3I6UA

Structure and activation mechanism of the chk2 dna-damage checkpoint kinase
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
413
structure length
390
Chain Sequence
TPAPWARLWALQDGFANLECVNDNYWFGRDKSCEYCFDEPLLKRTDKYRTYSKKHFRIFREVGPKNSYIAYIEDHSGNGTFVNTELVGKGKRRPLNNNSEIALSLSRNKVFVFFDLTVDDQSVYPKALRDEYIMSKTLGSGACGEVKLAFERKTCKKVAIRIISKRKFAIGLNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILGPTYLAPEVLVAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase Chk2
publication title Structure and activation mechanism of the CHK2 DNA damage checkpoint kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 107
structure length 390
sequence length 413
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00498 FHA FHA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3i6uA03
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 3i6uA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3i6uA02
4UB7A 3FI4A 2EU9A 4XG9A 5DE2A 3I0OA 4HYUA 2F4JA 3MH3A 2VX0A 2H6DA 2VO7A 5DR6A 2BRBA 3NYXA 3E8CA 3GC7A 4FKTA 4BCGA 5I9UA 3VO3A 3V51A 1W8CA 4NCTA 3HRFA 1V0BA 4RFMA 3TV6A 1IEPA 3QTRA 4X2NA 2RFDA 1OPJA 3WF5A 4IX4A 5GZAA 4DTKA 5HOAA 3JVSA 4H05A 5JFXA 4IAYA 3Q9XA 2W1GA 4B0GA 3S3IA 2J2IB 3L8PA 4WG4A 4FBXA 1J91A 3Q53A 4PF4A 3VQUA 4CRLA 3U6HA 4GJ2A 3Q4CA 2BILB 3N9XA 2ITZA 3PWYA 5FTQA 5FEQA 3EFKA 4FKUA 4UALA 1LR4A 4BCHA 2YZLA 4O6EA 1M2RA 4CFVA 4QRCA 4ANQA 4A7CA 2I0VA 2C47A 4IFGA 3R8UA 3PXRA 3C5UA 4FV2A 2FSTX 4PQNA 2X2KA 3OY3A 2PWLA 4QPMA 2UZTA 3LJ1A 3GP0A 3HA8A 1WBOA 2QQ7A 3P08A 1M52A 1KE7A 1YOJA 4M69A 1WVYA 4MXCA 2A1AB 4JAJA 3R8ZA 5FEDA 4EOOA 3PA3A 4FV0A 5I3OA 2BZIB 4OTPA 5HX8A 3CR0A 4BDBA 1PKGA 4IZ7A 2BRGA 5LCKA 3WZJA 1TVOA 4ALWA 4ZTMA 3OWKA 3GC9A 5AUWA 4C33A 5M07A 4FIJA 4QMQA 2UZDA 4AZEA 4GK4A 1LGQA 4CV8A 4MBJA 4MQ2A 4FKLA 4R6VA 4R7IA 3ZUUA 1TQPA 3BBWA 4C59A 1BYGA 2VTOA 2CMWA 3NYOA 3QHWA 2C30A 4EOQA 3LFSA 1XBAA 2PE2A 4RX5A 3QD0A 4H1JA 3FYJX 2ITTA 3GU5A 2GQGA 4BIEA 4OLIA 3MSSA 4F6SA 1TKIA 2VWXA 3ZC6A 3R7VA 3OP5A 1QPEA 3FMEA 4J71A 4QO9A 4YNEA 2G2HA 1PXMA 1ZOGA 3BKBA 4BDHA 4V0GB 4FC0A 2OJFE 4BKZA 5EHYA 3QTSA 4FSTA 4D55A 5C03A 3AGLA 3OEFX 4C4HA 5AUZA 2X2LA 3EQHA 2WQOA 4PMSA 5HLPA 5IISA 3POAA 1OPLA 5CVGA 4CYJA 5AV4A 1O6YA 3AD4A 1TQMA 3DA6A 3HP2A 3MY5A 3P23A 4FTCA 4G9RA 3WARA 3TUDA 4R77A 3PY3A 5JFSA 2QI8A 4FZFB 3TIYA 1Q5KA 2HIWA 2PVMA 2W99B 4QMZA 4FOBA 4II5A 4Y95A 3RJCA 4BCPA 2FSOX 4DGMA 3N4TA 2W4JA 4CFFA 2FSLX 3UTOA 4OT6A 2QODA 5CU2A 4DH3A 2ERKA 3PVBA 1WFCA 1YI3A 1LUFA 3RK5A 5LMBA 3R7YA 3JXWA 3NWWA 2PMLX 3NCGA 3BU6A 5CZIA 2CGVA 2LAVA 2VTTA 3OUKA 3UQFA 4RFYA 3DBQA 4IM2A 3QQLA 3TI1A 1KSWA 5AR5A 3A7JA 3ZLXA 5D10A 3AC4A 3ZSHA 4Y5HA 1M2QA 2A0TA 3BYOA 2DUVA 4E93A 1SVGA 3CPCA 5GJDA 3V6RA 3V8SA 4OTGA 4M0ZA 2WFYA 3QRKA 3BLRA 4TRLA 4BDEA 4M67A 5T3QA 4JOAA 3Q6WA 3QCXA 1OB3A 1W82A 4K2RA 4L3JA 3SW4A 3HLLA 3VAPA 3G5DA 4IACA 4ZTRA 2ETRA 1YDSE 5L3AA 4HZSA 4O7SA 4FV7A 5AM6A 3IW7A 3ORNA 4YPDA 2ITWA 1A9UA 3V5TA 3MV5A 2OFUA 3QGYA 3HUEA 3GU6A 4WNPA 3MY1A 1OBDA 3MN3A 4FKVA 5FG8A 1OKZA 3AMYA 1CDKA 2ZJWA 4XRJA 1FGKA 3QTXA 4HCVA 5FUTA 3CQEA 3TN8A 2BFYA 1CKIA 2C0OA 2V55A 2HZ0A 4WIHA 1JSTA 2XIKA 4MD7E 4FV5A 5F20A 4TNBA 3LFNA 4D9UA 3WBLA 4O7ZA 4ZS0A 4CG9A 3FHIA 4IE9A 3GC0A 3OT3A 1MP8A 2HXQA 3C50A 3WF9A 3O23A 2Y9QA 3QQKA 4W9WA 4WNKA 3QA0A 4BDCA 3D14A 2QOQA 2Y7JA 1CKJA 3H0ZA 4FT0A 4QMNA 3GOPA 3ZTXA 5DT3A 3VS2A 5FQDC 5A4LA 5IDPA 3Q96A 4JDHA 4YNOA 1YHSA 3G9LX 3KN5A 3SOAA 4MKCA 4EQUA 1JBPE 3P7BA 3BRBA 3KB7A 3U51A 3AC2A 1BL6A 2A4LA 5IQEA 2WTKB 5EYCA 4EWQA 2JDRA 5DNRA 1SZMA 3ZXZA 5F4NA 4JXFA 4XOYA 4N57A 2UVYA 3D15A 4E5AX 4ZSAA 3DDPA 3UIMA 3GI3A 5T68A 3BYVA 4M12A 4RIYB 2W3OA 1OL7A 3PJ3A 5E8VA 5EKOA 2A27A 3PE1A 3W33A 3IO7A 3Q9YA 5IEXA 3LJ0A 1PMEA 3FPMA 1YQJA 3QLGA 4PMTA 2HELA 3PXZA 1Y57A 4HOKA 4XHKB 5A4TA 2R4BA 4OGRA 5GINE 4APCA 3MH1A 2JKQA 2GHLA 5HLWA 5D7VA 2UW3A 3BHYA 1B6CB 2IWIA 3SX9A 2PY3A 4X0MA 3AC3A 4PP9A 1OPKA 4TYGA 4YGAA 4IVAA 1SYKA 3C4XA 3K54A 3IOKA 5AWMA 1SM2A 5HNBA 2ZV9A 4CLJA 2WMXA 4LFIA 2CSNA 4YJVA 2O5KA 4FOCA 4IJPA 4GT3A 5FM3A 3P78A 4XBRA 3V8TA 4NT4A 2F7ZE 3FZSA 3ELJA 4FK3A 3OWPA 2PZIA 3VJNA 4F65A 3AT3A 1FVTA 3R01A 4BF2A 5K0KA 2YIXA 2R3PA 2ERZE 3EN5A 4X2KA 5HBEA 2V7AA 2VTIA 3FMLA 2F7EE 3BE9A 5FWKK 5AR7A 5IUIA 5C27A 2PYWA 1FBNA 4O38A 5AP0A 2W0JA 4MCVA 3PYYA 2E9PA 4E6QA 5ANIA 3AD5A 4H3QA 1XWSA 3VS1A 3BWFA 3QRUA 4YBKA 5EI8A 1UNHA 3R21A 4F7SA 4RG0A 5AP3A 3ORIA 1PXOA 3OTUA 3WZEA 2UZVA 4XLIA 3DDQA 4CCBA 2QO7A 2FH9A 3FMHA 3WZUA 2YFXA 3QGWA 4Q5HA 1URCA 2WMBA 5H8EA 3SQQA 3AGMA 4A4OA 2JC6A 3ERKA 2EB2A 3TJDA 3NUYA 3I0QA 3K5VA 4HCUA 2VO0A 2BZKB 5E92A 4A0EA 4FEVA 2QKWB 2P33A 3K3JA 4S32A 5BYZA 3TNIA 4AA0A 4DEIA 4C38A 3CGFA 2GTMA 5DIAA 4AT4A 4H39A 4D9VA 4J1RA 3P86A 2PULA 5TR6A 4CXAA 3EIDA 4IC7A 2V5QA 3KK8A 4IVBA 5AR3A 3Q9ZA 4FKRA 5A3XA 5TOZA 1YJ5C 3K2LA 4GS6A 3FEGA 4DT9A 4E8AA 2UZNA 4RIOA 5HNGA 3AMBA 5BUJA 5GJFA 1PYXA 3LCTA 3DJ5A 4KKHA 3C9WA 3L9NA 4LV5A 2FSMX 3AQVA 4PMMA 4QTBA 1PKDA 2VWVA 1M2PA 5CQUA 2B4SB 2WMWA 3GCPA 2I0EA 5BVWA 2C3KA 3MESA 3U54A 1U5QA 5CALA 4AQCA 5AAEA 4TWOA 3K3IA 4QMXA 1WVWA 4CZTA 5AV2A 4WO5A 4H3BA 