3I6UA

Structure and activation mechanism of the chk2 dna-damage checkpoint kinase
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
413
structure length
390
Chain Sequence
TPAPWARLWALQDGFANLECVNDNYWFGRDKSCEYCFDEPLLKRTDKYRTYSKKHFRIFREVGPKNSYIAYIEDHSGNGTFVNTELVGKGKRRPLNNNSEIALSLSRNKVFVFFDLTVDDQSVYPKALRDEYIMSKTLGSGACGEVKLAFERKTCKKVAIRIISKRKFAIGLNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILGPTYLAPEVLVAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and activation mechanism of the CHK2 DNA damage checkpoint kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase Chk2
total genus 107
structure length 390
sequence length 413
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00498 FHA FHA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3i6uA03
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 3i6uA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3i6uA02
4R3PA 4GKHA 2ITTA 4KIKA 4QP1A 3ZOSA 2C0TA 2HELA 4S30A 5FP5A 4AOIA 3QHRA 5J9YA 5BMSA 4C7TA 1JKLA 1OL7A 1RE8A 4R6VA 3VQHA 2Z2WA 2OH4A 4UBAA 5BQ0A 5TOZA 2P0CA 1OL6A 4H05A 4AFEA 2DYLA 3TTJA 3UV0A 4Q9SA 4DTBA 2CJMA 4K77A 5CSWA 5DH3A 3RPSA 3COIA 4C3PA 4DLIA 3LLAA 1U54A 5LXMA 5I9UA 5KMMA 4A0EA 2FH9A 1YWNA 2PE0A 3OS3A 2ONLA 4PV0A 1M2PA 2YCSA 2ZAZA 3DK6A 2C5YA 3EN4A 3NS9A 3R8LA 1UU9A 3EWHA 3JYAA 3PXRA 5I9ZA 4OT5A 2RIOA 3GQLA 3JVRA 4CFXA 3SRVB 3MGYA 4DGOA 2UZDA 3FZTA 3BU3A 3QA8A 2YM8A 4YC3A 2VTQA 2C5NA 3PY0A 1B39A 3GUBA 1OPLA 4FTUA 2F4JA 4QRCA 4FIIA 4JT3A 4BZNA 3RNIA 1IEPA 3P9JA 4KBCA 2Y9QA 3D7ZA 3GU8A 5D41A 4A9UA 2GMXA 4CYIA 3PSBA 5FWKK 4FIJA 3KEXA 4EH4A 2UZLA 1SVHA 4C4HA 4J98A 4OTGA 2X6DA 1YDTE 4FV7A 3RINA 4I5HA 5ICPA 5M57A 3V6RA 1KE5A 3FI4A 4R7IA 4DBNA 2I0HA 2YIRA 2WOUA 1E1XA 3KRXA 4X2NA 5CVGA 4JDIA 3NUUA 1WLNA 4GG5A 3TKHA 2ITQA 3DV3A 2HZNA 4M7IA 3C13A 1GOLA 3TXOA 1KE9A 4JVGA 4MXZA 2YDKA 3NEWA 2W96B 3FLWA 3GT8A 4IHPA 4U7ZA 5C1QB 4IM0A 4D1XA 3UDBA 3PIYA 2W1FA 1FMOE 4ZSEA 3QZIA 3QRTA 4MHAA 4YHTA 3WZDA 5CXHA 3TTIA 4CZTA 4IB1A 5I5ZA 3W2SA 1H00A 5HLWA 5L6PA 3FQEA 4CZUA 1Q8UA 4NM0A 5CAOA 3OOGA 1T45A 3MFUA 4L3LA 4S34A 3QC9A 4UMPA 3NYVA 3LCTA 2XCHA 1U59A 3PVUA 5JRSA 4DFNA 2NNWB 1Y8YA 5A4CA 1NY3A 2JEDA 3IW7A 3KRJA 3PA4A 2XNBA 4U3YA 4G1WA 4CRLA 2PUNA 3ZDUA 4D2SA 3N9XA 3IDPA 2VGOA 4HZSA 4IZYA 1R1WA 3R04A 1JKSA 3CJFA 3G90X 4WG4A 5HCYA 3W55A 4GL9A 4G5PA 1UVRA 5LVLA 4C38A 3SXFA 2IZRA 4PMPA 5FG8A 1NT2A 2CDZA 3UNKA 4RX5A 1Y91A 3BGPA 4V0GB 2YERA 1WCCA 3TWJA 3FL5A 4J96A 4WD5A 4AW0A 2H34A 3QUPA 4YTHA 4ANMA 2CLQA 4QMPA 2R7IA 3DXQA 4CKRA 2XJ1A 4PPBA 2YM4A 3DBFA 4AF3A 1PYXA 4G2FA 4F1MA 4PTCA 4CRSA 1WV3A 3FAAA 2W3OA 3HV4A 2CNVA 4ZZOA 3R73A 3C1XA 4G17A 4ZLYA 2JKKA 2PMNX 3RMFA 3FV8A 2JIVA 2PWLA 3HEGA 4YJRA 4M0YA 4AE6A 5TR6A 3GU4A 5JN2A 3G2FA 5L6WL 3RPYA 1DM2A 3HMIA 5HOAA 4JBPA 3NYXA 4HCUA 2FF4A 4BWKA 3D83A 3FYJX 1JKTA 3PJ2A 4E1ZA 2JLDA 4RVLA 4XV2A 1I44A 4DG2E 2PUIA 4EJ7A 2GNHA 3ZLSA 1ZZLA 2A4LA 1DMZA 4NTSA 1QL6A 4BIBA 4FT7A 3SV0A 3RAIA 2FA2A 3JUHA 3ZUTA 4I94A 4EQCA 4U44A 2W5HA 3BYUA 5IPJA 3W2QA 3TNIA 3FLNC 3IGOA 3VWAA 3LXLA 3MFRA 3FKLA 4QP9A 3MDYA 5E90A 5HI2A 4QTAA 3PRIA 3F5UA 2R3GA 2OJGA 2BMCA 4ANSA 3MY1A 5IH4A 4ZLOA 4EBWA 4F64A 3L1SA 2Z7LA 3DTWA 1CSNA 4H1JA 4YO6A 4MXAA 4F9YA 4GVJA 5E50A 4I41A 1W7HA 4XBRA 5AWMA 5J79A 4D55A 2ZB1A 4FKUA 3DXPA 1G5SA 2RL5A 3NUNA 1VZOA 2WOTA 4PL3A 4J8MA 4RIYB 1Q41A 4QT1A 3ROCA 5A6NA 2PVYA 2AUHA 3V5PA 4LYNA 3HMPA 4APPA 4GEOA 2UW3A 1UNHA 4YPDA 4MK0A 4UWBA 5FTGA 4MCVA 2W1HA 3CCNA 1DI9A 2QG5A 1OPJA 5T6KA 4EHZA 2CKQA 4GRBA 4EK5A 1O6LA 4FNWA 4BDAA 4CTCA 4ID7A 4O0UA 1YI4A 3KXXA 1QMZA 3LE6A 1XH4A 5AM7A 4BWXA 4FTMA 4L00A 2YDIA 3FMDA 4M84A 3R28A 4UV0A 4FIHA 3SD0A 2VWXA 3COKA 1GXCA 4LMUA 4ACGA 3U4WA 4O2ZA 5JZJA 5J1WA 2BROA 4NEUA 5AUYA 2LGCA 3WYYA 3UOJA 3RALA 4Y72A 3CC6A 3QFVA 1ZZ2A 3PXYA 3FMMA 2E2BA 3QCYA 4TYHB 3AD6A 3R01A 3AC3A 1SNXA 4EK3A 4U40A 2W7XA 3PO8A 4LRJA 4O0XA 4L42A 1ZYLA 4BY9E 5IISA 2IW6A 3BV2A 2R4BA 4ZOGA 3D9VA 3GCVA 3PA5A 5FM2A 3RHKA 4IC7A 1YKRA 3GC0A 3UGCA 2XJ0A 4X2FA 5HNGA 2ZYBA 4DFLA 1WBPA 1GIHA 3HUCA 3OMVA 4TRLA 4FL1A 3N4TA 3A60A 3TZ9A 2NP8A 3LMIA 1VEBA 3G0EA 1OPKA 1YOLA 2JFMA 4NKSA 4WG3A 2QO9A 1OM1A 2VO7A 5HHWA 2ZB0A 3TIYA 5LARA 2GS2A 1TVOA 2OF4A 3C4WA 3DOGA 1PXLA 3PIXA 2PVFA 5CAVA 3PZEA 2GDOA 2YAKA 2OF2A 4D4YA 2PVKA 4MBJA 4Z9LA 3TJCA 5CZIA 2OXDA 4DH8A 3TUBA 4MWIA 3A61A 2ITVA 4I5PA 4RC3A 1URCA 2C3LA 1ZMUA 5LMAA 1AGWA 1YXTA 3QUDA 5CSXA 2CKEA 4C37A 2UW7A 3DLSA 5LMBA 4EH3A 3ZUUA 3DK7A 5M07A 1DS5A 5F95A 4EOJA 4ZTRA 5AR4A 3FMHA 3SOCA 2WIHA 3Q96A 3VS7A 3K2LA 4WNOA 5ETIA 3A4OX 1UU8A 2JKMA 3FXWA 3R02A 2RFSA 2IW9A 3DPKA 5EI2A 3U9CA 4BRXA 1SVGA 3MPTA 1Q4LA 1WZYA 3ACKA 1ZMWA 4QMVA 2AFFA 4O0WA 4R3CA 2QOLA 2WQMA 2IW8A 2GCDA 5HNBA 1WBTA 4G3DA 5DLSA 3T3VA 4JR3A 3OXZA 2IVSA 3U8WA 4FUYA 2YABA 4IWPA 1XQZA 4L46A 3ITZA 5AR3A 5L2WA 2PTKA 4DFYA 5BUIA 3PLSA 4FV9A 3DGKA 2OKRA 2VGPA 2OSCA 1UWJA 1CKIA 4YO4A 5AUXA 2C3IB 4FTLA 3DT1A 1F0QA 2R3OA 4DEGA 4IB3A 2R3IA 4FGBA 3UMXA 4TYEA 4ITHA 3R21A 4BTMA 3LMHA 4PDOA 3KB7A 3B8QA 5J8IA 3QQLA 3NMUF 4FYOA 3LFDA 4TPTA 2ZM4A 4P90A 5H8BA 3MESA 3R8PA 2OU7A 4NZWB 4C2WA 