3I6UA

Structure and activation mechanism of the chk2 dna-damage checkpoint kinase
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
413
structure length
390
Chain Sequence
TPAPWARLWALQDGFANLECVNDNYWFGRDKSCEYCFDEPLLKRTDKYRTYSKKHFRIFREVGPKNSYIAYIEDHSGNGTFVNTELVGKGKRRPLNNNSEIALSLSRNKVFVFFDLTVDDQSVYPKALRDEYIMSKTLGSGACGEVKLAFERKTCKKVAIRIISKRKFAIGLNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILGPTYLAPEVLVAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase Chk2
publication title Structure and activation mechanism of the CHK2 DNA damage checkpoint kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 107
structure length 390
sequence length 413
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00498 FHA FHA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3i6uA03
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 3i6uA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3i6uA02
3FKLA 3MFUA 3P4KA 3PY0A 1M7NA 1OM1A 4ACMA 5IQAA 3BQRA 2YJSA 4YSMA 5HOAA 4B9DA 4FGBA 3HX4A 3VF9A 3FMKA 4F0FA 3O23A 1BKXA 4YC8A 2CCIA 5ANEA 2I0HA 3GQLA 3HV6A 4G34A 4X6QC 5FP6A 5GNKA 3GCUA 3UE4A 4ALWA 1DM2A 4OW8A 4YBKA 3UIUA 2HCKA 2VTOA 4AGWA 4MTAA 4RLLA 1DAWA 3GUBA 3R28A 4WOVA 5CT7A 3NNWA 3QQLA 5CSVA 1R21A 2GQGA 4KS8A 3KN5A 4CTBA 3UJGA 2CN5A 3FZTA 2WTDA 4YHFA 3TZ8A 3VA4A 3PXKA 2J50A 5K0XA 4GL9A 5A4TA 2XKCA 1TQIA 3O7LB 4EJQA 4D58A 4KUJA 5C26A 4FSQA 5DLSA 2PHKA 3FI3A 3C1XA 3QF9A 2OH0E 3RPSA 2ITZA 4FTTA 3JS2A 3PUPA 4KRCA 2JAMA 5CU4A 2I1MA 4NM0A 2W99B 3BYVA 4S31A 4ZJJA 3SHEA 1PKDA 3U54A 2UV2A 4O7TA 1PMUA 1IRKA 2C5XA 4EHZA 4O82A 1WVYA 2E9NA 2JBOA 4RX8A 4PPCA 4EWHA 3HMIA 3L8XA 4FVRA 4LI5A 4EH5A 2ZVAA 3CE3A 3EFJA 4RJ8A 2E9PA 3ZEPA 3LQ3A 4F65A 3VBXA 3LXKA 3MS9A 4IANA 4LRMA 2RKUA 2X4FA 1PF8A 4F64A 2Q0NA 1BX6A 2ITUA 4M68A 5JN2A 4XNEA 3FLWA 5TR6A 2XJ0A 1FGIA 4PTCA 4ANOA 2JITA 4KBAA 3ATTA 1UU9A 2HZ0A 5B0XA 3DKFA 5M57A 1K9AA 2ZDTA 4ZY4A 2YM8A 3TXOA 3FQHA 1SZMA 3HV5A 3UNKA 1FVVA 4G6LA 2FEZA 3DAEA 4AW5A 1K3QA 3MVMA 4XRLA 4ZSLA 3HL7A 3IK3A 3G6GA 4DCEA 2QLUA 5TF9A 4JR7A 3FHIA 3BYOA 1FMKA 3C5IA 3CBLA 3EFLA 4DGLC 5F95A 4UN0C 3ZZEA 4FTAA 2R3KA 1UNLA 4FTRA 4IAAA 3BX5A 5EW9A 4BCQA 5GZ8A 1I44A 5DR2A 3IOKA 3ENMA 5ANJA 2ETMA 4OBQA 5D41A 3RKBA 4ANLA 5LVOA 5E9EA 3CC6A 5FD2A 5JSMA 3DKOA 3DQWA 4FOBA 4M97A 1DMZA 2W1EA 4DEIA 4CFFA 4O7RA 2X4ZA 3TTIA 1Q4LA 4GEOA 1OKZA 5D11A 4O7ZA 1Y91A 3MB6A 3R8PA 1MQBA 3QUDA 2JC6A 5LVMA 2I0YA 2VX0A 4KS7A 4F1OA 3RAHA 5KMJA 3UOJA 1M52A 2VN9A 3CY3A 3RJCA 2ITPA 2UW9A 3JR1A 3AT2A 3Q9YA 4L42A 4MBIA 2Z02A 2GCDA 2R3JA 5CAOA 3DCVA 3DDQA 3HZTA 3K5VA 2PE1A 3KXNA 1Z9XA 2VWYA 1GIHA 3BI6A 3H4JA 4NCTC 4MXCA 5CT0A 2PTKA 3FDNA 2HW7A 2OKRA 2OJ9A 2P2IA 1O6LA 3ORPA 4IWPA 4JQ7A 3ZLSA 3GQSA 3AC5A 4CZYB 5F4NA 3CEKA 2PK9A 1J7LA 2PUNA 4RMZA 2F2CB 3NEWA 4BDEA 2PZ5A 3GEQA 2J0KA 4U45A 3LMHA 3R7EA 2HXLA 3BU3A 2E9OA 2X9FA 3SRVB 3EZRA 2QVSE 5EDPA 3TIZA 5IDNA 3G6HA 4FMQA 3ITZA 4BCKA 3G33A 1U46A 5LMKC 5L8JA 5BMMA 3LM0A 2CKOA 4EK5A 2XKDA 4FEQA 3ZUTA 2IZSA 5A54A 5J9YA 4D2SA 1Y57A 4UMRA 4IMYA 3EHAA 4CV8A 5J1WA 2Z2WA 4DFBA 3A4PA 3PSBA 2O0UA 5D1JA 5LVLA 3U87A 4M84A 4M69A 1J4KA 3TUBA 5HE0A 4YJTA 5IA4A 3OY1A 3QU0A 3KMWA 3QCQA 2E9UA 4DC2A 2C6IA 5IQHA 1QPDA 2RFNA 3K3JA 3ELJA 3V8SA 4BCJA 3LAUA 4BDFA 3LXPA 4FUXA 4E6AA 1F5QA 5I5ZA 5ICPA 3L9PA 4UYNA 2E9VA 4BI1A 2I7QA 3U9CA 3EQDA 3IECA 1LGQA 2XEZA 3UNMA 4IZ7A 1LR4A 4RQKA 1UU3A 1LEWA 4U0IA 4MYGA 3LE6A 2CJMA 2OIQA 2WQMA 2VO0A 3FXXA 4GU6A 2QO7A 4IVBA 4S30A 5CF8A 1PJKA 5LARA 4D4VA 3OWPA 4RFYA 1KWPA 2WQNA 3DDPA 3E7VA 5H8EA 5M55A 3Q2MA 2HZNA 3VHKA 5DT0A 4R5SA 3L8VA 3KRJA 4FNWA 2W1HA 5AMNA 3QKLA 1PMVA 4Y85A 2CGUA 1VZOA 2VO6A 4BTJA 2F49A 4UWCA 5HKMA 5FXSA 3O8TA 3OT3A 3PPKA 4O91A 2YZAA 3D5XA 3R73A 4YZNA 3ZC5A 4ZZOA 3S0OA 1XH7A 3MV5A 3Q2JA 3Q4TA 4HYUA 4CYJA 3LFSA 4FG9A 2Y4PA 4Z7HA 2YLFA 1J4PA 3LLAA 4L3PA 4O0TA 3ZLWA 2CSWA 5E1SA 1R3CA 1ZYDA 3FMNA 5I3OA 2X7OA 4WG5A 3M11A 3F9NA 4G9RA 4TL0A 4ZAUA 2YABA 3QCXA 5L6WL 4ZZNA 3OOGA 5E90A 1PXIA 2VWWA 4EOPA 2YZLA 3WZUA 4NCTA 2CGXA 3A2CA 3ZRLA 4EOIA 4IW0A 5EI6A 5FTOA 5FG8A 4RLKA 4EQCA 4ZS4A 5TO8A 3VW6A 3LFEA 1WBTA 2QD9A 3UMZA 2LC1A 4LRKA 2PZYA 1U4DA 2XJ1A 3MH3A 4R3PA 5FEQA 2JQLA 4ENXA 2WGJA 2HZIA 4RC3A 4Y72A 4EH7A 3ACJA 4DFYA 5LMKA 5IQBA 4RWKA 4EOMA 4CFWA 2KULA 4DFXE 3LMGA 2ZAZA 2W0JA 4L46A 2O5KA 3MDYA 4O0RA 2WZJA 4RIOA 3R1SA 2J0LA 2GNIA 3C9WA 4EJ7A 4FK6A 1E1XA 3JUHA 3G90X 2VNWA 5HU9A 4N6ZA 4FT3A 3D14A 3VBTA 2C69A 2FSOX 2FSLX 3G2FA 4QTAA 3RZFA 5AA8A 5M4CA 5IEYA 1YOMA 4PMSA 2YIYA 3FYJX 3P23A 4QP1A 2QNJA 3OOMA 2XUUA 1M2RA 3NW6A 4O7WA 1XH6A 3CLYA 5DG5A 4CFVA 1QMZA 3QKMA 3U51A 4D2PA 2KFUA 2EVAA 4DLJA 4A0EA 2XBJA 3WILA 1ZYCA 2PVJA 4A07A 3S95A 1CTPE 4I41A 1UNGA 4IDTA 2BHHA 1JKLA 3PXQA 4YJPA 5JZNA 2CNQA 4IBMA 2VWVA 5CNNA 4I94A 4CTCA 3QD3A 4CRLA 3F3UA 3P7CA 5CASA 5L2IA 3G15A 5E8TA 5J79A 4EYMA 3VS7A 5JZJA 5K4IA 4MK0A 3CPCA 1WVWA 4FEUA 5K4JA 3CR0A 4V01A 4H39A 3V3VA 2YM5A 3IW5A 2JKOA 4O7VA 4QTBA 3U4WA 3COKA 3F3TA 3WF6A 1O6YA 2XIZA 3FC2A 1CDKA 4NH1A 1YOLA 2J51A 3I79A 1T45A 3R1QA 3AG9A 2GFSA 3PP0A 5EG3A 2YCRA 5FM2A 1XH8A 4RFMA 3RPRA 2JQJA 2VO3A 5M53A 