3I6WA

Structure and activation mechanism of the chk2 dna-damage checkpoint kinase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
410
structure length
369
Chain Sequence
PWARLWALQDGFANLECVNDNYWFGRDKSCEYCFDEPLLKRTDKYRTYSKKHFRIFREVGPKNSYIAYIEDHSGNGTFVNTELVGKGKRRPLNNNSEIALSLSRNKVFVFFDLTVDDQSVYPKALRDEYIMSKTLGEVKLAFERKTCKKVAIRIISKLNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFPTYLAPEVLVAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase Chk2
publication title Structure and activation mechanism of the CHK2 DNA damage checkpoint kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 103
structure length 369
sequence length 410
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00498 FHA FHA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3i6wA03
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 3i6wA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3i6wA02
4C02A 1X8BA 1M2QA 1PHKA 2C30A 2KULA 3PY3A 4ONAA 3MW1A 4R7HA 5E7RA 5B2LA 4O6EA 4PPBA 5IMEA 3ZDUA 5DJOA 4U0IA 3FXXA 1Q61A 1G3NA 5T6KA 5AUUA 4LG4A 1YI3A 5L6OA 5A3XA 4WRGA 2OXXA 5LCKA 2CJMA 2QHNA 4EK5A 3SG9A 4F6UA 1CKJA 2QOOA 3CKXA 5AP5A 5DYJA 1FMKA 4QMWA 2I40A 2P2HA 3ZFYA 3FBVA 2JKDA 3M2WA 2W5BA 5CQWA 1BMKA 2XIXA 3WE4A 5CSWA 2WMUA 3HV3A 4YU2A 1YXSA 2G2FA 2REIA 5A4CA 2UW8A 2XK7A 2WFYA 3EQBA 2WMVA 3LJ1A 3GI3A 2J4ZA 3GCVA 4W4YA 3QZHA 3FMJA 4L67A 3D7TA 3GOKA 4OTFA 1FHQA 4AZSA 2BZHB 1OI9A 3D4QA 4P4CA 5JK3A 2QOQA 5AV0A 3MFUA 2RGPA 3AT4A 1GZOA 5M56A 1WCCA 4JLCA 3QX2A 3UZRA 3QRIA 3FQSA 4FSQA 4QNYA 3TJCA 4XG8A 2GFSA 2PE2A 4O7SA 2UZVA 2X39A 3BEGA 3P7CA 2AC3A 4NEUA 5GZAA 5LVPA 4O0YA 5D12A 3DK6A 5K4IA 2X81A 1WBVA 4O6LA 4H1JA 5EHLA 2W1EA 4JVGA 3PXQA 3RJCA 4NJDA 4R1VA 5IQIA 2PUNA 2PUPA 4GL9A 4EH3A 4BGHA 4M7IA 4V05A 4QNAA 1NY3A 3EHAA 4WHZA 4B0GA 4DEDA 4TKSA 3ATSA 3RPRA 4MD7E 3EQDA 3D7TB 2UVXA 2I0HA 4M68A 5B2MA 3LQ8A 1YDSE 2GHGA 2HCKA 2GFCA 3IW7A 3JXWA 2FGIA 3KXMA 4DT9A 2VZ6A 3CTJA 4I20A 1B39A 2AC5A 4KS7A 4EK3A 2YM6A 4UMRA 1CSNA 3FZOA 4NM5A 5IEVA 3OUNA 1TQIA 5DVRA 3MH2A 3NYVA 4AW1A 4DTBA 1CTPE 3SXFA 4N57A 3NEWA 4YJVA 1JKSA 2GCDA 4NSTA 4L6QA 4C8BA 2CMWA 5HX6A 4G2SA 1K2MA 4KKGA 4KA3A 2PL0A 4PTCA 3FC2A 4FGRA 3FXWA 5JQ5A 1V0PA 4ZS4A 5EG3A 5EW9A 4DH8A 3BYMA 3MDBA 4E26A 4O7NA 2JGZA 1GZKA 2G15A 2QLUA 3IQ7A 4JG6A 2XCKA 3TTIA 4OR5A 1GAGA 2YHVA 4GK4A 4QMVA 3PVUA 4ZOGA 1G8SA 2G1LA 2XIYA 1T46A 3SOAA 3OUNB 1YHVA 4IMYA 3GCUA 3FWQA 4RFZA 2W1ZA 4A9RA 2W0JA 3BQRA 2B53A 4XG7A 5E8YA 1ZZLA 3PUPA 3QTUA 2YERA 3DB8A 4FT5A 5AUYA 4BWPA 1OUKA 4DCEA 1G6GA 3WF8A 3OROA 3P79A 3OT8A 3R02A 1YJMA 2GQRA 4ACDA 2BAJA 4J52A 3A8WA 3AC1A 3M11A 3L9MA 3PJ8A 5TE0A 1W83A 2VN9A 5E1EA 4AN9A 2JC6A 2C0TA 4AF3A 3D9VA 2C5YA 4FTMA 3NW5A 5KMIA 2YDKA 2W99B 3A60A 2QR8A 2JEDA 4BL1A 4G5PA 4E3CA 4DLIA 3E64A 3RNYA 3DOGA 3PY0A 5CI7A 4IM3A 2ZMDA 4FT9A 5HG5A 1J4OA 2WMWA 1GJOA 3H0ZA 3N9XA 4U6RA 5TO8A 3RMFA 3PG3A 1Q62A 3G6GA 4IZ5A 5B2KA 1ZAOA 2XYUA 3LMHA 4YHTA 1S9IA 3S3IA 3DS6A 4CFXA 4I0TA 4FSUA 2ZOQA 4CFMA 3QYWA 5IQAA 3CEKA 4I24A 4P5ZA 3VJNA 1FVRA 4G1WA 4BDIA 4AW2A 3G90X 3RCJA 2GS6A 1BKXA 4OTIA 1Z57A 1NXKA 2R2PA 3KRRA 2CLXA 4IAKA 2W1IA 3R8VA 4JNWA 4BDDA 5FG8A 3R9OA 2PUUA 4UX9A 2BIKB 3W8LA 4UY9A 1Y8YA 1XH4A 3H0YA 4MWIA 2PUIA 4D55A 4DFXE 4NIFB 5D7AA 5DR6A 4ASXA 3OWPA 5I0BA 3HP5A 4YZ9A 2RG5A 4C62A 4AZTA 1WBWA 3ZH8A 3DU8A 3QKKA 5CENA 1Q41A 4OTRA 2J5FA 1SNXA 2R0IA 4I0SA 1KOBA 4DC2A 2WTKC 3FI2A 4FC0A 4OTWA 5JEBA 4O81A 2PVFA 3ZS5A 4IB0A 3MESA 4UYNA 1ZMVA 5M44A 3II5A 1Q5KA 4RA4A 4FICA 3ZZWA 4NYEA 3V51A 5J7BA 3GENA 1Q24A 2EXEA 4FK6A 4CZUA 4DLJA 5ICPA 4E6CA 4F65A 4K11A 1KV1A 2GU8A 1XH8A 1WVYA 3G2FA 5FLFA 3QLFA 2ZM1A 4NZWB 3DY7A 4GW8A 2WO6A 4IX6A 1YWNA 1K3NA 4FT3A 3VQUA 2UZOA 3UIBA 2HZNA 1RE8A 3SGCA 3ZFMA 2IVVA 2W4KA 4CKRA 3GQIA 3KA0A 5CQUA 3DXPA 3MTFA 5M08A 3DBQA 4BVUA 2XB7A 5GIOE 1OB3A 2BFXA 3RPVA 2Z8CA 4JBOA 1FINA 5EYKA 5E9EA 4M69B 2X7FA 5GHVA 4D2SA 3O2MA 4I6BA 3ANRA 2DUVA 4E7WA 1LP4A 3QA0A 4L46A 3ETAA 4HZSA 4D4SA 3UN0A 3POZA 3LXKA 3BHVA 5EDPA 2ITWA 1K2PA 2YACA 3PWYA 4FKLA 3OXZA 1WLNA 1RW8A 2ZDTA 4GKHA 1PMVA 3EQCA 4PMMA 5DLSA 4EH9A 3OHTA 4ANNA 5HI2A 3IDPA 1P4FA 4RIOA 1G3GA 3NAYA 3ZOSA 3MJ2A 4AZFA 4K6ZA 4D2TA 2VTQA 2UZDA 2FF4A 1KE5A 4WUNA 4QYEA 3PLSA 4BDGA 3NVMB 4H36A 3LMIA 3Q6WA 4RC4A 4Q9ZA 5IDPA 3F3VA 3EOCA 4Q5EA 4FV3A 2JIIA 3IDBA 4ZS0A 4BKYA 3OY1A 5HLPA 1BL6A 3TZ8A 3HA8A 5CX9A 2VWBA 4O0TA 1H00A 2HY0A 1WFCA 2W1HA 4JOAA 4XH6A 2JKMA 5CEMA 3ZUUA 4Q2AA 3Q4CA 5M51A 3RZFA 2BZIB 2UW7A 3BU6A 3EYHA 3FZSA 3HV7A 4IWDA 3LHJA 1BX6A 3L8SA 2I6LA 3TJDA 4C33A 1QU5A 5IPJA 1U59A 4EGXA 4R3PA 4YPSA 1R3CA 4JBVA 4MD9E 2B9HA 2F57A 2BROA 3QD4A 5AP2A 4YSMA 5IG1A 2ERKA 2J0IA 4EK6A 4MXXA 3H9RA 2JFLA 3G5DA 1J7UA 2J2IB 3ZC5A 3NSZA 5EI6A 3QGWA 4XG3A 5FXRA 4I6QA 3VC4A 3R8LA 5AADA 1P2AA 4YPDA 4YP8A 4AT4A 4AZWA 5T3QA 4CFUA 3CQUA 3OXTA 1J4KA 2FYSA 3FY2A 2V55A 1OPJA 3DAKA 5H9BA 4E5AX 5CTPA 5CEIA 5DG5A 3QQLA 4KB8A 3U55A 3V5JA 5E8WA 5AAGA 2YIYA 1RJBA 2X8DA 2X4ZA 3FHIA 5GJGA 4DA5A 5FXSA 4YJTA 4CYJA 4ASDA 4B8LA 4CTCA 4BDHA 3O23A 4ZIMA 4D58A 3R63A 4UMQA 4DGLC 1ZYJA 2B9JA 2H96A 3BBWA 1YOJA 3I60A 3IS5A 4M14A 