2O63A 1Q8UA 3ZXTA 3DXNA 3VUTA 2HENA 5I9XA 2C1BA 2IZRA 3GCQA 4LOOA 4O1PA 4AE9A 4E5BA 5E1EA 4KINA 4KUJA 4UYNA 3G0FA 5H8BA 4C3PA 4G3EA 2QU5A 3LCDA 3IPHA 5CU6A 1JQHA 2G15A 5KZIA 1XO2B 3CXWA 4W8EA 2J5FA 3ATSA 1PMUA 3COIA 4QOXA 3RPRA 2O8YA 4OBPA 4ITJA 4WSYA 4QYGA 2QR8A 4EZ3A 3DTWA 3KCKA 1Y6BA 1X8BA 5M08A 3M42A 3G6GA 2C6IA 2QOBA 3VJOA 3VUKA 3FLZA 5LVLA 5C4KA 3CY2A 5ETCA 5HCXA 5HU9A 3EZRA 4D2RA 3NRMA 3F7ZA 3KCFA 3MY0A 3RBWA 3HX1A 1WBVA 2XK6A 4DA5A 3D5XA 4FEWA 3D9VA 3IECA 3L9MA 5CF8A 2VUWA 4NEUA 4BC6A 4FTMA 3SG9A 3DCVA 3O71A 3DFCB 4N4SA 4QMUA 4CG8A 3R63A 1S9IA 4RWIA 1XQZA 3O50A 4M8TA 2VX1A 5FDPA 2HZNA 1J4LA 2YIQA 3FLSA 4KA3A 4EGXA 3BELA 3I7CA 3LZBA 3KRRA 3QTQA 4YSMA 4J53A 4C3FA 1J4QA 3OG7A 2V0DA 3NLBA 4YZNA 3U4WA 4MHAA 4XG7A 4AGWA 2WD1A 1T46A 3CPBA 5ANDA 5EM6A 2PE1A 3KA0A 1JSVA 4ZK5A 4YJNA 4EH7A 3KRWA 4UMPA 2ZMDA 5EQEA 3NUXA 4FF8A 5JH6A 4BDIA 3LFFA 2PPQA 3WE8A 4KSQA 3P9JA 5B2LA 4ANSA 2CNUA 2YM5A 1ND4A 3QRIA 4XV3A 3RKBA 3QD2B 1GNGA 2XEZA 2GNIA 1IRKA 2XK9A 3R1NA 2C6MA 2P4IA 5JRSA 4XG4A 1OUYA 3FZOA 5BVFA 3BEGA 4LRKA 2W5HA 2Q0NA 3FMNA 3OZ6A 2QONA 1BI8A 4R3RA 3IDBA 4QP2A 3ZMMA 1G5SA 2BAQA 2CLXA 4ZJJA 3S95A 3CY3A 5EOBA 4AZFA 4A9UA 3ORTA 2YM3A 4QMSA 4XOZA 2F49A 3BV2A 4QT1A 3O2MA 4BVUA 1FVVA 1UA2A 2BIKB 3QTUA 4LL5A 3LQ8A 4X3FA 5EDQA 5EI6A 3ZBXA 4AW0A 4C7TA 4GT5A 3KEXA 4L00A 1XH9A 4MXXA 5K0XA 2PVLA 3FXZA 3S00A 5HO6A 5CEMA 3A8XA 2X9FA 3QQFA 4OR5A 1H4LA 2J0JA 1QPDA 4C58A 4UX9A 2HY81 3ROCA 1K2MA 1UU3A 3MJ2A 4FA2A 2Z2WA 1XH7A 4LMNA 4W4YA 2W1CA 3M2WA 4YTFA 5IH4A 2X81A 5J1VA 2WZJA 3KRLA 3NX8A 2NRYA 3OROA 3WIKA 3UOTA 3ANQA 4KNBA 5C4LA 4U81A 3TUBA 3D2IA 5A46A 3CCNA 3NAXA 2B54A 4FKIA 4RMZA 3GC8A 3T3VA 4BBFA 4IWDA 2ITYA 2QOOA 1T45A 4CRSA 4I94A 1H01A 1HOWA 2WEVA 1P4FA 1YKRA 3LAUA 3QZFA 1YVJA 2OJJA 3BLHA 3MA6A 5H3QA 2OLCA 5BYLA 4CLIA 5HESA 4C4IA 4ZEGA 4JDKA 5FXRA 1J4OA 2OZAA 2XBJA 4MBIA 3NUSA 4RIWA 2XIRA 2ONLC 2ZV2A 3MTLA 3PP1A 5CVFA 3F2RA 5FEEA 3VUHA 4DC2A 4FVQA 1QPJA 2WU7A 2W1IA 4XUFA 4Z9LA 2R3KA 4IJ9A 3NS9A 5D11A 3E8NA 5CEOA 3KF7A 5CF4A 3VHEA 3R22A 4C34A 3C4WA 3OD6X 2VGPA 1Q62A 3PXYA 4BZOA 2BAJA 4QQJA 4FIEA 2IZTA 2GU8A 2XK8A 3G51A 4J95A 3SXSA 3VVHA 2V62A 4KS8A 4QMMA 4XV1A 3B2WA 4F63A 1K3AA 2WQMA 4PPBA 2JPEA 4YMJA 2JFMA 3CP9A 5EH0A 1ZWSA 3HV5A 4GH2A 4MD9E 2XM9A 2X0GA 3RHKA 3CQWA 4CCUA 3CBLA 4H58A 3EKKA 4EOMA 3ZM9A 2OJ9A 3EN6A 3NNWA 3HMIA 4EK5A 4E1ZA 4DTBA 2JDOA 2OH4A 3KRXA 1P2AA 4DTAA 1WCCA 5ANJA 4JT3A 5JSMA 3LE6A 4O0VA 5AUTA 4EJ7A 3MI9A 5KMOA 3W2SA 2YCQA 5AP4A 2C69A 3OVVA 3OCGA 3U6IA 2YWPA 2AC5A 4D1SA 3BWJA 2OK1A 2R7BA 2C6EA 4ZTHA 3MGYA 5CU3A 5KZ0A 4CTCA 4I4FA 3PG3A 2E9OA 5ANOA 1F3MC 4DLIA 3UIBA 2QNJA 4XG3A 2G2IA 3VS5A 4L46A 4BTFA 2UZEA 4QMWA 4AGCA 2QC6A 4F64A 3ORMA 5HIBA 4YR8A 1J3HA 4N6ZA 5K4IA 3VS0A 3ORKA 4R7BA 2JDVA 4B8LA 2YM7A 4DG3E 4L9IA 4L01A 5HG7A 3UC3A 1KE9A 2I0YA 3CIKA 3IW4A 4IBMA 2JLDA 3DOGA 5AUUA 4ZOGA 3W2OA 2WPAA 5AUYA 3KK9A 5CXHA 1JNKA 4YJPA 4OW8A 4YJTA 3NR9A 3PE2A 2I1MA 2YJRA 3ZEPA 5IQAA 5JQ5A 3FC1X 2XM8A 3DLZA 4KWPA 4ZSEA 2C5NA 3PXKA 3EN9A 4LM5A 2PU8A 5TO8A 1GZKA 1MRUA 2B52A 3BLQA 4C36A 4LYNA 5DT0A 4U41A 3PFQA 4KKEA 4WUAA 3IW5A 2WTIA 3PSCA 5KUPA 3Q04A 2OICA 3QKKA 4M0YA 4R3PA 4XRLA 3ZONA 2W9ZB 2VO6A 3A61A 3RZBA 3VN9A 5LJJA 2G2FA 5LQFA 1K9AA 3Q4ZA 4GV1A 3OF0A 3RK9A 2YCSA 5HIDA 4TNDA 4DBNA 3FM8A 5M56A 5CANA 2XK7A 4RC4A 3DBFA 3EQGA 3Q4TA 4NFMA 4UXLA 4QPAA 1RQQA 4BICA 3FDNA 3S2PA 5KNJA 4KKGA 4WHZA 4PX6A 4W4XA 5A6OA 2B55A 4AW1A 2XRWA 1OZ1A 2ITOA 3QLFA 3LM0A 4TYIA 4O82A 3FWQA 3RPVA 2WO6A 2G01A 3KMWA 5KCVA 2HWOA 3O7LB 2QOHA 3HAMA 1WAKA 2XNOA 4FG7A 4EK6A 5HX6A 1H27A 2WQBA 3HKOA 2IG7A 3RINA 4EHVA 1PY5A 4IANA 2NP8A 1QU5A 3R9RA 4BN1A 3P1AA 2CGXA 2ITQA 4L7SA 5EYKA 4MXAA 4RWLA 2G9XA 2EXEA 4I24A 2NPQA 2UZLA 5HG9A 5L8LA 5D12A 4ZLOA 5IDNA 1L8TA 4O7RA 3EQDA 5AFVA 1QCFA 3QX2A 4FNZA 3ROYA 4OTIA 3ZCLA 3VWAA 4AZSA 5AR4A 3R73A 2WELA 3SV0A 3MVJA 1YXTA 5L2IA 2JBOA 3BHHA 1H28A 3FV8A 2XP2A 3QC9A 4HVSA 5IPJA 1JLUE 3JPVA 4YJQA 5HG5A 3POZA 4QYFA 4DGLC 2E9UA 3HUCA 3UNNA 4BI2A 4HNIA 4XP2A 5J5SA 3FL5A 4DH1A 5H9BA 5IQFA 5IQHA 1UWJA 2XIXA 4JBPA 5JQ8A 3LPBA 4IEBA 3HNGA 4EYJA 3NUPA 3ZDUA 4JNWA 4ARKA 2GSFA 4Z7HA 3WF8A 2WMSA 4YTHA 4K8AA 4QTEA 3G0EA 3A7HA 3OXTA 4AOIA 4U7ZA 4ASXA 4EH2A 2WTCA 5L2SA 3GQSA 2ESMA 2FEZA 2H8HA 4AG8A 3KVXA 4QQTA 3ZDIA 3FLNC 3HZTA 4USDA 4UWYA 4EK4A 4PTGA 4FV6A 4F9WA 4OTDA 2CGWA 4X6RA 2VWBA 4DH8A 3ODYX 4DFUA 3RNYA 2JKKA 2JKOA 4FSNA 3NEWA 2RG6A 4C3RA 5EW3A 3FQEA 3ZFMA 4F6WA 5DEYA 4O0UA 4EH9A 2WTKC 4JR3A 4RPVA 4ORKA 5FXSA 5J1WA 4UXQA 3EQPA 5DT4A 4DFNA 1KUTA 3TTJA 3W8QA 3D94A 3AC1A 1PXPA 3ZC5A 4O1OA 2BRFA 4G6OA 1DAWA 3ZO2A 2WIHA 4EC9A 1MQBA 4FGBA 3PPZA 2XVDA 4JBOA 2R3FA 4BZNA 3D0EA 3FYKX 1R3CA 4RIYA 2QCSA 5LMKC 5BVNA 2PE0A 5CTPA 3TKIA 2YIYA 4WUNA 1ZYSA 2CDZA 3ZUTA 2J0IA 3UMWA 2YACA 4W9XA 3P79A 2Z7RA 3GB2A 3HRBA 2Y6MA 4FG9A 4CFXA 3O17A 1Q61A 4EORA 3A4PA 5CU4A 1FPUA 3H0YA 4RIWB 4CT2A 5HG8A 3UNKA 3NVKI 4XH6A 2YISA 3HP5A 3E8EA 4EC8A 3UVQA 1EH4A 4WBBB 4CV9A 1ZYLA 3MA3A 1APME 3KC3A 3TM0A 2OKRA 3OFMA 1QPCA 2GTNA 3GQIA 3EZVA 3R9OA 4UN0C 2XMYA 4EONA 3F7WA 3DTCA 1LP4A 4AZWA 2R9SA 2GFCA 3PVUA 2QO2A 4NCTC 