4JBQA 4J96A 4AAAA 4ANMA 4DFLA 3HAMA 3IS5A 4BDJA 4L7FA 2VGOA 3OWKA 2QOBA 4J52A 3ZONA 2BAJA 5HVYA 3NCGA 4ZTHA 5HCZA 5IQCA 4H3QA 4QMTA 4KRDA 4CLJA 2FA2A 2BRFA 4O2PA 5G1XA 3ZCLA 4NFNA 4J53A 4ZSJA 5CLPA 3BE2A 3L9LA 4AW1A 3FZPA 3GT8A 3PIXA 1VEBA 2X8EA 4M12A 4U80A 3R9OA 4CG8A 5E1EA 4UY9A 3MFSA 4IB3A 3EWHA 4IHPA 3QQHA 1F0QA 3ZEWA 4DEDA 2R4BA 4QMOA 2J0JA 4IAFA 5J5TA 3SVVA 1ZRZA 5A9UA 4J7BA 4HJOA 5BVDA 5JEBA 5JFXA 2CKPA 2OZAA 3HVCA 3NRMA 1FVTA 4DG0E 5CI6A 2GHMA 4O6LA 1PXMA 1W84A 3MH2A 1XJDA 3SQQA 3R1YA 3OS3A 2RFDA 3N9XA 2R0IA 3M1SA 3SDJA 5JFWA 3ULIA 2W1DA 4QCJA 3R2YA 2XK7A 3EJ1A 4NSTA 3KN6A 2JFMA 2C6MA 3FMJA 1BMKA 2C0TA 1TQMA 3Q96A 1H01A 4PDYA 3ODYX 2W9FB 2OK1A 2C5YA 3I60A 4FTMA 4PNKA 1H08A 3WZJA 2IVSA 4QMZA 3L8PA 3MVJA 5TOZA 3NX8A 3ZRMA 2WTWA 3RNYA 1YWVA 2ZV9A 2BROA 4GFMA 2W3OA 3FLQA 4CT2A 4WA9A 1IA9A 3BPRA 3K5UA 5EI8A 4FT9A 3VS4A 3O2MA 5JKGA 2G1TA 2OFUA 3UO5A 3E8CA 5I3RA 3QQFA 3WYYA 3VS3A 5J1VA 3FM8A 5KCVA 4FNYA 4C4IA 1MRYA 4RA5A 3R6XA 4FV4A 5CEIA 3NS9A 4YJUA 2HENA 1G6GA 3PA5A 5DFPA 3NZ0A 4YPDA 1OBDA 5GJDA 4X2FA 3PPJA 1H00A 3BGPA 4ZTRA 4DEAA 4QQ5A 3OC1A 5HCXA 4KBCA 1H1SA 4MQ1A 1ZY4A 1UWJA 3HKOA 4PRJA 3WZEA 4MH7A 4EZ3A 2P4IA 1FOTA 1JKTA 2XK9A 3OFMA 5HVJA 2OH4A 4EC8A 2BFXA 4U44A 2CN8A 4R3CA 1QU5A 4IDVA 2A2AA 2B9JA 5HNGA 4FL3A 4N0SA 2H6DA 3C13A 4RBLA 3DLSA 2VRXA 2PE0A 3UMWA 3D94A 3E93A 4N70A 2HZ4A 2R3RA 3DBDA 1ZLTA 3E8NA 3KRWA 4DN5A 4MXAA 4F9CA 2V7AA 2C30A 3AC2A 3V5PA 4ACGA 3ZO4A 4D5KA 2QOQA 4YPSA 2H8HA 4F9AA 3BHVA 3DJ6A 2HELA 1FHQA 5HTCA 1SVEA 4RFZA 4FT0A 4ZTLA 4DGMA 4O7YA 4CGAA 1AD5A 1OZ1A 1AGWA 1JSUA 2C5NA 3VNTA 3TJCA 5FP5A 2VNYA 2B54A 3LFBA 3FZOA 2VTMA 4BZDA 3DU8A 2YCSA 4K77A 2YM4A 5IA3A 1R78A 3RZBA 4DFNA 3SGCA 2YDKA 4DF3A 5H3QA 4ACDA 3QCYA 3BLHA 2QG5A 3VBQA 2VTSA 2XBAA 4FYOA 4BHNA 4EUTA 3RGFA 1B39A 3MW1A 5E8YA 4ARKA 5AR2A 2VO7A 3H0YA 3ACKA 1OBGA 4FGRA 4NL0A 2BZJA 3NUNA 2UW4A 3GP0A 3OUNB 3WARA 2C6LA 2JBPA 4ZTSA 3PTGA 3P08A 3D2IA 4G2SA 4YZMA 3ORLA 3Q9XA 3BE9A 4HGSA 3SOAA 3FY2A 5DGZA 4BDKA 1J91A 3IGGA 1H27A 2PVRA 4KIQA 4AUAA 2DS1A 4BWXA 2ETRA 4A4XA 5I9ZA 3QRUA 1NT2A 4F4PA 4WKQA 2VD5A 4PUZA 5E8XA 5CENA 2XCKA 5HEZA 2BTSA 4IACA 2XNNA 2J7TA 2SRCA 3P1AA 5A4QA 4L9IA 5CEPA 5HU3A 5EQEA 2ITWA 2Z8CA 1PMNA 4EHGA 4L52A 1B6CB 4YP8A 4P2KA 5EHLA 1I09A 3ERKA 5CEOA 4OAVB 4Y83A 2PIEA 4KIKB 3DLZA 1WAKA 4OTGA 3ZXTA 1FINA 2Y4IC 1GJOA 1NVRA 3LFQA 3RCDA 3RWQA 3BBTB 3E63A 1JWHA 4W9WA 2UVZA 4XV1A 4CKIA 3BHYA 3F66A 4X2NA 5KKRB 1PRYA 2OF2A 5ANKA 1JVPP 3UC4A 4EKLA 1J7UA 2YM3A 4FSTA 2OW3A 3FLZA 4V0GA 2KB4A 1IAHA 3PIZA 3P9JA 2J9MA 3GU5A 4O7SA 4U81A 4I6QA 4FNZA 3MIYA 3SX9A 3H9FA 2WHBA 4RQVA 3NSZA 2C5OA 3FLSA 1Y8YA 3QD4A 4JIAA 5AP7A 4FL1A 4D2TA 2R7BA 4E6DA 4NZWB 4RIXB 4FTNA 3VUMA 5LCKA 5CANA 2GFCA 4DGGA 1JSTA 3OW3A 3WE8A 1K2MA 4U79A 1Q3WA 2RGPA 2JFLA 3P5KA 3Q4UA 4MD7E 4AWIA 3SA0A 4C61A 3KXHA 4WNOA 3RWPA 4F6SA 1A48A 1OB3A 1ZYSA 1XBCA 4Q9SA 2XMYA 4HYIA 4WNPA 5CI7A 5ETCA 4HVIA 3RHKA 5CZHA 4ORKA 4QMVA 2E2BA 4C4FA 3C4CA 2VWBA 1GXCA 4F0GA 3TZMA 1WV3A 3A7JA 4FV0A 3EN9A 3ZFMA 1OKYA 4GFGA 3B8QA 3TEIA 4BKJA 4C33A 4O21A 2OSCA 5EW3A 4OGRA 5DH3A 3RALA 3ENHA 3FEGA 3NW7A 2UVXA 3FV8A 5EQYA 3L9NA 2VTHA 4FR4A 5H8BA 4ZLOA 5AV4A 5C4LA 1OKVA 3R9RA 4U5JA 2WQOA 4LOPA 3LPBA 1WBSA 2BMCA 5FBOA 4XHKB 4GKHA 4C02A 5BX0A 4G6NA 3R00A 1P14A 4YHTA 2YHVA 3HAVA 3AMAA 5HO6A 5HBEA 3FXZA 1V1KA 4QMNA 4ZSEA 3F3VA 3COMA 4OTFA 5AA9A 3DNDA 3O71A 4WBBB 3VS0A 5CALA 2HW6A 1CKIA 2IJMA 3K3IA 5AADA 3MJ2A 2PUIA 3BLQA 4GJ2A 4LL5A 3QD0A 2R9SA 3SG8A 4E5BA 2RFEA 1H1RA 2UZNA 3DBCA 3VJOA 4RA4A 1PMEA 2ZV2A 3HRFA 3O7LD 5JGAA 2IVUA 4BC6A 4NM5A 4ZXTA 2ITNA 4E5WA 3QZIA 3NPCA 5C1QB 3Q5IA 4JDIA 1U54A 4S32A 3FXWA 2YITA 4FF8A 4C3PA 3PA3A 3CTQA 4ASZA 3A4OX 4J99A 5FEEA 3QRJA 1K3JA 2OXXA 4UXQA 2QI8A 4BZNA 3ZSGA 3RAIA 5HX8A 2BTRA 3O8UA 4YTFA 4G2FA 2VTLA 5E91A 3Q53A 2NNWB 4WNMA 2XIYA 2VTPA 1XWSA 3F61A 3NUUA 3QRIA 1PW2A 3ZH8A 2Y7JA 5HCYA 4W4VA 5EYMA 3U4UA 3A62A 5DOSA 3PWYA 4Q9ZA 5FXRA 2QOIA 3R7YA 3HUBA 3IPHA 2X6EA 2WQBA 4FIGA 2Z7SA 5EYDA 5J95A 5EDQA 5FDXA 5B2MA 5IEXA 2R5TA 4E4MA 1MP8A 4I5MA 3UOTA 3EN7A 5H8GA 1G3GA 1SVHA 3NYNA 4DEBA 3GNIB 3MN3A 2PVNA 3DXNA 4UX9A 2GQRA 3QKKA 5HGIA 4OLIA 5HNIX 4D4YA 4DTKA 3FLNC 4QMLA 4BIEA 1J1BA 4RIYB 3R22A 5FTQA 2WTKC 4QMYA 4JAJA 4DGOA 3KK9A 4FKVA 4MD9E 4IADA 2CHLA 2VUWA 5AJQA 4OTWA 1CM8A 4L53A 3WF5A 4CEGA 4NJ3A 3MBLA 4H1MA 3PY3A 4F08A 2VTIA 4Z7GA 3C4FA 3MPTA 4KA3A 3LW0A 3BIZA 4BGHA 3QC9A 4CFXA 4NTSA 4JBVA 5CSPA 1WVXA 3D2KA 5C03A 3W8QA 4CMOA 3A61A 4D9VA 1OL1A 2UW7A 2FVDA 4IZYA 3W8LA 3R7IA 2ITXA 3TKIA 3V6SA 4BL1A 5HBJA 1V0PA 3OUKA 3N4VA 5AX3A 2BRBA 3R9DA 4DHFA 2ZYBA 4QMSA 2WMRA 2CCHA 4AT4A 4UZHA 3ZHPC 3Q3BA 2AFFA 2PVHA 1WBPA 3MY1A 2C0OA 2OXYA 4EH9A 5GZAA 4MEDA 1XBAA 4RWIA 5EOLA 1V0OA 3H10A 3ETAA 4TWOA 4IQ6A 4OUCA 4XH6A 3ZOSA 3BEGA 4K8AA 4MWIA 4UALA 3AC3A 4H05A 3BHUA 3D83A 4BY9E 3F3ZA 3KF7A 4UWYA 5E50A 2ERKA 4BDCA 1K3AA 4C0TA 4EOKA 5E8ZA 3UYTA 2F9GA 4RRVA 3LFFA 3W55A 2EU9A 4I5PA 4JQ8A 3QZGA 1Q62A 5M51A 5GINE 2IZTA 5CAUA 3KVXA 3S3IA 2Z7QA 3RAWA 1H0VA 1JPAA 3DB6A 2X8IA 3ODZX 5AIKA 5GZ9A 3VN9A 5AV1A 3OCTA 3C0IA 3KXMA 3O8PA 5DPVA 1OIUA 3NYOA 4F70A 