3I6WA

Structure and activation mechanism of the chk2 dna-damage checkpoint kinase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
410
structure length
369
Chain Sequence
PWARLWALQDGFANLECVNDNYWFGRDKSCEYCFDEPLLKRTDKYRTYSKKHFRIFREVGPKNSYIAYIEDHSGNGTFVNTELVGKGKRRPLNNNSEIALSLSRNKVFVFFDLTVDDQSVYPKALRDEYIMSKTLGEVKLAFERKTCKKVAIRIISKLNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFPTYLAPEVLVAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase Chk2
publication title Structure and activation mechanism of the CHK2 DNA damage checkpoint kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 103
structure length 369
sequence length 410
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00498 FHA FHA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3i6wA03
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 3i6wA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3i6wA02
2QHNA 1GZOA 2WEVA 2WMAA 5FXRA 2GNFA 1M14A 3U6JA 3G15A 2OJJA 4USDA 4L9IA 4BDKA 2UZDA 4B99A 4IEBA 4FKOA 2BZKB 3COIA 3RTPA 1BI8A 2BHEA 3IW7A 3JPVA 4HZRA 4ZY6A 3U4UA 4NJDA 4MXYA 3W55A 2BTSA 3HNGA 3L8XA 5AIRA 4FR4A 2GTMA 3DTWA 4I0RA 4FI1A 5FM3A 3UOKA 4AGDA 4CFXA 4GS6A 4O7WA 5KBQA 5EFQA 3EFKA 4M12A 3RPRA 4XV3A 4KUJA 4BY9E 5HE3A 3R2BA 3C5IA 4O7SA 3Q4TA 2JDRA 4UN0C 4Y5HA 4M8TA 4MNEA 3PWDA 3RK9A 4A07A 2C6KA 3TIYA 2J0KA 3IPHA 3BYOA 3MFTA 3DCVA 2BAJA 3KRRA 3UODA 2NP8A 4GU6A 4Q9SA 4HPUE 3R8LA 2REIA 5F4NA 4ORKA 2WNTA 4J98A 5FWKK 5I9UA 2FSLX 4DEDA 3JYAA 5M4FA 4JQ7A 3C0HA 3DPKA 3RBWA 4J95A 4C3RA 3BEAA 5TOZA 3NW6A 4EK5A 4ANSA 1MUOA 3HAMA 4RLKA 3PG1A 4S30A 4GFMA 3FMDA 2BAQA 4XP0A 3EKKA 4MBIA 5HTBA 2I0YA 2BIYA 2AUHA 4RA5A 5JZJA 5E8UA 3BKBA 3NRMA 5HVYA 3BI6A 3VUHA 3VUIA 2W05A 5E8WA 1ZMUA 3JVSA 3F5UA 3QYWA 4L01A 4ARKA 2WTCA 4BVUA 3H30A 3L8PA 1JQHA 2B52A 1WLNA 1OI9A 4BI2A 3WZKA 4IQ6A 4QMYA 3PY1A 3R9RA 3NYXA 3BLHA 4CCBA 3F88A 5IG1A 2Q0NA 4DFNA 4BDGA 4GV1A 2VU3A 2J5FA 3LQ5A 3LHJA 3OBJA 5CU2A 1GIJA 3ZBXA 4U8ZA 4EBVA 1VZOA 3ALNA 5D7AA 4BBFA 3QZHA 3UMXA 2NRYA 4A9TA 3QTWA 2E9NA 4R77A 3DFCB 3O71A 4GCJA 2BUJA 2X8DA 5FLFA 3MVHA 2ITWA 4DYMA 3EN7A 2C6MA 4K0YA 4NKAA 4U0IA 4FOBA 1G6GA 4EQUA 5A54A 4MAOA 3G9NA 4DN5A 4EHGA 1JKLA 3UPXA 3MDBA 2BALA 4FV9A 1UA2A 1O9UA 2UW5A 3PZEA 1H25A 3CR0A 3RPOA 4GYIA 4WUAA 4CZUA 5D11A 3LCOA 5KMIA 1PW2A 1Y8GA 1RW8A 3PSBA 1NY3A 4GK2A 2VTIA 2R3FA 4ZTSA 5AV1A 4OTHA 4DGLC 3SA0A 2RFEA 4I21A 5FP6A 4AW2A 3EQGA 3R01A 3PWYA 4QP7A 2CGWA 4D4YA 3A8WA 3BHUA 3QTRA 4FVPA 3U9CA 3GU7A 2E9UA 2C3KA 3I6UA 3KMMA 3FZTA 3HV6A 3BBWA 5K0KA 2WTWA 3G90X 3NX8A 3OXIA 4IWOA 4JBOA 3ZHPC 2ITYA 3LMIA 3VS4A 2OF4A 3RAKA 2X0GA 2QU6A 3A61A 5FD2A 4AFEA 2JDVA 1A48A 3H9FA 4DFBA 4OBPA 3VA4A 3HMIA 2A4LA 4JDHA 4WG5A 3Q6WA 2VWVA 2VWXA 2X6EA 1MRUA 1ZY5A 3ZC6A 1W8CA 4OTDA 4G5PA 3HL7A 5M57A 1GZKA 4BGQA 3ATSA 2UZTA 3C4ZA 2QO7A 3TDVA 3QZFA 2JD5A 3HKOA 4IZYA 5A8IA 2GMXA 4YJUA 1PYEA 2RG6A 4FL3A 3R8UA 2XNBA 1JSTA 3LMGA 4OTQA 1CKPA 1O6KA 4ZTRA 3U51A 3O23A 2YIRA 3ZEWA 5LQFA 3KQ7A 4L52A 5CTPA 3NVKI 3HMNA 4QYEA 4RJ4A 1W7HA 2J5EA 3VS0A 2AYPA 5AAFA 4AS0A 4F9BA 1PHKA 4IZAA 2W96B 4S2ZA 4C58A 3TL8A 2XRUA 4H3BA 2W17A 4KAOA 2BDWA 4G6LA 4U9AA 4OW8A 4M0YA 2VTHA 1DI8A 4D0WA 2YCFA 2C6IA 2FGIA 3JS2A 2X7GA 3M42A 4ZMEA 4K1BA 1YDSE 4ZXTA 3DQWA 3TKIA 2QHMA 4X6RA 4Z7HA 2VO7A 4O1OA 3ID6C 1K9AA 3W2QA 5AJQA 1P4OA 4O0UA 2Z2WA 2Z7LA 3POAA 3OTVA 4HPTE 3SVVA 5A6OA 4KIQA 4YU2A 4D1ZA 4W4XA 4DGMA 1Y91A 3P7AA 3FXZA 1KOBA 4XG9A 3K5VA 5IEYA 3ALOA 3UJGA 2VRXA 3V8TA 5AR4A 3IW8A 4JDJA 3GXLA 5HVJA 1IAJA 3DXQA 3NLBA 4FYOA 3MPTA 2C5NA 3PZHA 3HYHA 5DEYA 3L8SA 3VW6A 2PVRA 4FG8A 