT7A 5J95A 4JIAA 4WUAA 2OG8A 4JIKA 4RZVA 1Y8GA 4RGJA 4I6BA 3BEAA 5ETIA 1ZRZA 3RHKA 5CU0A 4FTIA 3QUEA 3KMUA 3KXMA 3CLYA 2XBJA 3OT8A 4CSVA 2HXLA 2WIPA 2R7BA 4GCJA 4EOOA 4CFWA 2ZDTA 3DB8A 2P0CA 4F0GA 1Y57A 3QRTA 3WBLA 3BU3A 4JOAA 4TNDA 4C61A 1ZY4A 3BEGA 3FSFA 2R3KA 3LMHA 4NWMA 4M14A 4KB8A 3UZTA 4B8LA 1E1XA 1U54A 5C9CA 4HGTA 3UIMA 2RFDA 3PRIA 3OUKA 4GU9A 5A54A 2J6MA 3FLYA 3AOXA 4BCQA 4FNZA 3GQSA 4YJRA 4HPUE 3L9LA 4B99A 1XH4A 3C4EA 4WUNA 1GOLA 4BZOA 1ATPE 3TIZA 5L8JA 3WF6A 1H1QA 4TZRA 4I0RA 5FDPA 5HU3A 2HYYA 4EL9A 5H8BA 4PPBA 4B6LA 3R7GA 4J96A 1JVPP 4M8TA 4AN3A 1H26A 1Q99A 3ITZA 4QMLA 4FIEA 5CQWA 5BVDA 2YM7A 2PMNX 3BHTA 3BYVA 3R8ZA 4IE9A 3WZDA 1LPUA 1UJXA 5D1JA 4IVAA 3N4UA 3PP1A 4QMYA 4YSMA 4I92A 3Q4TA 4DAWA 4F99A 4XV1A 2X9EA 5E8ZA 3MIYA 4CCBA 3DXQA 4DEHA 1BI7A 4RVLA 2WB8A 2XEZA 1U5RA 4MWHA 2Q83A 2CGVA 3PIXA 1B6CB 3IW5A 3R9DA 3A62A 4G2FA 4IAZA 4M97A 2EUFB 4JG6A 3RWQA 4Y73A 3S3IA 4MYGA 4PMPA 3PXRA 3ZFYA 4Y46A 4QNYA 4HW7A 4TL0A 3S00A 3VUIA 2UW5A 4GSBA 3UO5A 4C57A 5GZ8A 4F09A 1G3GA 2G1LA 4NW6A 4RFZA 5CENA 3H9FA 3CJGA 3OEZA 4WG3A 3OP5A 5IMXA 1IAHA 3G33A 4E73A 4CQGA 1P5EA 4FKUA 1UWHA 3MPAA 2B4SB 3KU2A 1WMKA 2WD1A 5TE0A 1WV3A 4AGDA 2AC3A 4XNEA 4Q9SA 5FLFA 3SW4A 2GU8A 2C5YA 4YHTA 4MTAA 4BWXA 5J7HA 4OTPA 4O1PA 3U6JA 5CEPA 5TOZA 1ZMWA 3VBXA 4I6HA 3BYSA 3C0GA 4AQCA 4BTKA 5HX6A 4DTBA 3NGAA 4L7FA 1OL1A 5D11A 3E62A 1JWHA 1JSTA 2OZAA 1KE5A 5LVLA 4G3FA 4NIFA 3BZ3A 2CNUA 5I9WA 5HKMA 3PP0A 4NFMA 2JGZA 2WQOA 4R6VA 4RJ7A 3LXPA 4U43A 1PMUA 4FTQA 2Y4IC 2R3GA 2QLUA 3BE9A 2GS6A 3DCVA 4HNIA 4F9AA 5BVFA 5FQDC 3NUUA 4E6DA 4RA4A 3KKVA 4QQ5A 3ZUTA 3LFCA 4AXAA 4D5HA 2R3MA 4HYUA 4EH7A 3OCTA 4FK6A 1MQBA 3C1XA 1JLUE 4F9YA 4K9YA 2DQ7X 3MFUA 3LVPA 3LCOA 3LXLA 4MK0A 4RX7A 5EM8A 3ZRKA 4YMJA 5M57A 1PKGA 3A7JA 2FSTX 3WZEA 4Y83A 4EJ7A 1G8AA 3HV3A 3UE4A 3ZLWA 1M2PA 4AW5A 4DBXA 2YISA 2ZV2A 1Z5MA 3IPHA 3ULIA 3NYVA 3QQHA 2B9FA 5LWMA 4DEBA 1EH4A 3DBQA 4CG9A 1M2QA 2Y4PA 3IDBA 3MWUA 4WRSA 3UYSA 1Y8YA 3C4WA 3BHVA 3Q52A 2YM3A 4YC3A 4QP7A 2UZBA 4TTHB 4EOSA 3R7VA 4FKLA 5AUUA 3HMNA 4L42A 4PF4A 3ERKA 4Y95A 3V3VA 3HV4A 5LWNA 1YXXA 2G2IA 4C3FA 3HMMA 3QLFA 3SKCA 2Z60A 5LXMA 2RFEA 2XJ1A 3AQVA 4H39A 2B0QA 5HE2A 4BDGA 4ARKA 4L67A 4EKKA 3BIZA 4IB0A 3F5XA 3KRRA 3C51A 2WQEA 4BKJA 3HMPA 4AA5A 3EN7A 1Z57A 2QOCA 2ZV7A 3NVKI 2I0YA 3EFKA 3NUNA 4EUUA 3MW1A 3OBJA 4ITJA 4LRKA 4RIWA 4JNWA 2OICA 2VTPA 5GIPE 4IANA 2IW9A 5A8IA 4IHPA 3LCDA 4X2FA 2IN6A 2QO2A 4K0YA 4FIJA 4XG3A 3MH1A 3U8WA 4DH8A 5JGDA 4FL2A 1PXPA 3LFNA 5BUEA 3KFAA 1XH5A 4CFNA 4C2WA 5GINE 2HELA 4I5CA 1O6YA 4EWQA 2PMLX 3KT9A 4FTNA 4NIFB 4DFUA 3PG3A 2ZJWA 4MKCA 1FBNA 4F1OA 2XK6A 5KX8A 4FGBA 3TZ9A 5CEMA 2W0JA 4RG0A 4X0MA 4EBWA 5B2LA 3A60A 5FM3A 4YTIA 1J1CA 2BIKB 5AR7A 2I40A 2VO3A 3EYHA 3H9RA 5H9BA 5FD2A 4BGGA 4C4FA 3RVGA 1V0OA 4KRDA 5CNOA 4EZ7A 1OBDA 5CF5A 2V62A 4CFVA 2WEIA 4F7NA 2PVJA 4S32A 3OCGA 4FNXA 4R5YA 4RIXB 4F6UA 5M53A 3ZEWA 3ID6C 3EN5A 3NS9A 3VQUA 1H25A 3OBGA 4TNBA 5ANKA 3EHAA 3VJNA 1PF8A 3ZEPA 3DAEA 4IB5A 4BBEA 4AZVA 3RNYA 1OPLA 5JRSA 3VUKA 3BU6A 3PJ1A 3OT3A 2FGIA 