4O81A 4UZDA 4G3FA 2B9IA 4XUFA 4TYHA 3ANRA 2ZV7A 3HUCA 3OD6X 1O9UA 4FKWA 1PXNA 2QONA 4HPUE 4I1ZA 1H1PA 4MBJA 4LGGA 4FIIA 4TNBA 3ULZA 4UV0A 2JKKA 3TV6A 3FMLA 2Q0BA 2W05A 3R83A 2BIYA 4D55A 4CFMA 3O51A 3E8EA 4FTUA 3UNJA 4EBWA 2QODA 3OHTA 5LMBA 2YDIA 4USEA 1YXTA 4QD6A 4U7ZA 3UG2A 3UIXA 3BYMA 4I0RA 3UDBA 5A4CA 3HMMA 5HD4A 1PXLA 1Q8WA 4FX3A 4TNDA 1YWNA 5AP4A 3TIYA 3AD4A 5HVKA 4R7BA 3QTXA 2X2MA 4OTQA 3VUTA 3KMUA 3BGZA 4ASXA 4FG7A 4XV9A 2FH9A 4FKRA 4BDDA 5HIBA 3DGKA 3H3CA 4Y8DA 4ASDA 3HRCA 1Z57A 4XG8A 2W96B 5FXQA 3RK9A 4QYEA 1IA8A 1YI3A 4KIOA 4QNYA 1JKKA 5H9BA 1Q41A 4KNBA 4P7EA 2QOCA 4NEUA 3DS6A 1Q24A 2UW6A 3CKWA 2VWXA 2W1ZA 3RBWA 3HP5A 4LV5A 4PV0A 4YNOA 3EL8A 4XOYA 1CKPA 1Q5KA 5D9HA 3BEAA 3PP1A 3MYGA 3UODA 5BVFA 5AM7A 2PZIA 2QOKA 2OIDA 2GPHA 1P4OA 4D9UA 4FOCA 3HEGA 3NR9A 2QOHA 4FZDB 3NMUF 5I9XA 1B38A 2FGIA 2JDOA 5I9WA 4EORA 3QUPA 2XK4A 4L6QA 4L44A 4O1OA 1OL6A 4AA4A 3PZHA 2FO0A 3NYVA 2YERA 3DK3A 3G0FA 4HGLA 1J3HA 2GSFA 3DBQA 4JX7A 3KXXA 1APME 3COHA 4AT5A 1Y6BA 2WKMA 5KZIA 1STCE 3IW4A 2WIPA 4YHJA 2PULA 5C01A 5IQFA 3ZMMA 3NUSA 4R8QA 3EQFA 4LV8A 2V5QA 4E1ZA 2PMNX 3I0OA 3EMGA 4YTCA 2W5BA 4I5HA 3WI6A 1OVEA 4CQEA 4BGQA 3NLBA 3DXPA 4O0WA 1ZOGA 5DWRA 2OWBA 4ITJA 5DN3A 3QAME 2PMLX 1K2PA 1YVJA 3CD3A 2YIWA 1YDSE 3CTJA 4GVJA 4PL5A 3W1FA 5LWMA 2CKQA 1KE7A 4YJOA 3ZUUA 2P55A 1OUKA 2PVKA 3A7HA 3HECA 1XR1A 4GYGA 3FL4A 4GCJA 2VX3A 4KKHA 5KE0A 3UZPA 5L2SA 5KNJA 3MVLA 4DFUA 3MH1A 1RW8A 2NO3A 2BFYA 3ZFYA 4FE2A 4A4LA 4AXAA 3TCPA 4TWNA 5C8NA 3R1NA 1YXXA 5CQUA 3FPQA 5BUEA 5KHXA 4GT4A 4FSYA 3PRFA 3GOPA 4JI9A 4UBAA 4BTMA 2NRUA 3AD6A 5E7RA 4IIRA 1Y6AA 3PG3A 1WBWA 2W9ZB 3ZO2A 3HV3A 2X39A 3W10A 3ZLYA 3EIDA 1G8AA 1UHTA 5AWMA 1J4LA 2WMAA 2UZTA 2VTJA 1ZMWA 3I6UA 5I0BA 1FVRA 4HOKA 3LLTA 3ZO1A 2HY81 3HX1A 2Z60A 5M44A 5DI1A 2UVYA 4Y73A 3FI4A 4O96A 3GCQA 1W82A 3MA6A 4NKAA 1BI7A 5B2KA 5BVNA 4B8LA 1QPCA 1OMWA 2XNGA 4IJ9A 4EEVA 1Q61A 3DKGA 1H28A 2CNVA 2C1BA 2Y6OA 2O2UA 5JT2A 3KULA 4PY1A 4QMQA 5E8SA 2IO6A 3U9NA 4BN1A 5AP0A 2UW5A 3PXZA 4QRCA 3Q5ZA 5CAQA 4BKYA 4HPTE 2VTTA 2X7GA 3KRRA 1FQ1B 3VQUA 3CSVA 3KEXA 2FUMA 3QLGA 1O6KA 3G9LX 4HZSA 1OIQA 1P2AA 4C4GA 2HWOA 3EQHA 5JFSA 4YC6A 5J8IA 4OTHA 4UMUA 4Z16A 2KTYA 5IKWA 1G3NA 4PDOA 4D1SA 4TTHB 3P0MA 2FB8A 4F6WA 4IB0A 3R8MA 4M69B 4WRGA 4IVDA 5BVKA 1FPUA 4APPA 4I6BA 2W4OA 5D12A 1GZNA 5BVWA 2EXEA 3KGAA 5CU3A 4KIPA 5E8WA 3UPZA 2WAJA 5IA2A 4F9WA 3DAKA 1H24A 4CFNA 4IXPA 5L2WA 5JRQA 5AIRA 1NXKA 1OL5A 2QQ7A 2W7XA 4E20A 2XNBA 3PA4A 4R78A 2F4JA 1YDRE 3EQBA 4K6ZA 4W4WA 1H1QA 4FT7A 4Q5HA 4X3FC 4E26A 1KUTA 2JKMA 4BR3A 3F2NA 2JGZA 3FHRA 2Y9QA 4YJQA 3RPOA 1FHRA 3HUEA 4M7IA 4E7WA 3RP9A 5C9CA 4EBVA 4IX6A 4EH3A 2C68A 3O0GA 4ID7A 4YO6A 1PKGA 2CNUA 1S9IA 4IC8A 4QMPA 4CV9A 3PVUA 3PVBA 3NDMA 2V55A 5EKNA 3UQGA 3SXFA 4EWQA 2J5FA 3G9NA 3KKVA 4YZ9A 3E62A 4ANQA 5IEVA 3I0QA 2XKFA 3DZOA 5K5NA 4OT6A 5TE0A 4DG3E 2PU8A 3A7GA 3WIKA 3RK7A 2F7XE 3E64A 3EN6A 4JG7A 4MQ2A 2EH0A 3KY2A 4GKIA 4I20A 3NGAA 4D28A 4LUEA 1FMOE 5F94A 3AC4A 3FAAA 2R3QA 5BYYA 5K3YA 2PVMA 3L8SA 2BRGA 4EH4A 4TW9A 4FTCA 1YI6A 2Z7LA 3PG1A 5CTPA 2YISA 3DPKA 4HNIA 3F5GA 4FSUA 4WNKA 5FEDA 1XH4A 2WTVA 3JVSA 2RL5A 2XYUA 4X2JA 5DBXA 3R9NA 2A0TA 4PPBA 4FNXA 3TDWA 3F5PA 5GIPE 3BU5A 3QQUA 3EYHA 5FM3A 4BTKA 2J0IA 4YJSA 3QTIA 3AOXA 5HTIA 3BLRA 4QPAA 4ZTNA 2ZM4A 4PL3A 1OECA 2R3GA 3BWJA 3HMOA 4GU9A 4IM3A 2I40A 3I7BA 5JGBA 5K5XA 1IAJA 4QMMA 2VTQA 4E3CA 4BDHA 2BRNA 5HE1A 2JDRA 3R04A 4C62A 4LGHA 3KCKA 4G5PA 4DEGA 4ZSAA 5CEMA 3QTZA 5AR8A 5HIDA 5I4NA 3D0EA 4MXYA 5HLWA 2B7AA 3FUPA 1Q3DA 1WCCA 3ZXZA 4M15A 4EONA 3VS2A 1BLXA 4O7NA 4HVSA 4MF0A 3RK5A 5HQ0A 2C3KA 3C4EA 3HNGA 4RVMA 2UZUE 1ATPE 4BDBA 2HWPA 3QCSA 4JT3A 3D7TB 4GRBA 3EH9A 3KB7A 4WO5A 2JPEA 3I0NA 3BBWA 3AMYA 2PUUA 3GCVA 4X3FA 3TV4A 4AZEA 3OF0A 5KMKA 3OXZA 5HLNA 4YU2A 3AD5A 4YJVA 2C3LA 4RJ7A 4FV1A 4RX9A 3VUIA 5LVPA 3ZC6A 3ID6C 3KCFA 4RIWA 2BIKB 2XT9B 3H9OA 4FEVA 3WZDA 4JVGA 4FA2A 4U8ZA 4O0VA 3MIAA 3LOKA 3QQJA 3BZ3A 2BUJA 5DNRA 3T9IA 4F7LA 4F1TA 3V5LA 2ZMDA 2I0VA 1NVQA 1JQHA 3QXPA 3SOCA 3G51A 4FKTA 3QHRA 1PHKA 4V04A 4LG4A 3AT4A 1Y8GA 5L2TA 3OMVA 2UZOA 3DJ5A 4IX4A 2PSQA 2XVDA 4AU8A 3CTHA 4D0XA 3CPBA 2UW3A 4FYNA 1ZZ2A 4QOXA 3SD0A 2ITYA 4FKIA 2O64A 4NT4A 2KKLA 2ZDUA 4XV3A 4CT1A 1CSNA 1GZKA 4JR3A 5AUTA 3GU4A 3V01A 2CGWA 5JK3A 2XNMA 4A9YA 5BUIA 4WT6A 2XP2A 4HCUA 4TYGA 5LQFA 3LIJA 4ZLZA 4QP4A 4OR5A 4E4XA 5HORA 4B6LA 5AUXA 2FSMX 5IUHA 5BMSA 4TKSA 4LRJA 4GIIA 4E6QA 3O50A 4YJNA 4ZMFA 3VAPA 2IG7A 1OPLA 2W1FA 1U59A 4AN2A 1OL7A 1ZYLA 2YA9A 3OCBA 3NUPA 2QKWB 4ZOGA 4ZS0A 3GC7A 4ANSA 4EJNA 4F7SA 3JYAA 1ZMUA 2OZAB 3ORTA 5HO7A 1ERKA 4LYNA 4XBUA 2CDZA 2BZHB 4D4RA 2XRUA 4L67A 3UBDA 4JDHA 5EHYA 4HCVA 5AX9A 3GC9A 5IF1A 3DK7A 5T6KA 4BTFA 3KRLA 3VUKA 3E3PA 3RCJA 4C4JA 5CSXA 2IVTA 4BCOA 4FV5A 4DAWA 4G3EA 5J5SA 4B0GA 4Z55A 5IH6A 3VC4A 1WZYA 5JH6A 3COIA 4QP3A 3W2CA 4JNWA 2ERZE 4E4LA 3KQ7A 3OZ6A 4IE9A 3OTVA 3TN8A 2ZJWA 4ACCA 3DBFA 1YHVA 4N4SA 4XV2A 4NUSA 4CZTA 5IA1A 4FTLA 2WTIA 5EKOA 3SV0A 3C0HA 4TZRA 3B8RA 3F88A 2ZM3A 4K9YA 4L68A 1BL7A 3WF8A 1GOLA 5HD7A 4EK8A 4I4FA 1GY3A 5A4LA 3P78A 2CLQA 4WD5A 4C3FA 1KOAA 4IWOA 3GB2A 1ZOEA 1BYGA 