3COKA 3TZ8A 3EKNA 4ENYA 4IAKA 1IA9A 4BFMA 3FQHA 4D58A 4FZ7A 2CKEA 4FV9A 5KMJA 4XNEA 2PTKA 4IB1A 1MRVA 2HWPA 4EBVA 4FVRA 5DJOA 3DBDA 3Q9WA 2R0UA 5M4CA 4Q9SA 3QCSA 3GCUA 4C4EA 1M17A 3TXOA 4EHEA 3BBTB 2YEXA 2F57A 4J8MA 3F2NA 1XH4A 5AADA 3PRIA 2DQ7X 4V01A 4WOVA 4AS0A 4EOPA 3C7QA 4DFBA 2OIBA 5C8MA 2YHVA 4L45A 2JIVA 3GQLA 1JPAA 1E9HA 3P7AA 4FX3A 5GNKA 1Z5MA 2RG5A 3ET7A 4F4PA 5HQ0A 2FB8A 4GFOA 4WT6A 2PUNA 5DBXA 2QOKA 3UJGA 2B0QA 2JFLA 4L52A 2BIYA 4JQ8A 4TYHB 4HJOA 3K5UA 2V22A 3MB6A 2BHEA 5CLPA 4AWIA 1K2NA 2XNBA 3CTJA 3FZPA 2UZWE 3FMDA 1OM1A 3IKAA 4ZTSA 3T9TA 4EZ5A 3QTIA 5TF9A 3MB7A 1KWPA 3KVWA 4WBOA 2P55A 4P2KA 5AP6A 4G17A 5B7VA 4A9TA 4TYJA 4RZWA 3VULA 2CN5A 3Q4UA 5LOHA 5M57A 3SAYA 4GIHA 4AA4A 4RSSA 2A0CX 2BDWA 3ANRA 3NNUA 2PVNA 4IIRA 5EYMA 4LRMA 3ZYAA 3KREA 2C3JA 3PPKA 1R1WA 4KABA 5ETAA 3VPYA 3TWJA 1JKSA 2XKDA 5HVYA 1FMKA 4YJSA 4EOSA 2FGIA 3BEAA 1DS5A 3O0GA 4GU9A 4D4VA 5J9LA 3GFEA 3GEQA 4MK0A 5DR2A 5C1QB 1DMZA 4YJUA 3A7IA 2X7FA 4YC6A 5L8JA 5HBJA 5KX8A 4B6LA 4N70A 4PDSA 3A4OX 1WZYA 4X21A 4ACHA 1I09A 5CAVA 2A19B 1OI9A 2YLFA 3GBZA 1PXIA 2PMIA 4GIIA 4B99A 5HD7A 3B8QA 3I81A 5E8XA 4O86A 4P4CA 2XIYA 4I6QA 2BDFA 4D2WA 2XF0A 5ITAA 3NGAA 1E1XA 3QTWA 3CD3A 3P5KA 1UU9A 3MIAA 3QKMA 4BTKA 3NZ0A 4YZDA 1XBBA 3FE3A 5AP1A 2OH0E 5K5XA 1OMWA 4G5PA 1FVRA 4M3QA 4GKHA 4GMYA 4ANNA 4FKSA 3MFRA 3SW7A 3TZ7A 3BU3A 5CENA 4FL2A 5IA2A 4USFA 2F9GA 3HUBA 1WBSA 3RGFA 3ELSA 2J51A 3I4BA 1GZNA 5CT0A 3D83A 3ORXA 4EHGA 3ACJA 2X8DA 5L2QA 3D7TB 5ACBC 5CAUA 3A60A 3SC1A 2XNEA 3QQGA 5CU0A 2YCFA 3POOA 1KE5A 2B1PA 5CASA 3F9NA 5HVKA 4AT3A 3WILA 4E6CA 1ZY4A 1BI7A 1FOTA 4NL0A 3R1QA 1NW1A 5DMZA 4AU8A 3FKOA 2XKFA 5A6NA 4BWPA 1GZ8A 3LFQA 5HE0A 3Q2JA 4NKAA 1H1RA 1ZRZA 1WBPA 2PMNX 4CMOA 3MWUA 2I7QA 4F0FA 1JKLA 2OIQA 3UPXA 5DGZA 4APPA 4E4XA 1UHTA 3U8WA 5C9CA 3FLQA 4ZXTA 4UMUA 4YHJA 3W2PA 5J79A 3R9NA 2BTSA 5CSWA 1KOAA 3NUUA 5FBNC 3A62A 1ZYCA 4BBEA 5HD4A 4F7JA 2Q0BA 4U45A 1PXJA 2IW6A 3KY2A 1IASA 3ODZX 3R7IA 2Z8CA 2PSQA 3LIJA 3UG1A 4GSBA 4LGDA 2KB3A 4MXYA 4IWPA 1O9UA 2J6MA 2WMUA 4ZTQA 3LFAA 4FSZA 4D4SA 5ICPA 3Q2MA 1UKHA 2R3QA 2PVFA 3NYVA 4U9AA 3R30A 1PXNA 3TV7A 4BTJA 4FTQA 2W17A 3VF8A 4AGUA 4U79A 4K6ZA 3QZIA 5JEBA 1R21A 4FNXA 5HCZA 3FXXA 4GVAA 5EOLA 4D2PA 1K3JA 4ZJIA 3W18A 3RCDA 4FT9A 5JK3A 4FSRA 3NAYA 5BPYA 3OW4A 4HVHA 4ZSJA 4AGDA 1O6KA 4UWBA 1W0XC 2CKQA 3BI6A 2FYSA 4PL3A 5AJQA 4ZLZA 4FEQA 3KKVA 3PJ1A 3S1HA 2XT9B 3QA8A 2IZUA 5E8TA 2XH5A 4QCJA 4I21A 5IQGA 4F1MA 3NIEA 4OUCA 2OGVA 3UV0A 2XIZA 5AP5A 5FD2A 4R5YA 1YWNA 3PLSA 3QX4A 4N6YA 2WB8A 5LMAA 4RJ4A 4FTJA 3HEGA 5EKNA 3ID6C 3TDWA 4K11A 2WMVA 1IR3A 4G3FA 3BQCA 2O65A 2X6DA 2C6DA 1BUHA 3ZO1A 4MBLA 3TV4A 5DA3A 3E3PA 5LVPA 1ZYJA 3KN6A 3JY0A 2ETKA 3O8TA 4IB0A 3CSVA 2YDKA 4E4MA 4PTCA 2AYPA 3QBNA 1KV2A 4PWNA 1YXSA 3IK3A 3MH0A 2J0MB 4FTLA 5AP2A 4F1TA 5JN2A 4EK8A 2FA2A 4K77A 4E20A 2BUJA 2R64A 4C4GA 5CXZA 3R02A 2UZOA 4OAVB 4YZ9A 3MFTA 4ASEA 3VC4A 1ZAOA 4ZMFA 3UYSA 3WIGA 2AC3A 2OI4X 4JQEA 2YAAA 3QAME 4BCIA 4RC3A 2DWBA 2X7GA 2Y8OA 4V04A 4XV2A 1WV3A 3F6XA 2R3IA 4JS8A 2OJIA 3OUNB 2OFVA 3EQIA 4YU2A 1R39A 2HXLA 5AA9A 3DBEA 1ZZ2A 2EVAA 4DT8A 3VUMA 3KXGA 1OIRA 3KXNA 2OXYA 5JRQA 1KV1A 2WAJA 3A7FA 3DAJA 3IW6A 2KKLA 3KQ7A 3KRJA 4KRDA 1UNGA 5HE2A 4YO6A 3VS7A 3RTPA 3RAKA 4D5HA 1NXKA 3N51A 4YZMA 5E8UA 1WLNA 4JONA 3LLAA 1OECA 5EDPA 4BB4A 2BTRA 4ERWA 1TQIA 3BYSA 4XP3A 2YCRA 4CD0A 4ALVA 5HGIA 5BNJA 3UQCA 4RT7A 3OWJA 4OTHA 4JRNA 5I9VA 5CF5A 1ZLTA 5EQYA 4O2ZA 2HYYA 4X2JA 4O27B 5A9UA 5JMSA 2VTLA 4I23A 4FTOA 2GQSA 2VTMA 3MPMA 2JDTA 4YBJA 3JUHA 4EKKA 1ATPE 4D0WA 4DH7A 4IDVA 2WMAA 3RMFA 3CQUA 3F61A 2R2PA 4W4WA 2C6KA 4JI9A 5A54A 3KULB 4MQ1A 2NNWB 3P7CA 2C6LA 3LQ3A 3RHXA 1QMZA 4LV8A 2C6TA 4J96A 2QD9A 5DEWA 3VIDA 4EOKA 3F5PA 4LOQA 4NH1A 4X3JA 3D5UA 1J7LA 1MRYA 4O0TA 4RA4A 3UZPA 3E92A 4YHTA 2F2CB 3DLSA 5GHVA 4LUDA 4BDJA 4G34A 3EWHA 2QOLA 4W4VA 5IEYA 3SGCA 1Q3WA 1DAYA 4ZY4A 4S33A 3SD0A 5HICA 4WG3A 5I3RA 5KKRC 3VS3A 4EJQA 4JX3A 2W9FB 3HV6A 4BTMA 2UZUE 3N4VA 3GT8A 3LFEA 5IA1A 4I1ZA 5CI6A 4TN6A 2CPKE 3WZDA 1K3QA 4YJOA 5CEPA 3CE3A 4G31A 4LGGA 4DFYA 3AC8A 3PY0A 5FRIA 3FZRA 2R3MA 2YABA 4OTRA 3G90X 2W4OA 3ORPA 1G8AA 3UO5A 4S30A 5KBRA 2J9MA 3KFAA 4WRGA 3VF9A 4BWKA 4D1XA 3C5IA 1JOWB 1VYWA 1RJBA 1M7QA 4DEDA 4PDPA 2WOTA 4UZHA 4PDYA 3O7LD 5E8YA 1I44A 3BHUA 1Q3DA 2OF2A 4FIHA 5AA8A 4FZ6A 2YJSA 5IA5A 5B2MA 4DAWA 4AZVA 4FMQA 4Y83A 3LHJA 4CVAA 1V1KA 3FXWA 4JR7A 2XS0A 2RF9A 2ZB1A 4G9CA 2QHNA 4MAOA 2PK9A 4PL4A 2QHMA 3LLTA 4QTAA 5LVNA 2PUPA 4NYEA 1G6GA 2GS2A 4KD1A 4NM7A 4RWKA 4HGLA 3F3WA 4JLCA 4LGHA 4RC2A 4J97A 5F1ZA 2P2HA 5CSHA 4WG5A 3VBXA 2C3IB 5KMKA 2EXMA 2XK3A 4L8MA 2KFUA 2HCKA 2GMXA 1PRYA 3MJ1A 2Z7SA 2WEIA 1OL2A 4Q5EA 1KE8A 4ID7A 4QMPA 3TL8A 3R28A 4LOPA 1Z9XA 2WU6A 3OEZA 4I3ZA 4DGNA 1SVEA 4J98A 4IWQA 2OO8X 5DVRA 1SNUA 1URWA 4S31A 4L42A 2PVRA 4W8DA 2CKPA 3DY7A 4E7WA 5JGDA 3F3TA 4L68A 2YM6A 2LGCA 3SXFA 4D2TA 3HMMA 2SRCA 4QNAA 3NSZA 1XH6A 2GS6A 3LFCA 4C35A 5IA3A 1H07A 4QQ5A 1J7UA 2GCDA 5CYIA 2ZM3A 4YTIA 4C37A 3TDVA 3ZLWA 2UVXA 4J8NA 3QCYA 3GUBA 1P14A 4DFLA 4YLLA 4J99A 4X3FC 4H36A 4XP0A 2VN9A 2XCHA 2J0KA 2WQEA 4O22A 2WMTA 4MVFA 4QP7A 