4QPSA 1Y91A 3PVWA 2C6TA 4YLJA 4YZBA 4EOPA 3CP9A 3S4QA 1S9JA 3K3IA 4EJQA 2WMXA 3LJ2A 1YXVA 2JQJA 4WG5A 5EYDA 3LCDA 4USDA 3MFRA 3AXWA 5B0XA 2BRGA 5A46A 2R5TA 2PVKA 3O71A 2VTMA 5FP6A 3LXNA 3C5UA 4EKLA 4TL0A 2VWZA 2YCSA 3GU4A 3P9JA 4M8TA 2HENA 5M06A 3KC3A 2W1GA 5HORA 5HE0A 4FTJA 4M0YA 1DS5A 3HEGA 4QT1A 2VWYA 3BV3A 1YWVA 2CKEA 2R3QA 4WNOA 5ANGA 3PIZA 4BDKA 2GNHA 4J96A 2WTKB 4FVRA 4QP4A 4UMTA 1LPUA 4GV1A 3NYXA 1YWRA 3GFWA 1H26A 3OBGA 3U6JA 5LVOA 2QHMA 1O6YA 3PSDA 4YTFA 3VBTA 4AACA 4DTAA 3DAJA 4ZLOA 4AGWA 4MXYA 4DEHA 4UXLA 2YLFA 3E93A 1H1RA 3O8TA 1FMOE 3FPQA 5I9ZA 3LLAA 2VGPA 4LL5A 4OTGA 5BX0A 2HWPA 2ITXA 3F2NA 1H8FA 3GUBA 3UO4A 4J71A 5FM3A 3MH0A 3LFNA 3N51A 2F9GA 4U41A 4NCTC 1OKVA 1U4DA 2WQEA 1OL1A 3VHEA 4E6AA 3OEFX 2PPQA 4PQNA 3DXNA 4HCUA 5A4QA 3OY3A 5LQFA 1KV2A 2C6EA 4TPTA 5D7VA 4S2ZA 3ZRMA 3WYXA 1RDQE 4QP9A 4RX5A 3G15A 4NL0A 2ZJWA 4QP2A 2R7BA 4GFMA 2W96B 4ITHA 4S31A 2B4SB 3P23A 3PXFA 3U51A 2OBJA 3OZ6A 4RIXB 4NH1A 3GEQA 3NDMA 4DEAA 5M57A 2IW6A 2PMIA 4IH8A 3ZO1A 2ITQA 5JFXA 5HU9A 4X6RA 3U6IA 1GY3A 3PIXA 1J1CA 5EW3A 5HNBA 4Z7GA 3OOMA 2YJRA 1WBSA 2E9PA 2QD9A 4Z16A 1OIUA 3L9LA 2B55A 5BVWA 5BYYA 3F3TA 1OL5A 2FB8A 3G0FA 5EDRA 2PY3A 3HMMA 5KNJA 3B2WA 3VIDA 1F0QA 3I7CA 3Q96A 5FXQA 5K5XA 3DZQA 3ET7A 4EUTA 3MV5A 4BGGA 3UNKA 4DH3A 4BTMA 3WYYA 3TN8A 4CD0A 4F0GA 4RRVA 3W2QA 3WZJA 3RPSA 1UNLA 3PP0A 2W4OA 5BVNA 4IAFA 3CTHA 2XUUA 4ZSJA 4FTKA 4HVGA 5HHWA 4TYJA 4ZTHA 4FIIA 3UOHA 4FTLA 5E8TA 4BDFA 3ZU7A 3D14A 5HLWA 4U43A 5AV1A 4OGRA 4YNOA 4FV5A 4QYFA 4D4RA 1O6LA 3GQLA 5FTGA 1ZOHA 5CWZA 3D5WA 2HW6A 3EL8A 5AWMA 4MD8E 3LKMA 4NM0A 2ZMCA 4O0SA 3RALA 3TIZA 5A6NA 3KN6A 5HESA 4EWHA 3R8PA 4FEQA 4EBVA 3CPBA 5EQEA 4Y46A 3HUBA 1PMNA 3DK3A 4EWQA 3A7JA 3AGMA 3HYHA 4DF3A 4YBJA 3OEZA 1PJKA 2JITA 3AT2A 3VJOA 5HIDA 4D0WA 5KO1A 4QPAA 4PUZA 3KXNA 5JFSA 4ZJVA 1WAKA 2QQ7A 4QP8A 4FG9A 4HCTA 2C69A 4ACGA 2W1FA 4FKOA 4RGJA 4FA2A 3SW7A 5AR7A 1YJ5C 4LOOA 3WOWA 4BFMA 1FBNA 3QQHA 2ZB0A 2YM4A 4LFIA 2WQNA 5E1SA 2UW6A 2R3LA 2BR1A 4WSYA 3W1FA 2R3HA 4MYGA 2CLQA 3REPA 5HX8A 3VS6A 3T8OA 5JKGA 4WIHA 3QCQA 4LV5A 4YLLA 3ZZEA 4R6VA 3PE2A 4AWIA 3MFTA 3NW6A 4ZP5A 4MH7A 3F7ZA 3K54A 1TQMA 5HLNA 4RFYA 5E8ZA 3KVWA 2NRYA 3E8DA 1IEPA 3LOKA 3C4XA 3N4TA 5ANJA 1Q8ZA 3EQPA 4YZDA 4O7WA 3FC1X 2F7XE 2FEZA 1JPAA 5HE1A 3TKUA 3UIMA 3GC7A 5C01A 3TZMA 1Q8TA 2C6OA 3GP0A 1EH4A 5HD4A 4NCTA 2OXDA 4EQUA 5F9EA 1IASA 4F09A 3EQFA 4OBPA 3JVSA 4L44A 4X2JA 5KKRC 4YHFA 4DITA 4GK2A 3DBDA 4NKAA 5LVLA 1H08A 2OIDA 3EQIA 3EQGA 4M13A 3CIKA 4MEDA 4DINA 4PP7A 1UWHA 5A4EA 4E4XA 5AP0A 4XP0A 3ZLYA 4A9UA 3COIA 1H07A 3IO7A 3V5LA 4QQTA 4HGSA 2B54A 2VTPA 4X2NA 5L8KA 3TUCA 3NUYA 4G3DA 2WOTA 4KBCA 4RLKA 3IONA 2E9OA 3AMYA 4A06A 2XZSA 3QCXA 4P90A 5BVDA 4IB1A 3ORKA 3R6XA 3F5GA 4P5QA 4FT0A 4QRCA 3RM7A 2Y8OA 4O22A 1UHTA 4FUYA 1IAJA 4D2PA 3NUXA 3F82A 4JG8A 2P2IA 1KE6A 5HCXA 3DA6A 3NUSA 3R83A 2VWXA 3O7LB 1R1WA 3Q3BA 3AC5A 3CD8A 4IB3A 4JJRA 4RT7A 4V0GB 5F4NA 4RWJA 3ZC6A 5C8KA 2JFMA 3K2LA 3VBYA 5J9LA 3D5UA 1YRPA 4I5HA 3UZTA 2IZSA 3CQWA 4F64A 2UW5A 4OTPA 3BGPA 4LRKA 1YKRA 5DNRA 3ERKA 4H58A 1OIQA 4WT6A 5FTOA 4JAIA 4NUSA 4QQCA 3DFCB 3BYVA 5DEYA 3QD3A 4EH6A 2CKOA 4O86A 5HVYA 2UW9A 2GTNA 3GU7A 5LMKA 5FEQA 4IHPA 4D28A 1XH5A 2O3PA 4QYHA 3HL7A 3VQHA 2C47A 2VWUA 3FLSA 3I7BA 2F2CB 2P55A 3MJ1A 3A99A 4ZTRA 5BQ0A 5IH6A 3M1SA 3QAME 2C5VA 1XH7A 3CS9A 5BYZA 1JNKA 5IISA 4KBAA 4BBMA 2X2KA 1XHAA 3BBTB 5IA0A 4Y83A 5C26A 2OWBA 4DEBA 2A27A 2VAGA 4GUBA 4D2RA 2BRMA 4LI5A 3FE3A 4XRLA 3D83A 3QC9A 4AZVA 4IJPA 1MP8A 4KWPA 4LGHA 4YC6A 4F1MA 5CSPA 3KMMA 5GJFA 2VU3A 3WILA 3I4BA 4BI1A 1YHSA 3QALE 3O50A 2YM5A 3MI9A 3C0HA 3QBNA 3F3UA 1R78A 3SKCA 4AX8A 2QURA 4LGGA 4PNIA 3WI6A 4BCJA 4X2FA 2ZV7A 4JRVA 3MPTA 4MF1A 4DCAA 3PXRA 1K9AA 3PO8A 3FMKA 3GFEA 3DT1A 5CF6A 4FTQA 2R3FA 4IAYA 4C2WA 3KF4A 3ANQA 4FVQA 3RNIA 5I9XA 5BPYA 2IPXA 3GC9A 4OLIA 3F61A 2VO7A 4U79A 1PXKA 3UOJA 3UMZA 1BL7A 4BTJA 4HVSA 3AD5A 2QG7A 2Q0NA 4M3QA 4YR8A 1Q8UA 3S2PA 4ZZMA 4AAAA 2KB3A 1LGPA 5BMMA 1E1XA 3MS9A 2KKLA 3GBZA 3HMNA 5AIKA 1H1WA 2QU5A 3POOA 2WMTA 1MUOA 3EMGA 2IZTA 3QHRA 1ZYCA 3LVPA 3H4JA 5F20A 4ZSLA 5AUZA 3Q9XA 3ZMMA 3ZRLA 3FMHA 1ZYDA 4D1ZA 5E50A 3R1YA 4RC2A 3LFAA 3A4PA 2O0UA 3UQGA 4GT5A 3VN9A 3MY1A 4AG8A 1YW2A 3BLRA 3C50A 4HVIA 4LOQA 2VX0A 3E3PA 2GPHA 4X3JA 4G3EA 4MQ2A 3DLZA 5CS6A 3RAWA 2ETKA 4WNKA 4EYJA 4PL5A 4EZ7A 5JSMA 4EOQA 5KKRB 2BDWA 3KK8A 3HDMA 3Q2JA 1OECA 3QZFA 3Q4ZA 5L4QA 4JG7A 2PU8A 1J7LA 4YZMA 2WEIA 3CQEA 3GCSA 3HX1A 5H3QA 5CU6A 5JFWA 4LM5A 3LMGA 4Z55A 5BVFA 5CSHA 1J4LA 4LOPA 3C51A 3C0GA 4NM3A 5KHWA 2QCSA 4F63A 4CV9A 2LGCA 2B9IA 3EQHA 4U7ZA 2X8IA 3EQRA 4MNFA 4D5KA 1FHRA 4FKGA 4NKSA 5GZ8A 3PVGA 2BRNA 4AOIA 4RSSA 4ZY5A 1SZMA 3DKOA 3JR1A 3PRIA 3UPZA 2PZYA 5DH3A 4R5YA 3W10A 4MXOA 5K5NA 1M14A 4FTRA 5EKOA 3ORMA 1JOWB 5CU3A 2V5QA 5CEPA 2A0CX 4DH7A 4GJ2A 3ZM4A 3IECA 4RMZA 4EYMA 4N0SA 3W16A 2OG8A 4F08A 5FTQA 4X21A 5M55A 4XBRA 4FZFB 3HKOA 3MVJA 5ANKA 5HO7A 2XKDA 3RZBA 1U5RA 1QCFA 3FI8A 4WNMA 2F7ZE 3S0OA 3PA3A 2BILB 4G5JA 1GZNA 4C4GA 4D4YA 3ZEPA 3DZOA 2OH4A 1DM2A 3ULIA 2XEYA 5J9ZA 4O38A 5AAEA 3K5UA 3AMAA 1MZKA 2JKKA 3BGZA 4GFGA 4IX5A 3SAYA 5L2IA 