2XCHA 2JDVA 3G5DA 4LOOA 3GOKA 4MHAA 5IDPA 5AUUA 1F3MC 3VA1A 2OJGA 4RC2A 4YZBA 5CVHA 4PP7A 1KOBA 3IG7A 2G2IA 4XEYA 2PZRA 3C0GA 4U43A 1KE5A 3MH0A 2FYSA 3Q6WA 4DLIA 2XK8A 3QC4A 4O83A 4IAYA 2C3JA 5KHWA 4CLIA 3FI8A 3QRKA 4EH6A 3EQRA 1HCLA 1H07A 1PYXA 5D10A 2UUEA 2X1NA 3IW7A 4JL9A 4FKUA 4EI4A 2CGVA 1ZYJA 3UIMA 2R3NA 4GSBA 1JBPE 3T3UA 2WMQA 3WF7A 4MAOA 4RVLA 1DI9A 3ORIA 3UOHA 4RT7A 3TNWA 5BPYA 3FMDA 3MSSA 3VUGA 4PTEA 4TXCA 3VRZA 3W2OA 3UYSA 4B7TA 1GIIA 5IH4A 3TNQB 4YSJA 3PZEA 2Y8OA 5CXZA 1S9JA 3FMHA 3GCSA 4FKLA 1GNGA 4HZRA 1KE8A 2QCSA 4IVCA 3CJGA 4ZJVA 2W4KA 4QTEA 5CXHA 2W5AA 3DBEA 3FJQE 3BRBA 2O65A 4C37A 1Z5MA 1TKIA 4CXAA 4ZK5A 3NVMB 3NYXA 3MGYA 4MX9A 1M2PA 3QWKA 4X6RA 5AP5A 3I6WA 1FGKA 4XG2A 4RWJA 4Z9LA 4ZLYA 4HVGA 2V22A 2WTJA 3VBWA 4A9TA 5J7HA 4C34A 3TV7A 5D7AA 3HGKA 4PMPA 3LFAA 2LGCA 4DBXA 3ORZA 2BILB 3RINA 4A7CA 2UZDA 5KMLA 3GFEA 4EZ5A 1RQQA 4M67A 5LXMA 4LQMA 3FKOA 5DEWA 4FVQA 3HYHA 3TNHA 4IH8A 2R3LA 4BIDA 4YTIA 4RC4A 1OI9A 3RM7A 1URWA 4M13A 4Q2AA 3UV0A 3ZDUA 4G16A 3E7OA 4OTRA 3PIYA 3IQ7A 4G3CA 4I5CA 2YDJA 4BIBA 5BYLA 2OLCA 4IZ5A 5C27A 4C4HA 1VYWA 2RIOA 4EOSA 2R3MA 3ZRKA 3P79A 3L9MA 4YURA 4IM0A 4F99A 5CU0A 2XA4A 5EW8A 3UP7A 4GUEA 5AP1A 4QP2A 4E5AX 1YXVA 2B9HA 2IW8A 5L8KA 1REKA 3FMMA 1UU7A 4ZY5A 4ZZMA 5ACKA 4NIFA 4YUQA 1XQZA 5I9VA 3OROA 4EGXA 5GJGA 3R7UA 2W1CA 3RMFA 3EN4A 4EUUA 3SW7A 1H0WA 4CRSA 3E3BX 2C6TA 3OXTA 3VUDA 4AGDA 5FWKK 5LJJA 4WIHA 2BKKA 2IPXA 4YR8A 4FG8A 4RIXA 4C2VA 2WMUA 4R1VA 4RPVA 4AGUA 4PMMA 3KXGA 2B1PA 3MFTA 3OVVA 3DNEA 3Q6UA 4ZEGA 3S4QA 5DHJA 1P5EA 2OF4A 4PDPA 4XYFA 5JRSA 3PFQA 4V0GB 4Y95A 1LGPA 4ZIMA 3CQWA 4HNFA 3QGWA 4PF4A 4AZTA 4CQGA 3PO8A 5DR6A 3R9HA 4X2GA 4ALUA 4CCUA 2UZLA 3NNUA 3V8WA 3ZM4A 1RJBA 2XJ2A 2ITTA 3QWJA 4YZCA 3ROCA 1ZOHA 1UVRA 2QOOA 4JQEA 3QGYA 3ELSA 4O22A 4BF2A 1SNUA 4KD1A 3UGCA 2DQ7X 2YIXA 4EC9A 1YXSA 5CSHA 2OXDA 2RFSA 5BVEA 2YWPA 4AOTA 4CYIA 3D15A 3UZRA 4E73A 4JDJA 1W0XC 4I93A 4M3QA 4J71A 3EKNA 2X2LA 3KMMA 3WIGA 3F69A 3PE1A 5HIEA 3TT0A 4G3GA 4L3LA 3UTOA 1UWHA 5JFVA 1NW1A 2XNOA 3C4XA 4L01A 4F9YA 4GMYA 4UYAA 4GJ3A 2IW9A 3H0ZA 3Q52A 4IB5A 4MCVA 3GU6A 4FV6A 3ORXA 1MRUA 5AR5A 3GFWA 1Q8UA 4OTPA 4BGGA 5CEKA 2R3FA 4UB7A 4KSPA 2GS2A 5A46A 3N4TA 3IGOA 4ERWA 1OL2A 1RDQE 2ZM1A 5J9LA 4WBOA 3E5AA 3OBGA 3EQGA 4DGNA 1DAYA 2VWIA 3Q9ZA 4NJDA 3S00A 2XK6A 3R02A 4II5A 3T3VA 1YJ5C 3EFWA 4TYJA 3PJ1A 5G6VA 1JOWB 2JDSA 3F3WA 3LKMA 4JBPA 1G5SA 3W16A 4MXXA 2HXQA 3HUFA 1K3NA 1BUHA 3UOKA 3P86A 4NM7A 3PYYA 5DJOA 4B99A 3UMXA 4FTQA 3CIKA 5AAFA 4XX9A 1YI4A 5B7VA 5HX6A 3AXWA 3ORNA 3QZFA 4EOOA 2QU5A 3LCTA 4W8DA 3FY0A 3C7QA 4MNEA 5KX8A 4DH1A 2G01A 3C51A 1R39A 4RWLA 3KVWA 4AZVA 2Y4IB 4QO9A 3FMEA 4R7IA 4XJ0A 5IQDA 3CJFA 4USDA 4D2WA 5EQPA 5CU6A 5GHVA 5C8KA 3PE2A 1H25A 3G0EA 5AM6A 5EH0A 2GNGA 1RE8A 2PMIA 2ZB0A 1H1WA 1OPKA 3FLYA 4BCHA 2AC5A 2Q83A 2C0IA 2ITQA 4GVAA 3CQUA 2V62A 3DT1A 3EL7A 2UZWE 4AOIA 4HW7A 2J4ZA 1IG1A 5DT3A 4DITA 1ZY5A 3A7FA 4MWHA 4GK2A 3V04A 3LQ8A 4GT5A 2X7FA 1Q8YA 1IR3A 3CD8A 4AA0A 3LMIA 2QOLA 4EHVA 4RIYA 4AGCA 2H34A 3ZZWA 5M4UA 3Q9WA 1KV1A 5AEPA 4HVHA 4GIHA 4GUBA 1GIJA 4WG4A 3PPZA 4J97A 3SXSA 3ZUVA 3I81A 4LMNA 2RSVA 4K33A 1BI8A 1Q8TA 2J2IB 3ZBXA 4AACA 2BDFA 5FDPA 2QHNA 4AFJA 2X81A 3MJ1A 5J7BA 2X8DA 2PUPA 2A27A 2OIBA 1J1CA 5DYJA 1WBNA 5L6OA 3R63A 2NP8A 3AMBA 3DFAA 2WO6A 1PY5A 1NY3A 2UZBA 1OITA 4O86A 2WMTA 4BCMA 3LQ5A 2WMSA 3QX4A 3C5UA 4P90A 4XG7A 4Y5QA 3FL5A 2VZ6A 1WLNA 2ZMCA 1L3RE 1OKWA 4RGJA 4WUNA 5KUPA 4J98A 1HCKA 4L00A 3SC1A 3UVQA 2YFXA 3D9VA 4WG3A 4QQCA 4F0IA 4X7QA 2X6DA 4RJ4A 4CG9A 1GZOA 4RJ6A 5CNOA 5AV2A 4FV8A 3LFNA 3JPVA 3DQXA 2P2HA 3SG9A 3KXZA 5KBRA 2XS0A 3OCSA 2HY0A 2CMWA 2VGPA 5EM5A 4C36A 2JDTA 4FT5A 3OEFX 1Q99A 3WF9A 5F1ZA 5IUGA 5E4HA 4I6HA 5HBHA 4NW5A 5LMAA 4NYEA 5HNBA 4TPTA 3H9RA 4IAIA 2R7IA 2JIIA 4M0ZA 3NW5A 3F7WA 1MQ4A 2GS6A 4K11A 3W18A 3ZDIA 2V7OA 5LOHA 3UNZA 2UZVA 3VIDA 3MDBA 5KBQA 3R0TA 4GH2A 5L4QA 2A0CX 4FZFB 4RJ5A 3QD2B 4GK3A 4JDKA 4BI2A 5FBNC 4ZSGA 4RVKA 3M2WA 3OWLA 5GIOE 4U41A 4U97A 4U40A 4QMWA 3SXRA 2IN6A 1X8BA 5EOBA 2EB2A 4FZ7A 4I3ZA 1ZZLA 4ITIA 4M66A 3Q60A 4YLJA 4IM2A 4DA5A 4BBEA 5CWZA 2BAKA 5IQEA 3ZYAA 4TYHB 2GTNA 4O2ZA 3GU7A 3OP5A 2XF0A 2RG5A 2GNFA 2R0UA 5ETAA 2IZUA 4FV2A 4KABA 2C6EA 4DE4A 3R21A 1CKJA 3FSFA 3EFKA 3ORKA 4C8BA 4X0MA 3JY0A 2LAVA 3MI9A 1M2QA 3QALE 5B2LA 5J87A 4IX5A 4EH8A 2XKEA 4EQUA 3UOLA 1L8TA 3TZ7A 4G6OA 2WTKB 4MXZA 3UO6A 4EOJA 3DZQA 3ZBFA 4BDAA 4F6UA 2QU6A 2C1AA 4JLCA 5AUWA 3AGMA 3QA8A 3PJ8A 3DKCA 4D9TA 4FKSA 3BCEA 2PZPA 4J8NA 4V05A 2PL0A 4U3YA 3ANQA 4R3RA 3MY0A 4S34A 5DRBA 4UEUA 2OFVA 3QQGA 2G1LA 4PP9A 1JSVA 5LWNA 4P5QA 4U6RA 4Z3VA 2GNHA 5TKDA 2VU3A 2YEXA 1Q8ZA 2F7EE 2ZOQA 1XH9A 3GI3A 2WTCA 3OTUA 4FV3A 3GC0A 4KAOA 3QBNA 3LCDA 4QYFA 2QO2A 3W2QA 4F9BA 4H3PA 3V5TA 3UQCA 1XH5A 3D7ZA 4KKEA 3UO4A 4MD8E 2F2UA 2W1IA 3FBVA 4I23A 1YJMA 2I0EA 4EOQA 4PNIA 3Q04A 4IX3A 3A8XA 5DR9A 2WMWA 4AZFA 4JG6A 4UMPA 3QTSA 4HYHA 2BZIB 1UKIA 4QYYA 4GS6A 2REIA 1ZAOA 2IW6A 1SMHA 3ALNA 4NW6A 2ACXA 5AV0A 5CZIA 4BCPA 4AE9A 4ERKA 2VTRA 3I0MA 3PY1A 2WELA 5CAVA 3LFCA 2CPKE 2O3PA 3VVHA 2WU6A 4PWNA 2ZV8A 1XO2B 3KL8A 3MWUA 4BCFA 4WRSA 4RX5A 5DMZA 