4ZTLA 1K3NA 2W1DA 2BKZA 4DHFA 5DRDA 3DK6A 3UQGA 2HY0A 3R83A 5D1JA 3NNXA 4TXCA 2J0LA 1WMKA 2YLEA 4M84A 3HDNA 3UNJA 5E8ZA 3PIZA 3ULIA 4AA5A 3FL4A 1YHWA 2Y6OA 5EK7A 2O0UA 4A9RA 4O83A 3QZHA 4F99A 1GIJA 3TNPC 5CNNA 1OL1A 2UW0A 3F2AA 4NJDA 5CF6A 5CSXA 4EJNA 4IHPA 4QYHA 3E64A 3V3VA 4JBVA 4D9TA 2ZVAA 4GYIA 2AUHA 2GPHA 3QZGA 3UO6A 1OGUA 1F5QA 2NRUA 2Q83A 2QURA 3QTZA 3V01A 5FM2A 1OVEA 5AV1A 3TG1A 3FSKA 1DI8A 3QD4A 4ZS4A 2ZDTA 4ACMA 3WZKA 2YIRA 4EYMA 2YAKA 5L8KA 3MPTA 1H08A 4LG4A 2RFNA 3PG1A 5I4NA 3V6SA 4RVMA 1B38A 3VQHA 1BLXA 2ITVA 3RCJA 3FKLA 4AAAA 5IZFA 2R7IA 3UODA 4HYIA 4JVGA 5M4FA 5EFQA 4FIGA 4C0TA 3DXQA 1Q41A 4UY9A 1PXLA 2VTNA 3QU0A 3TZMA 4FT7A 5A4CA 2VNYA 3NW5A 2XYUA 5CAOA 3H3CA 3V5QA 4E4NA 3I7BA 3PJCA 3BGPA 4KBKA 4F7NA 5BX0A 4TZRA 4CKIA 2ZB0A 3VA1A 5GZ8A 3CJFA 4NM0A 4UEUA 5CSVA 4DGOA 2HW6A 2XUUA 3OCSA 3MBLA 2XBAA 3OBGA 3KMMA 3Q52A 2W5BA 3D5WA 1SVHA 4I0RA 4IAAA 4FG8A 2BHHA 4GVJA 3EFJA 4QMLA 2A2AA 3T8OA 4L67A 1OKVA 2YERA 4BIBA 4O7TA 3VUDA 3RM6A 4UZDA 5EQPA 5CVHA 3UMZA 4FIFA 4PP7A 3R7OA 4YUQA 4R5SA 1NVQA 3R71A 4I93A 5K4JA 5CZHA 3BYMA 4G3DA 2IVVA 3H30A 4I92A 1UU8A 4O91A 4DEAA 4EH4A 1W7HA 4C61A 2YWVA 4FEUA 2VD5A 4FTIA 4IW0A 1YXXA 3PXFA 3SLSA 4QP6A 4O7WA 4O7LA 3TUCA 3PDTA 2J90A 4FE2A 4GK3A 4TYHA 3V8WA 4D0XA 2VX3A 5M44A 3JYAA 4JIKA 2OJGA 4FIIA 2JDSA 1NVSA 4RA5A 3NIZA 4UV0A 5AAFA 3HMPA 5IF1A 2W5AA 3V5JA 3R7GA 4BGQA 3S0OA 2PZ5A 4Y85A 1WBWA 1OKWA 3B8RA 4QNYA 5EHOA 5HIEA 4CFUA 5IH5A 4GRBA 4M68A 3PPJA 1M7NA 5CX9A 2V7OA 1ZZLA 4FV3A 5FDXA 5AUVA 3RWQA 4RJ5A 2VTHA 4MNEA 5K3YA 4YO4A 3BHTA 3UG2A 2ZMCA 4MWHA 4Q2AA 3VNTA 4PPAA 4K0YA 3LMHA 1IAHA 5F95A 5M51A 1YJMA 2JKDA 1VR2A 2ETMA 2J50A 2VO3A 2VTPA 3FUPA 4G6NA 4I20A 4U42A 4FKPA 3CTHA 5HE1A 3RALA 3H9RA 4BCMA 5HU3A 4QPSA 3HVCA 4I5CA 1H25A 4DE4A 5HBHA 3GNIB 3ZBFA 3PO8A 4FL3A 4QP3A 5GIPE 2ITUA 2J7TA 3KXXA 3NCZA 5TT7A 4CFWA 3HUFA 2R3JA 5GIOE 2PL0A 1K2PA 3BHVA 2ZM1A 4JQ7A 4FYNA 4HPTE 5D41A 3H10A 3PUPA 3ZUVA 2H9VA 4CYIA 4FICA 5EW9A 4A9SA 5M53A 3VW8A 3C0GA 2X2MA 4AZTA 5CNOA 5ETFA 2ITNA 3PXQA 2BDJA 4K18A 4LL0A 2CNQA 1SMHA 4G2SA 2W05A 2XJ2A 4YC8A 2CNVA 3L8XA 5M55A 1Q97A 5AV0A 5J5TA 3I79A 3RI1A 4FL1A 4ASZA 1R0EA 1STCE 1WBTA 3F88A 3FMKA 5F94A 4IC8A 1FMOE 5ANGA 3D7TA 4QD6A 2DS1A 3RK7A 3ZEWA 4L6QA 4RBLA 4EI4A 3DK7A 3UPZA 1GZOA 4D28A 2EXCX 5KO1A 2G1LA 2PUIA 2I40A 3O96A 4FUYA 3FI3A 4R8QA 3IGOA 4EWHA 4I41A 3EQFA 4NTTA 4X6QC 4FVPA 3DK3A 2X4FA 1B39A 1F0QA 4X2GA 1HCLA 5J87A 1UJXA 3NMUF 1YW2A 2PVHA 4LI5A 2UW7A 5LWNA 4OBQA 3SDJA 5KBQA 1BL7A 4IM0A 5AR8A 3R04A 5CSPA 4ZP5A 1W83A 2ZM4A 4U3YA 1M14A 2QO9A 2WTWA 3GU8A 2PMOX 5GJGA 1FINA 4P7EA 4NK9A 4YSJA 3UP7A 4I0SA 4S34A 3IGGA 2X9EA 1YXUA 4AT5A 5L2TA 2CSWA 3DT1A 2YIWA 2RFSA 3EQCA 4U3ZA 5BVKA 4DG2E 3JVRA 3LCSA 4C2VA 2VTJA 5J9YA 1OIQA 3C0HA 4K1BA 4EUUA 3ALOA 3DS6A 1OIUA 3F69A 2H34A 5AEPA 4CKRA 5L2WA 2G1TA 4AN2A 3GGFA 4PNKA 1H0VA 1JSUA 3O8PA 2C4GA 2FVDA 4L53A 3PP0A 4AW5A 5CEIA 1U59A 4GUBA 5JFWA 2JBPA 4EOIA 4O7NA 5IU2A 3RVGA 4I5HA 3ACKA 4TT7A 3ZRLA 1V0OA 3IG7A 5AX9A 2ZV8A 4KRCA 5FXQA 4IAIA 2XA4A 4Y5QA 5IKWA 4GG5A 4JBQA 3PWDA 3L9PA 2WTVA 4G5JA 5B2KA 2HZ4A 3PTGA 4BKJA 4BCQA 5KMIA 5CY3A 2X7OA 3NW7A 2WMQA 4FTAA 3UP2A 4K33A 4KSPA 5J7HA 3W16A 5LVMA 4RRVA 2WKMA 3BYUA 1ZMWA 4HGSA 4GJ3A 2PZPA 4I6FA 3SXRA 1LEZA 4PL5A 1J4PA 3II5A 1JKTA 2YN8A 3DJ7A 4U43A 2Z02A 4DINA 5FTGA 5E91A 3AD6A 3V5PA 1AGWA 3QUEA 1KE6A 4QP9A 3LM5A 1YI4A 4AN3A 4A4XA 4BDAA 3FSFA 1OBGA 5CEKA 4PV0A 4DF3A 1JKKA 2QR7A 2VWWA 4MXZA 3ZH8A 5HO8A 3MFSA 2EWAA 4B8MA 1QL6A 3SRVB 2R0IA 2OZOA 3HMOA 2OF4A 3THBA 5AUXA 4DFXE 1FHQA 2WHBA 3F66A 3OCTA 4FYOA 4CGAA 3R9DA 3R8VA 3Q6UA 4GFMA 4XYFA 3OW3A 4FK6A 1Y6AA 2O64A 3EYHA 4FTNA 4JL9A 3DBCA 5DFPA 1CSNA 2I0HA 4NKSA 5IUGA 1A48A 4GKIA 3DB8A 5TKDA 3DFAA 3BGZA 2BMCA 2ZYBA 4TYEA 4AOTA 3ELVA 4R3CA 5A8IA 3QCQA 1UNLA 3ZOSA 1PF8A 4I5MA 4RJ3A 3BGQA 3OUNA 2JAMA 4FSWA 4CKJA 1H1QA 3QKLA 3H9OA 1Y8YA 5F9EA 2XKCA 5L4QA 2JQLA 5JFVA 3TEIA 3FLWA 4M15A 4YPSA 3QFVA 4JX7A 3RZFA 2EUFB 1J7IA 3E88A 3QYWA 3R7UA 3TIZA 4GEOA 4EHZA 3CKXA 4F9BA 4YTCA 5A14A 1J4KA 4HNFA 4I6HA 4D4YA 3GU4A 4YZBA 3QALE 5IMXA 3PIXA 3DKGA 2OXXA 2QG5A 1ERKA 3L9LA 1NY3A 3W2CA 3I0MA 4FTTA 5HHWA 4DCAA 4IB3A 2R3NA 4G3CA 3BCEA 2IO6A 2QOFA 3BE2A 3EL8A 5HCYA 3OBJA 3TNWA 2VAGA 3KMUA 4TPTA 2VU3A 3VS4A 3PLAE 5LARA 3VRZA 3TKUA 2BRNA 2IVUA 2R3LA 3EOCA 3FY0A 5L6OA 4C8BA 1PXKA 2X39A 4NM3A 1YDRE 2YDIA 4DEHA 4DLJA 2PZYA 1FQ1B 4KS7A 3VS6A 3RAIA 1JAMA 2FUMA 3PZHA 1XKKA 5HE3A 3TCPA 4CT1A 3KULA 1H26A 5AAGA 5C8NA 3DNEA 5KE0A 5BVOA 1GJOA 4MNEB 2BPMA 5KHWA 2CLQA 4FSMA 3ZS5A 1FGIA 3HL7A 2B7AA 3MIYA 3HV7A 2C0IA 5LVOA 3LKMA 4DCEA 5ANKA 5JKGA 4ZIMA 3FI8A 4FKOA 3ZM4A 5J7BA 3C4FA 1HCKA 3PVWA 4F08A 1Q4LA 4MD8E 1RW8A 2RKUA 4NM5A 2W4KA 3SA0A 3SVVA 4PY1A 4R1YA 3HMNA 2I6LA 3FQSA 4QMOA 5CEQA 4DEBA 2JIUA 5J9ZA 5AP7A 3ENHA 1YXVA 1MUOA 3WE4A 4R78A 2B9IA 4IX5A 5A4QA 3LCOA 3HX4A 4RIXA 4KB8A 1J1BA 4RJ8A 3MH2A 4YC3A 3RNIA 4EH5A 5HTCA 4QMVA 2OBJA 4TKSA 5IA0A 4O84A 1PMNA 2XJ0A 4O0WA 2IW8A 3QUPA 2BCJA 4MX9A 1RE8A 2CCIA 4HGEA 4ALUA 4D5KA 3HYHA 1YDTE 2IN6A 3BZ3A 3V04A 3VBTA 4B9DA 3FZ1A 2WGJA 3F3UA 3QC4A 3GU7A 3UBDA 1AQ1A 3NPCA 5A4EA 