3LM0A 1TVOA 1PMUA 4C4IA 1XJDA 3BHHA 4F0IA 2LC1A 3LFEA 4NFMA 1K3AA 1R0PA 4N6YA 1WVXA 5J87A 3IPHA 4IFGA 4U80A 3V6SA 4J53A 3OUKA 3SX9A 2OU7A 2CDZA 1FGKA 2C6LA 2FSMX 5CZIA 3HX4A 5CSVA 4PMTA 3BLQA 3NAXA 4FSNA 3TV4A 2R0UA 2X9EA 4FR4A 2JDOA 4IJ9A 1REKA 2XNEA 3NNVA 2AUHA 4YO4A 1YXUA 4NTTA 1J4QA 4RWIA 3SQQA 3RKBA 4UALA 4L9IA 3HDNA 4KIOA 3W55A 2BALA 5LWMA 3M42A 1WVWA 4O0XA 4PDOA 2J0JA 4IC8A 3HAVA 4V04A 4JR7A 2CSNA 3K5VA 4KAOA 3CJGA 3VPYA 5JRQA 3HRFA 4GVJA 2GQSA 4L3LA 4CMTA 4NK9A 4NFNA 4BC6A 2YM8A 3N4UA 2YLEA 5T68A 3V04A 1SVEA 4CRLA 3DPKA 2RG6A 1PKGA 3QTRA 4AXAA 2Y7JA 1ZY5A 4FF8A 4B7TA 2CN8A 3F66A 2GSFA 4EUUA 5EH0A 5GNKA 3OF0A 2ITVA 4N6ZA 4EONA 4OTHA 2IO6A 2XNGA 2XVDA 3RP9A 5JN2A 4F7JA 3DBEA 2QO7A 2Z7LA 3F3WA 4NJ3A 5BVOA 2GNFA 4FKQA 4BYIA 2JBOA 5AJQA 4S34A 5F1ZA 4CT2A 4F7SA 3PJ1A 4BCFA 2J0LA 5A9UA 2NO3A 5IA1A 2UVYA 3I0OA 3UIXA 3I0QA 2XIZA 3FI3A 4FV2A 2OJIA 2WMBA 2YABA 4XX9A 1UVRA 5JRSA 1KWPA 3OT3A 3QTWA 3WF9A 3UIUA 5LVNA 3MA6A 3A4OX 2BFYA 2OICA 3R7VA 2UZNA 4J1RA 3LQ5A 4R7IA 4A7CA 4BWXA 4ENXA 4MQ1A 2JIUA 1ZARA 2J6MA 2GNGA 4RFMA 4FV6A 2QOIA 5AV3A 5FRIA 2XEZA 3A62A 5AP4A 3RPYA 2O2UA 2WTCA 1Z9XA 5CALA 2VO6A 3FZ1A 2FA2A 3AQVA 3UP2A 4FKTA 4MVFA 1KE8A 5HBEA 2R3MA 3MPMA 5DR9A 5J9YA 3QQJA 2O8YA 2ZDUA 1W84A 4XG4A 5J95A 3LZBA 3NZ0A 4FSYA 4I3ZA 4IC7A 3SXRA 5KBQA 5IQFA 5CNOA 1NW1A 2BDJA 5D11A 1IG1A 3IW6A 2VTHA 2XMYA 3P0MA 1F3MC 3MGYA 4DEEA 4R3RA 4GK3A 5GJDA 3PFQA 4AE6A 4FMQA 1IAHA 3KXXA 3R9HA 5JT2A 1H25A 3ELSA 5I3RA 4QMLA 2NPQA 4ZZNA 2X8EA 2UVZA 4XMOA 1QPEA 3VW6A 5CU2A 4CXAA 2BUJA 3HV4A 2EXCX 3OXIA 4U3YA 3SRVA 4XLVA 3LFFA 4CG8A 3TT0A 4GVAA 3KMWA 4L52A 4ASEA 4PL3A 3SXSA 2DQ7X 5CT7A 3RBWA 4RX9A 3SHEA 2NP8A 4IVDA 3VF8A 4C36A 4FYNA 3RHXA 4I0RA 3RHKA 1R21A 4O83A 4O7RA 4NWMA 1HOWA 3Q2MA 4IB5A 1UKIA 1VYWA 2WIHA 2CNVA 3R1SA 2W9ZB 2YCFA 3BU5A 2F2UA 3NYOA 4IM2A 5DT0A 4DFUA 4DGOA 5EM8A 5EOLA 2GDOA 2VTLA 1XWSA 4IX4A 2R3IA 1ZOGA 3ZBFA 4BICA 2YZLA 5A4LA 4BF2A 2ITNA 5HVKA 3TUDA 4DFLA 2A19B 4EH5A 2UZUE 4HGTA 4O2PA 5LOHA 3D7ZA 4G3GA 3QRUA 4HJOA 3SDJA 3U9CA 3QRTA 4FEVA 2AYPA 2W17A 3HGKA 2H6DA 2XH5A 4FUXA 3FYJX 3ZEWA 2CN5A 3D2KA 5AIRA 3DTWA 4N4SA 2BZKB 1XKKA 4OBOA 1TKIA 4ITJA 3C4CA 3LFBA 1NVQA 2CCHA 1BI8A 4E20A 3IGOA 3DDQA 2C3KA 3KB7A 2PVJA 1PXJA 1P5EA 4GT3A 2B7AA 3RI1A 5HG8A 2R3JA 4CEGA 5BVEA 1OKYA 5IQBA 3ZSIA 5ANEA 1GIJA 3FMDA 4FI1A 4WA9A 1O6KA 4HZRA 2WTJA 5IEYA 2A1AB 2IVUA 1UU9A 4JI9A 3KL8A 3UOKA 3UVRA 3WZUA 4FL3A 3LPBA 5IA4A 3NUAA 4TW9A 4MXZA 2PIEA 3E8NA 3VVHA 3LQ3A 4DBXA 3NRMA 3CBLA 2XRWA 1XQZA 3T3VA 4ORKA 5ACKA 4ZZOA 4XV2A 2WAJA 3OCTA 4G16A 2PULA 4CQGA 2Z7SA 1FVTA 5DE2A 4D1SA 1K3JA 3HP2A 5LWNA 2CSWA 3OMVA 3Q53A 4TXCA 3QWKA 4WUAA 1R0EA 4FTIA 1KSWA 4XNEA 3FZPA 5HIBA 2YCQA 3E88A 4D9TA 5EYCA 3ODYX 1GNGA 4CKIA 3TDWA 2YFXA 5CAOA 3AGLA 5IDNA 4I6FA 3KT9A 3QKMA 4QMZA 5A14A 1WBTA 2YDJA 4C61A 1E9HA 2JDRA 2OJGA 3EIDA 3O96A 4GMYA 3PY1A 4YTIA 2V0DA 4QMXA 1I09A 3BELA 1UU3A 5KZIA 4F9WA 4JT3A 2C1BA 2BKKA 5M4CA 3R1QA 3ZUTA 3BZ3A 3JY0A 4HYSA 2OIBA 5FDPA 1LGQA 4HGLA 4U8ZA 5HVJA 4AW0A 1OL6A 1WBOA 5AAFA 4F0FA 4PMPA 4FKPA 3TTJA 5AUTA 4FKRA 5I5ZA 2B9FA 4F9CA 4C4EA 5HIEA 2VTJA 3HNGA 2UW4A 3DTCA 5D1JA 5D41A 3UQFA 1R39A 3E62A 4KS8A 3UZPA 3FM8A 4A9SA 1ND4A 5E8UA 4D1XA 2J0KA 3DJ5A 4EK8A 1UNGA 2IG7A 1M7NA 3ZLSA 1ERKA 2XBAA 4LMNA 4R1YA 2XYNA 3FPMA 3HLLA 4NW6A 1J91A 4RA5A 4RVKA 2OXYA 5BNJA 5JMSA 1P4OA 3CGOA 2PWLA 4AGDA 4EORA 5CAQA 4I5CA 2ESMA 3VRZA 4L00A 1FPUA 5HICA 2PVRA 3RCDA 3VUGA 3FDNA 4FKWA 3R73A 1XR1A 3R71A 4WBOA 3UDBA 5I9WA 3I0MA 3P78A 1Q8WA 2I0EA 2Z2WA 3AC3A 4LRMA 3FMLA 4PPCA 4ENYA 1IRKA 4IDTA 4IVBA 3WF6A 4KKEA 3E3BX 5J1WA 3VA1A 4GJ3A 4C59A 1LR4A 4AOJA 2PMNX 1BI7A 3NW7A 5HO8A 3QWJA 4E5WA 3UGCA 2P4IA 4TWPA 2IW8A 4GCJA 1KOAA 4OT5A 2W7XA 2XK4A 1JWHA 3HVCA 3ZLWA 1JSVA 3ODZX 4EJ7A 3KQ7A 1DI9A 1H0VA 1BUHA 3GGFA 3CY3A 5HE2A 3VULA 4EOSA 3W8QA 4WOVA 2OO8X 4AGUA 4QMMA 3AG9A 2SRCA 4EHEA 3L8VA 4YC3A 2ZM3A 5AP3A 4FSZA 1H28A 2BCJA 3W2PA 2JBPA 4EH7A 2QU6A 4RJ7A 2XK9A 4UEUA 5J79A 3AT3A 3CXWA 2YCRA 4PV0A 2ZVAA 3PZHA 2R7IA 4EOIA 4IFCA 3V3VA 3QF9A 2OGVA 3VS4A 5CEKA 4IX3A 4O2ZA 4KKHA 5CU4A 4ZY6A 4B9DA 4DGGA 1JKKA 4JDJA 3VBVA 4TYIA 5ETCA 5BYLA 4M67A 3LFQA 5ANDA 3DJ6A 1M52A 1OKWA 4W9XA 3V5WA 4EOJA 2WPAA 3HUFA 4NM7A 3P7BA 1SM2A 2OSCA 4BCKA 2BRFA 2BTSA 4NW5A 4AA4A 3QQFA 5CVFA 3AMBA 4CKJA 5M4IA 2W3OA 3LCTA 2HAKA 4CFFA 5EM5A 5FWKK 4DHFA 2FSTX 4APPA 2IVTA 3PJ3A 2J90A 1Y6AA 5JZNA 3VS2A 3ZHPC 2XJ1A 5G1XA 3TNIA 5KUPA 3NMUF 3EB0A 4CZYB 2OK1A 3ZRKA 4RZVA 2YA9A 5HZNA 5E8VA 4K1BA 3ORLA 4EK4A 3K3JA 4BZOA 3IOPA 2PMLX 2ZV8A 1URWA 1CDKA 3JS2A 4FNWA 5DHJA 4BDAA 4BBFA 2CKQA 3G6HA 4ACHA 5CLPA 5EFQA 1HCKA 1CKPA 5HG9A 3RGFA 4CFNA 3WARA 3QUDA 4XHKB 2ZV9A 4U42A 4E6QA 5KMJA 5ITAA 1U5QA 3F5UA 4X6QC 4LYNA 3ZUVA 4EKKA 3PLAE 4WKQA 1IR3A 4YC8A 3V5QA 2YAKA 3VS7A 4BCQA 1W82A 2P33A 2WEVA 5DPVA 2BMCA 1XBCA 2QOLA 3C0IA 1G5SA 4GKIA 3BU3A 3PJCA 4PP9A 4CG9A 1DI8A 3BEAA 2OKRA 4JX7A 4KRDA 3PJ2A 4LMUA 1U46A 1PW2A 1ZOEA 4HCVA 3VBQA 2YN8A 4AS0A 3PTGA 4S30A 5BUJA 5AP6A 4DEGA 4OUCA 2OFUA 4O91A 3POAA 1OIRA 2XK6A 1YXTA 3QZIA 2OJ9A 3ULZA 4EOOA 5LMKC 3NUUA 3TIYA 5KZ0A 1QL6A 5FEEA 5DMZA 3O8UA 