3ODYX 5IA2A 4UBAA 4QPSA 5GNKA 5LMKA 3UYSA 4J97A 3F5XA 2VO0A 3ZONA 1H00A 3EQPA 4FKWA 4PRJA 3FI2A 5CU6A 4DT9A 3FYKX 4XJ0A 4HYUA 4TYGA 5AMNA 4YJPA 3S95A 5JQ8A 4ITHA 3DJ6A 2VX1A 3TJDA 3PLSA 2VN9A 4BDBA 5DYJA 3NUSA 3GU8A 3GENA 4WNMA 1OPKA 2PVNA 4ANNA 2QG5A 4M15A 3EH9A 1CDKA 2C6EA 3RHXA 5IQAA 3GC9A 3C50A 2VTTA 4IVCA 2JLDA 2PVFA 2PMLX 3QF9A 3Q32A 4IE9A 4ANBA 1UU7A 1T46A 2DUVA 2PE1A 3OMVA 4NUSA 5A4TA 5D9HA 1WV3A 1PMNA 4CT1A 3DKCA 4O83A 3FUPA 2YACA 2C6LA 1ZOGA 5EH0A 4EK6A 1JLUE 3UZTA 4CFUA 1UU3A 4IM3A 4XEYA 4O7YA 4YZMA 3ZCLA 3EQFA 4YJSA 1RJBA 1R39A 2FUMA 2GDOA 2P2HA 2GHMA 2O63A 4M84A 2W4JA 2XK9A 1JBPE 4QQCA 5KMLA 5L8LA 1VEBA 2XNMA 3ZS5A 3GCQA 2C4GA 3T3VA 4AP7A 2O3PA 3AXWA 5ETIA 4DH1A 3W2RA 3ZLSA 1FQ1B 3HAVA 4MBJA 4QD6A 3ULZA 1R21A 2CGXA 4MYGA 3VF9A 4PDPA 4F7JA 3F9NA 3SXRA 5CF5A 3WZJA 3ZUUA 3DKGA 3R7YA 1FMOE 1YHWA 3B2WA 3Q9YA 4YHTA 5JH6A 5CSXA 2YM3A 3AC1A 4EQCA 2R3OA 1Q3DA 1IR3A 3M2WA 4RJ3A 5ANKA 1PXIA 3NYNA 4CKJA 3CY3A 3VS1A 4HVHA 3UQFA 1UHTA 2PWLA 4C4EA 2UZWE 3UG2A 1ZYDA 4UV0A 3QUEA 2WTIA 5JN2A 5KX8A 3G0FA 3F5PA 1GAGA 2ACXA 4G16A 3BE2A 5CWZA 3I0OA 5CU4A 4CXAA 4FA2A 1STCE 4M66A 4QTAA 2JDSA 1OKWA 4UMTA 4QP6A 1REJA 5IQFA 2VO3A 1URWA 1KSWA 2WPAA 3PE2A 2VO6A 4I94A 4NSTA 4V0GB 5E8SA 3ZLYA 3LFBA 3LW0A 4YGAA 4C0TA 2E9VA 5HG8A 1ZYLA 4O7ZA 4JG8A 3ZM9A 4EOQA 3QWKA 4O7VA 3Q6UA 4FTNA 3EKNA 2WMQA 1OVEA 2CPKE 2VD5A 3IS5A 3OZ6A 2XKFA 4R7HA 2XKDA 4U7ZA 2C0IA 2JEDA 3ZEPA 4BTJA 3AC3A 3H3CA 3RMFA 3LFAA 3PXYA 5HVKA 3NUPA 1P14A 4EH9A 4XOZA 3CSVA 3PPJA 4C3PA 3ETAA 2CCIA 2C69A 5M09A 1SVEA 5AP6A 3Q4ZA 3W8LA 3DBCA 4YSJA 2R3PA 3ZFMA 4E26A 3D5VA 2JC6A 4FZAB 3KXHA 4R7IA 4TY1A 3KULB 3PY0A 1WVYA 4TT7A 4KNBA 3CD3A 2OJGA 4IWPA 4CFFA 5E50A 2IPXA 4IDVA 2PE0A 1OL5A 4Y85A 3VIDA 1FGIA 4XP2A 3UV0A 1YHSA 4D2SA 1OUKA 3E93A 2YIYA 5CF4A 4AZEA 2QOOA 4FTTA 5IEVA 3DV3A 4S33A 5HE1A 5IQBA 4YJRA 4D58A 3UNKA 2F57A 2E2BA 2YM5A 4YZCA 5ACKA 3SD0A 2IZTA 4DFZE 4HZSA 5AR5A 2RIOA 4C4FA 2BMCA 5AUWA 1MRVA 4XS2A 2YAAA 4FKUA 3RNYA 4BZDA 4D28A 3QU0A 3FHIA 4QYFA 2GU8A 5F94A 4KKHA 4HYIA 5F20A 4BDDA 4ZY5A 2QCSA 1U4DA 4FV0A 3OWPA 2UW9A 2LAVA 4R6VA 3FI8A 4Q5HA 1LGPA 4O96A 5LMAA 3E3PA 4R1VA 3PFQA 4QP2A 2F7ZE 3PXKA 4X7QA 5AFVA 4EH4A 4YHFA 4DFUA 4RJ5A 5B2LA 4LG4A 2WFYA 3KRXA 4EHZA 1M7QA 2YABA 3DOGA 4RBLA 5AV0A 2CDZA 3QZGA 3KCFA 3C4WA 3VRZA 3W18A 3FMHA 4FF8A 4EHVA 3DLSA 2PL0A 4IFGA 4RX9A 5CQUA 1FMKA 3SW4A 3W10A 4AX8A 2XCHA 4DG3E 1J4KA 3TNIA 2XYNA 3UZPA 3A99A 3C4XA 3ROYA 5E8TA 2C68A 2ZM4A 4QMTA 4YLKA 2G2HA 2R0UA 1OBDA 5DR6A 4XBUA 4ENXA 4EJQA 3KMUA 3L9NA 4NM0A 3VO3A 3DA6A 4ACGA 3MWUA 2HZ4A 2ZAZA 4O91A 4XG3A 5CXHA 2C47A 5CAVA 3UQCA 3GQIA 1J1CA 4BZOA 4ANMA 4FEWA 3W2OA 4JG7A 1U46A 3UVRA 3TI1A 5AAGA 2PUUA 5EHLA 3PYYA 3D83A 2PPQA 4QMQA 4F9CA 3LCSA 1VJYA 3NPCA 5HCXA 4BCHA 4QMOA 1PXMA 3EB0A 3TNQB 3V6RA 4ZIMA 2BKZA 3I7CA 3NNVA 1Z9XA 2GTNA 4BBEA 3ELSA 3CCNA 3NWWA 4XLVA 3Q9WA 3MIYA 3I0MA 4DGOA 3JVRA 4Q5EA 4DEIA 2CGVA 3S3IA 3LMHA 4OT6A 3TNHA 4ANLA 3DXNA 4J53A 3QTUA 3N4TA 2UW0A 2QD9A 5G1XA 5DWRA 4DA5A 2Z7SA 3O8PA 3HGKA 3IDCA 2PMOX 3OXTA 3Q60A 4FVRA 3ZZWA 5HTCA 4LV5A 1IASA 4O0RA 4DEEA 1J1BA 4I5HA 2HZ0A 5FXSA 4ANOA 3E5AA 3RCDA 2G15A 1XH8A 3EZVA 3R7UA 2IZSA 1NVQA 4DITA 2ZV2A 4FV2A 5J9LA 4XG2A 3ZO1A 3PXQA 1FHRA 4KRCA 2YZLA 4GJ3A 4EOMA 4HVSA 1QPEA 1JNKA 4LMUA 5GIOE 2OI4X 1YKRA 3AGLA 3DQXA 3Q52A 5TKDA 5ANEA 3PJ1A 2BRBA 3IDBA 1WCCA 4YPSA 5C9CA 3TZMA 4AOIA 2QOFA 1MRYA 3HRCA 4F0GA 4K6ZA 2R4BA 3QD3A 4NTSA 1ZMWA 3R71A 4L68A 3PA3A 4A4OA 5BUJA 1MZKA 2VTQA 3O51A 4F4PA 2W1CA 2R3RA 2QOLA 2CN8A 3D4QA 4X3FA 2XJ0A 2PUPA 3WZDA 3W1FA 4D4VA 2HELA 3IOPA 1OL7A 2J9MA 3TUDA 4J1RA 