5IUHA 3QWJA 3DB6A 5E8WA 4G1WA 3RWPA 2W1EA 3R8PA 3DZQA 5FLFA 3ATTA 2J4ZA 4D2SA 4CQEA 4BDGA 2GQRA 4C02A 2IPXA 2RL5A 1GIIA 4ACDA 3HRCA 3EMGA 3Q32A 4F1OA 4ZJVA 3SG8A 3U4UA 3F3ZA 3GXLA 2CN8A 2W1HA 3W10A 4ZZNA 4XS2A 2QU6A 4CZUA 1OL5A 4F0GA 4AACA 1CTPE 4BWXA 2JGZA 4JAIA 3EQRA 5FTOA 3IQ7A 3BX5A 4RJ7A 1XH5A 3DKCA 4KIKA 3M1SA 1XBCA 2XNMA 3ZRKA 4P5ZA 3KF4A 4RVTA 3I6WA 3IDPA 4BHNA 2KTYA 3JS2A 5I9WA 1UKIA 2GNFA 2Y4IB 2UV2A 4FNYA 3CEKA 4YURA 3UN0A 4HVIA 4BIDA 4FKWA 4M14A 5CAQA 3FJQE 2RGPA 1OL6A 4N0SA 5FP6A 3C13A 4QP8A 3UNMA 3DU8A 5DOSA 1H24A 3F5XA 3C4CA 3GFWA 4D4RA 1H1WA 4OBOA 4PPCA 3AT2A 4AX8A 4E6DA 3IW8A 4NU1A 1OKYA 1W84A 2CCHA 2HK5A 3LVPA 2OWBA 4UMTA 1PHKA 4WNOA 2C5OA 2VRXA 3U9NA 4BY9E 3UNZA 3LFDA 3CC6A 5EG3A 1IA8A 1U46A 2XCKA 4NUSA 1ZOHA 4BDKA 1Y91A 3ZHPC 2QOCA 3OWLA 2RIOA 3LW0A 4AW2A 3WOWA 2NO3A 1Q8ZA 3I5NA 4LMUA 5IG1A 3E87A 5ANEA 4WA9A 3QL8A 3DAKA 3UGCA 3L8SA 4FT5A 1JVPP 2C5YA 4O21A 4FKJA 4QYEA 3IOPA 3F3VA 4NFNA 4BYIA 1XHAA 4Z7GA 4HYHA 3PY1A 2UW5A 4YLKA 3TNHA 3A2CA 3CLYA 3W2QA 4BHZA 2Z7LA 4FODA 1U54A 3NUNA 5HNIX 2QKRA 2ZDUA 4XEYA 4JDIA 2X6EA 2Z7QA 3R2BA 4RX8A 4HW7A 1YOMA 3V5WA 5M09A 2AFFA 4R7HA 2UVZA 2GS7A 5AV3A 3R8LA 3TKHA 3G15A 2VTRA 4K9YA 4ZAUA 5I9YA 1IAJA 4IWOA 2FF4A 1ZYDA 4FUXA 4P90A 4QQCA 4WKQA 3ZO3A 4DFZE 3RPSA 2YZAA 4M66A 3COMA 1ZXEA 3D7ZA 2FO0A 3E8DA 2W1FA 4MTAA 4U40A 4OTWA 5E8SA 3GCVA 2E2BA 1GOLA 3W55A 4ENXA 2YA9A 3ETAA 3I1AA 4Y46A 3AC5A 4U8ZA 4BDDA 5IEVA 3HAVA 3EJ1A 2JQIA 1XH8A 3BV3A 3W8LA 4JG8A 3AXWA 5FP5A 1CKPA 4U80A 5M06A 1YWRA 4Z55A 5BYYA 4DITA 3LMGA 3QYZA 3VBYA 1REKA 3ZFYA 3PIYA 2JD5A 3PSBA 3EN4A 4UWCA 5GZ9A 5J95A 2W1ZA 3OMVA 5I5ZA 4EEVA 2YM8A 2VTAA 3EH9A 4C57A 4EOLA 4USEA 3FZTA 2HW7A 5JZJA 2WMRA 4BKYA 2RFEA 5HEZA 4CQGA 4F7LA 1VZOA 2UZBA 4RX7A 4IAFA 4Q9ZA 2B9HA 3SKCA 2JAVA 2YDJA 4AUAA 2EB3A 1ZMVA 3LCKA 1DM2A 4ZTNA 4RQVA 1U5RA 3T3UA 4RFZA 3WYYA 4A4LA 3EQBA 3QD3A 3OOGA 2B9FA 5IQIA 3QWKA 1Y8GA 3LOKA 3F82A 2PVYA 4RLLA 5K9IA 1OUKA 4TTHB 4XX9A 5EM8A 3Q60A 4HPUE 4NW5A 4HVGA 5AMNA 4GK2A 5DI1A 3PRFA 3WF7A 3FI2A 5H2UA 5HKMA 4EKLA 4FTRA 4U44A 4I5PA 3OY1A 5DLSA 4BGHA 4RJ6A 4F9CA 5AX3A 4WRSA 3KXZA 4V05A 2CJMA 4KBCA 4U0IA 3RPYA 2F7XE 2E9VA 2YITA 3NUAA 1V0PA 3D4QA 4NJ3A 3SOCA 4M69B 3OOMA 4NIFA 5EW8A 4ZLYA 4GT4A 2P2IA 5HO7A 3ALNA 1VJYA 1MZKA 1YI6A 4ZZOA 4G6LA 3PVGA 4RIXB 1AD5A 5B0XA 1VYZA 4QYYA 2B9JA 5AR2A 2LC1A 2R3HA 4Z16A 1GAGA 3BIZA 3PA5A 4HYSA 5JT2A 3EB0A 3NDMA 4TW9A 1OIYA 1P5EA 1UV5A 2W7XA 5BVEA 3E7VA 3UIXA 4PMPA 1GY3A 2VWZA 3UE4A 4O0SA 5BUIA 3TNQB 3CGOA 3CKWA 3DGKA 2BRMA 4JDJA 4Z3VA 2OXDA 5DHJA 5E90A 3PSDA 1NT2A 1PYEA 3KGAA 4XG6A 4L44A 4MEDA 1JWHA 2CHLA 3QRTA 4G16A 4IQ6A 4QTCA 3UIUA 4FI1A 5CI7A 3TACA 4XMOA 5FBOA 4F70A 3DPKA 4MYGA 2XEYA 4O7VA 3CTQA 5EDRA 3UZTA 1FHRA 4JJRA 3TJCA 3M11A 4FZAB 1H8FA 2BZHB 2PVJA 1A06A 3I5ZA 2DYLA 4BDFA 4ITHA 5BQ0A 4FEXA 4ANMA 4ACGA 4HVDA 4WSQA 3EFWA 2UW4A 4FZDB 4O6LA 2CKOA 4PTEA 4OAUC 5HVJA 1YWVA 2PHKA 3R8MA 3UYTA 3ZLYA 2BROA 2XNPA 3W1FA 4FNWA 3QQHA 4CEGA 3IDCA 1G8SA 3QUDA 3OHTA 4NW6A 3VBWA 4O7YA 5DH3A 4FV4A 4KIKB 4E3CA 3ZSGA 2JQJA 4NSTA 2C68A 2R3RA 1Q8YA 2GNGA 3DAEA 4FTUA 4CMUA 3LXPA 2BRHA 2JEDA 4LRJA 4C4FA 2X8IA 4FV8A 4C62A 3L8VA 3CS9A 1UVRA 3DZOA 5EM5A 4EUTA 4CFNA 1Q24A 4UYAA 3VHKA 5M4IA 1PMVA 3I60A 1G3GA 3NVMB 3CJGA 2Y0AA 3KXHA 4FSUA 4XG2A 3F5GA 2QOIA 3DNDA 4IZAA 5EHLA 3ULZA 2JKMA 3DV3A 3LXKA 4BCNA 4IH8A 4FSQA 3R1SA 3NW6A 4I22A 5D9HA 1U4DA 5H8GA 4BI1A 3ITZA 3DXPA 5DPVA 3MTFA 2UW9A 1MQ4A 2ZV7A 4KIOA 4FTKA 2R5TA 1ZOEA 3AOXA 2HAKA 2HOGA 4EZ7A 4L7FA 4EH6A 3JY9A 3ZZEA 4M7IA 4QMTA 3Q3BA 3R00A 4JG6A 4CFMA 5HZNA 5BMSA 3G33A 5IH6A 3MPAA 4RVLA 4O96A 4U5JA 4X7QA 4YZCA 4M97A 4MWIA 5DG5A 3E62A 3P0MA 4F6UA 2UW8A 3G9NA 3E3BX 4X2FA 3FY2A 4RLKA 4J7BA 4UMQA 5HI2A 1UU7A 3UVRA 4IX6A 4I4EA 2EH0A 4GW8A 4ZSGA 2PUUA 1IG1A 4MF1A 3C51A 3FBVA 4ACCA 5EM7A 1U54B 3VUIA 3OT8A 4G3GA 5EI2A 2O2UA 4RZVA 3BPRA 1OITA 3A8WA 4TWPA 4QP4A 1S9JA 2BR1A 3RAHA 3UOJA 3SRVA 3U87A 5C01A 3WI6A 3BU5A 3C0IA 4HGTA 4CZYB 2XB7A 4S2ZA 5D7AA 4TL0A 4BYJA 4DG0E 4E26A 3LXNA 2ITPA 5AIKA 2REIA 5AIRA 4DGGA 4L43A 3UOLA 1BX6A 2GNLA 2KULA 3HV3A 4AFEA 3MDYA 5L6PA 4ANLA 3REPA 1WBNA 3A7GA 3QQJA 4OTFA 3Q5IA 5CT7A 2X4ZA 2P3GX 4ANOA 1GIHA 2WTDA 5ETIA 2GFSA 3QXOA 3MVLA 4D1ZA 4EBWA 3FMJA 2BKKA 3MYGA 5KMNA 3AMAA 3QHRA 3SHEA 2OIDA 1UWHA 4TY1A 3TT0A 3W32A 3DKFA 4B4LA 3JR1A 5J8IA 3UOHA 1H00A 3OC1A 2WQNA 3R2YA 3KU2A 3OXIA 4U97A 2X1NA 2XKEA 5JZNA 2ONLA 4C4JA 3P4KA 4L3LA 3W2RA 4ASDA 1L3RE 3BQRA 5EYDA 3UVPA 1Q8TA 3R6XA 3FAAA 2Y4PA 4R1VA 3MW1A 5C26A 2IZSA 5LWMA 1VEBA 2XK4A 3MFUA 4XCUA 4EH8A 3OXZA 5E9EA 1BKXA 1XJDA 1YRPA 3EN7A 5BUEA 5JGAA 3VBVA 3GVUA 3HGKA 3NNVA 4O0YA 5CS6A 1YOLA 3LQ5A 2WIPA 3HV4A 4DEEA 4AOJA 2PZRA 4GG7A 2WXVA 3AG9A 4IXPA 4IZYA 4RGJA 4UMRA 5DYJA 2HZIA 2IJMA 2PVKA 2WOUA 4YJRA 5M4UA 2UUEA 3KT9A 4GUEA 5AM7A 2VWYA 2XJ1A 2C5VA 2R3OA 5IMEA 1KOBA 4WD5A 4IVDA 4ITIA 4CMTA 3FMMA 4CNHA 5KHXA 1G3NA 3CD8A 3R0TA 2OSCA 4M13A 3U9CA 3UO4A 5HTIA 3KL8A 3O8UA 5BMMA 2GDOA 4NZWB 3LJ2A 3ZSIA 4E6AA 5CQWA 2GHMA 2BVAA 1ZY5A 3DQWA 4I0TA 3RM7A 2WTJA 5HTBA 3TZ9A 1LPUA 2C0TA 2GNJA 2VNWA 4FKGA 4XJ0A 5LXMA 4YLJA 5E4HA 3AT4A 1H1PA 2IVTA 