4JIKA 3D5XA 3PPZA 2QKWB 1ZRZA 3PPJA 4W4XA 3A8XA 4XOYA 3EJ1A 4WD5A 4Y5QA 3D5VA 3RWQA 4DTKA 4HPUE 4RX8A 4BR3A 1OL2A 1JBPE 1ZLTA 3P08A 1OZ1A 4FSRA 4L53A 5BVKA 2YWPA 5HO6A 2A2AA 4GU9A 3KULA 3UO6A 4IAIA 5JZJA 4CNHA 4JBQA 4ANBA 4W4WA 1M2PA 3RK5A 2JPEA 3A7IA 1JAMA 3MBLA 4OBQA 4BTKA 3E8EA 3QRKA 5AP1A 3E63A 3R28A 4YZNA 3EYGA 3FY0A 3MVMA 5AV2A 5M4UA 3FLQA 2VRXA 2BTRA 2R3NA 3NX8A 4UWYA 5EK7A 2J7TA 5DRBA 5CXZA 3EFKA 5HNIX 3TKHA 1JKTA 4K9YA 2XKFA 4AT3A 4ALWA 1FOTA 2RSVA 2QNJA 3QC4A 5FDXA 4Y95A 4DG3E 3O7LD 1W8CA 4AGCA 1T45A 5LCJA 4OTQA 2QO9A 4WNPA 2UZBA 5FEDA 4YTHA 4I1ZA 3TACA 3KULB 4E6DA 5CAUA 4BKZA 4TWOA 4UXQA 4KD1A 3ZYAA 1NA7A 2OIQA 1LUFA 1ZY4A 2R64A 2WQBA 5CU0A 2DYLA 5HOAA 4ZSAA 4GG7A 3ELVA 2RL5A 1Q4LA 4FOCA 1YOMA 5CT0A 2XJ0A 4O7ZA 1P14A 1APME 3IDCA 4IQ6A 5FGKA 5D9HA 2C4GA 4DBNA 2PE0A 4YTCA 5CAVA 4ZTSA 4XYFA 3SVVA 3BYSA 4E4NA 3NR9A 5L6WL 4K0YA 3MDYA 4F99A 3WIKA 5AV4A 2XRUA 3FKOA 4CYIA 5KMMA 4QMPA 4GS6A 4UB7A 5JH6A 4RJ3A 4HPTE 4IVCA 4CT1A 3Q04A 4FV0A 1SVGA 2QOKA 2X2LA 3R7GA 5CY3A 3W2SA 3Q9ZA 4BCNA 1VR2A 4CLIA 2CKPA 3FEGA 1ZXEA 3EFWA 2E9NA 3F69A 4QTBA 1B38A 3OS3A 3KRXA 2QOHA 5DA3A 4DFZE 1JLUE 4BYJA 3E92A 3U8WA 4L8MA 3KEXA 3HMOA 5KMKA 5HKMA 2YDIA 2X9FA 4FZ6A 5IEXA 2BPMA 5EOBA 2ACXA 1PXLA 2P3GX 2XCHA 3FQHA 3Q4UA 4I93A 5C27A 2R3GA 5H8BA 5BUEA 2HIWA 3RTPA 3B2TA 3B8RA 4AN2A 4FNXA 3HECA 4N70A 4BI0A 1PF8A 1J4PA 3UOTA 3ORTA 3LCOA 4PMSA 4QMSA 4FT7A 4FIGA 4L45A 2IW9A 5CAPA 4JDKA 3WZEA 3HMIA 3RM6A 3GOPA 1NVRA 3E5AA 2JDSA 1JSUA 1MRVA 3BHYA 5E90A 3UOLA 3CC6A 4TYHA 2ONLA 4RC3A 4DAWA 2W05A 4ALUA 4WG3A 2WXVA 1V1KA 3FLWA 4LL0A 3BHTA 2CCIA 4QQ5A 1ZMWA 4FBXA 4FKIA 1NT2A 4ZSGA 3PRFA 5AEPA 4YJNA 3D0EA 3RAHA 3COHA 2VUWA 3F7WA 3BIZA 4YUQA 2PYWA 2WB8A 3R2YA 3SC1A 4JDIA 5JGAA 2V7OA 3VUIA 5HNGA 2BZJA 3ZO3A 4C3FA 2C3JA 4JONA 4XV1A 4AFEA 2G2IA 4DGMA 5G6VA 1LEWA 4AUAA 3EL7A 3U6HA 4U9AA 2C6IA 4XP3A 5GINE 3ENHA 4FX3A 3R9RA 5J5TA 2FH9A 4M0ZA 4OAUC 3MIAA 4I21A 1YOLA 3A7HA 2VWVA 2JKQA 4F9YA 5K0KA 2WOUA 4FNZA 4Q9SA 2VD5A 2QOFA 3D15A 4UV0A 3PXKA 3O17A 3R04A 4O0VA 3MWUA 2ITOA 4IANA 3FHRA 1Q3DA 1VZOA 4H3BA 4EJNA 3I81A 4JQEA 4B6LA 3R8ZA 3CSVA 3VS5A 3W2CA 4UMUA 4JRNA 3MFSA 2BIYA 1I44A 4XG2A 3CE3A 5HE3A 2G1TA 3GVUA 2YWVA 5E8XA 2GNIA 1O9UA 3RAKA 4XV3A 3V6RA 5HBHA 3QU0A 1M7QA 3F9NA 5IUIA 2OF2A 4QO9A 3SLSA 3ACJA 2BDFA 3QL8A 4LUEA 3R9DA 1NVSA 1UA2A 1PXOA 3COMA 4CCUA 3UVQA 3NVKI 5AR4A 3W32A 3GCQA 4JL9A 2O64A 3QD2B 4D5HA 4B99A 5IA3A 3DDPA 3LFDA 3E87A 3UO5A 4J98A 3UPXA 4EOMA 2E9VA 2PVYA 2OFVA 4CFVA 2XA4A 5EQPA 2HWOA 5A6OA 2JQIA 3WZDA 2G2HA 4ZJIA 3MTLA 3VS3A 2YM3A 3F6XA 3RK7A 4NT4A 2VTAA 1FQ1B 3F5XA 3AD6A 3HAMA 1PYEA 3S1HA 4IEBA 5HG7A 4YURA 3DKGA 5DR2A 3VHKA 2OH0E 3A7GA 4QMNA 3VUTA 4L42A 4BN1A 5E4HA 1CMKE 2JQLA 2HZ4A 3GQSA 3WIGA 3Q5IA 4FZDB 3ZTXA 3ZXZA 2C5OA 4O27B 5L2WA 5H8GA 5AR8A 4O84A 5GIPE 4BDEA 2C5XA 4RIWA 3ZDIA 3CY2A 4CV8A 2WGJA 2ITPA 3I6WA 2IZRA 3HZTA 2F4JA 4TYGA 4UMPA 3C7QA 5ETAA 3DBFA 5I4NA 5IKWA 3KF7A 1OL7A 3UE4A 4CCBA 2CNUA 3AC8A 2PVHA 2GHLA 2XNBA 3FKLA 3CKWA 4P2KA 4F70A 4F4PA 3DQWA 2H9VA 4G17A 1REJA 1PRYA 4QYYA 3NWWA 4R5SA 4RQKA 3TV6A 1YI6A 3BLHA 4X2KA 3UG1A 4XG6A 4FEUA 2CGWA 3EFLA 3R9NA 4FVPA 1ZYLA 3R1NA 3I5ZA 3R7EA 4ANQA 2B52A 1Q3WA 2IWIA 1QPCA 4GIHA 4U45A 4RIWB 4RLLA 2FUMA 2JAVA 1IA9A 2Y6OA 2WKMA 4IDVA 4DH5A 3UNMA 2GQGA 3UC3A 5J8IA 5J1VA 4JDHA 4QP3A 4FZAB 3TZ7A 4I23A 4DFYA 4L7SA 4YNEA 4KSQA 4DH1A 5KMOA 5AA9A 3DCVA 3O51A 4F6SA 2Z02A 4IWPA 4DT8A 4MX9A 3P1AA 3OOGA 2YM7A 1MQBA 5K4JA 5A8IA 3UVPA 2IZUA 5CVGA 4II5A 4EHVA 3V8TA 5EI8A 3VRYA 4QYGA 3ORIA 3QCYA 4OT6A 5F94A 2OLCA 2PVMA 2ZM4A 4JAJA 3MA3A 2ITUA 4GUEA 2GHMA 2PZPA 4BZDA 5AA8A 1PMEA 3VNTA 3I1AA 4KNBA 4EBWA 3CJFA 4FIJA 4CGAA 3EKNA 1H1QA 4E8AA 4BY9E 3JUHA 3KMUA 1KUTA 4M12A 4FEWA 3W33A 3ID6C 4KABA 3GU6A 3A61A 4FV7A 3MIYA 3KRWA 4RZWA 1J7IA 4G9CA 4UWBA 4ZTNA 3PDTA 2ITYA 4FL1A 4S32A 3NYNA 4O7VA 2C6DA 5DI1A 5DFPA 2CNQA 4H3QA 1MRYA 3H9OA 2YAAA 4QMOA 3ORZA 4TRLA 3CLYA 3NNXA 5FM2A 4R7BA 4FV4A 4EC9A 4Y72A 3U87A 3E8CA 3Q4TA 3OFMA 4TYEA 3LXLA 5A4TA 4C4JA 4QP1A 2OI4X 3ZSGA 3EH9A 3HUCA 2VNYA 3S95A 2OJJA 4ZLYA 2UZLA 3QA8A 3DKCA 3MN3A 4E4LA 3GU8A 4U3ZA 2VTSA 4BWKA 5IQHA 4U40A 3HRBA 3F2RA 3NCZA 1PY5A 3R8UA 3FSFA 1WV3A 4BDBA 4RIYA 5ETFA 3UG2A 4AFJA 3DJ7A 3BCEA 4UZDA 2XP2A 3GXLA 3ORPA 3TUBA 3KRLA 2X0GA 3BE2A 1WBPA 2PTKA 1OUYA 4JS8A 5ANOA 2VTRA 5EKNA 4I22A 2RFNA 3E7OA 3TM0A 3F88A 2XM8A 4D0XA 3R30A 3Q52A 3KU2A 4QOXA 3UC4A 4F7LA 2UZWE 2Y6MA 5HD7A 1UU7A 3LE6A 4KBKA 2UZEA 3BE9A 4YJUA 1DMZA 2QKRA 5C8NA 2Z60A 3V5PA 1BYGA 2ZV2A 4GEOA 4FTAA 1BLXA 3TZ9A 4ZTMA 4AA5A 3A7FA 2V7AA 4RIYB 1GIHA 3KK9A 4L7FA 5FBOA 4OTDA 5L6PA 1W7HA 5K9IA 1YDTE 5LVMA 3QTQA 3WF5A 1YDRE 1SMHA 1U54A 4P7EA 2R3OA 4CRSA 5DIAA 2BRBA 2Y9QA 3R00A 4ZMEA 3JY9A 1V0OA 3MPAA 4QMUA 4HVDA 4JIAA 4E73A 4F6WA 2C68A 4CFWA 5JFVA 4Y5HA 4C4FA 5AFVA 3SV0A 4J8MA 3QZGA 3CGFA 4PTGA 3NCGA 5IQGA 5M07A 1SVHA 5J7HA 4Z3VA 3C4ZA 3OW4A 3BKBA 2XNPA 3WBLA 3FZRA 2XJ2A 3NUNA 3CCNA 2HXLA 4U5JA 3AOXA 3G0EA 3PVBA 2XIRA 4I92A 4CQEA 4J95A 1M17A 3SW4A 5I9VA 3VUHA 3FAAA 4M84A 3BWFA 4FKJA 3IG7A 1V0BA 2EWAA 5DEWA 1U54B 4RJ4A 3RAIA 5H2UA 3NLBA 4J99A 3KGAA 4IWOA 