1WBOA 3T8OA 4Q5EA 4O1PA 1KE9A 4BB4A 4QTCA 4L43A 4R5YA 4MKCA 5I9YA 4RJ3A 4YJRA 2CSNA 4BVUA 5AUVA 3HV4A 1A06A 2JEDA 2JAVA 3O96A 5DIAA 4CMUA 1OPJA 4A06A 4ZTQA 4E4NA 2PMOX 2YCFA 3C4ZA 5EHOA 3ZSHA 3IO7A 5ITAA 4BKZA 2XM8A 3UQFA 2YLEA 1URCA 4QTDA 3PJ3A 4XP0A 3WOWA 3IDPA 1FBNA 4IC7A 4Y46A 2WXVA 2WMBA 3E87A 2AC3A 2GHGA 3VBYA 3NAXA 4OTIA 4X21A 4UMTA 2G2FA 2XNEA 3SRVA 5F20A 5HG7A 3MTLA 4PX6A 3FE3A 2XB7A 4NWMA 3QZHA 3KT9A 1J4OA 5CF6A 3A99A 3V8TA 3CP9A 3ZU7A 2XZSA 3NUYA 1M14A 3I4BA 4FKQA 5K0KA 1T46A 1PXKA 5L3AA 3VHEA 4O84A 3QYZA 4QYHA 4L7SA 5AP2A 1MUOA 4BRXA 5JGDA 3UZTA 1SVGA 3FPMA 2ESMA 2C3IB 3FZSA 3LM5A 4O7LA 5LVNA 3V5JA 5HZNA 1YXUA 4MXOA 5CAPA 3CGOA 5T68A 3VS5A 3T9TA 2IZRA 2BVAA 4CZUA 3F5UA 3QTRA 5E8UA 4ZJIA 5M4IA 3BWFA 5A8IA 4H3BA 4DT8A 4CMTA 4FKJA 4AFEA 4M14A 4FZAB 2XK3A 2UZEA 4IB1A 3I5ZA 3CXWA 2P0CA 4HCTA 4XG6A 4C59A 4DEHA 5E8VA 1E1VA 4U3ZA 3CCNA 4I92A 4FIHA 3NUAA 2YAAA 4FSWA 3AGLA 3KULB 2QOFA 3LXLA 4PL4A 3MPAA 5CYIA 4ONAA 1ZXEA 4ZTMA 3RVGA 1UNHA 4IWDA 4EH2A 4JIKA 4W4XA 4FUYA 3K2LA 3QXOA 4PPAA 2YWVA 3FI2A 4UWBA 5AR3A 3BELA 4NU1A 2Z7RA 4L45A 4ACHA 4C4EA 1M17A 4CCBA 4I0SA 1M7QA 5KMNA 3CQEA 4TT7A 5ANOA 3RI1A 4AA5A 1R1WA 3DFCB 5AR7A 5FLFA 3S2PA 4YLKA 3ZTXA 4BYJA 5AFVA 4AN9A 4BZOA 1IEPA 4L8MA 4O38A 2XM9A 3VJNA 3WYXA 4NM3A 2X9EA 4K2RA 4XG9A 3VWAA 5K9IA 4I21A 1MZKA 2BRHA 3NVKI 4QP6A 4BCGA 5JQ8A 5BVOA 5M56A 2HOGA 3QFVA 3DJ7A 3JY9A 3DV3A 3MA3A 3KFAA 3EKKA 3BKBA 2B0QA 4FTIA 4D2VA 2W17A 2YM6A 3HA8A 4WSQA 4FV7A 4FC0A 4A4OA 2GQSA 3F6XA 2J90A 4AS0A 4JBOA 5IG1A 3L1SA 1BL6A 3QTWA 4FKOA 3TUCA 2HK5A 3GU8A 4FTKA 4QQTA 5EK7A 2OZOA 5CX9A 3QTQA 4KWPA 1P4FA 1W98A 2GU8A 4FIEA 2QC6A 3UIBA 3LXNA 4DH5A 3HA6A 5AP6A 4AE6A 4ANBA 1J7IA 2UW0A 2QR7A 3WE4A 3WZKA 4BCNA 4A9RA 3BQCA 3U8WA 3POOA 2J5EA 2EUFB 4HGTA 2G9XA 2WQEA 5CU2A 1OIRA 3EQCA 2WMXA 4I22A 3A60A 4CNHA 3TUDA 1WMKA 5L6PA 4C7TA 2VTNA 2BRMA 3Q4ZA 4G3DA 3LVPA 5JQ5A 3HMPA 2RG6A 2QHMA 2C4GA 3JXWA 5EM8A 1PYEA 2PE2A 1DI8A 3KU2A 4QT1A 2BR1A 2YN8A 2ETKA 2OJJA 3CY2A 4N6YA 1E9HA 3LZBA 4KSQA 4RVTA 3E92A 3BHHA 3CKXA 3W33A 5IMEA 2ZB1A 3BV2A 3ET7A 4GT3A 5DT4A 1PXOA 4P5ZA 4AG8A 3R7VA 2PVYA 3LCSA 4O0XA 1JLUE 2NRYA 3P7AA 3ALOA 2PVLA 2WFYA 5EYCA 4FVPA 3REPA 5IZFA 3EZVA 3EB0A 2O63A 3TNPC 3D7TA 3IDBA 3AC8A 2O8YA 4OBOA 5I9UA 4OBPA 5C4KA 4I24A 5ANIA 2BHEA 4XG4A 4FSRA 3KC3A 3OBJA 2F7ZE 2OBJA 3MB7A 3KRXA 4XG3A 4XRJA 5IU2A 3LJ1A 4FKPA 2WOTA 1TQPA 3D5WA 4JG8A 4IWQA 2I6LA 2YIQA 4DINA 4GFOA 4LOQA 3JVRA 4XS2A 4J8MA 4CSVA 1VJYA 5AP3A 1OUYA 2EXMA 4JX3A 3ATSA 4C2WA 4AZWA 4D1ZA 3NNXA 3HDMA 5CS6A 4K0YA 4W4YA 1GAGA 1OGUA 4QYGA 4WSYA 5KZ0A 4D1XA 4R77A 3R30A 4OAUC 4E6CA 3DK6A 4U42A 2QG7A 3PVWA 4X3FB 4JXFA 3NIEA 4DH7A 3BV3A 3NWWA 4XBRA 4EK6A 3DTCA 3R01A 4QMUA 4RIWB 4DT9A 3F5XA 5FTGA 3EN5A 3PDTA 3VBVA 4E93A 1VYZA 3D5VA 2EXCX 4G17A 1W8CA 4JRNA 3I5NA 2VWUA 5HO8A 3UPXA 4BYIA 2XIXA 1H26A 3A8WA 3TKHA 1PXJA 1QCFA 4M0YA 3UG1A 2HIWA 2Y0AA 2ITOA 1VR2A 4YC3A 2GMXA 4TYEA 4KINA 2PY3A 3W32A 3TNIA 3ZSIA 4HVDA 2H96A 3D4QA 4JRVA 3U6JA 2WIHA 4FEWA 3PSDA 5FRIA 4H87A 4M8TA 1SM2A 1QPJA 3TZ9A 4JOAA 4D5HA 1JNKA 2WNTA 4HYSA 4XP3A 3MESA 3FC1X 4MF1A 1LUFA 1SYKA 4FEXA 4BBMA 4YO4A 3ZS5A 1YRPA 1UV5A 5CEQA 4I4EA 3PXRA 5ANDA 4D0WA 4B8MA 3LJ0A 4C35A 2J6MA 5HE3A 2R2PA 5HLPA 5FGKA 1NVSA 3NCZA 4IVAA 3S1HA 5KMIA 4FIJA 4AW2A 4C57A 4GW8A 1ND4A 4BDIA 2IWIA 4KKGA 3EYGA 5IQIA 2R64A 3QX2A 4RZVA 2GNJA 2BDJA 3GCPA 1YDTE 2GDOA 2QO9A 5CQWA 3UVRA 4AZSA 3UVPA 1IASA 4AF3A 4W9XA 4CKRA 2WMVA 4Y5HA 4ZY6A 3TKUA 4FIFA 2EB3A 1MRVA 5E92A 5HHWA 2OI4X 2ITVA 5CVGA 3UNNA 3VQHA 3RAKA 1JAMA 4CFUA 5HG9A 2PVFA 5KKRC 2C6OA 2QURA 3RTPA 3GC8A 4JAIA 3V5WA 5L8LA 4FTOA 3TI1A 3PVGA 4G1WA 4GV1A 4OT5A 1GZ8A 1Q97A 5M06A 2OG8A 1TVOA 1U5QA 3BHTA 2DUVA 3R8VA 2AUHA 3GXLA 4UXLA 3GVUA 5M4FA 2OGVA 3R71A 5TT7A 3EQIA 3F2RA 2VWZA 3DB8A 2W1GA 3QL8A 4JONA 4O0UA 3F2AA 2XIKA 3ORMA 4XMOA 3PSCA 1YW2A 4D2RA 2C5VA 3PLSA 2B52A 3HP2A 5AUZA 2R3PA 4AN3A 4F7NA 5EDRA 4XLIA 3QRTA 2A4LA 3VF8A 3FQEA 1NA7A 3TL8A 4EL9A 3MTFA 3PXFA 3Q32A 4GG5A 5L2QA 1R0PA 2JD5A 2QLQA 2R3HA 3W2PA 4EK3A 1KSWA 2AYPA 2OU7A 2WEVA 3QYWA 3EOCA 4TY1A 3NNVA 4MNFA 4DFZE 2XRWA 3CS9A 2Y6MA 4K18A 4MBLA 3PXYA 4FSNA 5CY3A 4YGAA 3RPYA 3UP2A 1W83A 2XH5A 4CVAA 3ZO3A 1ZWSA 3NIZA 4EOLA 3F7ZA 3E88A 3I7CA 5CSWA 1PXPA 3OUNA 4QP8A 4BWPA 4FKGA 3N51A 4BBFA 5KO1A 4GYIA 2BDWA 1UKHA 2B9FA 5HG8A 2HAKA 2JQIA 3OG7A 1XKKA 5IUIA 3TM0A 1QPEA 3MFRA 3GQIA 2WU7A 4DG2E 4L3JA 4PTGA 3UC3A 4YMJA 2OJIA 1ZARA 3C50A 4C58A 3AT3A 4BICA 5C8MA 4X2KA 3K54A 3C4WA 2PYWA 3H30A 5M08A 2YM7A 4FZ6A 1A9UA 3LCOA 3SW4A 2YAKA 4AOJA 1UJXA 3BGQA 5H2UA 4EQMA 4O6EA 3R8LA 3TACA 3FWQA 5AV3A 4XP2A 5LCJA 2C6KA 4C3RA 1ZMVA 5EM6A 3RPVA 4DEEA 3OT8A 3NUXA 5A3XA 3EQPA 4KIKA 1OIYA 1H4LA 3HDNA 3HMNA 3LHJA 4I0TA 4MVFA 4QPSA 3VUHA 4E8AA 3SAYA 2YJRA 3SKCA 2PWLA 3PWDA 3TTJA 5BQ0A 2C6DA 3LFDA 4BFMA 4BDGA 3FZ1A 3O17A 4LMUA 4G9CA 2IVVA 3FYKX 5IPJA 2ONLC 2XIRA 1K2NA 3FSKA 4EYJA 2WPAA 3QHWA 5T3QA 3PLAE 3VRYA 3HV7A 2XNPA 3V5QA 3IW8A 4RZWA 4YZDA 3P7BA 3QUEA 3W2SA 1WBVA 4S2ZA 3VS6A 3RHXA 2B55A 2YCQA 5J9ZA 3DOGA 4A9SA 3DA6A 2A1AB 4R6VA 2P33A 4JS8A 4ALVA 4NKSA 3U55A 4XLVA 2G2HA 2FSTX 2DWBA 4BWKA 