4FK3A 3EFJA 4WSQA 3LFNA 4LRJA 1R0PA 2GFSA 4PNIA 1M2PA 2OKRA 5HO6A 2QLUA 4EH7A 4HYSA 4JAIA 1H1QA 2V0DA 1H26A 3BU5A 3FWQA 5EM7A 3ORKA 2XM8A 4BDFA 5EOBA 3KRWA 1KE9A 4F9AA 3W2SA 4AAAA 3IKAA 4D5HA 3QTQA 1QL6A 2OZAB 4X21A 4IW0A 3UVQA 5C8KA 5LVPA 5IPJA 3QQLA 4UWYA 3V3VA 4GK4A 2XIKA 1PRYA 3DFAA 3MVMA 2I7QA 3PXRA 2ITUA 2YDKA 3QUPA 3HDMA 5AP5A 4XBRA 3D7TA 4NFMA 3MH0A 4NM5A 5HHWA 4HYHA 3PVWA 1R1WA 3P1AA 3NUNA 4FKJA 4XOYA 4OTRA 5IMXA 4FZFB 1KE8A 2F9GA 4Y95A 3OCSA 4U81A 4PV0A 3WE4A 5DLSA 1HOWA 3DNEA 1OIRA 3V5TA 4DTAA 3OOMA 4ZLZA 4QMSA 2OJFE 4RWIA 3NNXA 4HGEA 4FG7A 4PDOA 4TWCA 3DZQA 2GHGA 4WO5A 5M44A 1SVHA 3AC5A 4FIEA 4PUZA 2WQNA 3TCPA 3MFUA 3BIZA 5E1SA 3FI4A 3PY3A 5EM5A 3G6HA 4R3PA 3KC3A 3PA4A 3H0ZA 5CAUA 4E4MA 4NW6A 4X3JA 5CSHA 3GOKA 3SW7A 5EYCA 3MBLA 4QQTA 4XV9A 4ACMA 4EEVA 4O7NA 1J3HA 4A9RA 4AGUA 2WTJA 3SOAA 4E6AA 3L9PA 4F1MA 1OPJA 2FSMX 5LWMA 3A62A 3Q9XA 2ZV7A 3VA1A 1OKZA 1YVJA 4M3QA 3CKXA 1B6CB 2QOKA 4IAYA 4NCTA 1UWJA 1TQIA 2F7XE 5J5TA 4FNWA 3QQKA 5CQWA 5BNJA 2JBPA 2X4ZA 2VX0A 3FL4A 4GG5A 4L7SA 5EI6A 4RJ8A 5C1QB 2HXLA 4C3FA 3FJQE 3HA8A 3F2NA 1OIQA 3GOPA 4B8MA 4JJRA 4PDYA 5E8XA 2GCDA 4OAUC 3BCEA 4FSTA 1YDRE 3FQHA 3AC4A 4U44A 4GYGA 1CMKE 5J79A 4IAKA 5CEMA 4AZVA 2IG7A 4R8QA 4EUTA 1VYWA 1YRPA 4FZ6A 3H4JA 4C4IA 2FA2A 4R78A 3VNTA 3WI6A 2Y4PA 4I0TA 3VUMA 3NR9A 2VWYA 5B0XA 3HA6A 4XLIA 3LZBA 5M4IA 4CYJA 4BI1A 3HRBA 4F63A 4L43A 4UMRA 4RX5A 1LR4A 5A14A 4KINA 4C62A 4X3FB 4ZOGA 3AD6A 4AXAA 4RWLA 2WXVA 3GCUA 3NIZA 4FZDB 4ZK5A 4FTAA 3VWAA 1PMVA 3SHEA 2OW3A 4FKGA 5HI2A 5K3YA 3QD4A 4WSYA 2OO8X 3LXKA 4C57A 4D9TA 5D12A 1GJOA 4DH8A 5LMKC 4ZMFA 3BHYA 4AN2A 4S34A 3GC0A 4U3YA 4EH5A 3UE4A 1L3RE 1A9UA 2PE2A 2OWBA 3HUEA 2NPQA 4YZNA 5IA5A 5KUPA 2ZM3A 4OLIA 4RA4A 4DEAA 4F7SA 3G5DA 2W5HA 4XMOA 4DH5A 5J1VA 4ZTHA 4CFVA 2HOGA 3QX4A 3H9RA 1P2AA 4KB8A 4RIWB 5HG7A 2ZYBA 3HMMA 4N70A 2GFCA 1MQBA 5CANA 2QOIA 1APME 3OTUA 4MTAA 3D5UA 4RZVA 4E5BA 5CALA 2W99B 2XIRA 2QOHA 2R3LA 4IJPA 4R5YA 4OTPA 2PULA 2PYWA 1K3QA 1UVRA 4BTKA 5KMOA 2HZNA 4EK8A 4D9UA 4ZZMA 4E4LA 4FSNA 2F2CB 2GNJA 1XJDA 3WILA 5IH6A 2PVKA 5HCZA 1KV2A 4AT4A 4IFCA 3AGMA 2ONLA 2P3GX 4EYJA 2BCJA 5AP7A 4S32A 3LE6A 3MW1A 1QCFA 2R3QA 3RAHA 2CCHA 3LXPA 2AC5A 3EQBA 1F0QA 2Z7RA 4IC8A 3H10A 4J7BA 2ZB1A 3IGGA 5LCKA 3L8VA 5AIKA 4MXOA 5L6PA 4TL0A 2GHLA 4J96A 3S2PA 2CKEA 4J71A 5KHXA 2V62A 4EJ7A 1JPAA 2OU7A 3VQUA 4FSWA 4PNKA 5I9XA 1Q41A 3RJCA 2BROA 3FHRA 4LFIA 1FINA 4AE6A 1RE8A 4RIOA 4UYAA 1GIHA 1HCKA 2ETKA 5T6KA 4FKTA 2RG5A 2YWVA 5HIBA 5GINE 2R64A 4KBCA 3AT4A 4GJ2A 4L46A 1KE7A 3DJ5A 3SG8A 3T9IA 2CKPA 5GJGA 3RK7A 2ITZA 2RFSA 4I92A 5HU9A 5I5ZA 3BU3A 4D2RA 1AD5A 4R7BA 5FBNC 5H8BA 1TKIA 3MN3A 4ACDA 3HECA 5L2IA 2C0OA 4YR8A 3ZFXA 2NO3A 1V0PA 1QU5A 2G2FA 3GC7A 3VUDA 4RIYB 4F6UA 3SOCA 4IDTA 1M7NA 3P7CA 4AWIA 5FTGA 2C6TA 1ZYJA 3WOWA 3C7QA 4WT6A 4D2TA 2HW7A 1IAHA 1OKYA 2QQ7A 3QRTA 5EW3A 4H87A 4CMOA 3GCSA 2R3KA 3WF9A 2XKEA 4M0ZA 2XNEA 2XUUA 4H39A 3V8SA 3V04A 4C2WA 1ZLTA 4FKIA 4QTDA 3PUPA 4G1WA 4PY1A 2P55A 4OUCA 5L6WL 3UOTA 5IDPA 2PZYA 3ORZA 4FV7A 3CC6A 5IKWA 2HWOA 4EC9A 4GT4A 5KHWA 3I6WA 4C59A 3PPKA 3FC1X 5B2KA 2J90A 1ZOEA 1DI9A 2YDJA 4HVDA 2QOQA 3GCVA 4BZNA 4WBBB 3EWHA 3SAYA 1PMEA 2J7TA 4G34A 3MH1A 4BDAA 3AT2A 5HE2A 2R2PA 3DB6A 5CEKA 5IDNA 5IISA 5C4LA 3U87A 3LFQA 4O27B 2EXMA 3MPMA 2R3JA 4AA4A 3A7HA 3OEZA 2A2AA 3OWKA 2J0IA 3FMEA 3FMMA 3OUNB 3P4KA 4DF3A 3K54A 3LFSA 3C4CA 4NZWB 4OTIA 4IWQA 3TEIA 3WARA 4EH3A 2PVMA 4MHAA 3JUHA 4N6YA 1H1SA 2W06A 2OK1A 3MA3A 4BCMA 1XBAA 4ID7A 1LP4A 3AQVA 2KFUA 2X7OA 3DU8A 4RRVA 4IZ5A 3VN9A 4AA5A 5K0XA 4RG0A 5LVNA 3RGFA 3ODZX 3QGYA 4H1MA 4RX8A 4O0XA 