3FXZA 1A9UA 4RJ8A 4O7YA 1JQHA 3MY5A 3BWJA 2FVDA 4I4EA 3R7IA 4ZTLA 5CF5A 3VO3A 5EQYA 2WTVA 1M2RA 3D94A 5F95A 3HUEA 2Y0AA 4K18A 3DKFA 1XH9A 4L01A 3OWJA 2GTMA 2HZ0A 4NIFA 4H05A 5L8LA 3PA5A 4YJQA 5EM6A 3VAPA 5CI6A 2X7OA 4X0MA 2ETRA 2WTIA 3Q6UA 2WQOA 3R7YA 2PSQA 2R3KA 4HNIA 5I9UA 3PA4A 3THBA 3FMNA 3PZEA 3SRVB 4D2WA 5IU2A 2J50A 1OGUA 3KFAA 4RVMA 2VTOA 3OTVA 1QPJA 3MVLA 3PSCA 4BHZA 5M4FA 4A4LA 2YIWA 3PSBA 5AX3A 3DBCA 4AN3A 5AR5A 4E4MA 1MRUA 3TNPC 3UV0A 5E8SA 3U4UA 5KMNA 4YJOA 3IKAA 4J97A 4AP7A 1Y8GA 4E93A 3FQEA 1AQ1A 2C3LA 1H27A 2QC6A 2JD5A 4FSTA 3QD0A 5FBNC 3P86A 5LJJA 4PDYA 3TEIA 3E7VA 4FV9A 4YZCA 4FZ7A 2OZAA 4F1OA 3LCKA 2O65A 5L2QA 2W5AA 5C03A 4BCOA 4RQVA 4M69A 1PXPA 4ZJJA 2CGXA 3WF7A 4FTUA 3GT8A 4MKCA 3UNJA 3NUPA 2NRUA 2Q0BA 5GZ9A 4ZY4A 4BIBA 4A0EA 3RVGA 4QD6A 1UNHA 4XBUA 5DT3A 2WTDA 4C0TA 5IMXA 5M09A 2Q83A 4EOKA 3R2BA 4DEIA 3KCFA 3T9TA 4FODA 3OC1A 3C9WA 4HYUA 4FKVA 2QG5A 2GS2A 2PZIA 2W4JA 1B6CB 5DT4A 1DAYA 2ERZE 5FP5A 3T9IA 2HK5A 3ZCLA 4C35A 5HBJA 3V01A 4QP7A 2I7QA 2E9UA 2EU9A 1YVJA 2X4FA 3OTUA 4KIPA 4MK0A 4BZNA 2R9SA 3G9NA 3AC4A 3MY0A 4YGAA 4YJSA 3WE8A 5HEZA 2OZAB 4IXPA 4BDJA 4A9YA 2ZB1A 4XG9A 4W8EA 4BBEA 1TQPA 4XP2A 3VBXA 1OM1A 2R3PA 3QQUA 3QHWA 3LFSA 4J7BA 3EZRA 3L8PA 3F2AA 4V01A 5JGBA 1URCA 3BQCA 4EOLA 3ZFXA 2VX1A 1JKLA 5AR2A 4ITIA 1Q99A 4ZXTA 2OW3A 2VO0A 3NPCA 3UBDA 2HY81 4LQMA 3KVXA 3DGKA 3FKNA 4YO6A 3VW8A 5LXMA 2QVSE 4O7TA 4BHNA 4OW8A 4ANLA 4IW0A 2Z7QA 3U4WA 4Z7HA 2IVSA 5CSXA 4GYIA 1OITA 2C6MA 5EYMA 3R01A 4KRCA 2XKEA 1G8AA 4RJ5A 4G6NA 1PYXA 1JSTA 3UNNA 3PXYA 1Z5MA 3EZVA 2VX3A 2BHHA 5IQCA 4ALVA 4S33A 2QOCA 4O21A 4PPAA 2OF4A 4RVLA 4HYIA 4I41A 2X6DA 4QTDA 3G51A 4HVHA 4FIEA 2HZIA 4BCHA 3TI1A 4L3PA 4QTEA 1H1PA 3BHUA 5TOZA 3IW5A 4QMQA 5KBRA 2XIKA 1PKDA 3G9LX 4XOZA 3NNWA 3C5IA 2V62A 2EB3A 2BKZA 2GNLA 3U54A 2O5KA 3OP5A 3SOCA 1GOLA 5AMNA 3TNHA 3EN5A 4C3RA 4C34A 1Q97A 3R0TA 2Y4IC 5EHYA 3PIYA 4NTSA 4XJ0A 1PXNA 2P0CA 1ATPE 3KKVA 1VEBA 3JVRA 3DNDA 2WU7A 4MBIA 5HTBA 4MTAA 3C4FA 2FSLX 3BYOA 2J51A 5AUXA 3W18A 4ACCA 3UNZA 5FQDC 3L1SA 3UP7A 2RFEA 4XEYA 3EN7A 2UW0A 4QPMA 3TXOA 4O96A 5HTIA 4IACA 5LARA 3RPOA 2J9MA 4EC8A 2XK3A 2FSOX 3IGGA 1H4LA 4WBBB 4A4XA 4U97A 4FOBA 3QXOA 4ANMA 2VTNA 4EHGA 4F9BA 3NIEA 4CVAA 4EHZA 2H8HA 1CM8A 1ZMUA 4UBAA 4KUJA 4PDPA 2DWBA 1A06A 2YISA 5LMBA 2EUFB 5AUWA 2BVAA 1H0WA 2QO2A 3FUPA 3KCKA 1XBAA 1Y57A 1YXXA 3DQXA 3H10A 2IJMA 4HGEA 3EWHA 3ORXA 4W4VA 4R77A 2BAKA 3Q5ZA 3VWAA 3PE1A 4CTBA 2B1PA 4GFOA 5TR6A 5TT7A 4BGQA 4EI4A 5JGDA 3KRJA 4AW5A 3O8PA 5EHOA 3ATTA 1CKIA 4ZMFA 3ALOA 3P5KA 4YBKA 2NNWB 5E91A 2EH0A 1HCLA 4H1MA 4RWLA 4PTEA 2WMSA 3H9FA 4GRBA 3QQGA 4EZ5A 2JDTA 2PVNA 4PRJA 4C57A 4I6HA 3WZKA 2QONA 2WMAA 3BPRA 5IQDA 4O0UA 3QUPA 3GC8A 3OBJA 3I6UA 3ROCA 1UV5A 4GH2A 3VUKA 4IZYA 4ANSA 1RQQA 5CEQA 5C1QB 2XBJA 4XV9A 4L43A 4RIXA 3GC0A 4DN5A 4F9AA 4G3CA 4WRSA 5HGIA 3TDVA 2UZTA 2KFUA 4FE2A 4AA0A 5CANA 3KXZA 2C3IB 3MYGA 5FD2A 5AX9A 2I0VA 3FJQE 1OKZA 3MB7A 5IF1A 2XM9A 4Q5HA 4XLIA 3Q9YA 2DS1A 3C4WA 4DFBA 1K2NA 1IA8A 4YJRA 3UYSA 3DB6A 2B0QA 4TWNA 3P7AA 4EH2A 4R78A 5CXHA 2E2BA 5C8MA 2XKCA 3GB2A 4O1PA 5KE0A 3R21A 2RF9A 4I5MA 4KINA 4M15A 1H24A 3FLNC 4FTOA 3PG1A 5DGZA 3TCPA 4BDCA 2F7EE 4BKJA 4C3PA 3KXHA 3KREA 3MH1A 4EQCA 4F1TA 2YITA 4USFA 4DFNA 4I94A 2WTWA 2HW7A 2YEXA 5BMSA 2GS7A 4HYHA 4UN0C 4IZ7A 3KN5A 1DAWA 4RX7A 4M66A 4PL4A 2EXMA 2ONLC 2PZRA 3F5PA 3OWLA 3SG8A 4MNEA 3QFVA 4FTTA 4F7NA 4BCMA 4CSVA 5C9CA 4ZAUA 1GXCA 3DXQA 1J3HA 1UJXA 3ELJA 2CGUA 4NU1A 3VS1A 4A9TA 2G9XA 1QPDA 5JQ8A 4K33A 5K3YA 1ZYSA 2A4LA 2XNOA 4ERWA 4USEA 5DOSA 4LV8A 2CGVA 3OW3A 4RVTA 4Z9LA 5ANIA 1E1VA 2CHLA 2EB2A 2G01A 1FVVA 3VUDA 5DN3A 2IN6A 4UZHA 2A0TA 3GNIB 4YMJA 3CR0A 4MBLA 5CVHA 5I9YA 3CD3A 3Q60A 3AD4A 5HQ0A 3ZM9A 4EH4A 3OD6X 3EN4A 4FIHA 5DRDA 3QXPA 4FIFA 4FL2A 3ZXTA 1H01A 2XS0A 4IBMA 4Y73A 4JBPA 3OG7A 3OCSA 3ORNA 5EDQA 4AOTA 4MNEB 4IZAA 3W2RA 2I0YA 3VBWA 3A2CA 3LCSA 3CTQA 2Y4IB 4IE9A 5CF4A 4FK3A 2J0MB 2QI8A 3PYYA 4ZTQA 3TNWA 2CPKE 4ANOA 4EH8A 1W0XC 2PVLA 3EFJA 4I4FA 4ERKA 3ZO2A 2RKUA 2YIXA 1VJYA 3HV5A 2ETMA 3MB6A 4KIKA 2HYYA 5LMAA 2X1NA 3P4KA 3Q32A 3KXGA 4JX3A 4H3PA 4GU6A 3EN6A 3FV8A 4DG0E 4PNKA 4TNDA 4W8DA 5D10A 4CMOA 1OVEA 5EW8A 3SA0A 4RJ6A 3ZBXA 2WU6A 4I5PA 2HXQA 2VTTA 3OCBA 4JQ8A 2RFDA 5AP7A 2W1CA 4FEXA 5CASA 3R8MA 4GIIA 4MXAA 2XT9B 3MVHA 2JKOA 5KCVA 2KTYA 4PY1A 3EKKA 4BI2A 3ROYA 2YIQA 4ARKA 3I0NA 4J8NA 3G33A 4YJPA 4A07A 3HA6A 3ZO4A 1QMZA 2Y4PA 1AGWA 3BRBA 2O63A 4JQ7A 4KIKB 4PX6A 2ZAZA 3FZTA 4LRJA 3AC2A 4TNBA 4AU8A 3S00A 4G6OA 4PF4A 5HCZA 3COKA 2YZAA 4O0RA 3TG1A 5BUIA 3Q9WA 3QTSA 4WSQA 3FL4A 4DG2E 5AM6A 3PXZA 3BGQA 4LGDA 3L9NA 3QTIA 4KIQA 4IAAA 2EVAA 2W5HA 1L8TA 4GT4A 5L8JA 4QQJA 3VA4A 4PWNA 3PWDA 4X3FC 5CEOA 5J5SA 3GCPA 4V0GA 4IIRA 3QCSA 3OVVA 5I3OA 2ITZA 3VF9A 4TWCA 3EN9A 4ZEGA 5IA2A 3D2IA 3QKLA 5EI2A 4ACMA 2GMXA 3QYZA 3UMXA 2QODA 2Z7RA 2WELA 3F3ZA 4JXFA 3UJGA 2WNTA 4TT7A 4BTFA 1YQJA 5CNNA 4IVAA 4CZTA 5KHXA 4BIEA 3FMEA 1JVPP 4OAVB 2VGOA 2I1MA 3UTOA 3R22A 4FV8A 4C38A 4HOKA 5C4KA 1OMWA 2LAVA 2VV9A 2WMQA 4O0WA 3IW8A 2JAMA 4QCJA 5ACBC 2YJSA 2XF0A 4G3FA 5L2TA 4X7QA 3ALNA 4TZRA 5TKDA 4RPVA 2HOGA 1PXIA 