3TG1A 1V0BA 2QR8A 2X0GA 2VX1A 4ANNA 5EYKA 3R8ZA 5IA0A 1YQJA 2GS7A 3ZLXA 3MVHA 4NIFB 4DYMA 1UU8A 2X2KA 2BCJA 4K1BA 4FI1A 4AW0A 5F9EA 3FQSA 4TYIA 4D4SA 4LFIA 2R3IA 4LM5A 2F57A 4O0YA 4J1RA 2VTAA 1XHAA 4O0SA 2BAQA 4YTHA 2G15A 4FTJA 2BZKB 5A4EA 2BPMA 4WHZA 4GK4A 2FF4A 4QP9A 2P3GX 4LL0A 3BU6A 5CF4A 3DXQA 1CMKE 2GNLA 2W4JA 4FODA 3HRBA 5IH5A 4NFMA 5ETIA 3VW8A 3THBA 4OTDA 4QMXA 4FICA 1YHSA 4DCAA 3OY3A 3OEZA 5DA3A 2JKQA 3DAJA 3TJDA 4DBNA 5IQGA 4CKJA 3DTWA 5GJFA 4LGDA 3UN0A 3MPMA 5D7VA 3D5UA 4N57A 5DVRA 4TWCA 3QTUA 3VS1A 3IKAA 2XYNA 4G5JA 2HYYA 4YLLA 5IA5A 5IISA 2W5HA 4PQNA 2KB3A 1LPUA 5ANGA 4EKKA 3OW4A 3KF4A 2WEIA 4W8EA 3IW6A 3MY5A 4CD0A 3BYUA 2B4SB 4DH3A 3E8DA 5BUJA 4IAZA 3QQKA 4PMTA 3R8UA 1R0EA 5A6OA 5CVFA 3LJ2A 3OXIA 3V6RA 5FUTA 2UW8A 2OJFE 3PJ2A 4AX8A 4F1MA 2WD1A 3POZA 4S33A 4I6FA 3AQVA 3U6HA 1H8FA 2OO8X 2ONLA 3SLSA 5AAEA 3BYSA 4IEBA 4FSMA 4ENYA 2J0MB 1UA2A 4KB8A 1EH4A 5HG5A 2A19B 4BI0A 5AR4A 1KV2A 4NTTA 2WB8A 2GTMA 3I1AA 4QQJA 3RM6A 1G8SA 3POAA 2R3OA 3W2RA 3QA0A 5KMOA 1HOWA 4FL2A 2JIUA 3WBLA 4EK4A 5ACBC 2VAGA 5EI2A 5A6NA 1U54B 1KE6A 1J4QA 4U9AA 4H36A 4RX7A 3GENA 3OCGA 5FQDC 3PRIA 2BALA 4BHZA 4NK9A 4AT3A 1U5RA 1SNXA 4H58A 4AP7A 3RNIA 4B4LA 4F63A 2BKZA 4TWPA 2XEYA 4TN6A 4TRLA 5KMMA 2JIVA 4F7JA 3Q4CA 2VV9A 4UMQA 5DRDA 5HICA 1LEZA 3ROYA 3KA0A 3CGFA 4X3JA 2C47A 4MNEB 4IZAA 1W7HA 4AQCA 4FBXA 3IOPA 2YIRA 4JJRA 3TWJA 5IMXA 4DTAA 4R7HA 3HLLA 2JLDA 3U6IA 3PJCA 2B53A 3II5A 4H1JA 4LUDA 4ASEA 5M07A 4XOZA 4EZ7A 4IAKA 4ITHA 5BYZA 2WOUA 5CF5A 5HTBA 1AQ1A 4DTBA 3A7IA 3OWJA 3R7GA 3B2WA 4QPMA 3ELVA 4RG0A 2OICA 4IFGA 3VPYA 3DY7A 2JKDA 2PPQA 3R2BA 3VULA 3LCKA 4ZMEA 2H9VA 5AAGA 3ZM9A 2GHLA 1LP4A 1YKRA 4YNEA 1YHWA 2QKRA 2RF9A 4HGEA 4P4CA 3R7OA 1WFCA 3V51A 4IFCA 1REJA 3FZRA 5EFQA 2EWAA 4G31A 4GG7A 5JMSA 4QNAA 3IONA 5HESA 5A14A 4XCUA 3KREA 1XBBA 4USFA 4FK3A 4C38A 3KK8A 3M42A 4BCIA 3TDVA 5AUYA 5BNJA 1QL6A 4QP7A 4APCA 4IJPA 1YOJA 4YBJA 4J95A 3IDCA 2V0DA 3AC1A 1JKSA 3VO3A 4KBKA 3ZFXA 2CLXA 2CKEA 3GGFA 4FSZA 3QLFA 5DE2A 5EM7A 4ZP5A 2DYLA 4RSSA 2YACA 5HE2A 3N4UA 3B2TA 5HI2A 4FV9A 4R1YA 4PDSA 4WUAA 4DH8A 3GBZA 5DEYA 2W06A 4O27B 3NAYA 1YWRA 5M09A 1DS5A 3FKNA 5ETFA 4A9UA 2NPQA 4F09A 4EHEA 3F82A
chains in the Genus database with same CATH superfamily
3FKLA 3MFUA 3P4KA 3PY0A 1M7NA 1OM1A 4ACMA 5IQAA 3BQRA 3AKJA 2YJSA 4YSMA 5HOAA 4B9DA 4FGBA 3HX4A 3VF9A 3FMKA 4F0FA 3O23A 1BKXA 4YC8A 2CCIA 5ANEA 2I0HA 3GQLA 3HV6A 4G34A 4X6QC 5FP6A 5GNKA 3GCUA 3UE4A 4ALWA 1DM2A 4OW8A 4YBKA 3UIUA 2HCKA 2VTOA 4AGWA 4MTAA 4RLLA 1DAWA 3GUBA 3R28A 4WOVA 5CT7A 3NNWA 3QQLA 5CSVA 1R21A 5JELA 2GQGA 4KS8A 3KN5A 4CTBA 3UJGA 2CN5A 3FZTA 2WTDA 4YHFA 3TZ8A 3VA4A 3PXKA 2J50A 5K0XA 4GL9A 5A4TA 1U7FB 2XKCA 1TQIA 3O7LB 4EJQA 3A77A 4D58A 4KUJA 5C26A 4FSQA 5DLSA 2PHKA 3FI3A 3C1XA 3QF9A 2OH0E 3RPSA 2ITZA 4FTTA 3JS2A 3PUPA 4KRCA 2JAMA 5CU4A 2I1MA 4NM0A 2W99B 3BYVA 4S31A 4ZJJA 3SHEA 1PKDA 3U54A 2UV2A 4O7TA 1PMUA 1IRKA 2C5XA 4EHZA 4O82A 1WVYA 2E9NA 2JBOA 4RX8A 4PPCA 4EWHA 3HMIA 3L8XA 4FVRA 4LI5A 4EH5A 2ZVAA 3CE3A 3EFJA 4RJ8A 2E9PA 3ZEPA 3LQ3A 4F65A 3VBXA 3LXKA 3MS9A 4IANA 4LRMA 2RKUA 2X4FA 1PF8A 4F64A 2Q0NA 1BX6A 2ITUA 4M68A 5JN2A 4XNEA 3FLWA 5TR6A 2XJ0A 1FGIA 4PTCA 4ANOA 2JITA 4KBAA 3ATTA 1UU9A 2HZ0A 5B0XA 3DKFA 5M57A 1K9AA 2ZDTA 4ZY4A 2YM8A 3TXOA 3FQHA 1SZMA 3HV5A 3UNKA 1FVVA 4G6LA 1Z0SA 3DAEA 4AW5A 2FEZA 1K3QA 3MVMA 4XRLA 4ZSLA 3HL7A 3IK3A 3G6GA 4DCEA 2QLUA 5TF9A 4JR7A 3FHIA 3BYOA 1FMKA 1Z0UA 3C5IA 3CBLA 3EFLA 4DGLC 5F95A 4UN0C 3ZZEA 4FTAA 2R3KA 1UNLA 4FTRA 4IAAA 3BX5A 5EW9A 4BCQA 5GZ8A 1I44A 5DR2A 3IOKA 3ENMA 5ANJA 2ETMA 4OBQA 5D41A 3RKBA 4ANLA 5LVOA 5E9EA 3CC6A 5FD2A 5JSMA 2QV7A 3DKOA 3DQWA 4FOBA 4M97A 1DMZA 2W1EA 4DEIA 4CFFA 4O7RA 2X4ZA 3TTIA 1Q4LA 4GEOA 1OKZA 5D11A 4O7ZA 1Y91A 3MB6A 3R8PA 1MQBA 3QUDA 2JC6A 5LVMA 2I0YA 2VX0A 4KS7A 4F1OA 3RAHA 5KMJA 3UOJA 1M52A 2VN9A 3CY3A 3RJCA 2ITPA 3V8QA 2UW9A 3JR1A 3AT2A 3Q9YA 4L42A 4MBIA 2Z02A 2GCDA 2R3JA 5CAOA 3DCVA 3DDQA 3HZTA 3K5VA 2PE1A 3KXNA 1Z9XA 2VWYA 1GIHA 3BI6A 3H4JA 4NCTC 4MXCA 5CT0A 2PTKA 3FDNA 2HW7A 2OKRA 2OJ9A 2P2IA 1O6LA 3ORPA 4IWPA 4JQ7A 3ZLSA 3GQSA 3AC5A 4CZYB 5F4NA 3CEKA 2PK9A 1J7LA 2PUNA 4RMZA 2F2CB 3NEWA 4BDEA 2PZ5A 3GEQA 2J0KA 4U45A 1ST4A 3LMHA 3R7EA 2HXLA 3BU3A 2E9OA 2X9FA 3SRVB 3EZRA 2QVSE 5EDPA 3TIZA 5IDNA 3G6HA 4FMQA 5EJIA 3ITZA 4BCKA 4AXFA 3G33A 1U46A 5LMKC 5L8JA 5BMMA 3LM0A 2CKOA 4EK5A 2XKDA 4FEQA 3ZUTA 2IZSA 5A54A 5J9YA 2XAOA 4D2SA 1Y57A 4UMRA 4IMYA 3EHAA 4CV8A 5J1WA 2Z2WA 4DFBA 3A4PA 3PSBA 2O0UA 5D1JA 5LVLA 3U87A 4M84A 4M69A 1J4KA 3TUBA 5HE0A 4YJTA 5IA4A 3OY1A 3QU0A 3KMWA 3QCQA 2E9UA 4DC2A 2C6IA 5DHTA 1QPDA 5IQHA 2RFNA 3K3JA 3ELJA 3V8SA 4BCJA 3LAUA 4BDFA 3LXPA 4FUXA 4E6AA 1F5QA 5I5ZA 5ICPA 3L9PA 4UYNA 2E9VA 4BI1A 2I7QA 3U9CA 3EQDA 3IECA 1LGQA 2XEZA 3UNMA 4IZ7A 1LR4A 4RQKA 1UU3A 1LEWA 4U0IA 1DD1A 4MYGA 3LE6A 2CJMA 2OIQA 2WQMA 2VO0A 3FXXA 4GU6A 2QO7A 4IVBA 4S30A 5CF8A 1PJKA 5LARA 2I2BA 4D4VA 3OWPA 4RFYA 1KWPA 2WQNA 3DDPA 3E7VA 5H8EA 5M55A 3Q2MA 2HZNA 3VHKA 5DT0A 4R5SA 3L8VA 3KRJA 4FNWA 2W1HA 5AMNA 3QKLA 1PMVA 4Y85A 2CGUA 1VZOA 2VO6A 4BTJA 2F49A 4UWCA 5HKMA 5FXSA 3O8TA 3OT3A 