1WFCA 4PPCA 3KVXA 5HOAA 3E7VA 4OTWA 1JWHA 3M11A 2VTOA 5CX9A 2B9IA 2V7AA 4IANA 1KE5A 3TIZA 4NM3A 4WHZA 2JKMA 5KCVA 2UZNA 2PZ5A 4I5MA 4K2RA 4BCQA 2YM8A 4PPBA 2V22A 4PTGA 4QT1A 3E7OA 4APPA 3R1YA 1G8SA 1F3MC 4BB4A 2VTAA 4O1PA 3QC4A 2XZSA 4MVFA 1F5QA 5JKGA 4QCJA 3BHTA 1FVVA 4QP9A 4GMYA 4D9VA 1G8AA 3HV4A 1PXOA 2WOUA 2G2IA 3UOJA 4K8AA 2YIXA 4FV1A 3ENHA 3EQCA 5FDPA 3F6XA 3CE3A 5DRDA 4AN3A 1BX6A 2CLXA 3RAIA 3FMKA 3RK5A 3VS2A 3LLTA 4EOIA 3VVHA 2ZDTA 3VUGA 4EOPA 4I22A 3CLYA 4G31A 5IQEA 3CP9A 5ANDA 4A9YA 1H0WA 3FC2A 4IVDA 3OBGA 3MJ2A 5KKRB 4PDSA 5AR8A 4YZBA 2UZEA 4G2SA 4F0IA 4BKYA 1K3AA 3C0GA 5L3AA 1SNXA 4M67A 4KA3A 5AUXA 5L8JA 3ZM4A 4CV8A 1TQPA 3EN9A 3DNDA 3W33A 2X9EA 2JDOA 2PSQA 4M68A 2OZOA 1Y6AA 2UW3A 2VZ6A 3QQJA 4M97A 3OROA 3LIJA 3R8VA 4ACCA 3FAAA 3BYMA 3CBLA 4O6LA 3R21A 4AG8A 3O7LD 4PL5A 4KKEA 1BLXA 3NUYA 5HEZA 1YXUA 4FTKA 4U5JA 5DT4A 2RL5A 4H05A 4LGHA 5HE0A 4LYNA 2ERKA 4QMWA 3MH2A 3C9WA 4MD7E 5K5NA 4GT3A 1PY5A 3RCJA 3RAWA 2W1EA 1R3CA 3SRVA 4YMJA 5AP2A 2CNUA 3ANQA 1OECA 4IB5A 3OT3A 3HRFA 2WTKB 4AW1A 3MB7A 3PO8A 2F2UA 5HNIX 4JQ8A 2YISA 3KKVA 5LJJA 3OUKA 2UZBA 3ZDIA 5E8YA 4IACA 3ZTXA 5FEEA 3R1QA 3KEXA 4Z55A 1XKKA 1OGUA 3ZXTA 3UNJA 4MNEB 3ORPA 4EBWA 5BVDA 4WA9A 5LOHA 3SDJA 1QMZA 1LUFA 3F3UA 1KOAA 1J4QA 3LLAA 4UALA 4O2PA 2JFMA 3NW5A 5ETFA 3PP0A 4AQCA 5IQHA 5J9YA 4L3PA 4X3FC 3PJCA 2CHLA 2XIZA 4F9WA 2ITNA 4FGBA 3VHKA 4USFA 4FT5A 3GU5A 3TXOA 1BL6A 5JK3A 4O7LA 4FSRA 3BYUA 2UZVA 5CSWA 4QYYA 5FXQA 4O84A 2HENA 3MY1A 5HCYA 2W1FA 1OL2A 4XG8A 3NVMB 3B2TA 2WMRA 4IVBA 4BCIA 3ZZEA 4XX9A 2WMBA 3Q53A 5B7VA 4EH6A 2QKRA 4EL9A 3F2RA 3ZC5A 3TJCA 2HIWA 3O2MA 3RP9A 4FSMA 1O6LA 2PUIA 3TV4A 2ZDUA 3MB6A 3R7OA 4L67A 4NYEA 2Q0BA 2PIEA 2YHVA 5C8MA 2VTRA 4O0YA 2EU9A 2P33A 4MEDA 4YC6A 3BYSA 3Q4CA 5KNJA 1UU9A 4XRLA 5BYZA 1OIUA 4WUNA 1OKVA 3VJNA 2VWZA 3I5NA 3BGQA 5IQDA 3FMNA 4HGSA 5L2QA 2XIXA 4AW5A 3TWJA 4EWHA 4MQ2A 5BPYA 3L9LA 3LQ8A 3AMBA 4I23A 4ALWA 3CQUA 4CMUA 3MESA 2E9OA 4Y72A 1H24A 4W4WA 5EYDA 2R3GA 4OT5A 5KE0A 5D7VA 3TV7A 3V6SA 1YWNA 1MQ4A 5I9ZA 4KS8A 3MI9A 3R02A 5IA0A 3R30A 3UBDA 5EDQA 4R3CA 4N0SA 2G1TA 4Q2AA 2WMTA 3BLQA 2O64A 2Y9QA 5E8VA 1ZY4A 3CQWA 3BRBA 4K9YA 1Q5KA 2C6OA 3E8DA 3ORTA 5DGZA 3CY2A 3AT3A 5EW9A 3TTIA 5IA1A 1WVXA 4FUXA 2CLQA 5CSVA 4NWMA 5CXZA 3FQEA 1DMZA 3QWJA 4BCOA 4ZJVA 1CTPE 4RGJA 1TQMA 4IMYA 3NUXA 4FTOA 1QPCA 4JLCA 5KZIA 1Z57A 4Q9ZA 4EH8A 3R2YA 4FIFA 4EZ7A 3GT8A 2JAVA 3QQUA 4NM7A 1Q24A 4ASZA 4NCTC 1K2MA 4CTBA 3A7JA 3BZ3A 4IX3A 2UVZA 3CTJA 4FIJA 4JBVA 4QOXA 2UW4A 3TKHA 1M17A 4X6QC 2YAKA 3DDQA 4EH2A 5CU0A 2FEZA 1UNGA 3GU4A 3CXWA 3I4BA 5JRSA 2AC3A 4ZSEA 3BE9A 3LCDA 3QQFA 4AA0A 4DC2A 1E9HA 3GVUA 3L9MA 3LPBA 3QBNA 3DS6A 3DKOA 4X0MA 3GP0A 4OBQA 3REPA 3LCKA 2XYUA 2C6DA 3NYVA 3D5XA 4I4FA 4LOQA 5JZNA 5LVOA 4B0GA 4DE4A 2O8YA 4ZAUA 5KZ0A 2W9ZB 3SLSA 3PLAE 3ZSHA 5KMKA 3ET7A 5DFPA 3O96A 3UO6A 3QC9A 3QCXA 5BMMA 4HCTA 1NW1A 4ERKA 3HV7A 5CAOA 1FVTA 2YJRA 3F3VA 4YO6A 2UV2A 3R7IA 4O2ZA 1KWPA 5J87A 4YSMA 1OM1A 4WNOA 5HQ0A 3HVCA 4PPAA 4W8EA 4NT4A 4RIXA 2XBJA 3KK8A 3PIZA 5EYMA 2X2LA 3G0EA 4DH7A 2B1PA 4YNEA 4L44A 2RKUA 4JBQA 3TV6A 3DK3A 2QR8A 3OD6X 4X2JA 3NCZA 4CCUA 2VTMA 5L4QA 4IAFA 2CJMA 3FLQA 3QCYA 3JR1A 2XNNA 4L45A 4ZTLA 3P7BA 1XQZA 3QA8A 4A4LA 3ZMMA 3COKA 5DPVA 4M7IA 4QMVA 4E93A 4HVIA 4PMTA 3EQIA 2I40A 4NKSA 3SGCA 4LGGA 1SM2A 1LGQA 2Q83A 4FTQA 4BCKA 4DFXE 3UOLA 4MWIA 4QTEA 5AAEA 4MF0A 3C51A 3UNMA 5K5XA 1URCA 3E3BX 4LL5A 3ROCA 4BGGA 5JGBA 3AC8A 3G2FA 3Q04A 2VWUA 4TN6A 4X2GA 4UWCA 5DA3A 1P4FA 4X2NA 3D7ZA 3GEQA 5FEDA 2H96A 2EB3A 3W16A 3U4WA 1JSUA 2Z7QA 2ONLC 5ANOA 3QTSA 5M08A 4L3LA 4EWQA 2QC6A 