2Z7SA 1BUHA 3NIZA 2ACXA 3GEQA 5FM3A 2QC6A 1NVRA 5ANJA 3EQFA 4FOCA 4QMTA 3KC3A 2VWWA 4LL5A 3GCSA 1LR4A 4BI0A 1IG1A 3BU5A 5EM8A 3Q53A 3QAME 2YN8A 4JRVA 3WILA 3GQSA 5I3RA 3DBDA 4L8MA 4L67A 2Q83A 3OCTA 2CNUA 4BKZA 1MRUA 2BAKA 4YJVA 2ITPA 4L01A 1ZLTA 3VJOA 3IO7A 4TWPA 3GC9A 4GUBA 4IZAA 4PTEA 4BYJA 3PPJA 2XNNA 2VTSA 2QCSA 1K9AA 4WSYA 3F5PA 4USFA 2CSWA 2UZNA 3REPA 4ARKA 5FBNC 3ORPA 3TG1A 5HORA 2BZJA 4AFJA 4F1OA 3PZHA 5EHYA 3F3VA 3Q2MA 2PU8A 4D28A 1Q8ZA 1JSVA 1IAHA 4D9VA 4FT5A 4NW6A 2JITA 3SX9A 1YHWA 2JDTA 4Q5EA 1K3QA 4NFNA 2UW0A 4RQKA 3NW6A 5EYMA 4FKRA 5HESA 2A19B 3NX8A 4C4FA 2C0OA 4QYGA 3NUYA 3V5LA 4L3JA 3IOKA 5EI6A 3PWYA 4KUJA 4MNFA 4H36A 1UNLA 4QP7A 3OZ6A 5I9XA 4PF4A 3F9NA 3TNHA 1K2MA 4GUEA 4X2KA 1OIRA 2F2UA 2OICA 3IW4A 5EDRA 5CI6A 4MBLA 4R77A 5DVRA 3F3ZA 4NM5A 4F7SA 3OCBA 2EH0A 3GP0A 4MD7E 3FMEA 2UW6A 4RJ7A 2WQEA 5IQIA 4FSRA 5EOLA 3POZA 4I0TA 1IASA 3EQDA 2F7XE 3Q9WA 5E1SA 2BFXA 4APCA 5F9EA 1YJMA 4H58A 2BDWA 3FI2A 3LLTA 3P86A 5FDXA 3EKKA 5ACBC 4JAIA 4C33A 5J87A 1UJXA 2BUJA 2WNTA 2WU6A 3PSCA 4MTAA 4EUUA 2OO8X 1ZRZA 3OW4A 4O1OA 5CS6A 1V0OA 3EHAA 5DGZA 3ALNA 5KX8A 1R0EA 3QC4A 5KZ0A 1UNGA 3AD5A 1NVQA 4FL3A 2WO6A 1CKPA 3FKNA 2YLEA 4EEVA 4K9YA 2OIQA 3LFAA 4IC8A 3ATTA 5GZ9A 4FNXA 3DLZA 4RLLA 4TY1A 1YI6A 3C50A 4PUZA 4QPAA 4ACHA 2Q0NA 4U41A 2UZEA 4UYNA 2X6EA 5FXSA 2V5QA 4BKYA 4Y85A 4J71A 1R3CA 4O21A 5DYJA 3DBEA 3SKCA 2VNYA 1KV1A 3E5AA 2E9OA 2X8IA 4K18A 3U9NA 3V01A 3O7LD 3QHWA 1H1PA 3G5DA 4XG6A 5DG5A 2EXMA 3MWUA 2PVMA 4E73A 4G2SA 2WMBA 4LI5A 4X6QC 3ZO2A 4LOQA 4BF2A 3ZCLA 2XK8A 1NA7A 3I6UA 2R5TA 3N4UA 4UEUA 3ZDIA 2ESMA 5KKRB 4P4CA 3UNJA 3MJ1A 1Q5KA 3I81A 5CAPA 1PMEA 3R0TA 3OC1A 4QD6A 2FB8A 4LUDA 2UVZA 5KNJA 3ZXZA 1SVEA 4CGAA 4KSQA 5C4KA 3SA0A 2J50A 2LC1A 3PE2A 4EONA 4ANOA 4UALA 3P5KA 5IH6A 3KXZA 5EHOA 2J0MB 1WVWA 5FBOA 1J4QA 2AC3A 4F6SA 4RJ6A 1B6CB 4K1BA 4ALVA 4AU8A 4TW9A 5LVNA 2YZAA 5K9IA 3OEFX 1M2QA 3L9NA 2GHLA 2WZJA 5ANDA 4XG7A 3CTHA 4BCNA 5BVEA 1PW2A 3MH3A 4IACA 4EJNA 3QQUA 3RPVA 3IQ7A 3UNNA 5CEIA 2YWPA 4XG3A 1GY3A 3UE4A 3S95A 2O63A 4JR7A 5JFWA 3SQQA 3ZRKA 3CIKA 4NU1A 1RJBA 3ZZWA 3QALE 2W06A 4HOKA 2VX3A 4C34A 3G9LX 3C5UA 3R8MA 2WTJA 1YOMA 2JDSA 4BI1A 4HPTE 4BIDA 4CT2A 5HLNA 2X9EA 3EFLA 3KCFA 3ELSA 2WEIA 4C0TA 2IJMA 3MPAA 5FXQA 3P78A 3V8TA 3LCSA 2DWBA 2JIIA 5AAEA 2R3PA 3BWJA 4EH9A 3O23A 2X81A 4BL1A 4EHGA 4PNIA 2B9HA 4D4VA 5CF8A 4USEA 3EIDA 5LQFA 2FYSA 3LQ5A 4FTCA 2QLQA 3UPZA 4FKQA 4IAKA 4L3PA 3DQWA 3VUTA 3UNZA 3DDQA 3OOMA 1PXJA 1JWHA 2VWBA 2UZBA 3DFCB 4IB0A 4MEDA 4NK9A 5C8KA 4PP9A 4YHJA 3WF5A 3OHTA 3KCKA 4HJOA 4MXXA 1OGUA 1H1WA 4DLJA 2WMRA 3UODA 2RF9A 3AC5A 4G3EA 2XT9B 2J51A 3HX1A 5HX8A 4I6BA 5ANKA 4BBFA 4C61A 1QPCA 4EYJA 5GZAA 3E87A 4N6ZA 5ETAA 3HA8A 4Z7HA 3ZC5A 3OTUA 5EDQA 2BDFA 4F9AA 1OKVA 5T3QA 2Z7QA 2VWVA 3NGAA 5IMXA 3U6JA 4B8MA 2JPEA 1K3NA 3RAKA 4YPSA 5I3OA 3U6IA 1MRVA 5JGAA 4XOYA 1J4OA 4GIIA 3BHHA 3FZOA 5JFSA 2PL0A 3F2AA 1WAKA 2BDJA 2WU7A 4GT3A 4RA4A 4JOAA 3OW3A 3ZSIA 4F0IA 4AZEA 5HICA 2VTIA 3VF8A 3QLGA 3ENHA 4BDKA 2REIA 3AG9A 4FNZA 4BCKA 1CMKE 3QRJA 4P5QA 3LFFA 2OXYA 3HMNA 3L9MA 2HCKA 4X2GA 2YDJA 4RRVA 4I1ZA 4I20A 3MFTA 4CNHA 4BHNA 4RX8A 4M69B 3QTSA 4Z55A 3MVLA 2ETRA 3H9RA 1GJOA 1UKIA 2F49A 2RFDA 3UG2A 5AUUA 1VR2A 4RWKA 2VD5A 3PG1A 3ZONA 3DJ5A 1Z9XA 4FE2A 3HKOA 4RIWA 3TEIA 1PKDA 3RWQA 3AT3A 4XRLA 5L3AA 3EB0A 3V5JA 2CMWA 1Y6BA 1YI3A 1REJA 2OJIA 3KU2A 5M4FA 1LP4A 3MI9A 3VBXA 3GCQA 4YZBA 2HW7A 3F3TA 2XCKA 4X3FC 3W2OA 3B2TA 3G9NA 4NM3A 1JSUA 4NCTC 4GK3A 3UIBA 4J99A 5EHLA 4BWPA 4CFNA 2WMTA 4EOIA 4WT6A 5M06A 2HXLA 4PWNA 4BDCA 4RVMA 4BN1A 4YU2A 5JT2A 1IA9A 2C5VA 5B7VA 2C6OA 3R7GA 3VIDA 3G6HA 1X8BA 5A6OA 3CJGA 3ZU7A 3RZBA 4JQ8A 1OL5A 5AP1A 5E8XA 2WXVA 5GIOE 1XH9A 4U42A 4UYAA 4G16A 5EYCA 2ERZE 3PP1A 3E8CA 4X7QA 5A3XA 4FVRA 4D5HA 2XIZA 2OIBA 3FHIA 4F6WA 4E7WA 2XIYA 4PDYA 2YIXA 3VS1A 4QMNA 1WFCA 5CEPA 3D94A 1K3JA 3KMMA 4QP6A 3E8DA 2OJ9A 1YXVA 4BC6A 3IK3A 4E4MA 4KBKA 4CVAA 3LXNA 5HCXA 2ERKA 1BI7A 4XP2A 3WF6A 4EWHA 4FT9A 3OF0A 5FGKA 3CKXA 1WBOA 1XJDA 3LM5A 4X6RA 5LVPA 3NDMA 5M55A 4RFYA 2C1BA 1O6KA 4R3RA 2J9MA 3PY1A 2PZPA 4F7JA 4G5JA 3R9DA 2VO3A 2GNJA 4FV0A 4XG2A 4RG0A 5HG8A 3VUIA 1OIYA 2E9UA 2OFUA 1MQ4A 4BCHA 4CFWA 2HK5A 3BBWA 4HNFA 4EKKA 2PPQA 3VJNA 5AIKA 4QP4A 1U5RA 1WVXA 2UZTA 4W9XA 4I0RA 2W1CA 4AGUA 3CGOA 4Z7GA 5A4EA 2KKLA 5D10A 3P7AA 3VUGA 4E3CA 4CT1A 2W9FB 3VW8A 3RK7A 1MP8A 4OTIA 3I1AA 2NPQA 4M67A 4AWIA 1IRKA 2EB3A 4WIHA 5JGBA 2IN6A 2V7AA 1J7UA 3UP7A 3FY2A 4YR8A 5EG3A 5D9HA 3TKUA 4JIAA 2XIKA 3LCOA 4M0ZA 2RG6A 2R3QA 5AMNA 4MYGA 5HE1A 3F7WA 3P08A 2Y4PA 3E3PA 1P4FA 3R9NA 3TZMA 4CG8A 1UA2A 2C47A 4O0TA 5A46A 3FI8A 2O0UA 1UWHA 1H28A 1OMWA 4R7HA 3WBLA 1FVTA 4QTDA 4G34A 3CPBA 1S9IA 4MXYA 5DT3A 4FEVA 2XVDA 2J0JA 4XMOA 1A48A 3LFNA 5AV2A 3FSKA 2ETKA 3FLQA 3KXGA 3ZBXA 3EN6A 4DEIA 4ZZMA 2BRBA 3RWPA 3N4VA 3BLRA 3QXOA 2GQRA 3K5VA 4DF3A 3KK8A 2UZOA 5HLPA 4AGDA 3IW8A 3D5VA 3W18A 4IFGA 4A9SA 1SM2A 4HNIA 2CN8A 3HLLA 3I5ZA 5HO7A 5CYIA 3CBLA 5G6VA 3KY2A 4BCOA 4Y46A 2KFUA 2B53A 4IVBA 4DINA 4YSMA 3FWQA 2XYNA 4GS6A 4FF8A 2XKCA 2I7QA 1XH8A 4HGSA 3D4QA 4OUCA 2ZDUA 4B0GA 3FUPA 4XS2A 4O7NA 2DUVA 1KSWA 