3PPKA 4O91A 2YZAA 3D5XA 3R73A 4YZNA 3ZC5A 4ZZOA 3S0OA 1XH7A 3MV5A 3Q2JA 3Q4TA 4HYUA 4CYJA 3LFSA 4FG9A 2Y4PA 4Z7HA 2YLFA 1J4PA 3LLAA 4L3PA 4O0TA 3ZLWA 3VZDA 2CSWA 5E1SA 1R3CA 1ZYDA 3FMNA 5I3OA 2X7OA 4WG5A 3M11A 3F9NA 4G9RA 4TL0A 4ZAUA 2YABA 3QCXA 5L6WL 4ZZNA 3OOGA 5E90A 1PXIA 2VWWA 4EOPA 2YZLA 3WZUA 4NCTA 2CGXA 3A2CA 3ZRLA 4EOIA 4IW0A 5EI6A 5FTOA 5FG8A 4RLKA 4EQCA 4ZS4A 5TO8A 3VW6A 3LFEA 1WBTA 2QD9A 3UMZA 2LC1A 4LRKA 2PZYA 1U4DA 2XJ1A 3MH3A 4R3PA 5FEQA 2JQLA 4ENXA 2WGJA 2HZIA 4RC3A 4Y72A 4EH7A 3ACJA 4DFYA 5LMKA 5IQBA 4RWKA 4EOMA 4CFWA 2KULA 4DFXE 3UDTA 3LMGA 2ZAZA 2W0JA 4L46A 2O5KA 3MDYA 4O0RA 2WZJA 4RIOA 3R1SA 2J0LA 2GNIA 3C9WA 4EJ7A 4FK6A 1E1XA 3JUHA 3G90X 2VNWA 5HU9A 4N6ZA 4FT3A 3D14A 3VBTA 2C69A 2FSOX 2FSLX 3G2FA 4QTAA 3RZFA 5AA8A 5M4CA 5IEYA 1YOMA 4PMSA 2YIYA 3FYJX 3P23A 4QP1A 2QNJA 3OOMA 5DHRA 2XUUA 4BJJA 1M2RA 3NW6A 4O7WA 1XH6A 3CLYA 5DG5A 4CFVA 1QMZA 3QKMA 3U51A 4D2PA 2KFUA 2EVAA 4DLJA 4A0EA 2XBJA 3WILA 1ZYCA 2PVJA 4A07A 1KHUA 3S95A 1CTPE 4I41A 1UNGA 4IDTA 2BHHA 1JKLA 3PXQA 4YJPA 5JZNA 2CNQA 4IBMA 2VWVA 5CNNA 4I94A 4CTCA 3QD3A 4CRLA 3F3UA 3P7CA 5CASA 5L2IA 3G15A 5JEOA 5E8TA 5J79A 4EYMA 3VS7A 5JZJA 5K4IA 4MK0A 3CPCA 1WVWA 3V80A 5K4JA 3CR0A 4V01A 4H39A 3V3VA 4FEUA 2YM5A 3IW5A 2JKOA 4O7VA 4QTBA 3U4WA 3COKA 3F3TA 3WF6A 1O6YA 2XIZA 3FC2A 1CDKA 4NH1A 1YOLA 2J51A 3I79A 1T45A 3R1QA 3AG9A 2GFSA 3PP0A 5EG3A 2YCRA 5FM2A 1XH8A 4RFMA 3RPRA 2JQJA 2VO3A 5M53A 4JBQA 4J96A 4AAAA 4ANMA 4DFLA 3HAMA 3IS5A 4BDJA 4L7FA 2VGOA 3OWKA 2QOBA 4J52A 3ZONA 2BAJA 5HVYA 3NCGA 4ZTHA 5HCZA 5IQCA 4H3QA 4QMTA 4KRDA 4CLJA 2FA2A 2BRFA 4O2PA 5G1XA 1G8KA 3ZCLA 4NFNA 4J53A 4ZSJA 5CLPA 3BE2A 3L9LA 4AW1A 4QEBA 3FZPA 3GT8A 3PIXA 1VEBA 2X8EA 4M12A 4U80A 3R9OA 4CG8A 5E1EA 4JIVD 4UY9A 3MFSA 4IB3A 3EWHA 4IHPA 3QQHA 1F0QA 3ZEWA 4DEDA 2R4BA 4QMOA 2J0JA 4IAFA 5J5TA 3SVVA 1ZRZA 5A9UA 4J7BA 4HJOA 5BVDA 5JEBA 5JFXA 2CKPA 2OZAA 3HVCA 3NRMA 1FVTA 4DG0E 5CI6A 2GHMA 4O6LA 1PXMA 1W84A 3MH2A 1XJDA 3SQQA 3R1YA 3OS3A 2RFDA 3N9XA 2R0IA 3M1SA 3SDJA 5JFWA 3ULIA 2W1DA 4QCJA 3R2YA 2XK7A 3EJ1A 4NSTA 4LDTA 3KN6A 2JFMA 2C6MA 3FMJA 1BMKA 2C0TA 1TQMA 3Q96A 1H01A 4PDYA 3ODYX 2W9FB 2OK1A 2C5YA 3I60A 4FTMA 4PNKA 1H08A 3WZJA 2IVSA 4QMZA 3L8PA 3MVJA 5TOZA 3NX8A 3ZRMA 3W0RA 2WTWA 3RNYA 1YWVA 2ZV9A 2BROA 4GFMA 2W3OA 3FLQA 4CT2A 4WA9A 1IA9A 3BPRA 5JEKA 3K5UA 5EI8A 4FT9A 3VS4A 3O2MA 5JKGA 2G1TA 2OFUA 3UO5A 3E8CA 5I3RA 3QQFA 3WYYA 3VS3A 5J1VA 3FM8A 5KCVA 4FNYA 4C4IA 1MRYA 4RA5A 3R6XA 4FV4A 5CEIA 3NS9A 5DHQA 4YJUA 2HENA 1G6GA 3PA5A 5DFPA 3NZ0A 4YPDA 1OBDA 5GJDA 4X2FA 3PPJA 1H00A 3BGPA 4ZTRA 4DEAA 3ML1A 4QQ5A 3OC1A 5HCXA 4KBCA 1VLRA 1H1SA 4MQ1A 1ZY4A 1UWJA 3HKOA 4PRJA 3WZEA 4MH7A 4EZ3A 2P4IA 1FOTA 1JKTA 2XK9A 3OFMA 5HVJA 2OH4A 4EC8A 2BFXA 4U44A 2CN8A 4R3CA 1QU5A 4IDVA 2A2AA 2B9JA 5HNGA 4FL3A 4N0SA 2H6DA 3C13A 4RBLA 3DLSA 2VRXA 2PE0A 3UMWA 3D94A 3E93A 4N70A 2HZ4A 2R3RA 3DBDA 1ZLTA 3E8NA 3KRWA 4DN5A 4MXAA 4F9CA 2V7AA 3VONA 2C30A 3AC2A 3V5PA 4ACGA 3ZO4A 4D5KA 2QOQA 4YPSA 2H8HA 4F9AA 3BHVA 3DJ6A 2HELA 1FHQA 5HTCA 1SVEA 4RFZA 4FT0A 4ZTLA 4DGMA 4O7YA 4CGAA 1AD5A 1OZ1A 1AGWA 1JSUA 2C5NA 3VNTA 3TJCA 5FP5A 2VNYA 2B54A 3LFBA 3FZOA 2VTMA 4BZDA 3DU8A 2YCSA 4K77A 2YM4A 5IA3A 1R78A 3RZBA 4DFNA 3SGCA 2YDKA 4DF3A 5H3QA 4ACDA 3QCYA 3BLHA 2QG5A 3VBQA 2VTSA 2XBAA 2IEWA 4FYOA 4BHNA 4EUTA 3RGFA 1B39A 3MW1A 5E8YA 4ARKA 5AR2A 2VO7A 3H0YA 3ACKA 1OBGA 4FGRA 4NL0A 2BZJA 3NUNA 2UW4A 3GP0A 3OUNB 3WARA 2C6LA 2JBPA 4ZTSA 3PTGA 3P08A 3D2IA 4G2SA 4YZMA 3ORLA 3Q9XA 3BE9A 4HGSA 3SOAA 3FY2A 5DGZA 4BDKA 1J91A 3IGGA 1H27A 2PVRA 4KIQA 4AUAA 2DS1A 4BWXA 2ETRA 4A4XA 5I9ZA 3QRUA 1NT2A 4F4PA 4WKQA 2VD5A 4PUZA 5E8XA 5CENA 2XCKA 5HEZA 2BTSA 4IACA 2XNNA 2J7TA 2SRCA 3P1AA 5A4QA 4L9IA 5CEPA 5HU3A 5EQEA 2ITWA 2Z8CA 1PMNA 4EHGA 4L52A 1B6CB 3W0NA 4YP8A 4P2KA 5EHLA 1I09A 3ERKA 5CEOA 4OAVB 4Y83A 2PIEA 4KIKB 3DLZA 1WAKA 4OTGA 3ZXTA 1FINA 2Y4IC 1GJOA 1NVRA 3LFQA 3RCDA 3RWQA 3BBTB 3E63A 1JWHA 4W9WA 2UVZA 4XV1A 4CKIA 3BHYA 3F66A 4X2NA 5KKRB 2I2AA 2OF2A 1PRYA 5ANKA 1JVPP 3UC4A 4EKLA 1J7UA 2YM3A 4FSTA 2OW3A 3FLZA 1U7VA 4V0GA 2KB4A 1IAHA 3PIZA 3P9JA 2J9MA 3GU5A 4O7SA 4U81A 4I6QA 4FNZA 3MIYA 3SX9A 3H9FA 2WHBA 4RQVA 3NSZA 2C5OA 3FLSA 1Y8YA 3QD4A 4JIAA 5AP7A 2AN1A 4FL1A 4D2TA 2R7BA 4E6DA 4NZWB 4RIXB 4FTNA 3VUMA 5LCKA 5CANA 2GFCA 4DGGA 1JSTA 3OW3A 3WE8A 1K2MA 4U79A 1Q3WA 2RGPA 2JFLA 3P5KA 3Q4UA 4MD7E 4AWIA 3SA0A 4C61A 3KXHA 4WNOA 3RWPA 4F6SA 1A48A 1OB3A 1ZYSA 1XBCA 4Q9SA 2XMYA 4HYIA 4WNPA 5CI7A 4JIWD 5ETCA 4HVIA 3RHKA 5CZHA 4ORKA 4QMVA 2E2BA 4C4FA 3C4CA 2VWBA 1GXCA 4F0GA 3TZMA 1WV3A 3A7JA 4FV0A 3EN9A 3ZFMA 1OKYA 4GFGA 3B8QA 3TEIA 4BKJA 4C33A 4O21A 2OSCA 5EW3A 4OGRA 5DH3A 3RALA 3ENHA 3FEGA 3NW7A 2UVXA 3FV8A 5EQYA 3L9NA 2VTHA 4FR4A 5H8BA 4ZLOA 5AV4A 5C4LA 1OKVA 5JERA 3R9RA 4U5JA 2WQOA 4LOPA 3LPBA 1WBSA 2BMCA 5FBOA 4XHKB 4GKHA 4C02A 3AFOA 5BX0A 4G6NA 3R00A 1P14A 4YHTA 2YHVA 3HAVA 3AMAA 5HO6A 5HBEA 1G8JA 3FXZA 1V1KA 4QMNA 4ZSEA 3F3VA 3COMA 4OTFA 5AA9A 3DNDA 3O71A 4WBBB 3VS0A 5CALA 2HW6A 1CKIA 2IJMA 3K3IA 5AADA 3MJ2A 2PUIA 3BL7A 3W0OA 3BLQA 4GJ2A 4LL5A 3QD0A 2R9SA 3SG8A 4E5BA 2RFEA 1H1RA 2UZNA 1SUWA 3DBCA 3VJOA 