4FT7A 4KIKB 1OKZA 3QRJA 3GGFA 4JDKA 4WT6A 3VUDA 3ZO2A 4DH3A 4LRMA 3CS9A 4QCJA 1K2PA 4H87A 4R3CA 4DFXE 1Q61A 2QG5A 3T9IA 4TW9A 3WF9A 2Z2WA 2IVSA 4JBPA 3MH2A 4YJUA 2WTIA 4NYEA 3S1HA 3R6XA 5M44A 2B9IA 4YHJA 3A2CA 4NSTA 1LP4A 4JT3A 2JQIA 4TYHA 2R0IA 3FEGA 1WBOA 5E8YA 4E1ZA 4KKGA 3U87A 2BAQA 3O17A 4U97A 3UDBA 2C6KA 2XIZA 4ITHA 1YXTA 2DS1A 4RX8A 3BE2A 5KCVA 1FQ1B 4V01A 1OB3A 3OCBA 5ANOA 3HUFA 5CAQA 3TKIA 4E6CA 2RL5A 3N9XA 1L8TA 1PXLA 4J1RA 2W5AA 4FYOA 4J7BA 4BR3A 1BL6A 4LMNA 3PA3A 4EZ5A 4YSJA 5AM6A 5DRDA 2XIYA 3GCUA 4ACDA 5GNKA 2GQGA 5HO8A 4DG0E 4PV0A 2ZAZA 4X3JA 4QPMA 3UV0A 4NKAA 4EHEA 2W4OA 3PY3A 1LGPA 1YKRA 3FZTA 4BDKA 4F7SA 1ZMVA 3F9NA 3W55A 3BLQA 4ZXTA 4A06A 3FL5A 4DG2E 4QYGA 4F6WA 4Z55A 2P2IA 2NP8A 1KUTA 4UMTA 3I0MA 2JKMA 1YXUA 4CZYB 2IZUA 3ZHPC 3E88A 3G51A 5J1VA 3ALNA 4KNBA 4Q9ZA 2CCIA 4RFMA 3H10A 3OW4A 1VYZA 3GT8A 2YM4A 4CEGA 5DIAA 4F65A 2YIYA 4ZTLA 3UOTA 1R0EA 1G5SA 5IQDA 2W1EA 3HV5A 3ZC6A 3VWAA 2PE2A 2VD5A 3FMHA 3UIBA 4K1BA 4IDVA 3C50A 5JKGA 5CZIA 4O86A 5E8SA 5DGZA 4W4WA 4DFNA 2REIA 3F3VA 3G6GA 5CSPA 4O84A 4H1JA 4APPA 4RMZA 1H00A 3Q04A 3KMMA 2EXMA 2EB3A 3V8TA 3FHIA 3GQIA 5GHVA 2W1IA 4RC4A 1SNUA 4CRSA 5CAVA 1KV1A 2JIIA 3CD8A 3QTWA 5JFVA 1T46A 5DEWA 2RIOA 3GCQA 3A7IA 1WLNA 5M09A 5T6KA 4ANBA 5CXZA 4ZP5A 1MRYA 1XO2B 3E63A 4BDCA 3SD0A 3PYYA 3PVWA 3W2PA 3FI3A 4CZTA 4FICA 2EXCX 3JS2A 5HTCA 1PMVA 3DTCA 4ZS0A 4TWCA 1PW2A 4QP8A 3LJ0A 2ITNA 1R78A 2PZPA 2W96B 3Q6UA 3UNMA 4D55A 2X4ZA 5IQFA 2CDZA 3FLQA 4CKJA 2B54A 5AJQA 5HGIA 3VS5A 5IA3A 4NM5A 2FO0A 3G6HA 4FI1A 3ZZEA 3FPMA 4O0RA 4Y85A 4DE4A 3TJCA 3P1AA 2ITXA 3IOPA 1U4DA 4YJVA 4TKSA 2QHMA 3TV7A 3AC4A 4CZUA 3WE4A 4AP7A 3QTSA 3MDBA 3FLZA 3HECA 2A19B 3OTUA 4U42A 5CS6A 5AEPA 3D5VA 3QALE 4A07A 1H4LA 3OWPA 3OF0A 4UALA 4V0GA 3QQGA 2W1CA 3ZUUA 4I21A 4JBVA 4EH2A 5L8KA 3EQCA 4NU1A 3P0MA 3NUXA 4IACA 3TNPC 2WMUA 2O64A 2PUUA 4XMOA 5EHLA 4ACMA 3Q6WA 5FP5A 3I0QA 5M4UA 2G15A 3GU8A 4J52A 5HG8A 2XEYA 2XKDA 3EQIA 4KIKA 3OW3A 1OL5A 2B9JA 3DQXA 4RWKA 3TEIA 2ZYBA 1O9UA 3QYZA 3KC3A 3VW6A 3ZDIA 2HY0A 4CYIA 4LRJA 2C3LA 4KWPA 2HWOA 2ONLA 2VTAA 3TKHA 4AGUA 4MNEB 3GCPA 1YXVA 4TYIA 1IG1A 4EUTA 3AC3A 2O8YA 5M06A 3TWJA 4FIFA 4UYNA 4Q5EA 4ACHA 2QOHA 3QUDA 3COHA 3PG1A 4G17A 4CV9A 2LC1A 3DFAA 3F7ZA 3TUBA 3L9PA 5AUYA 5AV2A 5BUIA 5IEVA 3MVJA 2OJ9A 3COIA 1DMZA 2RSVA 3AD6A 3ZFMA 2X8IA 1OL7A 2F7XE 3SXFA 2JC6A 2ZMCA 4OLIA 2OF2A 4XP3A 4C0TA 3UVQA 3POAA 3V6SA 3DZQA 1YWNA 4FKGA 4EOMA 4RSSA 3P9JA 4ANMA 4C4GA 4O7NA 5DNRA 4IVCA 4LGHA 3DLSA 3R2YA 3CE3A 1UU9A 1Y91A 1ZYCA 4GW8A 3ORTA 3SA0A 2WO6A 5AV3A 3ZTXA 5C8MA 2R3JA 3UO6A 4KD1A 3E7OA 5H8EA 1MQ4A 3HV6A 3SC1A 4BCNA 2W17A 2QOKA 4RIWB 4JR7A 3RK7A 3D7TB 3RBWA 2BZJA 2CPKE 5M56A 4JG8A 4O7SA 3OFMA 2E9VA 5DYJA 3PTGA 3O23A 2C47A 4ZTNA 2QOQA 3MTLA 4IXPA 4D2WA 2CGWA 3F5UA 4G3GA 5DR9A 2W4JA 2IZSA 4CMTA 2R9SA 4IX5A 4XG7A 5JFWA 5L6OA 4X2JA 2YCQA 2Z7LA 3SQQA 4DGGA 1Q8ZA 3N4VA 2WTVA 2YFXA 5HEZA 3IOKA 5G6VA 3DK7A 4D1ZA 2PWLA 3B2WA 3NYNA 3QL8A 3R02A 3V04A 5EDRA 3LFBA 4R1VA 2PUIA 5D10A 4RT7A 2W5BA 2WKMA 4RZWA 3TTIA 4DBNA 2XNMA 