4R8QA 4PX6A 4ZTNA 4EC8A 4O91A 4FZDB 4I3ZA 3ZLYA 4EQUA 3R8UA 4N70A 4F9WA 3EQCA 3LQ3A 5HE2A 2OG8A 2XJ2A 1PMVA 3L9LA 3MFSA 3DKCA 4OTFA 4BHZA 3GCUA 5C03A 4J7BA 3MB6A 4Y5QA 5HBHA 5K4JA 1JBPE 4WKQA 4D0WA 5E8TA 2X8DA 3SW4A 3MTFA 5M4CA 3TN8A 4YJQA 4UXLA 4RVTA 4F9CA 4NWMA 2ITOA 5IQGA 4ORKA 2PZ5A 1TKIA 3VBYA 3P4KA 2GTMA 2W1ZA 5D7AA 3QTXA 5CENA 4YC6A 1WBVA 3VA1A 3HDMA 5CNOA 2WTVA 1OL2A 3A7FA 1YHSA 2PE2A 2WB8A 4KB8A 5FD2A 2B0QA 3ANRA 3E92A 4B7TA 4USDA 4RSSA 4YUQA 4QP8A 1BX6A 1H27A 3T8OA 4EHEA 4CFUA 3VF9A 3QCXA 5AV4A 3RM7A 3GC7A 2B7AA 4XYFA 1XBBA 4GU9A 2XM8A 3E88A 1QPDA 3FMJA 4CLIA 5L2QA 3RPOA 3W2PA 4EOLA 4ACMA 1OKZA 4H3QA 2X7OA 3T9IA 4DG0E 3IONA 2VN9A 4BVUA 2YWVA 4FG8A 4OW8A 4D2VA 3ZM9A 2XKDA 4KIKB 3EN5A 3H3CA 3ZO3A 3EYHA 3VUDA 4BBEA 4UN0C 1E1VA 1MRYA 2B4SB 1GIIA 1H1QA 2PVNA 2QR7A 2A0CX 4IQ6A 4HGTA 4AS0A 4BGQA 4ACCA 5H9BA 5ACKA 2C6IA 2GHGA 4EOKA 4HYIA 1REKA 2WMAA 5BYZA 2OZAB 3KF4A 2BHEA 4LOOA 5H8EA 3UOKA 4C4EA 5HKMA 1PKGA 4G31A 1SYKA 3TJDA 4XV9A 4IJPA 1GZNA 2QI8A 4FSTA 4C35A 4I6HA 3P23A 3UYTA 4IAYA 1BI8A 5FRIA 4OBOA 5IA4A 2VTMA 3RGFA 4BICA 4YZNA 2W5AA 5JEBA 4PMMA 5FP6A 4MAOA 1M2RA 3RK9A 4O82A 4A4OA 3VULA 4IXPA 1YOJA 3AXWA 2XIXA 3ZC6A 5J7HA 4JLCA 2G2HA 2P2IA 3EYGA 4HZRA 2G1LA 1PXIA 3QTUA 1H8FA 3KRLA 3GBZA 4FKSA 4FVPA 5EW9A 4BCFA 4L44A 5HG5A 5DPVA 3U4UA 1G3GA 5E91A 2YISA 3FY0A 4Y73A 2EU9A 3BEGA 3FPMA 2PULA 3QRIA 3HUFA 4XRJA 4UZDA 3WE8A 4CQEA 3E8EA 4JONA 4QPMA 3LVPA 4EH2A 5DR9A 3SXRA 4QQTA 2I40A 2HYYA 3UC3A 5IZFA 3Q9YA 2GU8A 5J5SA 3L9PA 4IVDA 1STCE 3VS6A 3QBNA 2EXEA 4C3RA 2R9SA 3KN6A 3NNVA 3UVRA 3OT3A 2XA4A 3NUSA 3OWJA 3OBGA 5CU2A 3UOHA 3ZFXA 2O3PA 3TUDA 4QMWA 5KMKA 2C6KA 3PXZA 1ZYJA 3II5A 4I0SA 1RQQA 4O0RA 4U5JA 2VTPA 4NIFB 3DKGA 4NIFA 5AR5A 3UVPA 3TI1A 2ZDTA 3ERKA 4QQJA 3ZFMA 4QTCA 4D2RA 4DT8A 4S31A 2WGJA 4B9DA 4DAWA 2QURA 4C58A 3LQ8A 4FSNA 3PRFA 3TACA 5IQCA 4E6QA 3ULZA 5IEVA 3R7OA 4DTKA 5L4QA 3LOKA 4RWJA 3SVVA 4FTQA 3R1NA 2ETMA 4P5ZA 4TWNA 3OUNA 3OXIA 2GNGA 3FZPA 4JRNA 2WQOA 3ZRMA 2FSOX 4GFGA 3H4JA 4K0YA 4V0GA 5IA1A 1L8TA 3RKBA 3BELA 2XK4A 3VUHA 1W83A 2QU5A 5DRBA 4F08A 1XKKA 3VS5A 4ZMEA 2XEZA 5E7RA 3U51A 4F6UA 2WQNA 3WF8A 2JFLA 5H8GA 3R8ZA 4GKIA 2XMYA 3UQGA 2JIUA 2XK3A 3O50A 1FINA 1YVJA 4FSMA 1P2AA 1M52A 5EH0A 4FTIA 1R78A 5ETCA 4O1PA 5EKOA 2NRUA 4BDEA 3LHJA 4F7NA 3BHTA 4E6CA 3GGFA 3LJ0A 2PK9A 4I5CA 4GK4A 4JDHA 2ITYA 3K54A 4M12A 3MV5A 5T68A 4AX8A 4GK2A 4TWCA 4KKGA 4F09A 4NFMA 4FR4A 3UO4A 1IA8A 4BGGA 4RC2A 2VWUA 4B4LA 2I1MA 4U79A 3UO5A 3H0YA 5L8JA 2O5KA 5AV0A 3M2WA 4CMOA 4IZ7A 3HMOA 4DG3E 3Q6WA 4HYHA 4ZJIA 3CGFA 3LCDA 3QZGA 5F20A 2WMVA 5HU3A 3TV4A 3FDNA 5M4IA 3AGMA 4FICA 5B2MA 3PY3A 4FV8A 3KL8A 1WVYA 4J97A 4K6ZA 2VTHA 2XUUA 4ZMFA 2JDOA 2V22A 2JKDA 3HRCA 3QYWA 3ZS5A 1FGKA 3MH0A 4TKSA 3Q60A 4EC9A 4YNEA 4UY9A 3ZO1A 4BGHA 4HCTA 1PXKA 4D9UA 3ZHPC 4BDIA 5HTCA 5M4UA 2YACA 4FV1A 2PVRA 5K0KA 3PA3A 3RI1A 2G9XA 5IEXA 5EOBA 4O38A 3O8TA 4FZAB 4BDBA 2RGPA 3HA6A 3MIAA 3HMMA 2C69A 4IX6A 2V62A 4GW8A 4FEQA 2G15A 2VV9A 3UIMA 3FSFA 5EW8A 4ZJVA 4G3CA 4FG9A 5EM7A 1H26A 2Y8OA 1OUKA 1Q8WA 2VUWA 5AR7A 4EZ7A 4YGAA 3MA3A 2XK9A 3TUCA 2UV2A 4BZDA 5ANEA 2ZV9A 4AW5A 2AYPA 4KRCA 5A9UA 4BZOA 2JQLA 5DT4A 5M53A 3C9WA 3KRWA 3VVHA 3QTIA 5IQFA 5HVKA 1Z57A 4TYJA 2BKZA 1XH7A 4FTRA 5TO8A 5I9YA 5IUGA 4O22A 5CAQA 5C4LA 2C6TA 1OZ1A 3NYNA 3QTWA 3FZSA 3ZBFA 3BYMA 5AP2A 2HOGA 4MWHA 2WTCA 1GAGA 3OT8A 3EFJA 1ZXEA 2QVSE 3QTQA 3R1SA 4AZTA 4C57A 4D1SA 4KWPA 2XBJA 5IH5A 4J95A 4RZWA 3RNYA 4XEYA 1S9JA 4ZTSA 3HP2A 2XNMA 5DN3A 4AG8A 2X7GA 2Y6MA 4IAIA 4D5KA 4H1MA 5AUZA 1YXUA 2PVJA 1DAYA 3CQWA 3POOA 5EFQA 4NUSA 4FIGA 1LUFA 4J53A 3P79A 2VAGA 3PE1A 5HBEA 4A06A 4QMYA 5EYDA 4DGLC 4HYSA 3OFMA 3OXTA 3GU7A 4O2PA 1G8AA 4FT0A 4IH8A 2BRGA 2UVXA 5BVOA 4DCAA 4EOSA 3G51A 5JFVA 3GU6A 3ORLA 3AT4A 4NL0A 5A4TA 4C02A 2BZHB 3QCSA 5GZ8A 3BX5A 3EFWA 4WOVA 2QOCA 2J2IB 4JDJA 5J9ZA 2JAVA 1MZKA 3O8UA 3GCPA 4JG8A 5IKWA 2IPXA 2FGIA 4FX3A 4ZS0A 4H39A 2QO2A 1MUOA 2PY3A 3KMWA 4DH7A 3ORIA 2GFSA 5DNRA 3GQIA 1CKJA 4QQ5A 4QNYA 4RIOA 5A4LA 2ITWA 5M44A 4NM7A 2OI4X 1XWSA 2W1GA 3DZOA 4L45A 4RMZA 4WRSA 2QO7A 3IS5A 5JRQA 3QF9A 1BKXA 3FQSA 4RFZA 3BHYA 4WRGA 4K11A 3S2PA 2CKOA 4XUFA 2WQBA 4EI4A 4NW5A 3GFWA 5L2IA 3TL8A 1G6GA 4Z3VA 5AUTA 5K0XA 1QPJA 1OVEA 4P2KA 4PDPA 2OIDA 3VS4A 4BCIA 4HW7A 4YLLA 3JS2A 1Q99A 4JG7A 4D2TA 4EH5A 4Z16A 1IAJA 3OCGA 3VNTA 4L52A 4EH7A 3VS2A 4EQMA 2AC5A 3AMYA 3COHA 3RAHA 3HV7A 5KUPA 3LFQA 4AZFA 2OGVA 4PY1A 3RTPA 3QX4A 4OTQA 3OUNB 1WBWA 2ONLC 2HIWA 3HP5A 2XNOA 3IG7A 5ANGA 3TIZA 4JQ7A 5LWNA 2YCQA 4QQCA 2Y0AA 4QOXA 3UMZA 1YXSA 2PIEA 2GS7A 4O0YA 4EOPA 2ZMDA 3GU5A 4YMJA 1HOWA 2CGXA 4W9WA 3BE9A 1W8CA 3EQIA 1JKKA 2G01A 3BE2A 3FXXA 3PIZA 4FEUA 4HGLA 4KAOA 1GZKA 4O0SA 4D58A 1JNKA 3KGAA 3C4XA 4HVHA 3DJ6A 4FIEA 2C6MA 2PYWA 4LV8A 5LCKA 4FVQA 3UC4A 5DMZA 4YBKA 2QKWB 3CQEA 2X7FA 4ZSGA 1OB3A 2B1PA 3EZVA 3HZTA 5BYYA 2WIPA 3PYYA 4D1ZA 1CDKA 4RWLA 4Y8DA 4FTTA 3MN3A 4XV3A 3RM6A 2FVDA 2BILB 4G9CA 4FKPA 5M08A 4FSQA 3CY3A 4CQGA 4C3FA 3NNUA 2UUEA 4O6EA 4QPSA 4QTBA 3SLSA 3SOAA 4C2VA 4DGGA 3I0MA 5GNKA 2O8YA 2BTSA 1J1BA 3LJ1A 3OEZA 1O6YA 4RA5A 3WF7A 4A07A 1K3AA 4DGNA 1BMKA 1U4DA 