3POOA 5IUIA 4BGHA 3VPYA 3KB7A 4QMXA 4ZTMA 3OVVA 4CLJA 3QKMA 3HP5A 1RDQE 3AD4A 3PVGA 2WELA 4RWJA 4N6ZA 3R83A 5DI1A 4EUUA 5KMJA 3FSFA 5HNBA 3KREA 5J7HA 3ZO2A 3ORIA 2WGJA 1U5QA 3BGPA 2IVUA 3FZSA 3ORNA 4JRVA 4MBLA 5CY3A 5JGDA 5IU2A 4IJ9A 2WTDA 2OH4A 1YXXA 2XNPA 3GNIB 4A9SA 2C5XA 3NW7A 4CRLA 5IQGA 3MTFA 4D1SA 4APCA 3TTJA 4C2VA 4YZDA 3CIKA 3FZPA 3H9OA 3QRKA 4FK6A 5FUTA 3FMLA 4FT9A 3KN5A 4U41A 5KKRC 4LM5A 4BDIA 2GS6A 2BDFA 2X9FA 5DEWA 3PP1A 2W4KA 5EYKA 4BDEA 4BTFA 5CASA 2XT9B 4GSBA 4JT3A 4EJNA 3LJ1A 2BHHA 2EVAA 2QOBA 2WQOA 3MVJA 3OW4A 4YZ9A 4GIIA 4TYJA 2Y4IB 4ZP5A 5AM7A 4H58A 4K11A 5FP5A 4ZS4A 4MF1A 2YLFA 4BICA 4PP9A 3D2IA 2A0CX 4QP1A 4CKRA 4UMPA 2AFFA 3PDTA 4FEUA 3F3ZA 2IN6A 4JR7A 3ZRMA 2YM6A 2ZOQA 3FLWA 4K18A 4WIHA 5CT0A 3LAUA 4CTCA 4UYNA 4FNXA 5L6OA 3II5A 4I0SA 2ITOA 4RT7A 3CPBA 4FSUA 2R7BA 3VBQA 4C33A 2XEYA 3CJFA 3MGYA 1O6YA 1GNGA 4HOKA 2XIYA 3ZRLA 4KBAA 3QHRA 2ETMA 3FL5A 1BL7A 4O6EA 1OB3A 4ALVA 4CMTA 4C37A 3QXOA 4JX7A 4WNKA 1V1KA 1UNHA 1YW2A 2WTKC 4NJ3A 4CFNA 2GPHA 4ITIA 2BZIB 3VBVA 3AG9A 3BPRA 3KXNA 1H0VA 2PVLA 2XEZA 1JKTA 1PKGA 3OY1A 4NFNA 4LGDA 4JXFA 4UMQA 4TKSA 3FDNA 1PXJA 3E8EA 5AR7A 3NMUF 4Z7GA 1SMHA 4JBPA 2RSVA 1YWVA 1SZMA 4QMPA 1I44A 5IUGA 1I09A 2QOCA 2W1HA 3SXFA 5I4NA 4FV4A 4JQEA 5G6VA 3FKLA 4M13A 4H1JA 4CQEA 1PMUA 2JITA 3LQ3A 1PJKA 2C5YA 1LPUA 4F99A 2H34A 4AU8A 4ZJJA 4BWPA 3QHWA 2XK6A 4DFYA 4ZSAA 5GZ8A 2FH9A 4FKPA 4RVLA 4O21A 4G3EA 2H9VA 4RWKA 3ANRA 1H8FA 5A4LA 3RINA 4FL2A 1WBSA 2JKKA 3I81A 5HG5A 4CT2A 4EGXA 2V55A 4QP4A 2YCRA 2X6DA 2ZMCA 2JAMA 3RWQA 3EN4A 2GQSA 2YEXA 3KRJA 4ALUA 4ZS0A 3NS9A 5FM2A 5I0BA 4IX5A 1XH6A 4W4VA 3V5JA 4F1TA 3KY2A 2YIQA 3MYGA 2IW8A 2IW6A 5HLPA 1Y6BA 4BKZA 2JIUA 1T45A 5HO8A 1BYGA 2WMSA 3QZIA 5EOLA 1PXLA 4XV1A 1K2PA 2OJ9A 2JIVA 4NTTA 4U80A 4FT0A 3DDPA 2QLQA 3N51A 2QKWB 5DHJA 4N57A 2XA4A 5DBXA 2IZUA 2J6MA 4O0SA 2W9FB 3ELVA 2BRGA 4BIDA 4C4JA 2PZPA 3DAKA 3UG1A 3CTQA 1WBNA 4DTBA 1AQ1A 4G17A 3QRIA 5LVLA 5IA3A 5EQYA 4EK4A 3UO4A 2V5QA 4I6BA 5GZ9A 3UC3A 2IVVA 4FTLA 5DRBA 3GU6A 3OY3A 4PTCA 4FGRA 3R9HA 3AC2A 5IH4A 5C01A 1CSNA 4J99A 4JRNA 3O8TA 1U54A 5DN3A 4TNBA 3TKUA 4BFMA 5AX3A 4U45A 4MX9A 5JGAA 3RM6A 5ACBC 3PIXA 3CGOA 4I20A 5K4IA 5DR9A 4BIEA 3EQRA 3NIEA 3A7IA 4RMZA 3RNIA 4JG6A 4YURA 2EH0A 1OITA 3D9VA 5J8IA 4HJOA 2YWPA 5HTIA 3OC1A 4I41A 5EK7A 4Y8DA 4B4LA 5HO7A 2X7FA 4UZHA 1H08A 2RF9A 3F61A 3IK3A 4MNFA 4FTUA 2C0TA 4RQVA 2W7XA 5CI7A 5FTQA 3SKCA 3PG3A 3UP2A 5CF8A 3ATTA 1K2NA 3UOHA 1J7LA 4TWPA 2HK5A 4QNAA 4Z3VA 4FT7A 4H3PA 1V0OA 3ZO3A 2CGUA 3EL7A 4II5A 4BDHA 4EQMA 3AD5A 3GI3A 4DEBA 2ESMA 2WQBA 3ZUTA 4TYIA 4FTJA 2C5OA 4RJ7A 4X2FA 5CEIA 3IW5A 2PZIA 3DZOA 1WZYA 4HGLA 5AP4A 5B2MA 3F69A 5CI6A 5DH3A 4AZFA 3F7ZA 3WZUA 2R3MA 3GCPA 3VS7A 3WYYA 2GNIA 4D2WA 4KABA 2PMIA 4USEA 4E4NA 5GZAA 1JVPP 2ITPA 5AR3A 3KN6A 1XBCA 2J50A 4UY9A 3VC4A 4M14A 4QTBA 3FBVA 2X81A 1OIYA 2VTJA 1Q8ZA 5TR6A 4V05A 3NYOA 4MD8E 3E87A 2ZVAA 4KIKA 3BX5A 4IB0A 5A3XA 1Y57A 3Q2MA 3BWFA 3KRLA 4CNHA 4RFMA 3U8WA 1PKDA 1YXTA 4JAJA 4ZY4A 3ZSIA 1ZZ2A 4CYIA 1H28A 5D41A 4DT8A 4YLJA 2OFUA 2ITTA 4EC8A 4JI9A 2GNHA 1IG1A 1YJ5C 2W4OA 3EYHA 3G51A 2YJSA 4PMMA 3OG7A 4FNYA 3UN0A 2JKDA 2GNLA 4FOCA 5IH5A 3CJGA 3HZTA 3ULIA 1WBTA 5E7RA 3SX9A 3QKKA 4O7RA 2QNJA 4UXLA 2WOTA 2WQEA 5F9EA 4FIHA 3LVPA 3WE8A 3FZOA 3V8WA 4YBKA 4DCAA 5J7BA 3VBWA 3C0IA 4LV8A 5I3RA 4AOTA 3UNZA 2O2UA 3JY9A 4QQ5A 4WKQA 4XYFA 4IH8A 5HBHA 4L00A 2WEIA 2NRUA 3NSZA 4FV5A 3DK6A 4DG2E 4RLLA 2FO0A 4JIAA 5TF9A 3QD2B 2WMWA 4HNFA 2VWIA 3ZRKA 4CVAA 4MKCA 3UPZA 5DR2A 2PVYA 1JAMA 3VF8A 4E3CA 1DS5A 4FT3A 4MXAA 4GVJA 3QLGA 4MWHA 3FPMA 3EIDA 1JOWB 4PX6A 2CKQA 