4ZK5A 4Y8DA 5TF9A 3LAUA 2C0OA 4UYAA 4YSJA 5H8EA 2WMRA 4KSPA 3LW0A 4JR3A 4ZSEA 2V22A 4GSBA 3IK3A 2ZYBA 3UQCA 1GZ8A 2UW3A 2FO0A 3T3UA 1L3RE 2PE1A 3ZONA 4AZEA 1F5QA 2GNJA 4IM0A 4TN6A 2QOBA 4C37A 2YIRA 4K8AA 4WO5A 3QUEA 2PK9A 4E5BA 4TYHB 4G6LA 4B8MA 4G34A 4G9RA 4W9WA 2R4BA 3LFCA 3V8WA 1STCE 3QRJA 4XS2A 3QTXA 4D9VA 2UV2A 3H30A 4H39A 4MCVA 1OPLA 1FGIA 4BCGA 4HW7A 3LM5A 4FKUA 3TWJA 4E1ZA 5DWRA 3ENMA 3QX4A 4RG0A 4K77A 3RWPA 4DE4A 2RFSA 3JPVA 4MBJA 2W06A 4MWHA 4RBLA 3UMWA 3ZLXA 3IOKA 3FMMA 1WBNA 4FG8A 4XCUA 1UKHA 3BX5A 4PDSA 5CF8A 2BRHA 2XNMA 2C5NA 4M97A 2OJFE 3PPKA 3TKIA 1K3QA 3B8QA 4LUDA 2F49A 3LIJA 5IH4A 3FLZA 3DLSA 5HCYA 1PXMA 2JIVA 3V8SA 4D2VA 4O7LA 3LJ0A 3BI6A 4QMTA 3DAEA 2W9FB 3DK7A 5C4LA 1AD5A 4FSWA 2X7GA 4AE9A 1OIYA 2PMOX 4FV1A 1XH6A 3UODA 4BCIA 2X2MA 4FKSA 3NS9A 2KB4A 3QGYA 1SNUA 3PP1A 4EL9A 3ITZA 4IAZA 4RWKA 5AM7A 5AUVA 4D9UA 2H34A 1UU8A 3QLGA 3HV6A 2WZJA 2W1DA 3C1XA 4TTHB 5DBXA 2PHKA 1WMKA 3GU5A 5KX8A 1W98A 4BRXA 4MXCA 2AFFA 3KY2A 4L68A 3FYKX 4MAOA 1GIIA 3C13A 2OZOA 4HNFA 4C2VA 5IUHA 4XUFA 4BB4A 5KMLA 5L3AA 3FI4A 1YHWA 4X2GA 2WD1A 1XO2B 1MQ4A 2C6KA 3VS0A 1OPKA 3QQKA 3ZSHA 3I79A 4QTAA 3R7OA 2JDVA 2R3RA 5E92A 3MSSA 4UWCA 5L2SA 1ZZ2A 5CZHA 2VTIA 3OCGA 3IW4A 3JYAA 4X3FA 2X6EA 4D4VA 2WIPA 3NGAA 3W2OA 3NNUA 2PZ5A 5IUGA 3DFAA 4CLJA 3DNEA 4U81A 5EM7A 2C0IA 5IH5A 4ASZA 3C4EA 2RIOA 5AR3A 2C1AA 2XNNA 4WG4A 4Y85A 4YHJA 2XK8A 4U44A 3OWKA 1VYZA 4EEVA 4EZ3A 3LXPA 3FSKA 4IADA 2UUEA 2WHBA 4AT5A 4C7TA 3QTZA 1KE7A 1Q8YA 3BYUA 4G2FA 4QP6A 3RK9A 5B7VA 2HELA 1YI4A 2BAQA 4XRJA 5HU3A 1XBBA 2ITTA 2QLQA 3L8XA 3V5TA 4QMYA 4YLKA 4DGNA 2VWIA 2VWWA 4ZLZA 4B4LA 4K2RA 4L3JA 4H87A 4FTCA 4X3FB 4FTNA 4DYMA 4C4HA 3O0GA 3DV3A 4G31A 1A48A 1H1SA 1Y6BA 3HMPA 5HTCA 5CYIA 3VUMA 4IWQA 4R8QA 4APCA 3ACKA 4CMUA 4FSMA 1UWJA 4FGBA 2WQMA 4QTCA 3LLTA 1OBGA 1J1BA 3NIZA 4MF0A 2VNWA 3I5NA 2J5EA 2JLDA 5IZFA 3HRCA 4FNYA 1OBDA 5A54A 5M53A 4O82A 3TNQB 5IQEA 2QR7A 3H3CA 3UYTA 4GG5A 5K0XA 3N4VA 4GYGA 4MHAA 4TY1A 3TV7A 3U9NA 3MH3A 4FYOA 2BHEA 1WZYA 3BV2A 3RINA 5FUTA 1LEZA 3FLYA 3FL5A 4A4OA 4AQCA 3TL8A 4EQMA 2VO3A 4R3CA 5IA5A 4FG7A 3R7UA 4O1OA 4ID7A 3SD0A 1ZWSA 3L9PA 4C58A 4BCPA 1KE9A 5ETIA 4BIDA 1SYKA 3CPCA
chains in the Genus database with same CATH superfamily
4C02A 1X8BA 1M2QA 1PHKA 1TZDA 2C30A 2KULA 3PY3A 4ONAA 3MW1A 4R7HA 5E7RA 5B2LA 4O6EA 4PPBA 5IMEA 3ZDUA 5DJOA 4U0IA 3FXXA 1Q61A 1G3NA 5T6KA 5AUUA 4LG4A 1YI3A 5L6OA 5A3XA 4WRGA 2OXXA 5LCKA 2CJMA 2QHNA 4EK5A 3SG9A 4F6UA 1CKJA 2QOOA 3CKXA 5AP5A 5DYJA 1FMKA 4QMWA 2I40A 2P2HA 3ZFYA 3FBVA 2JKDA 3M2WA 2W5BA 5CQWA 1BMKA 2XIXA 3WE4A 5CSWA 2WMUA 3HV3A 4YU2A 1YXSA 2G2FA 2REIA 5A4CA 4QEBA 2UW8A 2XK7A 2WFYA 3EQBA 2WMVA 3LJ1A 3GI3A 2J4ZA 3GCVA 4W4YA 3QZHA 3FMJA 4L67A 3D7TA 3GOKA 4OTFA 1FHQA 4AZSA 2BZHB 1OI9A 3D4QA 4P4CA 5JK3A 2QOQA 5AV0A 3MFUA 2RGPA 3AT4A 1GZOA 5M56A 3A77A 1WCCA 4JLCA 3QX2A 3UZRA 3QRIA 3FQSA 4FSQA 4QNYA 3TJCA 4XG8A 2GFSA 2PE2A 4O7SA 2UZVA 2X39A 3BEGA 3P7CA 2AC3A 4NEUA 5GZAA 5LVPA 4O0YA 5D12A 3DK6A 5K4IA 2X81A 1WBVA 4O6LA 4H1JA 5EHLA 2W1EA 4JVGA 3PXQA 3RJCA 4NJDA 4R1VA 5IQIA 2PUNA 2PUPA 4GL9A 4EH3A 4BGHA 4M7IA 4V05A 4QNAA 1NY3A 3EHAA 4WHZA 4B0GA 4DEDA 4TKSA 3ATSA 3RPRA 4MD7E 1G8JA 3EQDA 3D7TB 2UVXA 2I0HA 5JEOA 4M68A 5B2MA 3LQ8A 1YDSE 2GHGA 2HCKA 2GFCA 3IW7A 3JXWA 2FGIA 3KXMA 4DT9A 2VZ6A 3CTJA 4I20A 1B39A 2AC5A 4KS7A 4EK3A 2YM6A 3BL9A 4UMRA 1CSNA 3FZOA 4NM5A 5IEVA 3OUNA 1TQIA 5DVRA 3MH2A 3NYVA 4AW1A 4DTBA 1CTPE 3SXFA 4N57A 3NEWA 4YJVA 1JKSA 2GCDA 4NSTA 4L6QA 4C8BA 2CMWA 5HX6A 4G2SA 1K2MA 4KKGA 4KA3A 2PL0A 3BL7A 4PTCA 3FC2A 4FGRA 3FXWA 5JQ5A 1V0PA 4ZS4A 5EG3A 5EW9A 4DH8A 3BYMA 3MDBA 4E26A 4O7NA 2JGZA 1GZKA 2G15A 2QLUA 3IQ7A 4JG6A 2XCKA 3TTIA 4OR5A 1GAGA 2YHVA 4GK4A 4QMVA 3PVUA 4ZOGA 1G8SA 2G1LA 2XIYA 1T46A 3SOAA 3OUNB 1YHVA 4IMYA 3VZCA 3GCUA 3FWQA 4RFZA 2W1ZA 4A9RA 2W0JA 3BQRA 2B53A 4XG7A 5E8YA 1ZZLA 3V80A 3PUPA 3QTUA 2YERA 3DB8A 4FT5A 5AUYA 4BWPA 1OUKA 4DCEA 1G6GA 3WF8A 3OROA 3P79A 3OT8A 3R02A 1YJMA 2GQRA 4ACDA 2BAJA 4J52A 3A8WA 3AC1A 3M11A 3L9MA 3PJ8A 5TE0A 1W83A 2VN9A 5E1EA 4AN9A 3V8PA 2JC6A 2C0TA 4AF3A 3V7YA 3D9VA 2C5YA 4FTMA 3NW5A 5KMIA 2YDKA 2W99B 3A60A 2QR8A 2JEDA 4BL1A 4G5PA 4E3CA 4DLIA 3E64A 3RNYA 3DOGA 3PY0A 5CI7A 4IM3A 2ZMDA 4FT9A 5HG5A 1J4OA 2WMWA 1GJOA 3H0ZA 3N9XA 4U6RA 5TO8A 3RMFA 3PG3A 1Q62A 3G6GA 4IZ5A 5B2KA 1ZAOA 2XYUA 3LMHA 4YHTA 1S9IA 3S3IA 3DS6A 4CFXA 4I0TA 4FSUA 2ZOQA 4CFMA 3QYWA 5IQAA 3CEKA 4I24A 4P5ZA 3VJNA 1FVRA 4G1WA 4BDIA 1W2DA 4AW2A 3G90X 3RCJA 2GS6A 1BKXA 4OTIA 1Z57A 1NXKA 2R2PA 3KRRA 2CLXA 4IAKA 2W1IA 3R8VA 4JNWA 4BDDA 5FG8A 3R9OA 2PUUA 4UX9A 2BIKB 3W8LA 2ZFYA 4UY9A 1Y8YA 1XH4A 3H0YA 4MWIA 2PUIA 4D55A 4DFXE 4NIFB 5D7AA 5DR6A 4ASXA 3OWPA 5I0BA 3HP5A 4YZ9A 2RG5A 3UDSA 4JIWD 4C62A 1W2CA 1WBWA 3ZH8A 4AZTA 3DU8A 3QKKA 5CENA 1Q41A 4OTRA 2J5FA 1SNXA 2R0IA 4I0SA 1KOBA 4DC2A 2WTKC 3FI2A 4FC0A 4OTWA 5JEBA 4O81A 2PVFA 3ZS5A 4IB0A 3MESA 4UYNA 1ZMVA 5M44A 3II5A 1Q5KA 4RA4A 4FICA 3ZZWA 4NYEA 3V51A 5J7BA 2XAOA 3GENA 1Q24A 2EXEA 4FK6A 4CZUA 4DLJA 5ICPA 4E6CA 4F65A 4K11A 1KV1A 2GU8A 1XH8A 1WVYA 3G2FA 5FLFA 3QLFA 2ZM1A 4NZWB 3DY7A 4KU0D 4GW8A 2WO6A 