1H0WA 2W4KA 3BYOA 3DBQA 3R22A 4M14A 4YZCA 5CZHA 5E8UA 4YJTA 4ZY6A 5HU9A 2IVTA 5AV1A 2R3JA 3SDJA 1LGQA 2OBJA 1WBSA 3QL8A 2CKPA 3HGKA 4FL2A 4EORA 3RCDA 5EDPA 4IZ5A 2O64A 3O96A 5CAUA 1FHRA 4DEHA 3HAVA 4MD9E 4PTGA 3R2YA 3OP5A 3F82A 1M7QA 4IWDA 4KIPA 5DT0A 3KT9A 5AAGA 4S32A 2WHBA 5JH6A 4ZSJA 2XK6A 4OAVB 4YSJA 4N0SA 4ENXA 3LM0A 4E5AX 4EK6A 1GNGA 4DHFA 3GNIB 1XR1A 1ZY4A 2B9IA 3DQXA 4JX3A 2KTYA 4FV4A 4K8AA 5E8YA 5GJDA 2GNFA 3FPQA 4PP7A 2UW9A 3QU0A 5FTOA 3NNWA 3S0OA 4LRKA 2I6LA 5F1ZA 4XNEA 3ELVA 4JBQA 3C0HA 3FLYA 5CT7A 5D12A 3R7EA 5KBQA 5FEEA 2VO6A 2X2KA 2JAMA 2QOHA 1CTPE 3FZRA 3IPHA 2WMWA 4OR5A 3HV5A 3R7VA 3UIXA 3AQVA 3ZH8A 4AA0A 5C01A 3A7HA 4E8AA 1RDQE 3I7CA 4DT9A 4TNBA 4O84A 4AZVA 1W82A 3OUKA 3ZEWA 4BB4A 4GG7A 4YZMA 5KHWA 2HY0A 3HAMA 2JQJA 4BBMA 4ASEA 3BYVA 4TNDA 1BYGA 4G3FA 4JQEA 3SHEA 1IR3A 4D0XA 1BLXA 4OTDA 5E8VA 4OLIA 2C1AA 3ULIA 3VUKA 4ZLZA 1P4OA 2CN5A 3BKBA 5HD7A 4PL4A 3Q32A 3BCEA 3NWWA 4EZ3A 3IDBA 4MXOA 3MW1A 3TZ7A 3EQRA 3QYZA 3ZYAA 3E7OA 3R8VA 3NCGA 4CV8A 5IQAA 3CXWA 5CI7A 3FKOA 2C0IA 4ZJJA 2W05A 3TKIA 5C9CA 2ZMCA 5H2UA 3QGWA 2X4ZA 5CQUA 4ZY4A 3HVCA 3DB6A 1H1RA 3H9FA 4I24A 4Q2AA 3ORMA 1TQPA 3UN0A 2J6MA 4FT3A 5C26A 2YJSA 1B38A 1YWVA 2PHKA 3C0IA 3HDNA 4AE9A 4EJQA 1W84A 4WNMA 4Y5HA 3R1YA 3H9OA 3K3JA 3BI6A 3UOTA 4MVFA 5E8SA 3M42A 3SGCA 1PXPA 2G1TA 3W1FA 3VHKA 4FOBA 3SRVA 5A4QA 5IA0A 4AN2A 4O27B 4DTAA 4KABA 5AIRA 4EOQA 3MVMA 2A2AA 1ZYCA 4XJ0A 1A9UA 2CGUA 4OTRA 5KKRC 4FK6A 5TE0A 4H3BA 4J8NA 5HEZA 2NO3A 3OBJA 4Y95A 2CLXA 4TN6A 3T3UA 4O7SA 4EH6A 1ZYSA 1PRYA 4V05A 5IUIA 4KRDA 3LMGA 4I21A 4QMUA 1KV2A 1NVSA 3W8QA 2ITUA 3V51A 3UZTA 3WIGA 4IX4A 3WIKA 5HGIA 4TL0A 2YM7A 4CCUA 2QONA 2EVAA 5F94A 2HZIA 4F63A 3L8VA 4CFMA 4BIEA 4F70A 3UNMA 4WUNA 5IA3A 2YEXA 5AP5A 4X3JA 4YJSA 2YFXA 3WZKA 3ZSGA 5L6OA 3O7LB 3CS9A 3LCKA 5G1XA 3QZFA 4CMUA 2XS0A 1H01A 5E4HA 4IAFA 3ZO4A 4X21A 5BYLA 5IQBA 2HW6A 4ENYA 4DH3A 1QU5A 5AV3A 3VA4A 3Q5IA 4PNKA 5CU3A 5DI1A 5ANIA 5I4NA 5HD4A 4HPUE 4MQ2A 2XZSA 4EZ5A 3VPYA 3R63A 4MKCA 3LPBA 4F0GA 4RZVA 5CNNA 3BGZA 5BMMA 3U6HA 2R3RA 1JVPP 1U5QA 3DCVA 3VO3A 3FM8A 5EM5A 3E62A 1Q8TA 3SAYA 3UG1A 3S3IA 2UZWE 1O9UA 4O7ZA 5FQDC 4DEAA 2P2HA 2Z7RA 4JL9A 1DAWA 5JQ8A 3B2WA 4FA2A 2Y6OA 4FSWA 1UKHA 4YJPA 5AUWA 3NSZA 5EM6A 3RK5A 3LFSA 2VX1A 3PTGA 4E4XA 5CF6A 3SW7A 3EOCA 3PXKA 4GT4A 4HCVA 4FODA 5CVFA 4FTKA 3IW5A 1OIQA 2X2LA 1KE8A 4FTAA 3BBTB 4FGRA 3BPRA 3D14A 4DFXE 4BCPA 5JMSA 1KE6A 2PE1A 4W4YA 2QOFA 4R7BA 3TV6A 3TDVA 4GCJA 4HVDA 2B9JA 2CGVA 4HYUA 2BR1A 4W4WA 2YJRA 2HXQA 3QD3A 5DJOA 2VWIA 1VJYA 3UP2A 2BALA 5IA2A 4UZHA 4L9IA 5KO1A 1Y8GA 2JKOA 2XRUA 3BHUA 2Q0BA 3D2IA 3D5UA 2CPKE 3OG7A 2PZYA 4GVAA 5AEPA 3BRBA 4FC0A 1UV5A 2QKRA 4NCTA 2W17A 3N51A 4QMOA 2VX0A 3A7JA 3C4CA 3OY1A 2VWYA 3RBWA 2JD5A 1LPUA 2PVLA 3PUPA 3WOWA 1ZOEA 3HUBA 3F7ZA 3QKMA 1H25A 1NW1A 4O7LA 3FHRA 2XYUA 4F4PA 4WA9A 5AP4A 2BAQA 3BEAA 1XBCA 3ZLXA 3GOPA 5JQ5A 1U46A 4II5A 2EWAA 4JS8A 2JDVA 3ZTXA 3KN5A 4IX3A 3ACJA 2KULA 4JBVA 4RBLA 2B9FA 3FI3A 3UZRA 4OBPA 1R21A 3GVUA 2E9NA 1Q3WA 3Q4UA 2R64A 4ZIMA 4IIRA 3VC4A 4G6LA 4BKJA 2VTLA 5KMLA 5B2LA 2BKKA 2KB3A 3AMBA 5GJGA 4XCUA 4DA5A 2XNEA 4O7YA 4EK8A 4YZ9A 3Q3BA 5BNJA 3Q9XA 3W2RA 5HNIX 1KWPA 4L7FA 4O86A 1JSTA 5HVYA 3ZM4A 4KS7A 5EQPA 3OWPA 4WBOA 3KREA 3I5NA 3UPXA 3QX2A 5CU4A 4IVCA 1YHVA 4WBBB 4BCGA 5FEQA 3WZEA 1FGIA 4O7TA 3BHVA 2R0UA 2BZIB 2QOIA 2QODA 3NPCA 2C68A 3QWJA 1XO2B 2VTAA 5F4NA 4D4RA 4ITJA 4AT3A 3AT2A 4TYIA 1H07A 2C6DA 1XH5A 2J0LA 5CY3A 3F61A 5B0XA 2A1AB 4B8LA 4E26A 2OJFE 1PY5A 4A9TA 3L8PA 2C5XA 1QPEA 1PJKA 2J4ZA 3IOPA 4RIXA 4W8EA 4ERWA 2OW3A 4V01A 1UHTA 3G6GA 2YCFA 4C59A 4A9RA 4G6OA 2HY81 4E20A 4BTFA 3NVMB 5D11A 1MQBA 3OWKA 4ZTHA 4XG9A 1FPUA 2UVYA 4IB5A 3PP0A 3I79A 5HVJA 1YRPA 2F2CB 3VUMA 5BVKA 3UO6A 1TQMA 4NTTA 5J5TA 2FEZA 4FEXA 4RJ5A 4RQVA 2LAVA 2CHLA 2XKEA 3FMLA 3CPCA 4PL5A 4ZP5A 3EKNA 5CEKA 3DY7A 4ITIA 4L53A 4QP3A 3DKOA 5IDNA 1F3MC 3T9TA 3R30A 3HRFA 4C4GA 3D2KA 4MBIA 5IQHA 3VBTA 2G2FA 4R1YA 2GHMA 3VBWA 5CVHA 3RHXA 3BZ3A 4L43A 5L8KA 4N57A 3DK3A 3CLYA 1YDRE 2WMXA 3BIZA 3CR0A 4FSUA 5LMKA 1URWA 3A7GA 3O71A 5HCZA 1Y57A 3WZJA 3H30A 4FSYA 5KCVA 1PXOA 3BLQA 5JGDA 4OTWA 4LGDA 4D9TA 4IWQA 4AUAA 2X0GA 5KE0A 1U54B 2FSMX 5IQDA 2RFNA 1J4PA 3ET7A 5BPYA 4LRMA 3RZFA 4IAAA 3LZBA 2QG7A 3PFQA 2GS6A 2IZSA 3AC8A 4X0MA 4KS8A 5DR2A 4IANA 4IBMA 5HE3A 4UB7A 4DEEA 5EKNA 2KB4A 4WG5A 3O0GA 4AA5A 4LQMA 3EN9A 5AJQA 3GC8A 4D4SA 5I9WA 3VW6A 4I6QA 3MDBA 1BL7A 2JKQA 3DA6A 3QKLA 4ASZA 4CKIA 3OD6X 4O81A 2W4JA 4DE4A 5GHVA 3Q4CA 1E9HA 3F5GA 3MVJA 3EN7A 3ODYX 3FC2A 4YJUA 4FV3A 3ZMMA 3MH2A 4F7LA 4CYJA 3DZQA 4P7EA 5IA5A 3DXNA 2E9VA 3F88A 3QQGA 4QYFA 3LKMA 4ZS4A 1M14A 3GOKA 3ORZA 3V5WA 2VWZA 1KOBA 3FBVA 4MH7A 4RVKA 3NCZA 4C36A 3QLFA 4G6NA 3JY0A 4BDFA 4LOPA 1J91A 2YM6A 1GIJA 3RAWA 4DH1A 2GTNA 2HAKA 2H96A 5AP3A 4CD0A 3JY9A 5AX9A 4IDVA 4O7VA 4V04A 5CWZA 2PMOX 4RWIA 5GIPE 4X2JA 4FK3A 3VS0A 1GZOA 5KZIA 4C4IA 5IU2A 4MQ1A 2YLFA 4JI9A 2ITXA 4WO5A 1Q97A 4FIFA 1J4LA 2IVUA 5CLPA 3G33A 4E6DA 3O17A 3LXKA 4NYEA 4KSPA 2QOQA 4JDKA 3IGGA 4C62A 4GU6A 4OTHA 3R9HA 3KULB 3FXZA 5TKDA 4BDDA 5CEOA 4I6FA 4TWOA 3R9RA 2P33A 4ZY5A 3I0OA 3LAUA 