1Q3DA 3UJGA 3EQFA 5IH5A 5J1WA 3BGPA 3DKFA 1AGWA 3VBWA 4QMPA 5B2KA 4E4LA 4QMVA 4GIHA 4TXCA 5C27A 2UW9A 1K9AA 3CGOA 1H1PA 2R3OA 2PPQA 1WBVA 1FOTA 3FC2A 3JVRA 3V5JA 5D12A 4XH6A 4MXYA 3H0ZA 3O7LD 4QMQA 1YWVA 3DY7A 3RNIA 2RG5A 1URWA 2XB7A 3BI6A 3DOGA 3AT3A 2W05A 2ZB0A 2BILB 5EQEA 4GH2A 3MFTA 4F63A 4KUJA 1OIYA 5EHYA 4EQUA 4MQ1A 4N0SA 3C0IA 4GG5A 4FTLA 4O27B 3HV7A 3UC4A 4RPVA 3UG2A 3OY1A 3CQWA 3WIKA 5J5SA 2J0LA 2ZM1A 2QU5A 4QMZA 3OOMA 3RGFA 4EOKA 4AGWA 2UW6A 4K77A 4JQ8A 2UZTA 4JRNA 3R9NA 5HNBA 3F2RA 3KRWA 2HZIA 5DWRA 3P08A 4EK5A 1ND4A 2JBOA 3DDQA 4U3ZA 3ZM9A 3PIZA 4FV4A 3V8WA 4CFMA 3RWPA 1VZOA 3I1AA 4ASEA 4EH6A 4D9VA 2GNIA 2VWWA 3PXKA 2R5TA 3BHHA 5AP4A 2E9PA 3GVUA 3O7LB 5LMKC 1SVHA 5AFVA 2YZAA 3F69A 4Y5HA 4DYMA 2ACXA 2QR7A 2C0OA 2QOBA 3VBQA 5K4JA 5EQYA 4ZSLA 5M08A 2P2HA 3IW8A 5DOSA 3TNWA 2VV9A 3NUYA 5CVHA 4D2PA 3QTXA 4IJPA 2QODA 2EH0A 2X39A 2HK5A 1KE8A 4K6ZA 4YP8A 3JUHA 2XA4A 4O0UA 3G5DA 3H30A 4GYIA 2WTWA 2G9XA 4FUXA 5HZNA 2X4FA 3ZO4A 4BIBA 4DH5A 5B7VA 2BRNA 3Q9WA 4I22A 3NLBA 2WU6A 2YM8A 5J9LA 3FLWA 4FVRA 4IM2A 4KBCA 3ZOSA 4EOIA 1UWJA 3BRBA 1VEBA 4FSNA 4D2VA 4YBKA 1YOMA 4MEDA 5E8XA 3UQCA 2ERZE 4X3FC 1P14A 3HP5A 4RWIA 1WBPA 2X2MA 4C4IA 2HCKA 3E92A 4IEBA 4CCUA 4HVGA 5CANA 2HWPA 2A0CX 3D2KA 4QQCA 4BDBA 3HDNA 2BRMA 4F4PA 5TO8A 4JG7A 3R73A 4X6QC 5AX9A 1A06A 4L3LA 2WTKC 3ZBXA 3BGQA 5EI8A 1UA2A 2I6LA 4FTKA 3ZO3A 1QPDA 3PO8A 4DF3A 3E5AA 3QWKA 2C1AA 3EJ1A 4QTDA 4ZEGA 4FKOA 5ANGA 2GFCA 2OBJA 2OLCA 3CP9A 3PY0A 2ETRA 4RQVA 3HUCA 4HVIA 2BDWA 3NZ0A 3CD3A 2GSFA 4QMWA 3OY3A 4CMUA 4H3BA 2XMYA 2GDOA 5FBOA 4EQMA 4N57A 2QCSA 2Y9QA 3LCSA 5HE0A 4DH7A 4AT3A 5A4CA 2YCFA 1Q97A 2X7OA 2QG7A 3LMGA 5HU9A 3QX4A 4RIYA 2VWIA 3I81A 5E7RA 5FGKA 2BRHA 2WQMA 3HUEA 2VO7A 5EKNA 1J4LA 4LOQA 2IZTA 3OWJA 3D7TA 3UG1A 3VUHA 2I0VA 3FWQA 3SHEA 3ANQA 3VS2A 2QOLA 4DHFA 3QC9A 4NW5A 2WMXA 2IVTA 2X81A 4I5HA 1R0PA 4J53A 1BYGA 4UY9A 3U55A 4II5A 2UUEA 4U9AA 3UOKA 4OTHA 4AN9A 5M07A 2WMBA 2FEZA 4FKWA 4P2KA 5I5ZA 1WZYA 4H36A 3U4UA 3MBLA 2PIEA 1APME 3D5UA 5TT7A 2J90A 4W9XA 4KBAA 3ZH8A 4E5BA 5CYIA 5LMKA 4MWIA 2JFMA 3PPZA 3TN8A 2OO8X 5J9YA 3G0FA 4ERKA 2P55A 2VGOA 3EH9A 3BYMA 4A9YA 3O2MA 3F88A 3MN3A 3HZTA 4LGGA 3VUTA 2EVAA 4F9BA 1YHSA 3Q4ZA 3ATSA 2Y6OA 3BV3A 1LR4A 4QOXA 3FMKA 3IW7A 3JY0A 3AMYA 4EOJA 3LFDA 3HGKA 3MIAA 2OIDA 5CALA 3DNEA 4BKYA 1H1WA 2VGPA 4BCMA 1H1SA 3SAYA 4AS0A 3PVUA 4UWYA 4QMNA 2PZRA 4ZLYA 4DEIA 3SV0A 2B9HA 4LUDA 4JBQA 2ONLC 4RC2A 4BDAA 1ZYDA 3IECA 2NRUA 1DAYA 1DS5A 1YJ5C 4RJ5A 2VWXA 1Q5KA 2W5HA 3BHYA 3FM8A 5BNJA 1FMOE 4CFUA 2FUMA 2ITVA 3KRJA 3PSDA 5L4QA 2X7FA 4XOZA 4CFFA 4CVAA 1URCA 4P5QA 2B53A 2X0GA 4BTJA 2BHHA 2NO3A 1XHAA 2QO9A 2UW3A 4M67A 3DPKA 2WXVA 4OGRA 4AE9A 3IG7A 1DI9A 3AC1A 4F64A 2UVZA 5AP6A 4EOLA 3BQRA 4JDJA 4FOBA 1OIUA 4C7TA 2XKFA 4R7BA 4FSUA 3FHRA 4FZFB 4OBPA 1YXSA 3VQHA 3RPRA 4O7VA 4MF0A 3OS3A 1OM1A 3ZRMA 4EK8A 3PLSA 5IH6A 3P5KA 2XZSA 5AX3A 4D4SA 3FMJA 4OBQA 1V0PA 3AMBA 3LLTA 5JQ8A 4BDDA 3ACJA 3C4XA 5HG9A 3CBLA 1SMHA 3CR0A 3QZHA 4B7TA 3D94A 4C02A 2W1ZA 1V1KA 2PMIA 4IFCA 1Z9XA 2X8DA 1GY3A 5E8VA 