4IX6A 1YWNA 1K3NA 4FT3A 3VQUA 2UZOA 3UIBA 2HZNA 1RE8A 5DHUA 3SGCA 3ZFMA 2IVVA 2W4KA 4CKRA 3GQIA 3KA0A 5CQUA 3DXPA 3MTFA 5M08A 3DBQA 4BVUA 2XB7A 5GIOE 1OB3A 2BFXA 3RPVA 2Z8CA 4JBOA 1FINA 5EYKA 5E9EA 4M69B 2X7FA 5GHVA 4D2SA 3O2MA 4I6BA 3ANRA 2DUVA 4E7WA 1LP4A 3QA0A 4L46A 3ETAA 4HZSA 4D4SA 2Q5FA 3POZA 3LXKA 3BHVA 5EDPA 3UN0A 2ITWA 1K2PA 2YACA 3PWYA 4FKLA 3OXZA 1WLNA 1RW8A 2ZDTA 4V24A 4GKHA 1PMVA 3EQCA 4PMMA 5DLSA 4EH9A 3OHTA 4ANNA 2XAMA 5HI2A 3IDPA 1P4FA 4RIOA 1G3GA 3NAYA 3ZOSA 3MJ2A 4AZFA 4K6ZA 4D2TA 2VTQA 2UZDA 2FF4A 1KE5A 4WUNA 4QYEA 3PLSA 4BDGA 5EJGA 3NVMB 4H36A 3LMIA 3Q6WA 4RC4A 4Q9ZA 2XXSA 5IDPA 5JELA 3F3VA 3EOCA 4Q5EA 4FV3A 2JIIA 3IDBA 4ZS0A 4BKYA 3OY1A 5HLPA 1BL6A 3TZ8A 3HA8A 5CX9A 2VWBA 4O0TA 1H00A 2HY0A 1WFCA 2W1HA 4JOAA 4XH6A 2JKMA 5CEMA 3ZUUA 4Q2AA 3Q4CA 5M51A 3RZFA 2BZIB 2UW7A 3BU6A 3EYHA 3FZSA 3HV7A 4IWDA 3LHJA 4AAYA 1BX6A 3L8SA 2I6LA 3TJDA 4C33A 1QU5A 5IPJA 1U59A 1DEVA 4EGXA 4R3PA 4YPSA 1R3CA 4JBVA 4MD9E 1Z0UA 2B9HA 2F57A 2BROA 3QD4A 5AP2A 4YSMA 5IG1A 2ERKA 2J0IA 1YGSA 4EK6A 4MXXA 3H9RA 2JFLA 3G5DA 4WRRA 1J7UA 2J2IB 3ZC5A 3NSZA 5EI6A 3QGWA 4XG3A 5FXRA 4I6QA 3VC4A 3R8LA 5AADA 1P2AA 4YPDA 4YP8A 4AT4A 4AZWA 5T3QA 4CFUA 3CQUA 3OXTA 1J4KA 2FYSA 3FY2A 2V55A 1OPJA 3DAKA 5H9BA 4E5AX 5CTPA 5CEIA 5DG5A 3QQLA 4KB8A 3U55A 3V5JA 5E8WA 5AAGA 2YIYA 1RJBA 2X8DA 2X4ZA 3FHIA 1U0RA 5GJGA 4DA5A 5FXSA 4YJTA 4CYJA 4ASDA 4B8LA 4CTCA 4BDHA 3O23A 4ZIMA 4D58A 3R63A 4UMQA 4DGLC 1ZYJA 2B9JA 2H96A 3BBWA 1YOJA 3I60A 3IS5A 4M14A 4QPSA 1Y91A 3PVWA 2C6TA 4YLJA 4YZBA 4EOPA 3CP9A 3S4QA 1S9JA 3K3IA 4EJQA 2WMXA 3LJ2A 1XMMA 1YXVA 2JQJA 4WG5A 5EYDA 3LCDA 4USDA 5DHQA 3MFRA 3AXWA 5B0XA 2BRGA 5A46A 2R5TA 2PVKA 3O71A 2VTMA 5FP6A 3LXNA 3C5UA 4EKLA 4TL0A 2VWZA 2YCSA 3GU4A 3P9JA 4M8TA 2HENA 5M06A 3KC3A 2W1GA 5HORA 5HE0A 4FTJA 4M0YA 1DS5A 4BJJB 3HEGA 4QT1A 2VWYA 3BV3A 1YWVA 2CKEA 2R3QA 4WNOA 5ANGA 3PIZA 4BDKA 2GNHA 4J96A 2WTKB 4FVRA 4QP4A 4UMTA 1LPUA 4GV1A 3NYXA 1YWRA 5C4VA 3GFWA 1H26A 3OBGA 3U6JA 5LVOA 2QHMA 1O6YA 3PSDA 4YTFA 3VBTA 4AACA 4DTAA 3DAJA 4ZLOA 4AGWA 4MXYA 4DEHA 4UXLA 2YLFA 3E93A 1H1RA 3O8TA 1FMOE 3FPQA 5I9ZA 3LLAA 2VGPA 4LL5A 4OTGA 5BX0A 2HWPA 2ITXA 3F2NA 1H8FA 3GUBA 3UO4A 4J71A 5FM3A 3MH0A 3LFNA 3N51A 2F9GA 4U41A 4NCTC 1OKVA 1U4DA 2WQEA 1OL1A 3VHEA 4E6AA 3OEFX 2PPQA 4PQNA 3DXNA 4HCUA 5A4QA 3OY3A 5LQFA 1KV2A 2C6EA 4TPTA 5D7VA 4S2ZA 3ZRMA 3WYXA 1RDQE 4QP9A 4RX5A 3G15A 4NL0A 2ZJWA 4QP2A 2R7BA 4GFMA 2W96B 4ITHA 4S31A 2B4SB 3P23A 3PXFA 3U51A 2OBJA 3OZ6A 4RIXB 4NH1A 3GEQA 3NDMA 4DEAA 5M57A 2IW6A 2PMIA 4IH8A 3ZO1A 2ITQA 5JFXA 3V7WA 5HU9A 4X6RA 3U6IA 1GY3A 3PIXA 1J1CA 5EW3A 5HNBA 4Z7GA 3OOMA 2YJRA 1WBSA 2E9PA 2QD9A 4Z16A 1OIUA 3L9LA 2B55A 5BVWA 5BYYA 3F3TA 1OL5A 2FB8A 3G0FA 5EDRA 2IF8A 2PY3A 3HMMA 3B2WA 3VIDA 1F0QA 3I7CA 3Q96A 5FXQA 5K5XA 3DZQA 3ET7A 4EUTA 3MV5A 4BGGA 3UNKA 4DH3A 4BTMA 3WYYA 3TN8A 4CD0A 4F0GA 4RRVA 3W2QA 3WZJA 3RPSA 1UNLA 3PP0A 2W4OA 5BVNA 4IAFA 3CTHA 2XUUA 4ZSJA 4FTKA 4HVGA 5HHWA 4TYJA 4ZTHA 4FIIA 3UOHA 4FTLA 5E8TA 4BDFA 3ZU7A 3D14A 5HLWA 4U43A 5AV1A 3UDTA 4OGRA 4YNOA 4FV5A 4QYFA 1MR1A 4D4RA 1O6LA 3GQLA 5FTGA 1ZOHA 5CWZA 3D5WA 2HW6A 3EL8A 5AWMA 2P1RA 4MD8E 3LKMA 4NM0A 2ZMCA 4O0SA 3RALA 3TIZA 5A6NA 3KN6A 5HESA 4EWHA 3R8PA 4FEQA 5BVIA 4EBVA 3CPBA 5EQEA 4Y46A 3HUBA 1PMNA 3DK3A 4EWQA 3A7JA 3AGMA 3HYHA 4DF3A 4YBJA 3OEZA 1PJKA 2JITA 3AT2A 3VJOA 5HIDA 4D0WA 5KO1A 4QPAA 4PUZA 3W0RA 3KXNA 5JFSA 4ZJVA 1WAKA 2QQ7A 4QP8A 4F78A 4FG9A 4HCTA 2C69A 4ACGA 2W1FA 4FKOA 4RGJA 4FA2A 3SW7A 5AR7A 1YJ5C 4LOOA 3WOWA 4BFMA 1FBNA 3QQHA 2ZB0A 2YM4A 4LFIA 2WQNA 5E1SA 2UW6A 2R3LA 2BR1A 4WSYA 3W1FA 2R3HA 4MYGA 2CLQA 3REPA 5HX8A 3VS6A 3T8OA 5JKGA 4WIHA 3QCQA 4LV5A 4YLLA 3ZZEA 4R6VA 3PE2A 4AWIA 3MFTA 3NW6A 4ZP5A 4MH7A 3F7ZA 3K54A 1TQMA 5HLNA 4RFYA 5E8ZA 3KVWA 2NRYA 3E8DA 1IEPA 3LOKA 3C4XA 3N4TA 5ANJA 1Q8ZA 3EQPA 4YZDA 4O7WA 3FC1X 2F7XE 2FEZA 1JPAA 5HE1A 3TKUA 3UIMA 3GC7A 5C01A 3TZMA 1Q8TA 2C6OA 3GP0A 1EH4A 5HD4A 4NCTA 2OXDA 4EQUA 5F9EA 1IASA 4F09A 3EQFA 4OBPA 3JVSA 4L44A 4X2JA 5KKRC 4YHFA 4DITA 4GK2A 3DBDA 4NKAA 5LVLA 1H08A 2OIDA 3EQIA 3EQGA 4M13A 3CIKA 4MEDA 4DINA 4PP7A 1UWHA 5A4EA 4E4XA 5AP0A 4XP0A 3ZLYA 4A9UA 3COIA 1H07A 3IO7A 3V5LA 4QQTA 4HGSA 2B54A 2VTPA 4X2NA 5L8KA 3TUCA 3NUYA 4G3DA 2WOTA 4KBCA 4RLKA 3IONA 2E9OA 3AMYA 4A06A 2XZSA 3QCXA 4P90A 5BVDA 4IB1A 3ORKA 3R6XA 3F5GA 4P5QA 4FT0A 4QRCA 3RM7A 2Y8OA 4O22A 1UHTA 4FUYA 1IAJA 4D2PA 3NUXA 3F82A 4JG8A 2P2IA 1KE6A 5HCXA 3DA6A 3NUSA 3R83A 2VWXA 3O7LB 1R1WA 3Q3BA 3AC5A 3CD8A 4IB3A 4JJRA 4RT7A 4V0GB 5F4NA 4RWJA 3ZC6A 5C8KA 2JFMA 3K2LA 3VBYA 5J9LA 3D5UA 1YRPA 4I5HA 3UZTA 2IZSA 3CQWA 4F64A 2UW5A 4OTPA 3BGPA 4LRKA 1YKRA 5DNRA 3ERKA 4H58A 1OIQA 4WT6A 5FTOA 4JAIA 4NUSA 4QQCA 3DFCB 3BYVA 5DEYA 3QD3A 4EH6A 2CKOA 4O86A 5HVYA 2UW9A 2GTNA 3GU7A 5LMKA 5FEQA 4IHPA 4D28A 1XH5A 2O3PA 4QYHA 3HL7A 3VQHA 3VONA 2C47A 2VWUA 3FLSA 3I7BA 2F2CB 2P55A 3MJ1A 3A99A 4ZTRA 5BQ0A 5IH6A 3M1SA 3QAME 2C5VA 1XH7A 3CS9A 5BYZA 1JNKA 5IISA 4KBAA 4BBMA 2X2KA 1XHAA 3BBTB 5IA0A 4Y83A 5C26A 2OWBA 4DEBA 2A27A 2VAGA 4GUBA 4D2RA 2BRMA 4LI5A 3FE3A 4XRLA 3D83A 3QC9A 4AZVA 4IJPA 1MP8A 4KWPA 4LGHA 4YC6A 