3UBDA 3D15A 2ZJWA 4BCMA 4RX7A 4LM5A 1YQJA 2QOBA 4A4LA 5AP6A 4XV1A 5GJFA 2BRMA 3RCJA 3WF9A 3HYHA 2JGZA 4RIWB 1KUTA 5ITAA 5I0BA 3FLZA 3W8LA 4S2ZA 3QA0A 2R3LA 3P7CA 3DAEA 2PMIA 3CTQA 1SNUA 4U8ZA 4U80A 4UMRA 1QCFA 2BCJA 2C3KA 4I23A 4DEDA 4KIQA 1V1KA 2VTJA 4AQCA 4RGJA 3EL8A 3V8SA 4IE9A 4CFVA 4UXQA 4UX9A 4IMYA 4KA3A 4AACA 2OXXA 5DRDA 4EKLA 4GYGA 1PYEA 4NT4A 5DBXA 3S4QA 2W9ZB 5IUHA 3Q5ZA 2BRNA 3LXPA 3Q4TA 4QYEA 5C27A 4C8BA 1P5EA 4CZYB 5A14A 4KD1A 4U9AA 3PLAE 4HVSA 1ZWSA 2WTDA 4U45A 4IDTA 1AQ1A 4G9RA 4OTPA 3U54A 4GIHA 4GYIA 3E93A 5E92A 4RIYA 4EUTA 5CEMA 4M3QA 5TF9A 4A7CA 2YIYA 2V7OA 4OGRA 3LFBA 3BQCA 4CXAA 3QD4A 1OKYA 2YIQA 1R39A 2ZM3A 1V0PA 4MF1A 2C3JA 3FQHA 2CNQA 4YBJA 3P7BA 3FZ1A 4FTJA 5FUTA 4U6RA 2I0VA 4C4JA 5AFVA 3R1QA 4E4LA 3ORKA 5HTBA 2OH0E 3ROYA 5EYKA 3LW0A 5IQEA 4EL9A 1HCKA 4YZDA 4IW0A 3KULA 4YLKA 5DEYA 4CFFA 5JKGA 2PZIA 1SMHA 5DWRA 2WFYA 3JPVA 4GFMA 4YHFA 5FTQA 3Q2JA 3AOXA 4QMLA 3JXWA 4RIXB 2ZV8A 3EH9A 3PJ1A 4AW2A 4AA4A 5KBRA 3I6WA 4XG8A 4NJ3A 5CTPA 5JSMA 5K4IA 2WAJA 3A99A 2J0IA 4YJOA 4DEBA 5M09A 4LUEA 3ODZX 3V3VA 2YITA 3CE3A 5LVMA 1ZAOA 4LG4A 4R78A 3TM0A 3E63A 3MB7A 4O0VA 4RJ3A 3D5WA 2W99B 2OZOA 5EQEA 1H4LA 4G3GA 1FMKA 3WARA 1JPAA 1OI9A 3A2CA 4ONAA 5CSVA 5CEQA 4BDHA 3MA6A 3QZHA 3OY3A 4WUAA 3PG3A 4YURA 5J1VA 2YIWA 5HX6A 4DGMA 1YJ5C 4PMSA 3I7BA 3L8XA 5IF1A 2YA9A 4JIKA 3O2MA 2WTKB 3NAYA 3MY0A 1K2PA 2XKFA 3ETAA 4IWOA 2OWBA 4R1VA 4UWYA 4ALWA 4FKOA 2R3FA 1ZOGA 2WTKC 2BTRA 3E8NA 3NW5A 3I0QA 3KVXA 3OTVA 5FEDA 3TCPA 4BFMA 2UW5A 4I93A 1LGPA 1OUYA 1VYWA 3CP9A 3ZXTA 3COMA 4GMYA 3KQ7A 3A62A 1CM8A 5GINE 5CXZA 4AXAA 4ZTMA 3QD2B 4FV6A 3CD3A 4QMXA 4KBAA 4AT4A 2X2MA 4ZZNA 3W32A 4LFIA 5A54A 1XH6A 2PUUA 4R5YA 3V8WA 1UU3A 3CQUA 3DBCA 2X9FA 3IKAA 4E93A 4CV9A 2R3KA 3NUXA 4BTJA 4L68A 1Z5MA 4FTNA 4WNPA 1WMKA 5DFPA 2O65A 1FVVA 3NZ0A 4CTBA 3D0EA 2BVAA 3F69A 2OZAA 3F2RA 4XBUA 2XIRA 3F6XA 2QHMA 2W1DA 1J1CA 2JQIA 3QD0A 5BVFA 2UZVA 3MH1A 2X1NA 4FNYA 2I0YA 3OROA 4RJ4A 5HIEA 1G8SA 3DDPA 4O96A 4AT5A 2J5EA 2W1IA 1J7IA 3QQJA 3F3WA 1W98A 3BLHA 4MX9A 3FL4A 3A8XA 5K5NA 1P14A 2JC6A 3E64A 5HQ0A 2GQSA 1Q61A 4M68A 4PPAA 4OAUC 3SG9A 2F9GA 2HENA 2QNJA 4XP3A 4ANBA 2OLCA 5AAFA 3VBVA 2V55A 2HWOA 3SC1A 5C8NA 3QQHA 5LOHA 4QCJA 4YNOA 5BVWA 4AN9A 3U55A 4IJ9A 1KE7A 2O2UA 4F65A 4H87A 3CD8A 4ZK5A 3Q6UA 4FZ7A 5CANA 4O83A 4OBQA 4EGXA 3G15A 3ZFYA 2GSFA 3QTRA 3C4FA 4BDJA 4PPCA 4FKVA 4M8TA 3DS6A 3NUPA 2IWIA 3UYSA 2DQ7X 5AP7A 4IADA 3HV3A 5ANOA 4AGCA 4AOJA 5KMNA 5M56A 3DAKA 2XP2A 3PJ3A 4JXFA 2ZV7A 5E1EA 2FUMA 3W33A 4XLIA 3QGYA 2IZUA 2BRFA 2P3GX 3O51A 5IG1A 4FI1A 3H0ZA 4XG4A 3TNPC 5J7BA 4NJDA 2WKMA 3R71A 2GPHA 4QNAA 5AA9A 5M51A 2E9PA 4ZEGA 3DJ7A 5K3YA 1LEWA 4IEBA 5D7VA 2Z8CA 2UZUE 3LFEA 4DFZE 3G0FA 4QYYA 1ND4A 2I0EA 2VTNA 2WPAA 3EFKA 3NLBA 5CU6A 2Z02A 2RSVA 4MNEA 2WMUA 4I4FA 4EK4A 3DTCA 3PXFA 5HG7A 2PSQA 2JBOA 5LJJA 5A8IA 4BDGA 3F5XA 4N4SA 4UMUA 5HBJA 3KXMA 3FE3A 2PVHA 4W8DA 4L6QA 2DS1A 3EQGA 3GENA 3QTZA 1R0PA 4FKLA 4H3PA 4J1RA 4UMTA 5J9LA 4JG6A 5KHXA 5BUEA 4DFBA 2WELA 3EJ1A 3Q52A 4E6AA 4U43A 3AC1A 4JNWA 2C6LA 3D5XA 1ZOHA 5EK7A 2GQGA 2W0JA 4Q5HA 5C8MA 1ZY5A 4EBVA 3SXSA 3ID6C 2XK7A 3EZRA 1G3NA 4GH2A 4LGGA 4TTHB 4TYHA 3AC2A 3NYOA 5LMKC 3MY5A 3OCSA 4O6LA 1OBGA 3TNWA 4K2RA 2GFCA 4DH5A 4ASDA 3I4BA 5EI8A 1OITA 3ORXA 4I22A 3UJGA 4AP7A 4M66A 4E5WA 2C30A 4XP0A 5AUVA 3F66A 2QHNA 1PXNA 2X4FA 3KKVA 4YTFA 2YAAA 3DNDA 3VAPA 4E5BA 1UU7A 2HZ0A 3C4ZA 3UVQA 4PDSA 4ZAUA 4RX9A 3EQBA 3UQFA 3DFAA 1M7NA 2R7BA 4FV2A 2F7ZE 2PMLX 4LGHA 2R2PA 5IEYA 3PVGA 4ALUA 2F7EE 4AAAA 4AZWA 5LWMA 4M69A 4M97A 2BFYA 3E7VA 4MNEB 4BYIA 2CCIA 5IMEA 1PMNA 2NRYA 3NIEA 3AC4A 5JFXA 5L8LA 5JK3A 3V6SA 4FEWA 4FSZA 2CCHA 3M11A 4F9BA 3UZPA 5JZNA 5BVNA 4KKHA 4JBOA 4CMTA 3PJCA 4YC8A 2VU3A 2IG7A 2FO0A 4QO9A 2W5BA 4ZSLA 3F3UA 2QD9A 2BAJA 5AR8A 2GNLA 4CSVA 5CF4A 1J3HA 1JQHA 2XNPA 4ANLA 2FSTX 3IECA 3R9OA 5HIDA 3PJ8A 1M17A 3CTJA 4B6LA 4ASXA 2VO0A 2YM3A 4QYHA 5LVOA 2ZOQA 1PHKA 3ENMA 2BIYA 2QU6A 3FC1X 3KFAA 4FTOA 3VN9A 4CEGA 4U97A 1PF8A 4TT7A 3ORNA 2QOKA 4A9YA 4DN5A 4ERKA 4F99A 3TDWA 4FZ6A 4S33A 5DA3A 3W10A 2H6DA 4IAZA 1NXKA 2UW8A 4MF0A 3RJCA 2R3HA 3NRMA 3KVWA 2V0DA 3UQCA 2C5OA 4EYMA 3U87A 1ERKA 1WBNA 1W0XC 3HECA 3UOLA 4B99A 4GFOA 4HVGA 3GXLA 3AD4A 3MTLA 4JX7A 2VTOA 3UIUA 1H08A 1XBAA 2J7TA 4XOZA 5KMOA 2EUFB 2J5FA 4DFUA 3HRBA 3GI3A 2WTIA 3D7TA 1Q8YA 3TZ8A 3VRYA 4EHVA 2H8HA 4QMZA 3BWFA 2BPMA 4RT7A 5CALA 4BTKA 4MXCA 4UMQA 1YDSE 2R0IA 3UTOA 5K5XA 2X8EA 4RJ8A 1HCLA 5CT0A 1XHAA 3R7UA 4EWQA 5HTIA 2H9VA 3PWDA 2ZM1A 4FUXA 1OL1A 4Y83A 4ACDA 3GFEA 2J90A 2XNGA 4R5SA 3A7IA 3VHEA 3FEGA 2XM9A 4U3ZA 3OVVA 3B8RA 4D2WA 3NR9A 3NW7A 2BIKB 2RKUA 3FYKX 4YTCA 4F1TA 2YHVA 4U81A 2JBPA 4QMMA 3FJQE 3VS3A 4AZSA 4EOMA 4O7RA 3MBLA 3JR1A 5CF5A 5HZNA 2VZ6A 3GB2A 5CASA 1Q24A 3QKKA 5CSHA 4GV1A 5AP0A 4AN3A 1J4KA 5EQYA 2QLUA 4GT5A 2Y4IC 4QTEA 2QR8A 3LIJA 3TNQB 4FV5A 3P1AA 4WNKA 3RPRA 3PXQA 4JJRA 2BRHA 4KIOA 4X3FB 4YLJA 4YJNA 2Y4IB 3AMAA 4ZXTA 5J95A 4ZSAA 2A27A 4IM3A 2X39A 2Y7JA 3Q04A 4CLJA 2QQ7A 2G2IA 1FOTA 3KF7A 3Q9ZA 4I92A 4NH1A 2EXCX 3RP9A 4BCQA 3OWLA 2R3NA 4YTIA 3E3BX 3R7YA 3MIYA 4F0FA 1FVRA 2OK1A 3BV3A 3QRUA 4I4EA 