1M2RA 2QG7A 2CSNA 3OXZA 4DBNA 3D7TB 2E9PA 2EWAA 3KCKA 3MDYA 4F6SA 3QQHA 4LRMA 5JFXA 2IVSA 5CS6A 4CG9A 3R7EA 1HCLA 4CRSA 3PJ2A 4G3FA 4FKSA 4LRKA 4LQMA 3FLSA 3LXLA 3C1XA 5FG8A 4GFGA 3BLRA 3GB2A 1DM2A 3P9JA 2ZV8A 5E92A 4AE9A 5C26A 4OTFA 3RZBA 1YXVA 5CNNA 4FVQA 4MXCA 3PVUA 2Y4IC 3SQQA 3S1HA 4MXXA 3W8QA 4CLIA 4P7EA 3UIXA 4AUAA 2X4FA 2FVDA 4TZRA 5L2SA 4EZ5A 4U3ZA 5BVFA 2HAKA 5ICPA 4M69A 2EXEA 5AM6A 4YJVA 2BPMA 2YIWA 3HUBA 3QCQA 4IM0A 4YTFA 4RZWA 5DT3A 5CEOA 5FGKA 3SXSA 3TNWA 4Y83A 3R9NA 1WBVA 3PRIA 5H8GA 4LL0A 3ZOSA 4C38A 5HBEA 5A9UA 3E88A 4BCNA 3UYTA 2JQIA 4DINA 4Z16A 4FG9A 4FODA 3QTIA 4F65A 2VGPA 3FZ1A 4RVTA 3Q4UA 3CGFA 5M4UA 1FBNA 3KXZA 4I4EA 2BDJA 3FSKA 2P2IA 4CFWA 4E73A 3DGKA 4EOOA 3UVPA 1GZ8A 3QA0A 3BHHA 1W82A 1SVGA 4IXPA 5F1ZA 5IUHA 4GU9A 2G01A 4P4CA 1ZYCA 4ASDA 4OGRA 5HD4A 5M07A 2XB7A 1ZWSA 1BMKA 5AV3A 5H8EA 4D2PA 3VUKA 3R1SA 5A4QA 2WD1A 4HNIA 3EN6A 3I1AA 4EI4A 4GVAA 4CQGA 5H2UA 4HVGA 3S00A 2QODA 3ZFYA 2ZMDA 3G6GA 5FQDC 3R8ZA 5AUTA 3RALA 5HORA 3COMA 4RPVA 4DGGA 3S4QA 2JFLA 4I1ZA 4R1YA 4E4XA 2GS2A 4IAIA 4KSPA 3MVLA 4A7CA 5JEBA 4G2FA 4JNWA 4FTCA 2W1DA 4X2KA 4ZLOA 4E8AA 4YJNA 3KFAA 4DLIA 2OXXA 2DQ7X 2PVJA 3NEWA 3UZRA 4NIFA 3BWJA 3TACA 3F3TA 2J4ZA 2FB8A 4YPDA 4GIHA 3SV0A 4O0VA 4FIIA 2C30A 4TWNA 2B0QA 3PE1A 4ZZNA 5IQCA 1K3NA 2A27A 4IIRA 2ERZE 2F49A 3EYGA 5DOSA 5CT7A 4FV8A 4DTKA 2JBOA 4LMNA 1AGWA 4NH1A 3FEGA 3UGCA 3E62A 4W4YA 3LFEA 4PWNA 4ASEA 4JIKA 4AT3A 1GXCA 2J2IB 3BHVA 4KKGA 2GQRA 4TWOA 1MP8A 2VV9A 4RVKA 2OH0E 5I9YA 1BUHA 2Y0AA 3P78A 1Q8YA 4BBMA 2CSWA 3KXGA 3BELA 4GH2A 2I0HA 4PL4A 4D0XA 2BILB 4HW7A 1H27A 4GT5A 5AP1A 3EMGA 2I1MA 3OFMA 4AACA 2VTNA 5JFVA 2BZHB 4LUDA 4PF4A 2XKCA 3E8CA 3GFWA 3UP7A 3VS6A 5J9ZA 5A4CA 2NNWB 2RFDA 1R0EA 4HGTA 4RFZA 2UZOA 4ERWA 1J4LA 2QURA 1WBPA 2QI8A 4FKQA 1BI7A 3E64A 4DHFA 4UZDA 4F09A 4E5AX 5JSMA 5AWMA 3BV2A 3K2LA 3KK9A 4UX9A 1GY3A 4U97A 5AV2A 4E7WA 1Z5MA 4FZ7A 3OP5A 2CMWA 3HX4A 3U6HA 4M69B 1YOMA 2BAKA 4N4SA 3O8UA 5DIAA 3CQEA 4I3ZA 3DJ7A 4J8NA 1KE6A 4FYNA 5AUVA 2PTKA 3C13A 3NZ0A 2VTPA 3VS3A 4XCUA 5C27A 1U59A 3BQRA 4CZYB 2WIHA 5L2TA 4PQNA 3HV3A 3UIUA 3T8OA 1Q4LA 3EZRA 4YTIA 4FKRA 3RPVA 2R3IA 4F70A 5BVNA 4J8MA 2UZLA 5HX6A 4JONA 1G3GA 2YLEA 2WB8A 5JQ5A 3ZLXA 5HG9A 3ZXZA 3WZEA 1W84A 3A8XA 3PSDA 3QFVA 3TZ8A 5FEQA 2B53A 4BC6A 2CNQA 2ITXA 4WBOA 3S0OA 1Q8TA 4E1ZA 3A7GA 4XRJA 3E63A 3RPYA 4BDCA 3HX1A 3DBEA 3O50A 2YM4A 4YC3A 5IMEA 1KUTA 4EK3A 5EHOA 5LWNA 4WNPA 1ZMVA 4BR3A 3ZYAA 4ZLYA 2XP2A 4YUQA 4GL9A 2OIBA 4DFLA 2BRHA 3FKOA 4FICA 4BWXA 2WZJA 5CVFA 2R3HA 2LGCA 5C8NA 3D0EA 4G5JA 3PJ3A 3KU2A 3UIMA 1YOJA 3UNNA 4B9DA 4EKKA 4ENYA 4J52A 4NL0A 2VX3A 3BGZA 4C35A 4U6RA 3RPSA 4F7NA 3B8RA 5HLWA 4L53A 1UJXA 4CGAA 5HNGA 2XJ2A 3QX2A 5BMSA 3FXXA 4H3QA 4DGNA 1RQQA 1H1WA 4EKLA 3RM7A 4AZTA 2IZRA 1UWHA 1NVSA 4AGCA 1L8TA 4L8MA 4U43A 1CKIA 4NIFB 4ZSLA 2W1IA 4ACHA 4C34A 1Q62A 2OIDA 2JKOA 5BUEA 1CM8A 5KMMA 4FE2A 4G9RA 2WO6A 2QR7A 5EQEA 2ETRA 4IAAA 5CF6A 3JY0A 4F0FA 1IEPA 4FC0A 2X2KA 3CPCA 4FEXA 4F08A 4YTCA 5HESA 4KSQA 4O82A 2UW7A 2WIPA 2VNYA 5K9IA 4FTIA 2XK7A 1ZZLA 4QO9A 2QO9A 2Y6MA 3HLLA 4F6WA 5AUUA 5JT2A 3ZDUA 5L8KA 2VWWA 3QGWA 4F7LA 5IF1A 3I0NA 3C4EA 4V0GA 1OPLA 2PU8A 3GGFA 5HU3A 1R78A 3W32A 3MV5A 2EXCX 3RI1A 4EOKA 4QYHA 3BU6A 4DG0E 1UNLA 5FBOA 2YERA 3TUBA 4KBKA 5CVGA 1H01A 4YNOA 4RFYA 3IW4A 3MY0A 5E8ZA 1BKXA 1ZOHA 3C5UA 1YHVA 4P2KA 3QKLA 5HX8A 1Q99A 1YJMA 3DBFA 3NDMA 2X1NA 1M52A 4RJ6A 2FYSA 2XCKA 4XNEA 4PMSA 5DG5A 4JDIA 3CTHA 5H3QA 4C02A 2BRFA 3EHAA 3MY5A 4EZ3A 4QPAA 1CKJA 1FGKA 3EJ1A 1Q8WA 4U40A 2Z8CA 3EFLA 2R3NA 2VAGA 4RC2A 4AT5A 2VWBA 2W3OA 4D1XA 2FSTX 3KULA 3R0TA 