4RA4A 1PMEA 2ZV2A 3HRFA 5DHSA 3O7LD 5JGAA 2IVUA 4BC6A 4NM5A 4ZXTA 2ITNA 4E5WA 3QZIA 3NPCA 5C1QB 3Q5IA 4JDIA 1U54A 4S32A 3FXWA 2YITA 4FF8A 4C3PA 1Y3HA 3PA3A 3CTQA 1KHXA 4ASZA 3A4OX 4J99A 5FEEA 3QRJA 1K3JA 2OXXA 4UXQA 2QI8A 4BZNA 3ZSGA 3RAIA 1Y3IA 5HX8A 2BTRA 3O8UA 4YTFA 4G2FA 2VTLA 5E91A 3Q53A 2NNWB 4WNMA 2XIYA 2VTPA 1XWSA 3F61A 3NUUA 3QRIA 1PW2A 3ZH8A 2Y7JA 5HCYA 4W4VA 5EYMA 3U4UA 3A62A 5DOSA 3PWYA 4Q9ZA 5FXRA 2QOIA 3R7YA 3HUBA 3IPHA 2X6EA 2WQBA 4FIGA 2Z7SA 5EYDA 5J95A 5EDQA 5FDXA 5B2MA 5IEXA 2R5TA 4E4MA 1MP8A 4I5MA 3UOTA 3EN7A 5H8GA 1G3GA 1SVHA 3NYNA 4DEBA 3GNIB 3MN3A 2PVNA 3DXNA 4UX9A 2GQRA 2A98A 3QKKA 5HGIA 4OLIA 5HNIX 4D4YA 4DTKA 3FLNC 4QMLA 4BIEA 1J1BA 4RIYB 3R22A 5FTQA 2WTKC 4QMYA 4JAJA 4DGOA 3KK9A 4FKVA 4MD9E 4IADA 2CHLA 2VUWA 5AJQA 4OTWA 1CM8A 4L53A 3WF5A 4CEGA 4NJ3A 3MBLA 4H1MA 3PY3A 4F08A 2VTIA 4Z7GA 4O4CA 3C4FA 3MPTA 4KA3A 3LW0A 3BIZA 4BGHA 3QC9A 4CFXA 4NTSA 4JBVA 5CSPA 1WVXA 3D2KA 5C03A 3W8QA 4CMOA 3A61A 4D9VA 1OL1A 2UW7A 2FVDA 4IZYA 3W8LA 3R7IA 2ITXA 3TKIA 3V6SA 4BL1A 5HBJA 1V0PA 3OUKA 3N4VA 5AX3A 2BRBA 3R9DA 3DITA 4DHFA 2ZYBA 4QMSA 3V8NA 2WMRA 2CCHA 4AT4A 4UZHA 3ZHPC 3Q3BA 2AFFA 2PVHA 1WBPA 3MY1A 2C0OA 2OXYA 4EH9A 5GZAA 1QWTA 4MEDA 1XBAA 4RWIA 5EOLA 1V0OA 3H10A 3ETAA 4TWOA 4IQ6A 4OUCA 4XH6A 3AKKA 3ZOSA 3BEGA 4K8AA 4MWIA 4UALA 3AC3A 4H05A 3BHUA 3D83A 4BY9E 4WRRA 3F3ZA 3KF7A 4UWYA 5E50A 2ERKA 4BDCA 1K3AA 4C0TA 4EOKA 5E8ZA 3V8PA 3UYTA 2F9GA 4RRVA 3LFFA 3W55A 2EU9A 4I5PA 4JQ8A 3QZGA 1Q62A 5M51A 5GINE 2IZTA 5CAUA 3KVXA 3S3IA 2Z7QA 3RAWA 2Q5FA 2XXSA 1H0VA 1JPAA 3DB6A 2X8IA 3ODZX 5AIKA 5GZ9A 3VN9A 5AV1A 3OCTA 3C0IA 3KXMA 3O8PA 5DPVA 1OIUA 3NYOA 4F70A 4O81A 4UZDA 4G3FA 2B9IA 4XUFA 4TYHA 3ANRA 2ZV7A 3HUCA 3OD6X 4O4BB 1O9UA 4FKWA 1PXNA 2QONA 4HPUE 4I1ZA 1H1PA 4O4FA 4MBJA 4LGGA 4FIIA 4TNBA 3ULZA 3AKLA 4UV0A 2JKKA 3TV6A 3FMLA 2Q0BA 2W05A 3R83A 2BIYA 1XMLA 4D55A 4CFMA 3O51A 3E8EA 4FTUA 3UNJA 4EBWA 2QODA 3OHTA 5LMBA 2YDIA 4USEA 1YXTA 4QD6A 4U7ZA 3UG2A 3UIXA 3BYMA 4I0RA 3UDBA 5A4CA 3HMMA 5HD4A 1PXLA 1Q8WA 4FX3A 4TNDA 1YWNA 5AP4A 3TIYA 3AD4A 5HVKA 4R7BA 3QTXA 2X2MA 4OTQA 3VUTA 3KMUA 3BGZA 4ASXA 4FG7A 4XV9A 4DHZA 2FH9A 4FKRA 4BDDA 5HIBA 3DGKA 3H3CA 4Y8DA 4ASDA 2XAMA 3HRCA 1Z57A 4XG8A 2W96B 5FXQA 3RK9A 4QYEA 1IA8A 1YI3A 1U0RA 4KIOA 4QNYA 1JKKA 5H9BA 1Q41A 4KNBA 4P7EA 2QOCA 4NEUA 3DS6A 1Q24A 2UW6A 3CKWA 2VWXA 2W1ZA 3RBWA 3HP5A 4LV5A 4PV0A 4YNOA 3EL8A 4XOYA 1CKPA 1Q5KA 5D9HA 2QVLA 3BEAA 3PP1A 3MYGA 3UODA 5BVFA 1XMMA 5AM7A 2PZIA 2QOKA 2OIDA 2GPHA 1P4OA 4D9UA 4FOCA 3HEGA 3NR9A 2QOHA 4FZDB 3NMUF 5I9XA 1B38A 2FGIA 2JDOA 5I9WA 4EORA 3QUPA 2XK4A 4L6QA 4L44A 4O1OA 1OL6A 4AA4A 3PZHA 2FO0A 3NYVA 2YERA 3DK3A 3G0FA 4HGLA 1J3HA 2GSFA 3DBQA 4JX7A 3KXXA 1APME 3COHA 4AT5A 1Y6BA 2WKMA 5KZIA 1STCE 3IW4A 2WIPA 4YHJA 2PULA 5C01A 5IQFA 3ZMMA 3NUSA 4R8QA 3EQFA 4LV8A 2V5QA 4E1ZA 2PMNX 3I0OA 3EMGA 4YTCA 2W5BA 4I5HA 3WI6A 1OVEA 4CQEA 4BGQA 3NLBA 3DXPA 4O0WA 1ZOGA 5DWRA 2OWBA 4ITJA 5DN3A 3QAME 2PMLX 1K2PA 1YVJA 3CD3A 2YIWA 1YDSE 3CTJA 4GVJA 4PL5A 3W1FA 5LWMA 2BONA 2CKQA 1KE7A 4YJOA 3ZUUA 2P55A 1OUKA 2PVKA 3A7HA 3HECA 1XR1A 4GYGA 3FL4A 4GCJA 2VX3A 4KKHA 5KE0A 3UZPA 5L2SA 5KNJA 3MVLA 4DFUA 3MH1A 1RW8A 2NO3A 2BFYA 3ZFYA 4FE2A 4A4LA 4AXAA 3TCPA 4TWNA 5C8NA 3R1NA 5DHPA 1YXXA 5CQUA 3FPQA 5BUEA 5KHXA 4GT4A 4FSYA 3PRFA 3GOPA 4JI9A 4UBAA 4BTMA 2NRUA 3AD6A 5E7RA 1MR1A 4IIRA 1Y6AA 3PG3A 1WBWA 2W9ZB 3ZO2A 3HV3A 2X39A 3W10A 3ZLYA 3EIDA 3W0SA 4AAYA 1G8AA 1UHTA 5AWMA 1J4LA 2WMAA 2UZTA 2VTJA 1ZMWA 2X0PA 3I6UA 5I0BA 1FVRA 4HOKA 3LLTA 3ZO1A 2HY81 3HX1A 2Z60A 5M44A 5DI1A 2XARA 2UVYA 4Y73A 3FI4A 4O96A 3GCQA 1W82A 3MA6A 4NKAA 1BI7A 5B2KA 5BVNA 4B8LA 1QPCA 1OMWA 2XNGA 4IJ9A 4EEVA 1Q61A 3DKGA 1H28A 2CNVA 2C1BA 2Y6OA 2O2UA 5JT2A 3KULA 4PY1A 4QMQA 5E8SA 2ZFYA 2IO6A 3U9NA 4BN1A 5AP0A 2UW5A 3PXZA 4QRCA 3Q5ZA 5CAQA 4BKYA 4HPTE 2VTTA 2X7GA 3KRRA 1FQ1B 3VQUA 3CSVA 3KEXA 1G88A 2FUMA 3QLGA 1O6KA 3G9LX 4HZSA 1OIQA 1P2AA 4C4GA 2HWOA 3EQHA 5JFSA 4YC6A 5J8IA 4OTHA 4UMUA 4Z16A 5DHUA 2KTYA 5IKWA 1G3NA 4PDOA 4D1SA 4TTHB 3P0MA 2FB8A 4F6WA 4IB0A 3R8MA 4M69B 4WRGA 4IVDA 5BVKA 1FPUA 4APPA 4I6BA 2W4OA 5D12A 1GZNA 5BVWA 2EXEA 3KGAA 5CU3A 4KIPA 5E8WA 3UPZA 2WAJA 5IA2A 4F9WA 3DAKA 1H24A 4CFNA 4IXPA 5L2WA 5JRQA 5AIRA 1NXKA 1OL5A 2QQ7A 2W7XA 4E20A 2XNBA 3PA4A 4R78A 2F4JA 1YDRE 3EQBA 4K6ZA 4W4WA 1H1QA 4FT7A 4Q5HA 4X3FC 4E26A 1KUTA 2JKMA 4BR3A 3F2NA 2JGZA 3FHRA 2Y9QA 4YJQA 3RPOA 1FHRA 3HUEA 4M7IA 4E7WA 3RP9A 5C9CA 4EBVA 4IX6A 4EH3A 2C68A 3O0GA 4ID7A 4YO6A 1PKGA 2CNUA 1W2FA 1S9IA 4IC8A 4QMPA 4CV9A 3PVUA 3PVBA 3NDMA 2V55A 5EKNA 3UQGA 4AXCA 3SXFA 4EWQA 2J5FA 3G9NA 3KKVA 4YZ9A 3E62A 4ANQA 5IEVA 3I0QA 2XKFA 3DZOA 5K5NA 4QDVA 4OT6A 5TE0A 4DG3E 2PU8A 3A7GA 3WIKA 3RK7A 2F7XE 3E64A 3EN6A 4JG7A 4MQ2A 2EH0A 3KY2A 4GKIA 4I20A 3NGAA 4D28A 4LUEA 1FMOE 5F94A 3AC4A 3FAAA 2R3QA 5BYYA 5K3YA 3UDZA 2PVMA 3L8SA 2BRGA 4EH4A 4TW9A 4FTCA 1YI6A 2Z7LA 3PG1A 5CTPA 2YISA 3DPKA 4HNIA 3F5GA 4FSUA 4WNKA 5FEDA 1XH4A 2WTVA 3JVSA 2RL5A 2XYUA 4X2JA 5DBXA 3R9NA 2A0TA 4PPBA 4FNXA 3TDWA 3F5PA 5GIPE 3BU5A 3QQUA 3EYHA 5FM3A 4BTKA 2J0IA 4YJSA 3QTIA 3AOXA 5HTIA 3BLRA 4QPAA 4ZTNA 2ZM4A