3V04A 3PPKA 4DITA 2OFVA 5BVDA 1K2NA 1ATPE 3TV7A 3W16A 2BHHA 3JVSA 3ELJA 4XX9A 2P4IA 3TT0A 4IM2A 3QQFA 4E4NA 3SG8A 3FMNA 3MJ2A 1TQIA 3KXHA 4FKTA 3PPZA 3HX4A 3ZSHA 4CCBA 2HWPA 5AM6A 5CQWA 4CKJA 5L2TA 4A4XA 4O7WA 2EB2A 4RLKA 3PDTA 4WHZA 4DBXA 5AR2A 3ZZEA 4AW1A 1V0BA 3PVWA 1YW2A 4KNBA 3UMWA 4BI2A 3CKWA 5KMJA 1PXMA 3POAA 2Z60A 3IDCA 3V5TA 3C4EA 5LCJA 4IX5A 5FDPA 1LEZA 2XB7A 3EL7A 3K5UA 5IDPA 4BR3A 2PZRA 2VTRA 2VNWA 3DAJA 4DYMA 3AGLA 2VRXA 1J7LA 4PMTA 2W1EA 4FKWA 5DEWA 2CSNA 3Q4ZA 4M13A 1PMUA 3NNXA 4ZTLA 4Q9ZA 1OIUA 3NVKI 3PVBA 4X3FA 2A0TA 1GZ8A 1OBDA 4YP8A 2XEYA 3C7QA 1AD5A 3KMUA 3QWKA 4BCJA 4NKAA 3QQKA 5HO8A 4LL0A 3C5IA 4FG7A 3THBA 4XLVA 3HNGA 5DR6A 4FZFB 4EOOA 5E8ZA 3LFCA 1Y6AA 2C6EA 2XF0A 3BGQA 3ZRLA 5FXRA 3CSVA 5CSPA 2YM5A 1APME 3CY2A 5EW3A 3MYGA 3R83A 4PRJA 4IFCA 2B52A 3BYSA 3WZUA 3KXNA 3KA0A 4ANQA 3BU6A 3QXPA 5L2SA 2YCRA 4L7SA 2IO6A 3FMKA 2ZV2A 4HVIA 4FKIA 3S1HA 3BQRA 3IW6A 5DOSA 4UWCA 5I9VA 2PUPA 4FYNA 3R2BA 3ORTA 2P55A 2B54A 2ITZA 3ZUVA 4AGWA 4ZTQA 1A06A 1ZARA 2UW4A 3ALOA 4GSBA 4IVAA 4PQNA 3MVHA 4N6YA 3EMGA 3PSDA 1SZMA 3QRKA 3MSSA 4FKGA 4M15A 5AADA 3FLSA 3D7TB 2ZVAA 2RG5A 2B55A 5HIBA 1JOWB 4I5MA 3LJ2A 4XH6A 2WTWA 3P0MA 3DU8A 5HE0A 3KK9A 3MS9A 3NUAA 3ZLWA 4GJ2A 5FLFA 1DI8A 3MPMA 2IZTA 4AOTA 3CEKA 4RC4A 3C0GA 3EQHA 3QCQA 2R3MA 3VBQA 5E9EA 1H24A 4QMSA 3L8SA 3O8PA 4LMNA 1KOAA 3C51A 4DCEA 2F57A 2RFEA 1T46A 4QP2A 3M1SA 5CX9A 3VRZA 2OJJA 3NAXA 2XBAA 3DKFA 5HG9A 4DC2A 1JLUE 4FKJA 4TYGA 5DIAA 1YWRA 5E8WA 3QUEA 1L3RE 1RW8A 2J0KA 2IVVA 4J52A 3DNEA 3R6XA 3HUEA 1FHQA 4GJ3A 1FQ1B 4HGEA 2W4OA 1VYZA 1ZMVA 2BZKB 4KINA 2YZLA 4TXCA 1F5QA 3R00A 4CG9A 1YXXA 4TZRA 3WE4A 4LV5A 2WMSA 3VQUA 3WI6A 4W4VA 3HL7A 4FMQA 1EH4A 3EQPA 1H0VA 4K33A 2C4GA 5D1JA 2XRWA 3W2CA 5CU0A 3H10A 5BX0A 3K3IA 1Q3DA 1OKWA 3ANQA 2FSLX 2WEVA 1H1SA 1BL6A 4JAJA 5DHJA 3WYXA 2XH5A 4XHKB 1FBNA 5AX3A 3F2NA 3RVGA 3R7IA 5BUJA 3A4PA 3V5QA 3ZEPA 4OT6A 4QMQA 1JAMA 1Q62A 1OECA 2ITNA 2WD1A 5DE2A 4U0IA 5H3QA 2VTTA 3I60A 3S00A 1I09A 1ZYDA 2CGWA 2HZ4A 5ETFA 5AA8A 5TT7A 3A8WA 2WMQA 2JDRA 4WSQA 3I0NA 2SRCA 4D2PA 4RFMA 5KMIA 4KKEA 5HO6A 3DB8A 2QOOA 4RPVA 4W4XA 3KRRA 5B2KA 3ATSA 2GNIA 3HV6A 4EH8A 4NSTA 4FBXA 4MD8E 4ANNA
chains in the Genus database with same CATH superfamily
4R3PA 4GKHA 2ITTA 4KIKA 4QP1A 3ZOSA 2C0TA 2HELA 4S30A 5FP5A 4AOIA 3QHRA 5J9YA 5BMSA 4C7TA 1JKLA 1OL7A 1RE8A 4R6VA 3VQHA 2Z2WA 2OH4A 4UBAA 5BQ0A 5TOZA 2P0CA 1OL6A 5JEJA 4H05A 4AFEA 2DYLA 3TTJA 3UV0A 4Q9SA 4DTBA 1G88A 2CJMA 4K77A 5CSWA 5DH3A 3RPSA 3COIA 4C3PA 4DLIA 3V7WA 1U54A 3LLAA 5LXMA 5I9UA 5KMMA 4A0EA 2FH9A 1YWNA 2PE0A 3OS3A 2ONLA 4PV0A 1M2PA 2YCSA 2ZAZA 3DK6A 2C5YA 3EN4A 3NS9A 3R8LA 1UU9A 3EWHA 3JYAA 3PXRA 5I9ZA 4OT5A 2RIOA 3GQLA 3JVRA 4CFXA 3SRVB 3MGYA 4DGOA 2UZDA 3FZTA 3BU3A 3QA8A 2YM8A 4YC3A 2VTQA 2C5NA 3PY0A 1B39A 3GUBA 1OPLA 4FTUA 2F4JA 4QRCA 4FIIA 4JT3A 4BZNA 3RNIA 1IEPA 3P9JA 4KBCA 2Y9QA 3D7ZA 3GU8A 5D41A 4A9UA 2GMXA 4CYIA 3PSBA 5FWKK 4FIJA 3KEXA 4EH4A 2UZLA 1SVHA 4C4HA 4J98A 4OTGA 2X6DA 1YDTE 4FV7A 3RINA 4I5HA 5ICPA 5M57A 3V6RA 1KE5A 3FI4A 4R7IA 4DBNA 2I0HA 2YIRA 2WOUA 1E1XA 3KRXA 4X2NA 5CVGA 4JDIA 3NUUA 1TZDA 1WLNA 4GG5A 1MK2A 3TKHA 2ITQA 3DV3A 2HZNA 4M7IA 3C13A 1GOLA 3TXOA 1KE9A 4JVGA 4MXZA 2YDKA 3NEWA 2W96B 3FLWA 3GT8A 4IHPA 4U7ZA 5C1QB 4IM0A 4DY6A 4D1XA 3UDBA 3PIYA 2W1FA 1FMOE 4ZSEA 3QZIA 3QRTA 4MHAA 4YHTA 3WZDA 5CXHA 3TTIA 4CZTA 4IB1A 5I5ZA 3W2SA 1H00A 5HLWA 5L6PA 3FQEA 4CZUA 1Q8UA 4NM0A 5CAOA 3OOGA 1T45A 3MFUA 4L3LA 4S34A 3QC9A 4UMPA 3NYVA 3LCTA 2XCHA 1U59A 3PVUA 5JRSA 4DFNA 2NNWB 1Y8YA 5A4CA 1NY3A 2JEDA 3IW7A 3KRJA 3PA4A 2XNBA 4U3YA 4G1WA 4CRLA 2PUNA 3ZDUA 4D2SA 3N9XA 3IDPA 2VGOA 4HZSA 4IZYA 1R1WA 3R04A 1JKSA 5DHQA 3CJFA 3G90X 2IEWA 4WG4A 5HCYA 3W55A 4GL9A 4G5PA 1UVRA 5LVLA 4C38A 3SXFA 2IZRA 4PMPA 5FG8A 1NT2A 2CDZA 3UNKA 3AKJA 4RX5A 1Y91A 3BGPA 3DITA 4V0GB 2YERA 1WCCA 3TWJA 3FL5A 4J96A 4WD5A 4AW0A 2H34A 3QUPA 4YTHA 4ANMA 3VONA 2CLQA 4QMPA 2R7IA 3DXQA 4CKRA 2XJ1A 4PPBA 2YM4A 3DBFA 4AF3A 1PYXA 4G2FA 4F1MA 4PTCA 4CRSA 1WV3A 3FAAA 2W3OA 3HV4A 2CNVA 4ZZOA 3R73A 3C1XA 4G17A 4ZLYA 2JKKA 2PMNX 3RMFA 3FV8A 2JIVA 2PWLA 3HEGA 4YJRA 4M0YA 4AE6A 5TR6A 3GU4A 5JN2A 1Z0SA 3G2FA 5L6WL 3RPYA 2ZFYA 1DM2A 3HMIA 5HOAA 4JBPA 3NYXA 4HCUA 2FF4A 4BWKA 3D83A 3FYJX 1JKTA 3PJ2A 4AXCA 4E1ZA 2JLDA 4RVLA 4XV2A 1I44A 4DG2E 2PUIA 4R9PA 4EJ7A 2GNHA 3ZLSA 1ZZLA 2A4LA 1DMZA 4NTSA 1QL6A 4BIBA 4FT7A 3SV0A 3RAIA 2FA2A 3JUHA 3ZUTA 4I94A 4EQCA 4U44A 2W5HA 3BYUA 5IPJA 3W2QA 3TNIA 3FLNC 3IGOA 3VWAA 3LXLA 3MFRA 3FKLA 4QP9A 3MDYA 5E90A 5HI2A 4QTAA 3PRIA 3F5UA 2R3GA 2OJGA 2BMCA 2IF8A 3MY1A 4ANSA 5IH4A 4ZLOA 4EBWA 4F64A 3L1SA 3VZCA 2Z7LA 3DTWA 4AXDA 1CSNA 4H1JA 4YO6A 4MXAA 4F9YA 4GVJA 5E50A 4I41A 1W7HA 4XBRA 5AWMA 5J79A 4D55A 4WRRA 2ZB1A 4FKUA 3DXPA 1G5SA 2RL5A 3NUNA 1VZOA 2WOTA 4PL3A 4J8MA 4RIYB 1Q41A 4QT1A 3ROCA 5A6NA 2PVYA 3P5JC 2AUHA 3V5PA 4LYNA 3HMPA 4APPA 4GEOA 2UW3A 1UNHA 4YPDA 4MK0A 4UWBA 5FTGA 4MCVA 2W1HA 3CCNA 1DI9A 2QG5A 1OPJA 5T6KA 3A77A 4EHZA 2CKQA 4GRBA 4EK5A 1O6LA 4FNWA 4BDAA 4CTCA 4ID7A 4O0UA 1YI4A 3KXXA 1QMZA 3LE6A 1XH4A 5AM7A 4BWXA 4FTMA 4L00A 2YDIA 3FMDA 4M84A 3R28A 