5HLNA 5CAUA 1PYEA 3FZOA 3VO3A 4D1SA 3KULA 1BI8A 3NAYA 5FXRA 5I0BA 3KEXA 4YNOA 4TYGA 1KOAA 5JFXA 4AUAA 2F7EE 4LGDA 4U3YA 1H8FA 4PUZA 2BFXA 2PVHA 2IW6A 2VWZA 1YI4A 1E1VA 2UZEA 5GZ9A 5EOLA 1W0XC 4O0WA 3WYYA 2LAVA 1RQQA 4LYNA 1QPEA 5FXQA 3ZDUA 4F08A 3RAHA 2C5VA 2C6LA 3NNUA 3UZPA 2F49A 3FE3A 2VNYA 3O51A 4HYSA 4GFGA 4OAUC 3SW7A 4HGSA 2XNNA 2OH4A 3COMA 3HKOA 4G6OA 3S4QA 3P7CA 4W4XA 2W1FA 4W8DA 3UMZA 5IQCA 3AC2A 4XBRA 1H1RA 2JKKA 3MPTA 3RM7A 3QZFA 4F7LA 2C6DA 3FQSA 1K3NA 4WBOA 1OGUA 1ZOEA 3FDNA 2OXDA 3TI1A 3ZLXA 2BIYA 2XBAA 2UZLA 1V0BA 3LFQA 1B39A 3PXYA 4GJ3A 2SRCA 4FTAA 4TY1A 5HD4A 3DBDA 4CTBA 4O7TA 1OIQA 3JPVA 5E90A 4AU8A 3QBNA 2IG7A 2BFYA 3IDPA 5HG5A 3FI8A 2W1HA 3G0EA 4O0VA 1FGIA 3R1NA 3U9CA 4AZSA 4UMQA 4WNOA 4NK9A 4PNIA 5FG8A 3E8CA 3GFWA 3DJ6A 2ITZA 3A8WA 3TXOA 3FC1X 1KOBA 3MA3A 3I7CA 3MY0A 2G01A 3R01A 4AZEA 5KBRA 3HYHA 3QD3A 3LCKA 3QD0A 1O6LA 3AC5A 4AGCA 3M42A 3ZM4A 3PJ8A 4GG7A 3IW4A 2PSQA 4DITA 4FT0A 1ZZ2A 5IA2A 1NVRA 1WBNA 3R7UA 3LM0A 2UZVA 3G90X 3DB6A 1SVGA 3QKLA 4DA5A 1DI8A 4YO4A 3P7BA 4OTGA 4YZBA 3F61A 3E8DA 5KMJA 2JPEA 5AV4A 3NWWA 5CU4A 4TYHB 2PVYA 4GS6A 4HGLA 2WQBA 4IC8A 4GRBA 4QTEA 2ZDUA 2GCDA 2FVDA 5ANDA 4V04A 2ZOQA 3ANRA 5DR2A 2V55A 3II5A 1J4PA 2J5FA 1FVRA 3UQFA 3QXPA 3QCQA 4R3PA 1JOWB 2I0HA 3QQKA 3TNIA 3WOWA 2X7GA 1OZ1A 5BPYA 1U46A 4FKTA 4KA3A 1YOJA 2VX3A 2R3PA 5DLSA 3EZRA 4C34A 3ZRLA 4ZZNA 4NL0A 3DA6A 1XH7A 4IX6A 4DN5A 4S2ZA 3H9OA 3NUSA 4FEVA 4YZMA 3THBA 2R3HA 4M15A 5CEOA 4PTCA 4X3FB 3AMAA 4LOPA 3QKMA 4AW1A 2OFVA 2BHEA 3ROCA 3RZBA 1H28A 5FRIA 3CQEA 5IDNA 1OBGA 5FEEA 2AUHA 4A4LA 3ENMA 5JFSA 2V7OA 5LJJA 4QYYA 4YUQA 4MXOA 2B55A 2BR1A 3K3IA 4GVAA 5BMSA 4QRCA 5M51A 1Q24A 2UV2A 4YLLA 4KIQA 3QTZA 1TQMA 4QNAA 3ORXA 5GZAA 3CKXA 3QLGA 4FVQA 3FAAA 2GNFA 3ZMMA 3UBDA 3VA1A 4U81A 5HO6A 4L68A 4M12A 2W1DA 3WE8A 4IWQA 1XQZA 5CAOA 1TVOA 3QZGA 1RDQE 4BCOA 4XV9A 3G9NA 3LFFA 2XM9A 4C2VA 2XIXA 2C0IA 2Q0BA 3IO7A 4WRGA 3ZS5A 3IGOA 4BTFA 4EWHA 2XVDA 4P4CA 2F9GA 3NAXA 4FV2A 4Z16A 2YLEA 1TQIA 3R1SA 1MRUA 2YHVA 3LZBA 3EQGA 1UU8A 3OD6X 5EYDA 4MNEA 5ETCA 4UXLA 3EKKA 2YDJA 1PMEA 2R0UA 5EI6A 4DFZE 2C1BA 2FF4A 3SRVB 5AP0A 3Q2MA 5EW8A 2CJMA 5LVOA 4JX3A
chains in the Genus database with same CATH superfamily
3WZKA 3UP7A 3OC1A 4BDJA 4RFYA 3NRMA 4I5PA 4CG8A 3LFEA 1B38A 1H24A 4NCTC 4E20A 4A4XA 2CGUA 4ALVA 4BC6A 3SOCA 3S0OA 3LXKA 3SXRA 4BI1A 4QMTA 5T3QA 3RHXA 2UZUE 3IGGA 3OWKA 4BZDA 4CT2A 2XJ0A 4KSPA 5JEKA 3NUAA 3Q3BA 3PY1A 3DKOA 3W33A 4YBJA 4U40A 5DHSA 2E9UA 4PL3A 4GK3A 4EI4A 4YJOA 2XARA 3EFJA 5IF1A 2B52A 3RM6A 4G3EA 3VRZA 3FUPA 3EWHA 4H1MA 4XRLA 5FP6A 3PJCA 4FSYA 2R7IA 3CJFA 4BYJA 3SX9A 3RINA 3P7AA 4XG9A 4DEGA 2PE1A 3BX5A 3KVWA 3SG8A 4RJ4A 5JGAA 1XBAA 4YLJA 3W2QA 3LM5A 3DXNA 4UXQA 4APCA 2WNTA 1GNGA 3HRCA 1NT2A 4MBLA 1M7NA 4YPSA 3POOA 3QTUA 4S31A 1TZDA 2BCJA 3RTPA 2ETMA 4AZWA 4ENXA 5HLPA 4RVMA 2CLQA 5D7VA 3NSZA 5I4NA 2PVLA 4O7WA 4LQMA 2PY3A 2CNVA 1OECA 4ID7A 5E9EA 4WG5A 3QC4A 2W1GA 3A7GA 4MD7E 5BQ0A 4H3PA 1JKSA 4RQKA 1BKXA 5FEQA 5LVPA 3Q53A 5ICPA 4M84A 2R3QA 4AAAA 5IKWA 5DN3A 4G5JA 