2J5EA 3G2FA 5DWRA 3O51A 3A99A 2E9NA 4LQMA 4NIFB 4RX9A 5HLNA 3FPQA 4EH3A 2VTSA 5E1SA 5KMMA 3N4UA 3VUGA 4GCJA 4EK3A 2IVSA 3G6HA 2W06A 3R7EA 5JGBA 2XZSA 3ORZA 3WF6A 3ZFXA 2QG7A 4IADA 3S4QA 5IQBA 1SNXA 2PIEA 1NVRA 4EQCA 4JIAA 1Q8WA 2ZAZA 3E93A 3D5VA 1REJA 2XNNA 4IDTA 4O2PA 4O0XA 2XRUA 3HA6A 1ZMUA 4E5WA 3WYXA 4BL1A 3ORLA 1R0PA 4IX3A 3QQUA 4MF0A 3RPOA 3F5UA 4ZSLA 5CAPA 3V5LA 4HZRA 2OW3A 3VRYA 4E4LA 1W98A 1Q99A 3R1YA 4AN9A 5G6VA 4ONAA 3UC4A 2H96A 5KKRB 4IB5A 3KXMA 2VZ6A 1CM8A 1R78A 2BZJA 2VGOA 2VWUA 2W96B 3QF9A 3Q5ZA 4O0RA 2Z60A 5E7RA 2IW9A 3VW6A 4DYMA 4JRVA 4UBAA 4BGGA 4EOJA 4QTDA 2XYNA 4V0GA 4JG7A 4KIPA 3I6UA 4ZY5A 2JIIA 3FHRA 3C4ZA 4BZDA 3ZZWA 3ZLSA 4ANBA 3MDBA 2ACXA 5I0BA 3EHAA 4YP8A 2OG8A 2F2UA 2OU7A 3FC2A 4C2WA 4CTBA 4E73A 4FGRA 3PA4A 3LXLA 2R3GA 3GENA 4BCFA 5FGKA 2KB4A 4ZMEA 4IFCA 5G1XA 3IS5A 4A06A 4IM3A 4DN5A 4KIQA 1LGPA 3RAWA 1WVXA 2YM4A 5IA4A 4DBXA 4BRXA 5DN3A 4BBMA 4RVKA 2Y4IC 3E63A 3LFBA 3EL7A 4NWMA 3UOKA 5K5NA 1LEWA 3EYGA 4KAOA 2VWIA 3E7OA 1PJKA 4RQKA 4FKQA 2BALA 4FT3A 3LMIA 4RWJA 3FLYA 4XV9A 2X8EA 4PNIA 4ERKA 4F09A 2ZOQA 1H1SA 3DQXA 5IQCA 5ACKA 5HORA 4EL9A 3MS9A 1H0WA 4GL9A 4U6RA 2P0CA 4TWCA 3VA4A 4WNMA 4F9YA 4BCOA 4EQMA 3DJ6A 5KMLA 1O6LA 4DEGA 4DH5A 4PDOA 3H9FA 4OT5A 3E5AA 3PZEA 4PUZA 4CSVA 4KBAA 3D2KA 4GU6A 1YHVA 4XLVA 4IVCA 5CWZA 4AFJA 4B7TA 3H4JA 4FSYA 2C1AA 1P4OA 3GCSA 3U55A 3QXPA 2VTQA 4BI0A 5E50A 3PJ2A 3T9IA 4PRJA 1PW2A 2UW6A 1E1VA 4XBUA 5I9ZA 4GYGA 4BR3A 4X3FB 1BMKA 2C3LA 3MVHA 2QLQA 3RP9A 3ZO4A 2WNTA 5C8KA 4LUEA 4Y73A 4A07A 5T6KA 4Y72A 5DR9A 3HDMA 4H1MA 2JITA 5DRBA 4BCKA 4OTQA 1GXCA 2RSVA 1Z57A 3OTVA 4HCTA 4MXOA 4QMYA 4Y8DA 4TWNA 4AP7A 4ZY6A 4ZZMA 3B2TA 4QP1A 2BAKA 3OCBA 4D2VA 2XNGA 3PJ8A 3L1SA 3OS3A 4MH7A 3NYNA 4GFGA 4IZ5A 3U6JA 4O81A 3C1XA 3UMXA 1J1CA 3C4EA 3QRJA 4AF3A 3UZRA 2C5XA 4J52A 3I0NA 3FKNA 2CGUA 4AXAA 4F0IA 4H87A 5L6WL 3GOKA 2QVSE 4P5QA 3DKOA 2B53A 1DI9A 2OZAB 4L3PA 3ZRMA 2O3PA 2QLUA 4MNFA 2ITXA 2C6OA 5TE0A 4A9YA 4BCJA 2BFXA 5LCJA 5LMKA 4F9AA 1CMKE 4G2FA 3TTIA 4YHFA 1NA7A 3ZU7A 2VV9A 3HECA 4AE6A 5IQDA 4FR4A 3COHA 1ZARA 3ENMA 4H3PA 1XR1A 2GHGA 3UDBA 4I6BA 4XG8A 3MVMA 3EFLA 2GNHA 3IONA 4IAZA 4IMYA 3R9HA 4NTSA 5BVDA 3VBQA 4FV1A 1RDQE
chains in the Genus database with same CATH superfamily
4UB7A 3FI4A 2EU9A 4XG9A 5DE2A 3I0OA 4HYUA 1G8JA 4R77A 2F4JA 3MH3A 2VX0A 2H6DA 2VO7A 5DR6A 2BRBA 3NYXA 3E8CA 3GC7A 4FKTA 4BCGA 5I9UA 3VO3A 1W2CA 3V51A 1W8CA 4NCTA 3HRFA 1V0BA 4RFMA 3TV6A 1IEPA 3QTRA 4X2NA 2RFDA 1OPJA 3WF5A 4IX4A 5GZAA 4DTKA 5HOAA 3JVSA 4H05A 5JFXA 4IAYA 3Q9XA 2W1GA 4B0GA 3S3IA 2J2IB 4O4EA 3L8PA 4WG4A 4FBXA 1J91A 3Q53A 4PF4A 3VQUA 4CRLA 3U6HA 4GJ2A 1ST0A 3Q4CA 2BILB 2XANA 3N9XA 2ITZA 3V7WA 3PWYA 5FTQA 5FEQA 3EFKA 4FKUA 4UALA 1LR4A 4BCHA 2YZLA 4O6EA 1M2RA 4CFVA 4QRCA 4ANQA 4A7CA 2I0VA 2C47A 4IFGA 3R8UA 3PXRA 3C5UA 4FV2A 2FSTX 4PQNA 2X2KA 3OY3A 2PWLA 4QPMA 2UZTA 3BL9A 3LJ1A 3GP0A 3HA8A 1WBOA 2QQ7A 3P08A 1M52A 1KE7A 1YOJA 4M69A 1WVYA 4MXCA 2A1AB 4JAJA 3R8ZA 5FEDA 4O4CA 2X0PA 3PA3A 4FV0A 5I3OA 4EOOA 2BZIB 4OTPA 5HX8A 3CR0A 4BDBA 1PKGA 4IZ7A 2BRGA 5LCKA 3WZJA 1TVOA 4ALWA 4ZTMA 3OWKA 3GC9A 5AUWA 4C33A 5M07A 4FIJA 4QMQA 2UZDA 4AZEA 4GK4A 1LGQA 4CV8A 4MBJA 4MQ2A 4FKLA 4R6VA 4R7IA 3ZUUA 1TQPA 3BBWA 4C59A 1BYGA 2VTOA 2CMWA 3NYOA 3QHWA 2C30A 4EOQA 3LFSA 1XBAA 2PE2A 4RX5A 3QD0A 1QWTA 4H1JA 3FYJX 2ITTA 3GU5A 2GQGA 4BIEA 4OLIA 3MSSA 1MJSA 4F6SA 1TKIA 2VWXA 3ZC6A 1Y3HA 3R7VA 3OP5A 1QPEA 3FMEA 4J71A 4QO9A 4YNEA 2G2HA 1PXMA 1ZOGA 3BKBA 4BDHA 4V0GB 4FC0A 2OJFE 4BKZA 5EHYA 3QTSA 4FSTA 4D55A 5C03A 3AGLA 3OEFX 4C4HA 5AUZA 2X2LA 3EQHA 2WQOA 4PMSA 5HLPA 5IISA 3POAA 1OPLA 5CVGA 2I2DA 4CYJA 5AV4A 1O6YA 3AD4A 1TQMA 3DA6A 3HP2A 3MY5A 3P23A 4FTCA 4G9RA 3WARA 3TUDA 4JIWD 3PY3A 5JFSA 2QI8A 4FZFB 3TIYA 1Q5KA 2HIWA 2PVMA 2W99B 4QMZA 4FOBA 4II5A 4Y95A 3RJCA 4BCPA 2FSOX 4DGMA 3N4TA 2W4JA 4CFFA 2FSLX 3UTOA 4OT6A 2QODA 5CU2A 4DH3A 2ERKA 3PVBA 1WFCA 1YI3A 1LUFA 3RK5A 5LMBA 3R7YA 3JXWA 3NWWA 2PMLX 3NCGA 3BU6A 5CZIA 2CGVA 2LAVA 2VTTA 3OUKA 3UQFA 4RFYA 4V24A 3DBQA 4IM2A 3QQLA 3TI1A 1KSWA 5AR5A 3A7JA 3ZLXA 5D10A 3AC4A 3ZSHA 3S40A 4Y5HA 1M2QA 2A0TA 3BYOA 2DUVA 4E93A 1SVGA 3CPCA 5GJDA 3V6RA 2AEGA 3V8SA 4OTGA 4M0ZA 2WFYA 3QRKA 3BLRA 4TRLA 2QVLA 4BDEA 4M67A 4AXEA 5T3QA 4JOAA 3Q6WA 3QCXA 1OB3A 1W82A 4K2RA 4L3JA 3SW4A 3HLLA 3VAPA 3G5DA 4IACA 4ZTRA 2ETRA 1YDSE 5L3AA 4HZSA 4O7SA 4FV7A 5AM6A 3IW7A 3ORNA 4YPDA 2ITWA 1A9UA 3V5TA 3MV5A 2OFUA 3QGYA 3HUEA 3GU6A 4WNPA 3MY1A 1OBDA 3MN3A 4FKVA 5FG8A 1OKZA 3AMYA 1CDKA 2ZJWA 4XRJA 1FGKA 3QTXA 4HCVA 5FUTA 3CQEA 3TN8A 2BFYA 1CKIA 2C0OA 2V55A 2HZ0A 4WIHA 1JSTA 2XIKA 4MD7E 4FV5A 5F20A 4TNBA 3LFNA 4D9UA 3WBLA 4O7ZA 4ZS0A 4CG9A 3FHIA 4IE9A 3GC0A 3OT3A 1MP8A 2HXQA 3C50A 3WF9A 3O23A 2Y9QA 3QQKA 4W9WA 4WNKA 3QA0A 4BDCA 3D14A 2QOQA 2Y7JA 1CKJA 3H0ZA 4FRFA 4FT0A 4QMNA 3GOPA 3ZTXA 5DT3A 3VS2A 5FQDC 5A4LA 5IDPA 1J2FA 3Q96A 4JDHA 4YNOA 1YHSA 3G9LX 3KN5A 3SOAA 3V8PA 4MKCA 4EQUA 1JBPE 3P7BA 3BRBA 3KB7A 3U51A 2ZFYA 3AC2A 1BL6A 2A4LA 5IQEA 2WTKB 5EYCA 4EWQA 2JDRA 5DNRA 1SZMA 3ZXZA 5F4NA 4JXFA 4XOYA 4N57A 2UVYA 3D15A 4E5AX 4ZSAA 3DDPA 3UIMA 3GI3A 5T68A 3BYVA 4M12A 