4UV0A 4FIHA 3SD0A 2VWXA 3COKA 1GXCA 4LMUA 4ACGA 3U4WA 1MR1A 4O2ZA 5JZJA 5J1WA 2BROA 4NEUA 5AUYA 2LGCA 3WYYA 3UOJA 3RALA 4Y72A 3CC6A 3QFVA 1ZZ2A 3PXYA 3FMMA 2E2BA 3QCYA 4TYHB 3AD6A 3R01A 3AC3A 1SNXA 4EK3A 4U40A 2W7XA 3PO8A 4LRJA 4O0XA 4L42A 1ZYLA 4BY9E 5IISA 2IW6A 3BV2A 2R4BA 4ZOGA 3D9VA 3GCVA 3PA5A 5FM2A 3RHKA 4IC7A 1YKRA 3GC0A 3UGCA 2XJ0A 4X2FA 5HNGA 2ZYBA 4DFLA 1WBPA 1GIHA 3HUCA 3OMVA 2XANA 4TRLA 4FL1A 3N4TA 3A60A 3TZ9A 2NP8A 3LMIA 1VEBA 3G0EA 1OPKA 1YOLA 2JFMA 4NKSA 4WG3A 2QO9A 1OM1A 2VO7A 5HHWA 2ZB0A 3TIYA 5LARA 2GS2A 1TVOA 2OF4A 3C4WA 3DOGA 1PXLA 3PIXA 2PVFA 5CAVA 3PZEA 2GDOA 2YAKA 2OF2A 4D4YA 2PVKA 4MBJA 4Z9LA 3TJCA 5CZIA 2OXDA 4DH8A 3TUBA 4MWIA 3A61A 2ITVA 4I5PA 4RC3A 1URCA 2C3LA 1ZMUA 4O4DA 5LMAA 1AGWA 1YXTA 3QUDA 5CSXA 2CKEA 4C37A 2UW7A 3DLSA 5LMBA 4EH3A 3ZUUA 3DK7A 5M07A 1DS5A 5F95A 4EOJA 4ZTRA 5AR4A 3FMHA 4DHJA 3SOCA 2WIHA 3Q96A 3VS7A 3K2LA 4WNOA 5ETIA 3A4OX 1UU8A 2JKMA 3FXWA 3R02A 2RFSA 2IW9A 3DPKA 5EI2A 3U9CA 4BRXA 1SVGA 3MPTA 1Q4LA 1WZYA 3ACKA 1ZMWA 4QMVA 2AFFA 2I2FA 4O0WA 4R3CA 2QOLA 2WQMA 2IW8A 2GCDA 5HNBA 1WBTA 4G3DA 5DLSA 3T3VA 4JR3A 3OXZA 2IVSA 3U8WA 4FUYA 2YABA 4IWPA 1XQZA 4L46A 3ITZA 5AR3A 5L2WA 2PTKA 4DFYA 5BUIA 3PLSA 4FV9A 3DGKA 2OKRA 2VGPA 2OSCA 1UWJA 1CKIA 4YO4A 5AUXA 2C3IB 4FTLA 3DT1A 2BONA 1F0QA 2R3OA 4DEGA 4IB3A 2R3IA 4FGBA 1G8KA 3UMXA 4TYEA 4ITHA 3R21A 4BTMA 3LMHA 4PDOA 3KB7A 3B8QA 5J8IA 3QQLA 3NMUF 4FYOA 3LFDA 4TPTA 2ZM4A 4P90A 5H8BA 2AEGA 3MESA 3R8PA 2OU7A 4NZWB 4C2WA 2Z7SA 1BUHA 3NIZA 2ACXA 3GEQA 5FM3A 2QC6A 4AXEA 1NVRA 5ANJA 3EQFA 4FOCA 4QMTA 3V80A 3KC3A 2VWWA 4LL5A 3GCSA 1LR4A 2AN1A 4BI0A 1IG1A 3BU5A 5EM8A 3Q53A 3QAME 2YN8A 4JRVA 3WILA 3GQSA 5I3RA 3DBDA 4L8MA 4L67A 2Q83A 3OCTA 2CNUA 4BKZA 1MRUA 3AKLA 2BAKA 4YJVA 2NYAA 2ITPA 4L01A 1ZLTA 3VJOA 3IO7A 4TWPA 3GC9A 4GUBA 4IZAA 4PTEA 4BYJA 2XARA 3PPJA 2XNNA 2VTSA 2QCSA 1K9AA 4WSYA 3F5PA 4USFA 2CSWA 2UZNA 3REPA 4ARKA 5FBNC 3ORPA 3TG1A 5HORA 2BZJA 4AFJA 4F1OA 3PZHA 5EHYA 3F3VA 3Q2MA 2PU8A 4D28A 1Q8ZA 1JSVA 1IAHA 4D9VA 4FT5A 4NW6A 2JITA 3SX9A 1J2FA 1YHWA 2JDTA 4Q5EA 4JIWD 4NFNA 1K3QA 2UW0A 4RQKA 3NW6A 5EYMA 4FKRA 5HESA 2A19B 3NX8A 4C4FA 2C0OA 4QYGA 3NUYA 3V5LA 4L3JA 3IOKA 5EI6A 3PWYA 4KUJA 4MNFA 4H36A 1UNLA 4QP7A 3OZ6A 5I9XA 4PF4A 3F9NA 3TNHA 1K2MA 4GUEA 4X2KA 1OIRA 2F2UA 2OICA 3IW4A 5EDRA 5CI6A 4MBLA 4R77A 5DVRA 3F3ZA 4NM5A 4F7SA 3OCBA 2EH0A 3GP0A 4MD7E 3FMEA 2UW6A 4RJ7A 3GMJA 2WQEA 5IQIA 4FSRA 2AQXA 5EOLA 3POZA 4I0TA 1IASA 3EQDA 2F7XE 3Q9WA 5E1SA 2BFXA 4APCA 5F9EA 1YJMA 4H58A 2BDWA 3FI2A 3LLTA 3P86A 5FDXA 3EKKA 5ACBC 4JAIA 4C33A 5J87A 1UJXA 2BUJA 2WNTA 2WU6A 3PSCA 4MTAA 4EUUA 2OO8X 1ZRZA 3OW4A 4O1OA 5CS6A 1V0OA 3EHAA 5DGZA 3ALNA 5KX8A 1R0EA 3QC4A 5KZ0A 1UNGA 3AD5A 1NVQA 4FL3A 2WO6A 1CKPA 3FKNA 2YLEA 4EEVA 4K9YA 2OIQA 3LFAA 4IC8A 3ATTA 5GZ9A 4FNXA 3DLZA 4RLLA 4TY1A 1YI6A 3C50A 4PUZA 4QPAA 4ACHA 2Q0NA 4U41A 2UZEA 4UYNA 2X6EA 5FXSA 2V5QA 4BKYA 4Y85A 4J71A 1R3CA 4O21A 5DYJA 3DBEA 3SKCA 2VNYA 1KV1A 3E5AA 2E9OA 2X8IA 4K18A 3U9NA 3V01A 3O7LD 3QHWA 1H1PA 3G5DA 4XG6A 5DG5A 3V8PA 2EXMA 3MWUA 2PVMA 4E73A 4G2SA 2WMBA 4LI5A 4X6QC 3ZO2A 4LOQA 4BF2A 3ZCLA 2XK8A 2I2CA 1NA7A 3I6UA 2R5TA 4MUQA 3N4UA 4UEUA 3ZDIA 2ESMA 5KKRB 4P4CA 3UNJA 3MJ1A 1Q5KA 3I81A 5CAPA 1PMEA 3R0TA 3OC1A 4QD6A 2FB8A 4LUDA 2UVZA 5KNJA 3ZXZA 1SVEA 4CGAA 4KSQA 5C4KA 3SA0A 2J50A 2LC1A 3PE2A 4EONA 4ANOA 4UALA 3V7YA 3P5KA 5IH6A 3KXZA 5EHOA 2J0MB 1WVWA 5FBOA 1J4QA 2AC3A 4F6SA 4RJ6A 1B6CB 4K1BA 4ALVA 4AU8A 4TW9A 5LVNA 2YZAA 5K9IA 3OEFX 1M2QA 3L9NA 2GHLA 2WZJA 5ANDA 4XG7A 3CTHA 4BCNA 5BVEA 1PW2A 3MH3A 4IACA 4EJNA 3QQUA 3RPVA 3IQ7A 3UNNA 5CEIA 2YWPA 4XG3A 1GY3A 3UE4A 3S95A 2O63A 4JR7A 5JFWA 5JEOA 3SQQA 3ZRKA 3CIKA 4NU1A 1RJBA 3ZZWA 3QALE 2W06A 4HOKA 2VX3A 4C34A 3G9LX 3C5UA 3R8MA 2WTJA 1YOMA 2JDSA 4BI1A 4HPTE 4BIDA 4CT2A 5HLNA 1Y3HA 2X9EA 3EFLA 3KCFA 3ELSA 2WEIA 4C0TA 2IJMA 3MPAA 5FXQA 3P78A 3V8TA 3LCSA 2DWBA 2JIIA 5AAEA 2R3PA 3BWJA 4EH9A 3O23A 2X81A 4BL1A 4EHGA 4PNIA 2B9HA 4D4VA 5CF8A 4USEA 3EIDA 5LQFA 2FYSA 3LQ5A 4FTCA 2QLQA 3UPZA 4FKQA 4IAKA 4L3PA 3DQWA 3VUTA 3UNZA 3DDQA 3OOMA 1PXJA 1JWHA 2VWBA 2UZBA 3DFCB 4IB0A 4MEDA 4NK9A 5C8KA 4PP9A 4YHJA 3WF5A 3OHTA 3KCKA 4HJOA 4MXXA 1OGUA 1H1WA 4DLJA 2WMRA 3UODA 2RF9A 3AC5A 4G3EA 2XT9B 2J51A 3HX1A 5HX8A 4I6BA 5ANKA 4BBFA 4C61A 1QPCA 4EYJA 5GZAA 3E87A 4N6ZA 5ETAA 3HA8A 4Z7HA 3ZC5A 3OTUA 5EDQA 2BDFA 4F9AA 1OKVA 5T3QA 2Z7QA 2VWVA 3NGAA 5IMXA 3U6JA 4B8MA 2JPEA 1K3NA 3RAKA 4YPSA 5I3OA 3U6IA 1MRVA 5JGAA 4XOYA 1J4OA 4GIIA 3BHHA 3FZOA 5JFSA 2PL0A 3F2AA 1WAKA 2BDJA 2WU7A 4GT3A 4RA4A 4JOAA 3OW3A 3ZSIA 4F0IA 4AZEA 5HICA 2VTIA 3VF8A 3QLGA 3ENHA 4BDKA 2REIA 3AG9A 4FNZA 4BCKA 1CMKE 3QRJA 4P5QA 1XMLA 3LFFA 2OXYA 3HMNA 3L9MA 2HCKA 4X2GA 2YDJA 4RRVA 4I1ZA 4I20A 3MFTA 4CNHA 4BHNA 4RX8A 4M69B 3QTSA 4Z55A 3MVLA 2ETRA 3H9RA 1GJOA 1UKIA 2F49A 2RFDA 3UG2A 5AUUA 1VR2A 4RWKA 2VD5A 3PG1A 3ZONA 2X0QA 3DJ5A 1Z9XA 4FE2A 3HKOA 4RIWA 3TEIA 1PKDA 3RWQA 3AT3A 4XRLA 5L3AA 3EB0A 3V5JA 2CMWA 1Y6BA 1YI3A 1REJA 2OJIA 3KU2A 5M4FA 1LP4A 3MI9A 3VBXA 3GCQA 4YZBA 2HW7A 3F3TA 2XCKA 4X3FC 3W2OA 3B2TA 3G9NA 4NM3A 1JSUA 4NCTC 4GK3A 3UIBA 4HAOA 4LDTA 