3MA6A 5KMLA 4TWNA 3RK5A 4B9DA 3VZDA 3DBEA 3L8VA 4BGQA 4QMXA 3E87A 5CASA 1JBPE 3RAIA 5EJGA 3G15A 5DE2A 1STCE 2ZM3A 2JBPA 2J51A 4YZDA 1O6KA 4JIVD 1SYKA 3EZVA 3W2OA 3FXWA 3UGCA 4O4DA 3M11A 3NYXA 3ALOA 4GFOA 1ZARA 4MQ2A 5AWMA 3UC3A 3NW6A 5M4IA 5IQAA 2YIXA 5ANIA 3PSBA 1Q8YA 4NM3A 3R8LA 4UMPA 4GJ2A 1YT5A 4O7ZA 4F1MA 4WNPA 4QMMA 4E5WA 3QTIA 2ZV8A 5EM7A 4NH1A 1K3QA 3P78A 4AZFA 3B8QA 1R3CA 3L8XA 2WZJA 4LFIA 4AE6A 5L2WA 5KUPA 3LHJA 5CLPA 2J0MB 2XNOA 4LI5A 4PTGA 3ORMA 3ZBFA 3NFFB 3L9NA 4FKIA 5IZFA 4M13A 5JGBA 5KMIA 3PPKA 1FHRA 4EOPA 3GCSA 3MFRA 4Z3VA 4NEUA 2PUPA 4F1TA 3D0EA 2A4LA 4O7RA 3ROYA 5A4QA 3WZUA 3HA6A 5I9UA 4IZAA 1JSVA 3L8PA 4YZ9A 1J7LA 3DDPA 3ZSIA 2YCRA 4LDTA 5DT0A 3PE2A 4OTFA 2GNLA 4S33A 4QP3A 5EK7A 4G6LA 1PY5A 3GB2A 4HGEA 5DPVA 5HESA 5K5NA 3BWFA 4E5AX 2R2PA 3O8UA 4YNEA 3SDJA 5AP1A 4RWLA 3UPZA 4GK2A 5FM2A 2YN8A 4EHGA 4YURA 4FTCA 3EL8A 3BYOA 2GHGA 5BX0A 3QQJA 5CI6A 1BMKA 5CZHA 4BCGA 3GU5A 3DFCB 2FA2A 2OWBA 4QYHA 4AWIA 2YIRA 3HLLA 4WO5A 3DQWA 4EZ3A 3K5VA 2R3FA 4JAIA 1X8BA 5B0XA 3W10A 4IM3A 1XMMA 5AV1A 5GJGA 2C4GA 4PPAA 4C4HA 3C4FA 4NM7A 4YLKA 3VBVA 2GQSA 4TWOA 4ANOA 4C4EA 2XK4A 2QVLA 2IVVA 2VO0A 2R3NA 3D2IA 2VWUA 3QA0A 4MHAA 4BJJB 4FZ7A 3R8MA 1J91A 3TZ8A 3LOKA 2OJJA 1F3MC 1GZNA 5LOHA 1UKIA 3I6WA 3OTVA 2YM6A 1MRVA 2P4IA 2V0DA 1XH6A 2XJ2A 3F2NA 4FTUA 4YPDA 3DJ5A 5IEYA 3R0TA 4EH3A 3V80A 3OXIA 4O6LA 4L43A 1REJA 3ORZA 4N70A 4XHKB 3UMWA 3W1FA 4Y8DA 1J7UA 4AT5A 3OUNB 2WMQA 4IZ5A 5E91A 4AT4A 3FL4A 3AKLA 5AIRA 4XV3A 5AP3A 1XWSA 1Q41A 4IX4A 4WD5A 4XP2A 1YWRA 2X8EA 1XBBA 3LW0A 3TZ7A 4TYJA 3V5LA 2I2BA 3ELJA 3ZU7A 5CAPA 4IAIA 4PMTA 4DY6A 1GIHA 4HJOA 4J8MA 1XH9A 2C30A 1OUYA 1Q4LA 3OXZA 3SOAA 2E2BA 3BKBA 4LV5A 3V7UA 1PMNA 3PFYA 1W2FA 2YIQA 2JIUA 4FV5A 2JQJA 4J99A 3EOCA 4BICA 3W8LA 3HMIA 3DBFA 4PDSA 4BBFA 2KB4A 3SGCA 4R78A 3P5JC 4BCKA 3LJ2A 3DGKA 5EM5A 2VTJA 2CSWA 5ITAA 3LFSA 2VX1A 3O96A 5J9ZA 1A48A 4D4RA 4ZS4A 3DXPA 2W9FB 3NNWA 1KE6A 4GVJA 2BALA 3Q96A 3NDMA 2CKEA 3TL8A 3ZLSA 1YRPA 2PTKA 3FJQE 4RVKA 1OKVA 1OKYA 2WAJA 5DHTA 4FA2A 2KB3A 3G9LX 5DBXA 5JZJA 1YJMA 2BRFA 4FGRA 3U4WA 4PPCA 1TQPA 2Z7RA 4HZSA 3C4ZA 3GCVA 4K2RA 4QP6A 4RJ8A 1NW1A 3KREA 4FJVA 4O7YA 3SG9A 4AXDA 2WIHA 1OPKA 4PNKA 3C13A 4BHNA 5JH6A 3KQ7A 1KSWA 2BONA 3UQGA 3S95A 3AT2A 1L3RE 3VS1A 4EHZA 2PK9A 5EDPA 5AAGA 4CLIA 1Y3IA 4F9WA 4PDPA 3MSSA 5CU3A 1I09A 1YDTE 3WIGA 1UKHA 4YZNA 1SZMA 1U59A 4C62A 1ZXEA 3BLRA 4G1WA 4HPTE 4AXEA 3V8PA 3T9TA 1LGQA 4I41A 2XCKA 1CDKA 2O5KA 3LKMA 3UDZA 4D9TA 1PXKA 3DT1A 4JVGA 4N4SA 3ORIA 3V01A 5L2IA 2PULA 4IIRA 4BRXA 1DM2A 4XJ0A 5IUIA 3QWJA 2JEDA 3BYUA 3IDCA 4JQ7A 2X2LA 3F3TA 3QHWA 4O22A 3QRIA 2YWVA 4ZZOA 3R21A 4LMUA 3ZYAA 1SVEA 3KA0A 3Q4CA 5IISA 1OI9A 3WZJA 2XH5A 3GU6A 4USEA 4MF1A 5DI1A 3PA4A 4FIIA 1FMKA 4O0SA 3UVRA 5CT7A 5EW9A 4BWKA 1PYXA 1FINA 2BZIB 3NX8A 3PIYA 4GEOA 2JKDA 1LEZA 4MH7A 1UNLA 3KRXA 3A7FA 4U80A 5I9ZA 3ATTA 1H0VA 1UNGA 2ZM4A 3BELA 3I5ZA 4B4LA 3UIUA 4JAJA 3QRKA 3EFLA 4FNYA 1JQHA 3GUBA 3OMVA 5AP7A 3GENA 2NPQA 2UZOA 2BMCA 4RRVA 2IZRA 4D4VA 1PXJA 5B2MA 5I9YA 4XG4A 3M2WA 4FTTA 