3I60A 3WIGA 2X2MA 1J91A 1OZ1A 1S9JA 2WMUA 4Y73A 3NNWA 3UIBA 3COHA 5GJFA 2YFXA 4QMLA 3FE3A 3OWLA 3VQHA 2XM9A 4I6HA 2BRNA 4BDJA 4D2VA 3VUTA 3U6IA 5J1WA 3FM8A 2QU5A 3GUBA 1NXKA 4GUBA 4D4SA 2HWPA 3F2AA 4I6QA 5BVWA 3UC4A 5BVEA 2B7AA 4IAZA 4E6CA 4C36A 5C4KA 4JL9A 2G1LA 3R7VA 3OF0A 3CS9A 2DWBA 4TXCA 2UVXA 3CKWA 5LCJA 2W0JA 4TNDA 4TYHA 3IGOA 1OL1A 4RC4A 5DMZA 5BYLA 3QL8A 3FV8A 5CAPA 4XHKB 3OCTA 2FSOX 5BVKA 4BN1A 5TE0A 3FKNA 1DAWA 5EKNA 2ZV9A 3OT8A 2BTRA 2OIQA 4ZZOA 4GW8A 4W9XA 2B55A 3SRVB 3H0YA 5M55A 4CSVA 3NGAA 4O0WA 2WTVA 4DCEA 3HUFA 3OOGA 1JSVA 5GJDA 2R5TA 5KBRA 3IG7A 4PTEA 4XG7A 4EONA 3ORMA 4BCGA 3U55A 2RFNA 3CEKA 3I7BA 3F82A 4FX3A 5LXMA 2XNOA 4MXZA 4D5KA 4QP3A 3PVBA 2WMXA 3CD8A 1U5RA 4QTCA 4QNYA 5HBJA 3GBZA 3D14A 3D5WA 3HUCA 1YI6A 2B54A 2DS1A 2C3JA 3Q9ZA 2Y7JA 3V51A 4AZWA 1J7UA 3DLZA 5JFWA 4BL1A 4RSSA 3LCTA 3LFCA 4ZEGA 2ZJWA 3BV3A 1PF8A 5AP3A 5AADA 4RC3A 2HCKA 4YTHA 2IW9A 5M4CA 5KO1A 2JKQA 3DY7A 4O0TA 3WF5A 4R5SA 4EOLA 4K77A 3TZ9A 3D94A 3ZU7A 4W9WA 5AA8A 4GK3A 2B9JA 3ITZA 3O7LB 5FRIA 3WYXA 3MTLA 4QMZA 3FI3A 1XH9A 5E4HA 3Q2JA 4I5PA 5M56A 2YZAA 3UDBA 2YCQA 3NAYA 1G5SA 3KGAA 2DYLA 1WVWA 4BTMA 1REKA 1S9IA 5A4EA 5I3OA 4FKVA 1B38A 4BYIA 2XMYA 4FSQA 1DAYA 4L3JA 4U79A 4XP3A 4GKIA 4FMQA 1ZARA 4IVAA 2JDTA 2O5KA 3QTXA 4H36A 3VJOA 5ETAA 3DTCA 3PXFA 2VTSA 5AUYA 2JQLA 1J7IA 4YJTA 3VW8A 4TW9A 4DLJA 1XH5A 2J0LA 2CKOA 2OLCA 4IHPA 3V01A 3D15A 5EG3A 3DT1A 5AP0A 3DBDA 4IX4A 2Z60A 2X8EA 4Y5QA 5HICA 2XVDA 4IADA 4E6DA 3G9LX 3VHEA 3UO5A 3BBTB 2O65A 1Q3WA 5EM8A 2R0IA 5DNRA 1GZNA 2YM7A 4IX6A 3UTOA 4MK0A 3EN5A 2YITA 3ORXA 4HCVA 2OICA 3F5GA 2JPEA 5IQIA 4OBOA 4U42A 3WF8A 4EYMA 4A0EA 3RHKA 2JQJA 5AV4A 1E1VA 3IECA 2V7OA 3HV5A 3N9XA 5EI2A 4C8BA 2C1BA 2VNWA 1ZRZA 2VGOA 3SC1A 5IA4A 4MCVA 3R00A 5ANIA 4F9YA 4KWPA 2YDIA 4NW5A 2HW6A 3K3IA 1YI3A 5HGIA 4C7TA 2UW6A 3GFEA 3R28A 1WBWA 2XNGA 4XV2A 4EOJA 2CN5A 3I5ZA 3GQSA 3HP2A 2CNVA 1ERKA 1V0BA 4TYHB 2PK9A 1Q97A 3Q5IA 2OFVA 3PSCA 2WU6A 3A7FA 2LC1A 5HKMA 3NUAA 3AMAA 3NUUA 3KF7A 3THBA 4KD1A 2JIIA 3IW6A 2BZJA 3KXMA 5CZHA 5AX9A 4NK9A 3MS9A 2ZM1A 4G9CA 1M2QA 2I0VA 1ZYSA 3G33A 3NNUA 2OZAA 3P0MA 3VBXA 3U54A 3Q3BA 3D2KA 1EH4A 3V5PA 4ONAA 4A4XA 3MA6A 4L6QA 3RWPA 1K3JA 1YXSA 2I6LA 3B8QA 1ZAOA 4B6LA 4YBJA 4V04A 3HEGA 2A0TA 1SYKA 4NEUA 1G3NA 2XF0A 4UWBA 1IA9A 2XK4A 4P5ZA 4CFMA 1UV5A 5F95A 1IRKA 1YI4A 3OS3A 3QRUA 4UEUA 3FZRA 2UZUE 2HY81 3FLNC 4P5QA 4OAVB 3MPAA 4GFOA 5BUIA 5KMNA 3IONA 2F7EE 3FMJA 4D55A 4KIPA 1TVOA 3K5UA 5E90A 1JKSA 2C1AA 4WRSA 5M06A 4RIXB 4I93A 4G3GA 1WAKA 3JXWA 4BI0A 4BWKA 3FLYA 3TG1A 5BX0A 1Y8YA 4I24A 3WBLA 3UMWA 4DEHA 4MQ1A 3ACKA 4BHNA 1XWSA 5K4JA 1B39A 4O86A 1PYXA 3HMOA 3WF6A 3LFFA 1FVRA 3HDNA 4KRDA 5TT7A 3ERKA 3R9DA 3UMZA 4CD0A 3SG9A 4DBXA 4OR5A 1YWRA 4L42A 3KVWA 1WBOA 3OW3A 5E9EA 4BCPA 4OTGA 4RX7A 4YP8A 5TO8A 4QRCA 3R1NA 2BRMA 2I0EA 2XK8A 2GS7A 3ORLA 4GG7A 1XHAA 3RVGA 5HIEA 3LFDA 4IC7A 3P08A 4ZSGA 3MH3A 2IVTA 2GSFA 3Q5ZA 2H6DA 1YOLA 3I0QA 3W2CA 2OF2A 2PZRA 4V01A 3DXPA 3OCBA 1QPJA 5EQPA 4GKHA 3A4PA 2WKMA 3PJ8A 3E92A 5AR2A 4CZTA 2OXDA 2XK3A 5CNOA 4FEQA 4ANQA 3QCSA 3EFWA 3W2PA 3P86A 4JR3A 3DAEA 3R7GA 4YC8A 4CV9A 3F3WA 5M51A 3LM0A 4AGWA 2OGVA 1W83A 3N4VA 4GEOA 5ETCA 2BIKB 3IO7A 3LJ0A 3ZH8A 4S31A 5C03A 4RQKA 3ZUVA 4DH3A 3ZO4A 5CEQA 4FBXA 5CLPA 4WOVA 5DE2A 5ITAA 4WRGA 3T3UA 1X8BA 3VBTA 3VS5A 4KIOA 5EKOA 2BKKA 5H9BA 5E1EA 4FL1A 4PMPA 4UMUA 2KKLA 5LMBA 4G6OA 3NAXA 3QTZA 5LARA 2OXYA 2XH5A 3OCGA 1NA7A 3R6XA 4D4RA 5J95A 4YJQA 4W8DA 3FY2A 1P5EA 4IZ7A 1XH4A 4EOSA 1ZXEA 1OL6A 1OBGA 3OWJA 2BVAA 3POZA 3E8NA 4FUYA 4ZJIA 3PXZA 4LUEA 5HD7A 2XBAA 4JOAA 4CEGA 4IB1A 