4F1MA 5CSPA 3KMMA 5GJFA 2VU3A 3WILA 3I4BA 4BI1A 4AXEA 1YHSA 3QALE 3O50A 2YM5A 3MI9A 3C0HA 3QBNA 3V8MA 3F3UA 1R78A 3SKCA 4AX8A 2QURA 4LGGA 4PNIA 3WI6A 4BCJA 4X2FA 2ZV7A 4JRVA 3MPTA 4MF1A 4DCAA 3PXRA 1K9AA 2QV7A 3FMKA 3PO8A 3GFEA 3DT1A 5CF6A 4FTQA 2R3FA 4IAYA 4C2WA 3KF4A 3ANQA 4FVQA 3RNIA 5I9XA 5BPYA 2IPXA 3GC9A 4OLIA 3F61A 2VO7A 4U79A 1PXKA 3UOJA 3UMZA 4DY6A 1BL7A 4BTJA 4HVSA 3AD5A 2QG7A 2Q0NA 4M3QA 4AXDA 4YR8A 1Q8UA 3S2PA 4ZZMA 4AAAA 2KB3A 5JEJA 1LGPA 5BMMA 1E1XA 3MS9A 2KKLA 3GBZA 3HMNA 5AIKA 1H1WA 2QU5A 3POOA 2WMTA 1MUOA 3EMGA 1G88A 2IZTA 3QHRA 1ZYCA 1MJSA 3LVPA 3H4JA 5F20A 4ZSLA 5AUZA 3Q9XA 3ZMMA 3ZRLA 3FMHA 1ZYDA 4D1ZA 5E50A 3R1YA 4RC2A 3LFAA 3A4PA 2O0UA 3UQGA 4GT5A 3VN9A 3MY1A 4AG8A 1YW2A 3BLRA 4DHJA 3C50A 4HVIA 2I2CA 4LOQA 2VX0A 3E3PA 2GPHA 4X3JA 4G3EA 4MQ2A 3DLZA 5CS6A 3RAWA 2ETKA 4WNKA 4EYJA 4PL5A 4EZ7A 5JSMA 4EOQA 5KKRB 2BDWA 3KK8A 3HDMA 3Q2JA 1OECA 3QZFA 3Q4ZA 5L4QA 4JG7A 2PU8A 1J7LA 4YZMA 2WEIA 3CQEA 3GCSA 3HX1A 5H3QA 5CU6A 5JFWA 4LM5A 3LMGA 4Z55A 5BVFA 5CSHA 1J4LA 4LOPA 3C51A 3C0GA 4NM3A 5KHWA 2QCSA 4F63A 4CV9A 2LGCA 2B9IA 3EQHA 4U7ZA 2X8IA 3EQRA 4MNFA 4D5KA 1FHRA 4FKGA 4NKSA 5GZ8A 3PVGA 2BRNA 4AOIA 4RSSA 4ZY5A 3DSHA 1SZMA 1KHXA 3DKOA 3JR1A 3PRIA 3UPZA 2PZYA 5DH3A 4R5YA 3W10A 4MXOA 5K5NA 1M14A 4FTRA 5EKOA 3ORMA 1JOWB 5CU3A 2V5QA 5CEPA 2A0CX 4DH7A 4GJ2A 3ZM4A 3IECA 4RMZA 4EYMA 4N0SA 3W16A 2OG8A 4F08A 5FTQA 4X21A 5M55A 3VZDA 4XBRA 4DDGA 4FZFB 3HKOA 3MVJA 5ANKA 5HO7A 2XKDA 3PUFC 3RZBA 1U5RA 1QCFA 3FI8A 4WNMA 2F7ZE 3S0OA 3PA3A 2BILB 4G5JA 1GZNA 4C4GA 4D4YA 3AFOA 3ZEPA 3DZOA 2OH4A 1DM2A 3ULIA 2XEYA 5J9ZA 4O38A 5AAEA 3K5UA 3AMAA 5JEMA 1MZKA 2JKKA 3BGZA 4GFGA 4IX5A 3SAYA 5L2IA 3LM0A 1TVOA 1PMUA 4C4IA 1XJDA 3BHHA 4F0IA 2LC1A 3LFEA 4NFMA 1K3AA 1R0PA 4N6YA 1WVXA 5J87A 3IPHA 4IFGA 4U80A 3V6SA 4J53A 3OUKA 3SX9A 2OU7A 2CDZA 1FGKA 2C6LA 2FSMX 5CZIA 3HX4A 5CSVA 4PMTA 3O5AA 3BLQA 3NAXA 4FSNA 3TV4A 2R0UA 2X9EA 4FR4A 2JDOA 4IJ9A 1REKA 2XNEA 3NNVA 2AUHA 4YO4A 1YXUA 4NTTA 1J4QA 4RWIA 3SQQA 3RKBA 4UALA 4L9IA 3HDNA 4KIOA 3W55A 2BALA 5LWMA 3M42A 1WVWA 4O0XA 4PDOA 2J0JA 4IC8A 3HAVA 4V04A 4JR7A 2CSNA 3K5VA 4KAOA 3CJGA 3VPYA 5JRQA 3HRFA 4GVJA 2GQSA 4L3LA 4CMTA 4NK9A 4NFNA 4BC6A 2YM8A 3N4UA 2YLEA 5T68A 3V04A 1SVEA 4CRLA 3DPKA 2RG6A 1PKGA 3QTRA 4AXAA 2Y7JA 1ZY5A 4FF8A 4B7TA 2CN8A 3F66A 2GSFA 4EUUA 5EH0A 5GNKA 3OF0A 2ITVA 4N6ZA 4EONA 3S40A 4OTHA 2IO6A 2XNGA 2XVDA 3RP9A 5JN2A 4F7JA 3DBEA 2QO7A 2Z7LA 3F3WA 4NJ3A 5BVOA 2GNFA 4FKQA 4BYIA 2JBOA 5AJQA 4S34A 5F1ZA 4CT2A 4F7SA 3PJ1A 4BCFA 2J0LA 5A9UA 5JERA 2NO3A 5IA1A 2UVYA 3I0OA 3UIXA 3I0QA 2XIZA 3FI3A 4FV2A 2OJIA 2WMBA 2YABA 4XX9A 1U7VA 1UVRA 5JRSA 1KWPA 3W0OA 3OT3A 3QTWA 3WF9A 3UIUA 5LVNA 3MA6A 3A4OX 2BFYA 2OICA 3R7VA 2UZNA 4J1RA 3LQ5A 4R7IA 4A7CA 4BWXA 4ENXA 4MQ1A 2JIUA 1ZARA 2J6MA 2GNGA 4RFMA 4FV6A 2QOIA 5AV3A 5FRIA 2XEZA 3A62A 5AP4A 3RPYA 2O2UA 2WTCA 1Z9XA 5CALA 2VO6A 3FZ1A 2FA2A 3AQVA 3UP2A 4FKTA 4MVFA 1KE8A 5HBEA 2R3MA 3MPMA 5DR9A 5J9YA 3QQJA 3BLAA 2O8YA 2ZDUA 1W84A 4XG4A 5J95A 3LZBA 3NZ0A 4FSYA 4I3ZA 4IC7A 3SXRA 5KBQA 5IQFA 5CNOA 1NW1A 2BDJA 5D11A 3P5JC 1IG1A 3IW6A 2VTHA 2XMYA 3P0MA 1U7VB 1F3MC 3MGYA 4DEEA 4R3RA 4GK3A 5GJDA 3PFQA 4AE6A 4FMQA 1IAHA 3KXXA 3R9HA 5JT2A 1H25A 3ELSA 5I3RA 4QMLA 2NPQA 4ZZNA 2X8EA 2UVZA 5DHPA 4XMOA 1QPEA 3VW6A 5CU2A 4CXAA 2BUJA 3HV4A 2EXCX 3OXIA 4U3YA 3SRVA 4XLVA 3LFFA 2I2DA 4CG8A 3TT0A 4GVAA 3KMWA 4L52A 4ASEA 3TYKA 4PL3A 3SXSA 2DQ7X 5CT7A 3RBWA 4RX9A 3SHEA 4I6LA 2NP8A 4IVDA 3VF8A 4C36A 4FYNA 3RHXA 4I0RA 3RHKA 1R21A 4O83A 4O7RA 4NWMA 1HOWA 3Q2MA 4IB5A 1UKIA 1TFFA 1VYWA 2WIHA 2CNVA 3R1SA 2W9ZB 2YCFA 3BU5A 2F2UA 3NYOA 4IM2A 5DT0A 4DFUA 4DGOA 5EM8A 5EOLA 2GDOA 2VTLA 1XWSA 4IX4A 2R3IA 1ZOGA 3ZBFA 4BICA 2YZLA 5A4LA 4BF2A 2ITNA 5HVKA 3TUDA 4DFLA 2A19B 4EH5A 2UZUE 4HGTA 4O2PA 5LOHA 3D7ZA 4G3GA 3QRUA 4HJOA 3SDJA 3U9CA 3QRTA 4FEVA 2AYPA 2W17A 3HGKA 5BV3A 2H6DA 2XH5A 4FUXA 3FYJX 3ZEWA 2CN5A 3D2KA 5AIRA 3DTWA 4N4SA 2BZKB 1XKKA 4OBOA 1TKIA 4ITJA 3C4CA 3LFBA 1NVQA 2CCHA 1BI8A 4E20A 3IGOA 3DDQA 4AXCA 2C3KA 3KB7A 2PVJA 1PXJA 1P5EA 4GT3A 2B7AA 3RI1A 5HG8A 2R3JA 4CEGA 5BVEA 1OKYA 5IQBA 3ZSIA 5ANEA 1GIJA 3FMDA 4FI1A 4WA9A 1O6KA 4HZRA 1OGYA 2WTJA 5IEYA 2A1AB 2IVUA 1UU9A 4JI9A 3KL8A 3UOKA 3UVRA 3WZUA 4FL3A 3LPBA 2I2FA 2XARA 5IA4A 3NUAA 4TW9A 4MXZA 2PIEA 3E8NA 3VVHA 3LQ3A 4DBXA 3NRMA 3CBLA 2XRWA 1XQZA 3T3VA 4ORKA 5ACKA 4ZZOA 4XV2A 2WAJA 3OCTA 4G16A 2PULA 4CQGA 2Z7SA 1FVTA 5DE2A 4D1SA 1K3JA 3HP2A 5LWNA 2CSWA 3OMVA 3Q53A 4TXCA 3QWKA 4WUAA 1R0EA 4FTIA 1KSWA 4XNEA 3FZPA 4R9PA 5HIBA 2YCQA 3E88A 4D9TA 5EYCA 3ODYX 1GNGA 4CKIA 3TDWA 2YFXA 5CAOA 3AGLA 5IDNA 4I6FA 3KT9A 3QKMA 4QMZA 5A14A 5EJHA 1WBTA 2YDJA 4C61A 1E9HA 2JDRA 2OJGA 3EIDA 3O96A 4GMYA 3PY1A 4YTIA 2V0DA 4QMXA 1I09A 3BELA 1UU3A 5KZIA 4F9WA 4JT3A 2C1BA 2BKKA 5M4CA 3R1QA 3ZUTA 3BZ3A 3JY0A 4HYSA 2OIBA 5FDPA 1LGQA 4HGLA 4U8ZA 5HVJA 4AW0A 1OL6A 1WBOA 5AAFA 4F0FA 4PMPA 4FKPA 3TTJA 5AUTA 4FKRA 5I5ZA 2B9FA 4F9CA 4C4EA 5HIEA 2VTJA 3HNGA 2UW4A 3DTCA 5D1JA 5D41A 3UQFA 1R39A 3E62A 5DHTA 4KS8A 3UZPA 3FM8A 4A9SA 1ND4A 5E8UA 4D1XA 2J0KA 3DJ5A 4EK8A 1UNGA 2IG7A 1M7NA 3ZLSA 1ERKA 2XBAA 4LMNA