1PXOA 3MFSA 3I0OA 3WF8A 4FV0A 3R9HA 4C3RA 4QYFA 3VONA 5EHOA 5CF4A 3ML1A 4FKVA 2ITYA 1S9JA 3B2TA 4L8MA 5IA4A 2YLFA 4KIPA 4C35A 5A6NA 5IQBA 3AT4A 4RIXA 5HD7A 5AUTA 2J4ZA 3BPRA 5ACKA 2R4BA 1YI6A 1MUOA 4PQNA 4JR3A 2QI8A 2IVUA 4FKPA 4O38A 3QQLA 3L1SA 2HENA 3VJOA 4H58A 2IO6A 3EMGA 4D5KA 3ZONA 4CFXA 4DGOA 4XRJA 4AOTA 5HTIA 4BDFA 5M4CA 1AQ1A 2JITA 4JQEA 5DH3A 4MX9A 3PWYA 5KHWA 1YHWA 1ZOGA 2C0TA 4O96A 3RCDA 2OJFE 3O8PA 2W9ZB 3Q5ZA 4MVFA 3FMLA 3OWLA 1G3NA 2JDOA 2OU7A 2YDIA 5D9HA 4WBBB 3SLSA 4LL5A 2QLQA 2A27A 4I94A 4ZLZA 1H07A 4RBLA 4BF2A 3O5AA 4JJRA 4DDIA 2PVNA 1P4FA 4U44A 5E50A 3PUFC 2BROA 4DG3E 2ZV9A 2YEXA 4IBMA 4BY9E 3NCZA 3VS4A 4U6RA 2J9MA 5BYYA 4D9UA 4EHVA 2JDRA 3C0HA 2R3LA 4MD8E 4AN2A 4L01A 2J0JA 3P4KA 3FV8A 4ZSGA 5KMKA 1M2RA 5AV0A 4CV8A 2YA9A 4FTOA 2F7ZE 3FY2A 3EQBA 3SRVA 3R1YA 2KTYA 3N51A 1FVTA 2OXXA 5JZNA 5DR6A 5HOAA 5L2TA 2XAOA 4S34A 5IEXA 2BAKA 1P4OA 2BRBA 2GFSA 2AYPA 4GT4A 5F94A 1Y6BA 4FIGA 2J0KA 4QP9A 2ITTA 3LIJA 5F95A 5TR6A 3EB0A 4YGAA 3HAVA 2UZNA 4J98A 5DA3A 4R5SA 4ASDA 3QKKA 3R30A 4OTRA 3FMEA 5AIKA 3W18A 5LMBA 4UZDA 4A9UA 3FYKX 4H3QA 1REKA 2FB8A 4HCUA 4E93A 5IQGA 4C3PA 4CD0A 2JD5A 4RIYB 3E93A 3HMOA 1YI3A 1HCLA 1OUKA 4OBOA 3UP2A 4AOJA 3PDTA 4IDTA 5DG5A 2CKQA 5K5XA 4GKIA 3R00A 5CF8A 5HQ0A 3CGFA 3EQHA 4G6NA 4BCJA 4EYJA 1QWTA 5FUTA 3W0NA 4O2PA 5HO7A 3I7BA 4UMRA 2Q5FA 2QKWB 4NKSA 5AR2A 4ZY6A 3QCYA 3ELVA 2QNJA 5BVNA 3SXSA 2ZVAA 4L52A 4UZHA 4XLVA 2OXYA 4E4MA 1XJDA 2G2FA 4YU2A 4KSQA 2YCSA 2VZ6A 4MXZA 5CQUA 4LL0A 5HNIX 4CLJA 1G88A 5EI2A 4HCVA 3R8VA 4CTCA 2XK9A 2HXQA 2C69A 2HOGA 4QYEA 3I79A 2OZOA 2ESMA 3FZRA 1UVRA 4C59A 4JX7A 4NJDA 4UWCA 1E9HA 4FV9A 3R7IA 2XP2A 3GU7A 3QRUA 1BX6A 2C3JA 5K0KA 3GC7A 3NW5A 3MGYA 4QTAA 4PP7A 1J7IA 3DZOA 1JKLA 4BTMA 3HL7A 2PZ5A 3MYGA 5DRBA 2BKZA 2C5XA 3TUCA 4ZY5A 3HAMA 4FSMA 4DGNA 4TRLA 4WNMA 3HRBA 5AAFA 4E6QA 4RX5A 1U5QA 4UEUA 4EH8A 5JN2A 4FZDB 1JAMA 3UOLA 4KS8A 4ERWA 3ULZA 3EQPA 3FMNA 3F3UA 2WTDA 3O8TA 2WPAA 4AW0A 4EC8A 3MESA 5BYZA 3B8RA 4ITIA 2WMWA 2FSLX 2VUWA 2WQNA 4Y5QA 2G1TA 3F7WA 4CKRA 2VWYA 4PX6A 4Z9LA 4GV1A 1IA8A 4XBUA 1M17A 3I60A 4MNFA 3BU5A 1ZMUA 2YJSA 2QD9A 4ZTSA 5BYLA 4ALWA 2XM8A 3QUPA 1M14A 4GK4A 4M3QA 1XH8A 4EK6A 3PPJA 1KE9A 5KKRC 3TUDA 3CY2A 2QVSE 1H0WA 3RPYA 4WA9A 1KWPA 4XYFA 4D2RA 3R71A 2I1MA 4ZSEA 4FBXA 4BGHA 3AGMA 1CKIA 4YJNA 3DNDA 4NT4A 5GIOE 3FKNA 1ZY5A 3NNVA 4XG2A 4BVUA 4DEAA 2EB2A 3CCNA 4LM5A 4RLLA 3TNQB 5C1QB 3LLAA 1JNKA 4IZYA 3KN6A 4JLCA 4MD9E 1CSNA 1VYWA 5DVRA 3TZMA 2QC6A 2XK3A 5D7AA 4A4YA 4IVBA 4YC8A 3EQDA 2IJMA 4YZCA 3DLZA 4L6QA 4FR4A 1FVVA 4DH1A 4NJ3A 3KXXA 1M7QA 1H27A 3JYAA 4CRLA 4EBVA 3TDWA 3TG1A 4P90A 1K3AA 3WILA 4DT8A 5CY3A 4ZTRA 3ETAA 1DD1A 5L8LA 2ETKA 4E6AA 3MB6A 4EGXA 4ZMEA 3HRFA 4QO9A 2HY81 1CKPA 2WTJA 2X0PA 4QEBA 2O63A 2PVMA 3GXLA 4YJTA 3VS0A 2W4KA 3QTRA 2PE0A 2OFUA 4QP1A 3PVBA 4NCTA 3WARA 2I2CA 2F57A 2BUJA 3MVHA 4FV3A 1R1WA 3WF7A 3AD5A 4FG9A 4FG8A 5IMEA 1YW2A 2YIWA 2WHBA 2PVFA 4M0YA 4FV7A 2GNHA 4PL5A 4DLJA 3PA5A 5HVJA 1CM8A 4L00A 2PUNA 5HBEA 4C58A 1W98A 2C6TA 2VWBA 2Z7QA 1YDSE 1J1BA 3KULB 1MZKA 