4J99A 5EHLA 4BWPA 4CFNA 2WMTA 4EOIA 4WT6A 5M06A 2HXLA 4PWNA 4BDCA 4RVMA 4BN1A 4YU2A 5JT2A 1IA9A 2C5VA 5B7VA 2C6OA 3R7GA 3VIDA 3G6HA 1X8BA 5A6OA 3CJGA 3ZU7A 3RZBA 4JQ8A 1OL5A 5AP1A 5E8XA 2WXVA 5GIOE 1XH9A 4U42A 4UYAA 4G16A 5EYCA 2ERZE 3PP1A 3E8CA 4X7QA 5A3XA 4FVRA 4D5HA 2XIZA 2OIBA 3FHIA 4F6WA 4E7WA 2XIYA 4PDYA 2YIXA 3VS1A 4QMNA 1WFCA 5CEPA 3D94A 1K3JA 3KMMA 4QP6A 3E8DA 3VZDA 2OJ9A 1YXVA 4BC6A 3IK3A 4E4MA 4KBKA 4CVAA 3LXNA 5HCXA 2ERKA 1BI7A 4XP2A 3WF6A 4EWHA 4FT9A 3OF0A 5FGKA 4WERA 3CKXA 1WBOA 1XJDA 3LM5A 4X6RA 5LVPA 3NDMA 5M55A 4RFYA 2C1BA 1O6KA 4R3RA 2J9MA 3PY1A 2PZPA 4F7JA 3UDZA 4G5JA 3R9DA 2VO3A 2GNJA 4FV0A 4XG2A 4RG0A 5HG8A 3VUIA 1OIYA 2E9UA 2OFUA 1MQ4A 4BCHA 4CFWA 2HK5A 3BBWA 4HNFA 4EKKA 2PPQA 3VJNA 5AIKA 4QP4A 1U5RA 1WVXA 2UZTA 4W9XA 4I0RA 2W1CA 4AGUA 3CGOA 4Z7GA 5A4EA 2KKLA 5D10A 5DHRA 3P7AA 3VUGA 4E3CA 4CT1A 2W9FB 3VW8A 3RK7A 1MP8A 4OTIA 3I1AA 2NPQA 4M67A 4AWIA 1IRKA 2EB3A 4WIHA 5JGBA 2IN6A 2V7AA 1J7UA 3UP7A 3FY2A 4YR8A 5EG3A 5D9HA 3TKUA 4JIAA 5BVIA 2XIKA 3LCOA 4M0ZA 2RG6A 2R3QA 5JEMA 5AMNA 4MYGA 5HE1A 3F7WA 3P08A 2Y4PA 3E3PA 1P4FA 3R9NA 3TZMA 4LV7A 5DHTA 1UA2A 2C47A 4O0TA 5A46A 3FI8A 1QWTA 4CG8A 2O0UA 1UWHA 1H28A 1OMWA 4R7HA 3WBLA 1FVTA 4QTDA 4G34A 3CPBA 1S9IA 4MXYA 5DT3A 4FEVA 2XVDA 2J0JA 4XMOA 1A48A 3LFNA 5AV2A 3FSKA 2ETKA 3FLQA 3KXGA 3ZBXA 3EN6A 4DEIA 4ZZMA 2BRBA 3RWPA 3N4VA 3BLRA 3QXOA 2GQRA 3K5VA 4DF3A 3KK8A 2UZOA 5HLPA 4AGDA 3IW8A 3D5VA 3W18A 4IFGA 4A9SA 1SM2A 4HNIA 2CN8A 3HLLA 3I5ZA 5HO7A 5CYIA 3CBLA 5G6VA 3KY2A 4BCOA 4Y46A 2KFUA 2B53A 4IVBA 4DINA 4YSMA 3FWQA 2XYNA 4GS6A 4FF8A 2XKCA 2I7QA 1XH8A 4HGSA 3D4QA 4OUCA 2ZDUA 4B0GA 3FUPA 4XS2A 4O7NA 2DUVA 1KSWA 4R8QA 4PX6A 4ZTNA 4EC8A 4O91A 4FZDB 4I3ZA 3ZLYA 4EQUA 3R8UA 4N70A 4F9WA 3EQCA 3LQ3A 5HE2A 2OG8A 2XJ2A 1PMVA 3L9LA 3MFSA 3DKCA 4OTFA 4BHZA 3GCUA 5C03A 4J7BA 3MB6A 4Y5QA 5HBHA 5K4JA 1JBPE 4WKQA 4D0WA 5E8TA 2X8DA 3SW4A 3MTFA 5M4CA 3TN8A 4YJQA 4UXLA 4RVTA 4F9CA 4NWMA 4AXFA 2ITOA 5IQGA 4ORKA 2PZ5A 1TKIA 3VBYA 3P4KA 2GTMA 2W1ZA 5D7AA 3QTXA 5CENA 4YC6A 1WBVA 3VA1A 3HDMA 5CNOA 2WTVA 1OL2A 3A7FA 1YHSA 2PE2A 2WB8A 4KB8A 5FD2A 1ZOQA 2B0QA 3ANRA 3E92A 4B7TA 4USDA 4RSSA 4YUQA 4QP8A 1BX6A 1H27A 3T8OA 4EHEA 4CFUA 3VF9A 3QCXA 5AV4A 3RM7A 3GC7A 2B7AA 4AQKA 4XYFA 1XBBA 4GU9A 2XM8A 3E88A 1QPDA 3FMJA 4CLIA 5L2QA 3RPOA 3W2PA 4EOLA 4ACMA 1OKZA 4H3QA 4JMQA 2X7OA 3T9IA 3V8QA 4DG0E 3IONA 2VN9A 4BVUA 2YWVA 4FG8A 4OW8A 4D2VA 3ZM9A 2XKDA 4KIKB 3EN5A 3H3CA 3ZO3A 3EYHA 3VUDA 4BBEA 4UN0C 1E1VA 1MRYA 2B4SB 1GIIA 1H1QA 2PVNA 2QR7A 2A0CX 4IQ6A 4HGTA 4AS0A 4BGQA 4ACCA 5EJGA 5H9BA 5ACKA 2C6IA 2I2BA 2GHGA 4EOKA 4HYIA 1REKA 2WMAA 5BYZA 2OZAB 3KF4A 2BHEA 4LOOA 5H8EA 3UOKA 4C4EA 5HKMA 1PKGA 4G31A 1SYKA 3TJDA 4XV9A 4IJPA 1GZNA 2QI8A 4FSTA 4C35A 4I6HA 3P23A 3UYTA 4IAYA 1BI8A 3UDTA 5FRIA 4OBOA 5IA4A 2VTMA 3RGFA 4BICA 4YZNA 2W5AA 5JEBA 4PMMA 5FP6A 4MAOA 1M2RA 3RK9A 4O82A 4A4OA 3VULA 4IXPA 1YOJA 3AXWA 2XIXA 3ZC6A 5J7HA 1OGYA 4JLCA 2G2HA 2P2IA 3EYGA 4HZRA 2G1LA 1PXIA 3QTUA 1H8FA 3KRLA 3GBZA 4FKSA 4FVPA 5EW9A 4BCFA 4L44A 5HG5A 4DDIA 5DPVA 3U4UA 1G3GA 5E91A 2YISA 3FY0A 4Y73A 2EU9A 3BEGA 3FPMA 2PULA 3QRIA 3HUFA 4XRJA 4UZDA 3WE8A 4CQEA 3E8EA 4JONA 4QPMA 3LVPA 4EH2A 5DR9A 3SXRA 4QQTA 2I40A 2HYYA 3UC3A 5IZFA 3Q9YA 2GU8A 5J5SA 3L9PA 4IVDA 2QV7A 1STCE 3VS6A 3QBNA 2EXEA 4C3RA 2R9SA 3KN6A 3NNVA 3UVRA 3OT3A 2XA4A 3NUSA 3OWJA 3OBGA 5CU2A 3UOHA 3ZFXA 2O3PA 3TUDA 4QMWA 5KMKA 2C6KA 3PXZA 1ZYJA 3II5A 4I0SA 1RQQA 4O0RA 4U5JA 2VTPA 4NIFB 3DKGA 4NIFA 5AR5A 3UVPA 3TI1A 2ZDTA 3ERKA 4QQJA 3ZFMA 5C4VA 4QTCA 4D2RA 4DT8A 4S31A 2WGJA 4B9DA 4DAWA 2QURA 4C58A 3LQ8A 4FSNA 3PRFA 3TACA 5IQCA 4E6QA 3ULZA 5IEVA 3R7OA 4DTKA 5L4QA 5DHSA 3LOKA 4RWJA 3SVVA 4FTQA 3R1NA 2ETMA 4P5ZA 4TWNA 3OUNA 3OXIA 2GNGA 3FZPA 4JRNA 2WQOA 3ZRMA 2FSOX 4GFGA 3H4JA 4K0YA 4V0GA 5IA1A 1L8TA 3RKBA 3BELA 2XK4A 3VUHA 1W83A 2QU5A 5DRBA 4F08A 1XKKA 3VS5A 4ZMEA 2XEZA 5E7RA 3U51A 4F6UA 2WQNA 3WF8A 2JFLA 5H8GA 3R8ZA 4GKIA 2XMYA 3UQGA 2JIUA 2XK3A 1Z0ZA 3O50A 1FINA 1YVJA 4FSMA 1P2AA 1M52A 5EH0A 4FTIA 1R78A 5ETCA 4O1PA 5EKOA 2NRUA 4BDEA 3LHJA 4F7NA 3BHTA 4E6CA 3GGFA 3LJ0A 2PK9A 4I5CA 4GK4A 4JDHA 2ITYA 3K54A 4M12A 3MV5A 5T68A 4AX8A 4GK2A 4TWCA 4KKGA 4F09A 4NFMA 4FR4A 3UO4A 1IA8A 4BGGA 4RC2A 2VWUA 4B4LA 2X0OA 2I1MA 4U79A 3UO5A 3H0YA 5L8JA 2O5KA 5AV0A 3M2WA 4CMOA 4IZ7A 3HMOA 4DG3E 5JELA 3Q6WA 4HYHA 4ZJIA 3CGFA 3LCDA 3QZGA 5F20A 2WMVA 5HU3A 3TV4A 3FDNA 5M4IA 3AGMA 4FICA 5B2MA 3PY3A 4FV8A 3KL8A 1WVYA 4J97A 4K6ZA 2VTHA 2XUUA 4ZMFA 2JDOA 2V22A 2JKDA 3HRCA 3QYWA 3ZS5A 1FGKA 3MH0A 4TKSA 3Q60A 4EC9A 4YNEA 4UY9A 3ZO1A 4BGHA 4HCTA 1PXKA 4D9UA 3ZHPC 4BDIA 5HTCA 5M4UA 2YACA 4FV1A 2PVRA 5K0KA 3PA3A 3RI1A 2G9XA 5IEXA 5EOBA 4O38A 3O8TA 4FZAB 4BDBA 2RGPA 3HA6A 3MIAA 3HMMA 2C69A 4IX6A 2V62A 4GW8A 4FEQA 2G15A 2VV9A 3UIMA 3FSFA 5EW8A 4ZJVA 4G3CA 1U7VA 4FG9A 5EM7A 1H26A 2Y8OA 1OUKA 1Q8WA 2VUWA 5AR7A 4EZ7A 4YGAA 3MA3A 2XK9A 3TUCA 2UV2A 4BZDA 5ANEA 2ZV9A 4AW5A 2AYPA 4KRCA 5A9UA 4BZOA 2JQLA 5DT4A 5M53A 3C9WA 3KRWA 3VVHA 3QTIA 5IQFA 5HVKA 1Z57A 4TYJA 2BKZA 1XH7A 4FTRA 5TO8A 5I9YA 5IUGA 4O22A 5CAQA 5C4LA 2C6TA 1OZ1A 3NYNA 3QTWA 3FZSA 3ZBFA