4RIYB 1U0TA 2W3OA 1OL7A 3PJ3A 5E8VA 5EKOA 2A27A 3PE1A 3W33A 3IO7A 3Q9YA 5IEXA 3LJ0A 1PMEA 3FPMA 1YQJA 3QLGA 4PMTA 2HELA 3PXZA 1Y57A 4HOKA 4XHKB 5A4TA 2R4BA 4OGRA 5GINE 4APCA 3MH1A 2JKQA 2GHLA 5HLWA 5D7VA 2UW3A 3BHYA 1B6CB 2IWIA 3SX9A 2PY3A 4X0MA 3AC3A 4PP9A 1OPKA 4TYGA 4YGAA 4IVAA 1SYKA 3C4XA 3K54A 3IOKA 5AWMA 1SM2A 5HNBA 1TFFA 2ZV9A 4CLJA 2WMXA 4LFIA 2CSNA 4YJVA 2O5KA 4FOCA 4IJPA 4GT3A 5FM3A 3P78A 4XBRA 3V8TA 4NT4A 2F7ZE 3FZSA 3ELJA 4FK3A 3OWPA 2PZIA 3VJNA 4F65A 3AT3A 1FVTA 3R01A 4BF2A 5K0KA 2YIXA 2R3PA 2ERZE 3EN5A 4X2KA 5HBEA 2V7AA 2VTIA 3FMLA 2F7EE 3BE9A 5FWKK 5AR7A 5IUIA 5C27A 2PYWA 1FBNA 4O38A 5AP0A 2W0JA 4MCVA 3PYYA 2E9PA 4E6QA 5ANIA 3AD5A 4H3QA 1XWSA 1MK2A 3VS1A 3BWFA 3QRUA 4YBKA 5EI8A 1UNHA 3R21A 4F7SA 4RG0A 5AP3A 3ORIA 1PXOA 3OTUA 3WZEA 2UZVA 4XLIA 3DDQA 4CCBA 2QO7A 2FH9A 3FMHA 3WZUA 2YFXA 3QGWA 4Q5HA 5EJFA 1URCA 2WMBA 5H8EA 3SQQA 3AGMA 4A4OA 2JC6A 3ERKA 2EB2A 3TJDA 3NUYA 3I0QA 3K5VA 4HCUA 2VO0A 2BZKB 5E92A 4A0EA 4FEVA 2QKWB 2P33A 3K3JA 4S32A 5BYZA 3TNIA 4AA0A 4DEIA 4C38A 3CGFA 2GTMA 5DIAA 4AT4A 4H39A 4D9VA 4J1RA 3P86A 2PULA 5TR6A 4CXAA 3EIDA 4IC7A 2V5QA 3KK8A 4IVBA 3PFYA 5AR3A 3Q9ZA 4FKRA 5A3XA 5TOZA 1YJ5C 3K2LA 4GS6A 3FEGA 3V7YA 4DT9A 4E8AA 2UZNA 4RIOA 5HNGA 3AMBA 5BUJA 5GJFA 1PYXA 3LCTA 3DJ5A 4KKHA 3C9WA 3L9NA 4LV5A 2FSMX 3AQVA 3VONA 4PMMA 4QTBA 1PKDA 3T5PA 4DHZA 2VWVA 1M2PA 5CQUA 2B4SB 2WMWA 3GCPA 2I0EA 5BVWA 2C3KA 3MESA 3UDTA 3U54A 1U5QA 5CALA 4AQCA 5AAEA 4TWOA 3K3IA 4QMXA 1WVWA 4CZTA 5AV2A 4WO5A 1YT5A 4H3BA 2O63A 1Q8UA 3ZXTA 3DXNA 3VUTA 2HENA 5I9XA 2C1BA 2IZRA 3GCQA 4LOOA 4O1PA 4AE9A 4E5BA 5E1EA 4KINA 4KUJA 4UYNA 3G0FA 5H8BA 4C3PA 4G3EA 2QU5A 3LCDA 3IPHA 5CU6A 1JQHA 2G15A 5KZIA 1XO2B 3CXWA 4W8EA 2J5FA 3ATSA 1PMUA 3COIA 4QOXA 3RPRA 2O8YA 2I1WA 4OBPA 4ITJA 4WSYA 4QYGA 2QR8A 4EZ3A 3DTWA 3KCKA 1Y6BA 1X8BA 5M08A 3M42A 3G6GA 2C6IA 2QOBA 3VJOA 3VUKA 3FLZA 5LVLA 5C4KA 3CY2A 5ETCA 5HCXA 5HU9A 3EZRA 4D2RA 3NRMA 3F7ZA 3KCFA 3MY0A 3RBWA 3HX1A 1WBVA 2XK6A 4DA5A 3D5XA 4FEWA 3D9VA 3IECA 3L9MA 5CF8A 2VUWA 4NEUA 4BC6A 4FTMA 3SG9A 3DCVA 3O71A 3DFCB 4N4SA 4QMUA 4CG8A 3R63A 1S9IA 4RWIA 1XQZA 3O50A 4M8TA 2VX1A 5FDPA 2HZNA 1J4LA 2YIQA 3FLSA 4KA3A 4EGXA 3BELA 3I7CA 3LZBA 3KRRA 3QTQA 4YSMA 4J53A 4C3FA 1J4QA 3OG7A 2V0DA 3NLBA 4YZNA 3U4WA 4MHAA 4XG7A 4AGWA 2WD1A 1T46A 3CPBA 5ANDA 5EM6A 2PE1A 3KA0A 1JSVA 4ZK5A 4WERA 4YJNA 4EH7A 3KRWA 4UMPA 2ZMDA 5EQEA 3NUXA 4FF8A 5JH6A 4BDIA 3LFFA 2PPQA 3WE8A 4KSQA 3P9JA 5B2LA 4ANSA 2CNUA 2YM5A 1ND4A 3QRIA 4XV3A 3RKBA 3QD2B 1GNGA 2XEZA 2GNIA 1IRKA 2XK9A 3R1NA 2C6MA 2P4IA 5JRSA 4XG4A 1OUYA 3FZOA 5BVFA 3BEGA 4LRKA 2W5HA 2Q0NA 3FMNA 3OZ6A 2QONA 1BI8A 4R3RA 4I6LA 3IDBA 4QP2A 3ZMMA 1G5SA 2BAQA 2CLXA 4ZJJA 3S95A 3CY3A 5EOBA 4AZFA 4A9UA 3ORTA 2YM3A 4QMSA 4XOZA 2F49A 3BV2A 4QT1A 3O2MA 4BVUA 1FVVA 1UA2A 2BIKB 3QTUA 4LL5A 3LQ8A 4X3FA 5EDQA 5EI6A 3ZBXA 4AW0A 4C7TA 4GT5A 3KEXA 4L00A 1XH9A 4MXXA 5K0XA 2PVLA 3P5JC 3FXZA 3S00A 5HO6A 5CEMA 3A8XA 2X9FA 3QQFA 4OR5A 1H4LA 2J0JA 1QPDA 4C58A 4UX9A 2HY81 3ROCA 1K2MA 1UU3A 3MJ2A 4FA2A 2Z2WA 1XH7A 4LMNA 4W4YA 2W1CA 3M2WA 4YTFA 5IH4A 2X81A 5J1VA 2WZJA 3KRLA 3NX8A 2NRYA 3OROA 3WIKA 3UOTA 3W0RA 3ANQA 4KNBA 5C4LA 4U81A 3TUBA 3D2IA 5A46A 3CCNA 3NAXA 2B54A 4FKIA 4RMZA 3GC8A 3T3VA 4BBFA 4IWDA 2ITYA 2QOOA 1T45A 4CRSA 4I94A 1H01A 1HOWA 2WEVA 1P4FA 1YKRA 3LAUA 3QZFA 1YVJA 2OJJA 3BLHA 3MA6A 5H3QA 2OLCA 5BYLA 4CLIA 5HESA 4C4IA 4ZEGA 4JDKA 5FXRA 1J4OA 2OZAA 2XBJA 4MBIA 3NUSA 4RIWA 2XIRA 2ONLC 2ZV2A 3MTLA 3PP1A 5CVFA 3F2RA 5FEEA 3VUHA 4DC2A 4FVQA 1QPJA 2WU7A 2W1IA 4XUFA 4Z9LA 2R3KA 4IJ9A 3NS9A 5D11A 3E8NA 5CEOA 3KF7A 5CF4A 3VHEA 3R22A 4C34A 3C4WA 3OD6X 2VGPA 1Q62A 3PXYA 4BZOA 2BAJA 4QQJA 4FIEA 2IZTA 2GU8A 2XK8A 3G51A 4J95A 3SXSA 3VVHA 4O4BB 2V62A 4KS8A 4QMMA 4XV1A 3B2WA 4F63A 1K3AA 2WQMA 4PPBA 2JPEA 4YMJA 2JFMA 3CP9A 5EH0A 1ZWSA 3HV5A 4GH2A 4MD9E 2XM9A 2X0GA 3RHKA 3CQWA 4CCUA 3CBLA 4H58A 3EKKA 4EOMA 2AN1A 3ZM9A 2OJ9A 3EN6A 3NNWA 3HMIA 4EK5A 4E1ZA 4DTBA 2JDOA 2OH4A 3KRXA 1P2AA 4DTAA 1WCCA 5ANJA 4JT3A 5JSMA 3LE6A 4O0VA 5AUTA 4EJ7A 3MI9A 5KMOA 3W2SA 2YCQA 5AP4A 2C69A 3OVVA 3OCGA 3U6IA 2YWPA 2AC5A 4D1SA 3BWJA 2OK1A 2R7BA 2C6EA 4ZTHA 3MGYA 5CU3A 5KZ0A 4CTCA 4I4FA 3PG3A 2E9OA 5ANOA 1F3MC 4DLIA 3UIBA 2QNJA 4XG3A 2G2IA 3VS5A 4L46A 4BTFA 2UZEA 4QMWA 4AGCA 2QC6A 4F64A 3ORMA 5HIBA 4YR8A 1J3HA 4N6ZA 5K4IA 3VS0A 3ORKA 4R7BA 2JDVA 4B8LA 2YM7A 4DG3E 4L9IA 4L01A 5HG7A 3UC3A 1KE9A 2I0YA 3CIKA 3IW4A 4IBMA 2JLDA 3DOGA 5AUUA 4ZOGA 3W2OA 2WPAA 5AUYA 3KK9A 5CXHA 1JNKA 4YJPA 4OW8A 4YJTA 3NR9A 1Y3IA 5BV3A 3PE2A 4L02A 2I1MA 2YJRA 3ZEPA 5IQAA 5JQ5A 3FC1X 2XM8A 3DLZA 4KWPA 4ZSEA 2C5NA 3PXKA 3EN9A 4LM5A 2PU8A 5TO8A 3KIOC 1GZKA 1MRUA 2B52A 3BLQA 4C36A 4LYNA 5DT0A 4U41A 3PFQA 4KKEA 4WUAA 3IW5A 2WTIA 3PSCA 5KUPA 3Q04A 2OICA 3QKKA 4M0YA 4R3PA 4XRLA 3ZONA 2W9ZB 2VO6A 3A61A 3RZBA 3VN9A 5LJJA 2G2FA 5LQFA 1K9AA 3Q4ZA 4GV1A 3OF0A 3RK9A 2YCSA 5HIDA 4TNDA 4DBNA 4QDEA 3FM8A 5M56A 5CANA 2XK7A 4RC4A 3DBFA 3EQGA 3Q4TA 4NFMA 4UXLA 4QPAA 1RQQA 4BICA 3FDNA 3S2PA 5KNJA 4KKGA 4WHZA 4PX6A 4W4XA 5A6OA 2B55A 4AW1A 2XRWA 1OZ1A 2ITOA 3QLFA 3LM0A 4TYIA 3AKJA 3FWQA 4O82A 3RPVA 2WO6A 2G01A 