4WIHA 5ANJA 2JIVA 3R28A 4X2KA 4PWNA 1ZLTA 3BHUA 1OVEA 5C01A 3UN0A 2WTCA 4FSRA 3U51A 3MV5A 3QZIA 5LCKA 3LE6A 2QQ7A 3PXZA 2CN8A 4YHFA 5HCZA 4CXAA 2GPHA 3O50A 2OIQA 2XIRA 2Y0AA 2QO7A 3BWJA 4YJQA 4IB1A 3LJ1A 5EJFA 4BDIA 4TYEA 3NIEA 5CX9A 5KNJA 4BCFA 3C7QA 4O6EA 2HAKA 2HZ0A 3DU8A 5DEYA 4JRVA 5JEBA 3QU0A 1RW8A 2W06A 1JSUA 4FKQA 3IS5A 2XUUA 4FE2A 2ITQA 4Y72A 5CF6A 3COKA 1YDRE 2ZFYA 2WU7A 3N4TA 3CPBA 4ZSJA 4HOKA 2XK8A 3BGZA 4Z7GA 5AA9A 5LCJA 2J7TA 4I3ZA 3O0GA 3KY2A 1JKKA 4F70A 4V24A 3L9MA 5A4LA 5BVOA 1U7FA 4KINA 3MJ1A 3UNJA 4G16A 4FVPA 3VW8A 5GJFA 3QTQA 1GZOA 5JEMA 4WOVA 5J7BA 2VN9A 2OZAB 1Q62A 4D58A 4F6SA 4F7JA 3V7WA 2Y7JA 1ZAOA 3F5GA 4FZAB 2PVKA 4G9CA 4DGMA 5ANEA 3DAJA 1FGKA 3MY5A 5AR8A 4EK3A 3OROA 4YO6A 3WI6A 4O91A 2X6DA 4FL3A 4GT5A 1HCKA 3BLAA 3F2AA 4QMSA 4MXXA 2W99B 3R7OA 5IH4A 4BDHA 4FSWA 4DEEA 3CXWA 4E8AA 1GAGA 3BQCA 4IVDA 3JY9A 3R83A 3C9WA 2WTKB 4UBAA 3QF9A 3BCEA 4O21A 4I0SA 2VU3A 1SM2A 2QURA 4EH9A 4JL9A 3KF4A 2QONA 4L3JA 3AKJA 2FYSA 1Q8UA 1OMWA 4ZJIA 4HNFA 2JLDA 3CIKA 2EXEA 5A6OA 2J0IA 4QQJA 1IR3A 2VTTA 4AW2A 4GT3A 4BCHA 4DTKA 2XNGA 4JXFA 2UW4A 4MBJA 4I20A 4MXCA 4B8MA 4C37A 3IQ7A 3NIZA 4U0IA 3FKOA 1ZYSA 4USDA 3C5UA 3V8MA 1YGSA 4MCVA 4PDYA 2RF9A 5L6PA 2H6DA 3PE1A 3V6RA 2JDSA 3UOJA 3VVHA 2BKKA 2RFSA 1QPJA 3NEWA 4IC7A 2BZKB 4ZTHA 4UN0C 4FTJA 1VJYA 3MVLA 3PJ3A 3Q2JA 4EJNA 5JQ5A 3W16A 3U9NA 2EU9A 2RKUA 4BN1A 3GNIB 5E8WA 3KL8A 1AD5A 5CI7A 4AOIA 2YITA 3NCGA 1FPUA 4NZWB 5DT4A 5EH0A 4IWDA 4G3DA 3KB7A 3V5QA 5JT2A 4U45A 5DHJA 2C6EA 2WGJA 3KK9A 3MTFA 4FKJA 4HYHA 4FSZA 5E4HA 1Q8TA 1H08A 3EFWA 3KVXA 5J8IA 4EH4A 1S9IA 4HYIA 5CXHA 3DBCA 3F82A 4D28A 4ASZA 4BB4A 4B0GA 3U6IA 1IASA 3OUNA 4IW0A 3FBVA 3RP9A 4FV6A 3FY0A 3T3UA 3GC8A 5HORA 4P5ZA 2XALA 5HLWA 3WF5A 4DCAA 4KRCA 4FOCA 3VHEA 4D2TA 1UU7A 4K8AA 2B7AA 3LQ8A 4BFMA 1WVYA 4FL1A 2Z02A 5KZIA 5F9EA 4Q2AA 3A7HA 1QCFA 4RA5A 3EN9A 5ACBC 5ETFA 3UODA 5IU2A 5J79A 4R1YA 1ZOHA 3E7VA 3ELSA 4ANLA 2CKPA 3P86A 2CMWA 3HVCA 4U41A 5K4IA 4GKHA 3TT0A 1NVQA 2JDVA 5DT3A 1P2AA 5A46A 2XXSA 3GC0A 4FG7A 4FT9A 4E7WA 4X3FA 5AR5A 4F0FA 2YAAA 4JBOA 3QGYA 4XG8A 2UZWE 3HEGA 1IRKA 1YOLA 5KKRB 5AA8A 4YTCA 2QU6A 4USFA 3FQEA 3H4JA 3JR1A 4FEQA 3TNHA 4BBMA 3W8QA 1G6GA 2HZ4A 4CQEA 2CCHA 3OVVA 4FIHA 2A2AA 3DTWA 4JDHA 3QAME 4ZZMA 3S2PA 3KRLA 4ZY4A 5H3QA 4XS2A 4AF3A 1XR1A 3QD2B 4ZTQA 3RCJA 3ZCLA 4ASXA 2XKCA 2UW0A 5EOBA 5CEIA 3ZZWA 4O82A 4E4NA 4UMUA 3KF7A 3MH0A 4FYNA 4J95A 4FNWA 4L46A 2RGPA 4ANNA 3RALA 1MK2A 3DS6A 5I9XA 3GQLA 4EYMA 5EG3A 4IZ7A 3D5WA 3ZFXA 3FZPA 4G9RA 4ANSA 3Q9ZA 3RPVA 3Q4UA 4M0ZA 4F0IA 4X2NA 2BZHB 2OI4X 5HIDA 3Q5IA 5IQEA 4U8ZA 3HX4A 4A9TA 2GTNA 4QD6A 3U54A 3TACA 4H05A 3QCSA 4UV0A 4FMQA 2RFNA 5AUWA 3TV6A 2VNWA 2O0UA 4DFLA 4DFBA 3PZHA 2FSOX 2HIWA 2CSNA 4OW8A 3DK3A 3VN9A 4DFYA 5CNNA 4YJPA 2PZYA 3ET7A 4M68A 2F4JA 3CQUA 4O4FA 4S30A 1IEPA 4PMMA 5FTOA 3T3VA 3W2SA 3CKWA 3AD4A 4I0TA 5JSMA 1W84A 5LQFA 3UOHA 2WELA 4GUEA 4O2ZA 5AR3A 3NR9A 4QTCA 3IONA 3PSCA 3Q9XA 3UVPA 4DCEA 2Z7SA 2VTNA 4RIOA 2I1WA 4HZRA 1WAKA 3VF8A 4ZSAA 3F5PA 1K3JA 4DTAA 1IA9A 2NNWB 1BUHA 4LG4A 5EKOA 4QMOA 1XBCA 3NPCA 3CTQA 2XK7A 3EL7A 3GU4A 2WMRA 3PJ2A 2CHLA 4FKRA 4RJ6A 5LVMA 4FODA 5EYCA 5C8KA 4QP2A 2XCHA 3VBYA 3R7YA 2VTRA 1YHVA 3H0YA 4M69B 5T68A 5CSWA 3UDTA 4BL1A 3R9RA 4C33A 4JDIA 3EYGA 1VR2A 2WMSA 4E4XA 5IUGA 5C4KA 5HCXA 1ST4A 1YQJA 2RG6A 2VTLA 3JXWA 4I23A 4RC3A 5DHUA 2QOIA 5CEQA 4EKLA 4DHZA 4OT5A 1WBWA 2QHNA 3V5TA 4ONAA 3E8EA 4ZJJA 4ALUA 2WMVA 3UNKA 1W7HA 3QA8A 4IAAA 4M66A 1ZZLA 3ORLA 1J3HA 1ERKA 4XX9A 2QV7A 4X21A 3VA4A 4KUJA 4FEWA 3A4OX 2X2KA 4W4VA 5K3YA 3ODZX 2R3RA 1PXIA 3OOGA 4EH5A 3VPYA 3CSVA 3E64A 5F1ZA 4CGAA 5K9IA 3OHTA 3R9OA 3REPA 4HVHA 5KMNA 4NUSA 4OTWA 4YTHA 5GJDA 4FV8A 1SUWA 5FXSA 1LUFA 1Q3WA 1OKWA 1T45A 1NA7A 3NNXA 3HNGA 3PFQA 1WFCA 2GNGA 3ORNA 5DFPA 3VULA 3LXNA 2Y6MA 2P33A 4LV8A 3KIOC 5HIEA 2XRUA 2KULA 4ZLOA 4IAKA 2WMAA 4FSTA 4OUCA 3AXWA 3SVVA 3UZRA 1NVSA 2V7AA 2Z8CA 4EJQA 4G2SA 3GI3A 2VWVA 5HVKA 2IW8A 3R1QA 3D9VA 3ZUVA 3KK8A 4MBIA 5DJOA 2XYUA 3PVGA 2YABA 4QDEA 4AG8A 4BI2A 4ZTMA 1FHQA 2UVYA 3QQFA 2FH9A 1ZWSA 2E9NA 5CU2A 2C3KA 3UTOA 1J4QA 3D4QA 4G34A 4Z7HA 2I0EA 4MXAA 4MAOA 3AGLA 3VRYA 3ACKA 1R21A 1U7FB 2IEWA 2OIBA 2VO6A 5AUVA 5KO1A 2YAKA 1WVXA 5L2SA 4ORKA 5CVGA 1UU3A 4PRJA 4RLKA 5CSHA 3R7EA 2JKOA 2R64A 3UO4A 2H34A 3C4CA 5FBNC 3RAWA 4AACA 4C8BA 4J8NA 4BHZA 4BDEA 5IQIA 3KXZA 2OF4A 3ZXZA 3LCTA 1NY3A 4R9PA 1PHKA 2XRWA 5HHWA 4M7IA 4ZJVA 4V0GB 4XV2A 2DYLA 1KHUA 4XEYA 2C6MA 3KN5A 4W9WA 3POZA 3K3JA 4U7ZA 4WSQA 5EM6A 2C3IB 3V5WA 4CNHA 1W82A 2XIKA 3KXHA 4X7QA 2XANA 4R77A 3OCSA 3HX1A 2HZNA 5LMAA 2BTRA 1UHTA 4U79A 2HW6A 4EK4A 3K54A 1R39A 3LQ5A 5TF9A 2OJIA 3CC6A 4GFMA 4OTQA 2Y8OA 4M69A 3WYXA 5HI2A 3FZSA 4ZK5A 1Q8WA 3FI4A 1WCCA 1OITA 2GNJA 5KMOA 1GJOA 3R04A 4LOOA 3L8SA 3NW7A 4W8EA 4YTFA 4EEVA 2VTHA 4KS7A 5IDPA 2UW8A 2XT9B 3FZ1A 4LUEA 5HX8A 1IAJA 4BCPA 1YVJA 1UV5A 3TJDA 3V8SA 2W7XA 4TWPA 4XOYA 4D4YA 3DKGA 5I3RA 2PHKA 2XNPA 3K5UA 3LMIA 3LFAA 2C6IA 3GC9A 4FUYA 4C38A 3GOKA 1JKTA 4I5MA 3VUGA 4KKEA 4RVTA 2OW3A 4OAVB 4PTEA 3ZO1A 2XKEA 4G3CA 5AADA 2AC5A 4IMYA 4EC9A 3DJ7A 3K2LA 3MH3A 2QKRA 3W0MA 4IX3A 4WG4A 3V8RA 3NUPA 3IK3A 3QGWA 5K0XA 5HBHA 4PMSA 3I4BA 4ACGA 4UB7A 1QMZA 4YJSA 5IA0A 1OPJA 4ZOGA 4NTSA 2J5EA 2C5OA 2DUVA 2ERKA 4UX9A 4DC2A 4FX3A 3LAUA 2BAJA 5EW3A 4JMQA 3Q32A 3ZC5A 3FQHA 4I1ZA 3RPSA 5E8UA 2H9VA 5CSXA 4FC0A 1GZ8A 4E26A 3V5PA 3TTJA 4GIIA 1VLRA 4AZTA 5L6WL 3I6UA 4KAOA 5AUXA 4ANQA 3CPCA 4X2GA 5EYMA 2AFFA 5A4EA 4FSQA 1DAWA 1OL2A 2F2UA 2DWBA 4UYAA 3QCXA 3RK9A 4I24A 4RWJA 1TKIA 4IAYA 5DHRA 4YC6A 2X1NA 3R8PA 3NMUF 4P7EA 5KE0A 3W32A 1LEWA 3QX2A 4WSYA 3VS7A 4YR8A 1Y6AA 5HNGA 5BVWA 2OGVA 3DK6A 2E9OA 2X6EA 2WOUA 1QU5A 2BRGA 2O2UA 3Q9YA 3EKNA 3UIXA 4AX8A 4JONA 2GS7A 4FK3A 2C6OA 2ITUA 4R3RA 2AEGA 3G2FA 4WNKA 5CSVA 3ZLYA 5AR4A 4JS8A 4RJ3A 3OEFX 3TDVA 1WVWA 2V5QA 3F3ZA 4A0EA 2QOOA 3CEKA 3R2BA 4L44A 1J4OA 3FMDA 4KBKA 5M4FA 3JVSA 1UNHA 5E1EA 2BDJA 2JKQA 2PZIA 4CT1A 3D14A 4RX9A 3MY1A 2O3PA 1RE8A 4QPAA 5C4LA 5C8NA 2CKOA 4W4YA 3W0RA 2V22A 2B1PA 3CY3A 3PUPA 5EFQA 1ZOQA 1CTPE 2ITOA 3VS3A 4XLIA 2PMOX 4E3CA 2A0TA 1I44A 5I9VA 4OT6A 4HCTA 3H3CA 1KE7A 4IAFA 5L2QA