3KMWA 5KCVA 2HWOA 3O7LB 2QOHA 3HAMA 1W2DA 1WAKA 2XNOA 4FG7A 4EK6A 5HX6A 1H27A 2WQBA 3HKOA 2IG7A 3RINA 4EHVA 4A4YA 1PY5A 4IANA 2NP8A 1QU5A 3R9RA 4BN1A 3P1AA 2CGXA 2ITQA 4L7SA 5EYKA 4MXAA 3PUFC 2I29A 4RWLA 2G9XA 2EXEA 4I24A 2NPQA 2UZLA 5HG9A 5L8LA 5D12A 4ZLOA 5IDNA 1L8TA 4O7RA 3EQDA 3V7UA 5AFVA 1QCFA 3QX2A 4FNZA 3ROYA 4OTIA 3ZCLA 3VWAA 4AZSA 5AR4A 3R73A 2WELA 3SV0A 4AXCA 3MVJA 1YXTA 5L2IA 2JBOA 3BHHA 1H28A 3FV8A 2XP2A 3QC9A 4HVSA 5IPJA 1JLUE 3JPVA 4YJQA 5HG5A 3POZA 4QYFA 4DGLC 2E9UA 3HUCA 3UNNA 4BI2A 4HNIA 4XP2A 5J5SA 3FL5A 4DH1A 5H9BA 5IQFA 5IQHA 1UWJA 2XIXA 4JBPA 3W0MA 5JQ8A 3LPBA 4IEBA 3HNGA 4EYJA 4LV7A 3NUPA 3ZDUA 4JNWA 4ARKA 2GSFA 4Z7HA 3WF8A 2WMSA 4YTHA 4KU0D 4K8AA 4QTEA 3G0EA 3A7HA 3OXTA 4AOIA 4U7ZA 4ASXA 4EH2A 2WTCA 5L2SA 3GQSA 2ESMA 2FEZA 2H8HA 4AG8A 3KVXA 4QQTA 3ZDIA 3FLNC 3HZTA 4USDA 4UWYA 4EK4A 4PTGA 4FV6A 4F9WA 4OTDA 2CGWA 4X6RA 2VWBA 4DH8A 3ODYX 4DFUA 3RNYA 2JKKA 2JKOA 4FSNA 3V8RA 3NEWA 2RG6A 4C3RA 5EW3A 3FQEA 3ZFMA 4F6WA 5DHRA 5DEYA 3VZCA 4O0UA 4EH9A 2WTKC 4JR3A 4RPVA 3NFGB 4ORKA 5FXSA 2I2AA 5J1WA 4UXQA 3EQPA 5DT4A 4DFNA 1KUTA 4AXDA 3TTJA 3W8QA 3D94A 3AC1A 1PXPA 3ZC5A 4O1OA 2BRFA 4G6OA 1DAWA 3ZO2A 4MUQA 2WIHA 4EC9A 1MQBA 4FGBA 3PPZA 2XVDA 4JBOA 2R3FA 4BZNA 3D0EA 3FYKX 1R3CA 4RIYA 2QCSA 5LMKC 5BVNA 2PE0A 5CTPA 3TKIA 2YIYA 4WUNA 1ZYSA 2CDZA 3ZUTA 2J0IA 3UMWA 2YACA 4W9XA 3P79A 2Z7RA 3GB2A 3HRBA 2Y6MA 4FG9A 4CFXA 3O17A 1Q61A 4EORA 3A4PA 5CU4A 1FPUA 3H0YA 4RIWB 4CT2A 5HG8A 3UNKA 3NVKI 4XH6A 2YISA 3HP5A 3E8EA 4EC8A 3UVQA 1EH4A 4WBBB 4CV9A 1ZYLA 3MA3A 1APME 3KC3A 2NYAA 3TM0A 2OKRA 3OFMA 1QPCA 2GTNA 3GQIA 3EZVA 3R9OA 4UN0C 2XMYA 4EONA 3F7WA 3DTCA 1LP4A 4AZWA 2R9SA 2GFCA 3PVUA 2QO2A 4NCTC 3COKA 3TZ8A 3EKNA 4ENYA 4IAKA 1IA9A 4BFMA 3FQHA 4D58A 4FZ7A 2CKEA 4FV9A 5KMJA 4XNEA 2PTKA 4IB1A 1MRVA 2HWPA 4EBVA 4FVRA 5DJOA 3DBDA 3Q9WA 2R0UA 5M4CA 4Q9SA 3QCSA 3GCUA 4C4EA 1M17A 3TXOA 4EHEA 3BBTB 2YEXA 2F57A 4J8MA 3F2NA 1XH4A 5AADA 3PRIA 2DQ7X 4V01A 4WOVA 4AS0A 4EOPA 3C7QA 4DFBA 2OIBA 5C8MA 2YHVA 4L45A 2JIVA 3GQLA 1JPAA 1E9HA 3P7AA 4FX3A 5GNKA 1Z5MA 2RG5A 3ET7A 4F4PA 5HQ0A 2FB8A 4GFOA 4WT6A 2PUNA 5DBXA 2QOKA 3UJGA 2B0QA 2JFLA 4L52A 2BIYA 4JQ8A 4TYHB 4HJOA 3K5UA 2V22A 3MB6A 2BHEA 5CLPA 4AWIA 3DITA 1K2NA 2XNBA 3CTJA 3FZPA 2UZWE 3FMDA 1OM1A 3IKAA 4ZTSA 3T9TA 4EZ5A 3QTIA 5TF9A 3MB7A 1KWPA 3KVWA 4WBOA 2P55A 4P2KA 5AP6A 4G17A 5B7VA 4A9TA 4TYJA 4RZWA 3VULA 2CN5A 3Q4UA 5LOHA 5M57A 1U7VA 3SAYA 4GIHA 4AA4A 4RSSA 2A0CX 2BDWA 3ANRA 3W0SA 3NNUA 2PVNA 4IIRA 5EYMA 4LRMA 3ZYAA 3KREA 2C3JA 1Z0ZA 3PPKA 1R1WA 4KABA 5ETAA 3VPYA 3TWJA 1JKSA 2XKDA 5HVYA 1FMKA 4YJSA 4EOSA 2FGIA 3BEAA 1DS5A 3O0GA 4GU9A 4D4VA 5J9LA 3GFEA 3GEQA 4MK0A 5DR2A 5C1QB 1DMZA 4YJUA 3A7IA 2X7FA 4YC6A 5L8JA 5HBJA 5KX8A 4B6LA 4N70A 4PDSA 3A4OX 1WZYA 4X21A 4ACHA 1I09A 5CAVA 2A19B 1OI9A 2YLFA 3GBZA 1PXIA 2PMIA 4GIIA 4B99A 5HD7A 3B8QA 3I81A 5E8XA 4O86A 4P4CA 2XIYA 4I6QA 2BDFA 4D2WA 2XF0A 5ITAA 3NGAA 1E1XA 3QTWA 3CD3A 3P5KA 1UU9A 3MIAA 3QKMA 4BTKA 3NZ0A 4YZDA 1XBBA 3FE3A 5AP1A 2OH0E 5K5XA 1OMWA 4G5PA 1FVRA 4M3QA 4GKHA 4GMYA 4ANNA 4FKSA 3MFRA 3SW7A 3TZ7A 3BU3A 5CENA 4FL2A 5IA2A 4USFA 2F9GA 3HUBA 1WBSA 3RGFA 3ELSA 2J51A 3I4BA 1GZNA 5CT0A 3D83A 3ORXA 4EHGA 3ACJA 2X8DA 5L2QA 3D7TB 5ACBC 5EJIA 5CAUA 3A60A 3SC1A 2XNEA 3QQGA 5CU0A 2YCFA 3POOA 1KE5A 2B1PA 5CASA 3F9NA 2Q5FA 5HVKA 4AT3A 3WILA 4E6CA 1ZY4A 1BI7A 1FOTA 4NL0A 3R1QA 1NW1A 5DMZA 4AU8A 3FKOA 2XKFA 5A6NA 4BWPA 1GZ8A 3LFQA 5HE0A 3Q2JA 4NKAA 1H1RA 1ZRZA 1WBPA 2PMNX 4CMOA 3MWUA 2I7QA 4F0FA 4BJJB 1JKLA 2OIQA 3UPXA 5DGZA 4APPA 4E4XA 1UHTA 3U8WA 5C9CA 3FLQA 4ZXTA 5JEJA 4UMUA 4YHJA 3W2PA 5J79A 5DHPA 3R9NA 2BTSA 5CSWA 1KOAA 3NUUA 5FBNC 3A62A 1ZYCA 4BBEA 5HD4A 4F7JA 2Q0BA 4U45A 1PXJA 2IW6A 3KY2A 1IASA 3ODZX 3R7IA 2Z8CA 2PSQA 3LIJA 3UG1A 4GSBA 4LGDA 2KB3A 4MXYA 4IWPA 1O9UA 2J6MA 2WMUA 4ZTQA 3LFAA 4FSZA 4D4SA 5ICPA 3Q2MA 1UKHA 2R3QA 2PVFA 3NYVA 4U9AA 3R30A 1PXNA 3TV7A 4BTJA 4FTQA 2W17A 3VF8A 4AGUA 4U79A 4K6ZA 3QZIA 5JEBA 1R21A 4FNXA 5HCZA 3FXXA 4GVAA 5EOLA 4D2PA 1K3JA 4ZJIA 3W18A 3RCDA 4FT9A 5JK3A 4FSRA 3NAYA 5BPYA 3OW4A 4HVHA 4ZSJA 4AGDA 1O6KA 4UWBA 1W0XC 2CKQA 3BI6A 2FYSA 4PL3A 5AJQA 4ZLZA 4FEQA 3KKVA 3PJ1A 1OGYA 3S1HA 2XT9B 3QA8A 2IZUA 5E8TA 2XH5A 4QCJA 4I21A 5IQGA 4F1MA 3NIEA 4OUCA 2OGVA 3UV0A 2XIZA 5AP5A 5FD2A 4R5YA 1YWNA 3PLSA 3QX4A 4N6YA 2WB8A 5LMAA 4RJ4A 4FTJA 3HEGA 5EKNA 3ID6C 3TDWA 4K11A 2WMVA 1IR3A 4G3FA 3BQCA 2O65A 2X6DA 2C6DA 1BUHA 3ZO1A 4MBLA 3TV4A 5DA3A 3E3PA 5LVPA 1ZYJA 3KN6A 3JY0A 2ETKA 3O8TA 4IB0A 3CSVA 2YDKA 4E4MA 4PTCA 2AYPA 3QBNA 1KV2A 4PWNA 1YXSA 3IK3A 3MH0A 2J0MB 4FTLA 5AP2A 4F1TA 5JN2A 4EK8A 2FA2A 4K77A 4E20A 4HAOA 2BUJA 2R64A 4C4GA 5CXZA 2XAOA 3R02A 2UZOA 4OAVB 4YZ9A 3V8QA 3MFTA 4ASEA 3VC4A 1ZAOA 1U0RA 4ZMFA 3UYSA 3WIGA 2AC3A 2OI4X 4JQEA 2YAAA 3QAME 4BCIA 4RC3A 2DWBA 2X7GA 2Y8OA 4V04A 4XV2A 1WV3A 3F6XA 2R3IA 4JS8A 2OJIA 3OUNB 2OFVA 3EQIA 4YU2A 1R39A 2HXLA 5AA9A 3DBEA 1ZZ2A 2EVAA 4DT8A 3VUMA 3KXGA 1OIRA 3KXNA 2OXYA 5JRQA 1KV1A 2WAJA 3UDZA 3A7FA 3DAJA 3IW6A 2KKLA 3KQ7A 3KRJA 4KRDA 1UNGA 5HE2A 4YO6A 3VS7A 3RTPA 3RAKA 4D5HA 1NXKA 3N51A 4YZMA 5E8UA 1WLNA 4JONA 3LLAA 1OECA