2EUFB 2P0CA 5HLNA 4BCFA 3V5WA 3TDWA 3A2CA 3NCGA 2A19B 5DT0A 2YN8A 3VAPA 3WIKA 2PVHA 1W98A 4B7TA 2BFYA 5IEXA 4TTHB 4RIWA 4YHJA 2W5AA 1H07A 3ACJA 3MJ1A 3FPQA 2R9SA 4G3DA 2BFXA 1UKIA 4HCUA 5FDXA 4QMUA 4FNZA 4I6FA 4QYGA 4UB7A 4YO4A 4DAWA 3IQ7A 1H4LA 3MSSA 3R22A 5ANJA 4E6QA 5CSPA 1ND4A 4UXQA 3PRFA 2YA9A 4AZSA 5AUZA 5JFSA 3M1SA 1GOLA 4AF3A 2P4IA 3QYZA 2WHBA 3FLZA 5E91A 2H8HA 2VTLA 4L7FA 3R04A 5CVHA 3WF7A 3ZLWA 1IA8A 5GHVA 4BKJA 4QMNA 1H1PA 3PA5A 1VR2A 2UUEA 1PXNA 1SNUA 3ENMA 5CYIA 4O81A 4AOJA 5ANGA 3QLFA 3P23A 3BYVA 3U9NA 3QAME 2IJMA 4NU1A 1FPUA 3BEGA 5FTOA 5AEPA 5I9VA 3R8MA 4C4GA 4YJOA 4BRXA 2A1AB 4XG6A 2Y8OA 3KXXA 2HYYA 2R7IA 1H1RA 3DB8A 4LOOA 1J4OA 4FIGA 4CKIA 4R3RA 2B4SB 3DK7A 4QP8A 2C5VA 3PIYA 2KULA 2WMVA 4IB3A 3OHTA 3GC8A 2J0MB 4IWDA 2GQGA 3FXWA 3FY0A 4F1OA 5D1JA 3EQHA 5IZFA 4FSZA 4JVGA 4BYJA 3FQSA 5CU3A 3EOCA 3F66A 3R8PA 4QPMA 3L1SA 1KV1A 3C4FA 3LOKA 2WU7A 3MIAA 1LEZA 5T3QA 3IOKA 3ZSGA 4Y46A 5J5SA 3K3JA 1NVRA 3A4OX 3DKFA 3OEFX 4ZSJA 4LOPA 4G6NA 4FEVA 5JRQA 1LEWA 3V5LA 4RIYA 1J4PA 3IDPA 3TT0A 5CAQA 2ITVA 1UKHA 3KT9A 1ATPE 5CZIA 3O17A 4JS8A 5JMSA 2KB3A 3VBYA 2UVYA 2XRWA 3QALE 4TYEA 5EW8A 5DVRA 3O0GA 3R73A 4AW0A 5CEPA 3V5QA 2RGPA 3GQLA 4CG8A 5GIPE 2J51A 4WG3A 5LVMA 1XO2B 4F64A 3UQGA 2WQMA 4QMMA 5I9WA 3TZ7A 3R63A 4JX3A 3EQDA 3FYJX 2OBJA 4FSYA 2W1ZA 2X39A 3TN8A 4AN9A 2ITQA 3TNPC 1GIIA 2PY3A 3T9TA 2IO6A 3MFRA 4PL3A 4ITJA 1E1XA 4BCJA 4AFJA 2B9FA 5BVOA 1Q8UA 4B8LA 3RKBA 1QPDA 1NT2A 4IBMA 4E20A 5A6NA 3LM5A 4DEGA 1Q61A 1U54B 2QO2A 2ZB0A 4MH7A 4WD5A 2EB2A 4YLLA 4ZTNA 2BR1A 4FV3A 5EI8A 1W0XC 5T68A 3OUNA 1PXPA 3KL8A 1WMKA 2QVSE 2OG8A 2HXQA 4O7TA 3P5KA 1OUYA 4TRLA 5HIDA 3EL8A 4FKLA 2VUWA 3PPZA 3QUDA 3TUCA 3AMYA 5EM6A 2XJ1A 3AOXA 2IWIA 2XS0A 4QQJA 2B9HA 4JDKA 3LKMA 4ZTQA 2HZIA 2YCSA 3QD0A 2GNGA 4LI5A 1YQJA 1XBBA 2C3LA 5BQ0A 4EORA 3BQCA 5EDPA 3KA0A 5EDRA 3QXPA 1XR1A 2PHKA 4FTRA 5AA9A 2PUNA 2Z02A 4KS7A 3LJ2A 4XG4A 4BF2A 2KB4A 3Q96A 4C4HA 3A60A 4FTMA 4C61A 3KF4A 4ASXA 1A06A 2UW8A 4XH6A 5CENA 3HMPA 5A46A 5HZNA 1YDTE 5D10A 4MD9E 4PP7A 4WG4A 3TM0A 2OJIA 4O22A 4O38A 3KMWA 2Y6OA 4A06A 4BHZA 1FHQA 3DAJA 4K33A 2G9XA 3LXNA 2X8IA 4GUEA 2FF4A 2F4JA 3VULA 3ZBFA 4TPTA 4XUFA 4A9UA 4FV6A 2KTYA 3QRJA 5BYYA 2WAJA 3I79A 4Z9LA 4KIKB 3MFSA 1VYZA 5M53A 1OMWA 2C3IB 2J0JA 3PTGA 3DBQA 3QQGA 1UU8A 4P90A 4EHEA 4I5CA 2PMNX 2HY0A 4BIBA 5EHYA 1FOTA 2QONA 1PXKA 3RZFA 4GRBA 1JKKA 3F7WA 4G3CA 3ELJA 4IM2A 2W5BA 4E5WA 2OSCA 3N4UA 2O0UA 3VRYA 2SRCA 2JGZA 2W1GA 3P79A 3R9OA 5DJOA 1XH7A 4RVMA 5L2WA
chains in the Genus database with same CATH superfamily
2QHNA 1GZOA 2WEVA 2WMAA 5FXRA 2GNFA 1M14A 3U6JA 4WERA 3G15A 2OJJA 4USDA 4L9IA 4BDKA 2UZDA 4B99A 4IEBA 4FKOA 2BZKB 3COIA 3RTPA 1BI8A 2BHEA 3IW7A 3JPVA 4HZRA 4ZY6A 3U4UA 4NJDA 4MXYA 3W55A 2BTSA 3HNGA 3L8XA 5AIRA 4FR4A 2GTMA 3DTWA 4I0RA 4FI1A 5FM3A 3UOKA 4AGDA 4CFXA 4GS6A 4O7WA 5KBQA 5EFQA 3EFKA 4M12A 3RPRA 4XV3A 4KUJA 4BY9E 5HE3A 3R2BA 3C5IA 4O7SA 3Q4TA 2JDRA 4UN0C 4Y5HA 4M8TA 4MNEA 3PWDA 3RK9A 4A07A 2C6KA 3TIYA 2J0KA 3IPHA 3BYOA 3MFTA 3DCVA 2BAJA 3KRRA 3UODA 2NP8A 4GU6A 4Q9SA 4HPUE 3R8LA 2REIA 5F4NA 4ORKA 2WNTA 4J98A 5FWKK 5I9UA 5EJHA 2FSLX 4DEDA 3JYAA 5M4FA 4JQ7A 3C0HA 3DPKA 3RBWA 4J95A 1W2CA 4C3RA 3BEAA 5TOZA 3NW6A 4EK5A 4ANSA 1MUOA 3HAMA 4RLKA 3PG1A 4S30A 4GFMA 1OGYA 3FMDA 2BAQA 4XP0A 3EKKA 4MBIA 5HTBA 2I0YA 2BIYA 2AUHA 4RA5A 5JZJA 5E8UA 3BKBA 3NRMA 5HVYA 3BI6A 3VUHA 3VUIA 2W05A 5E8WA 1ZMUA 3JVSA 3F5UA 3QYWA 4L01A 4ARKA 2WTCA 4BVUA 3H30A 3L8PA 1JQHA 2B52A 1WLNA 1OI9A 4BI2A 3WZKA 1KHUA 4IQ6A 4QMYA 3PY1A 3R9RA 3NYXA 3BLHA 4CCBA 3F88A 5IG1A 2Q0NA 4DFNA 4BDGA 4GV1A 2VU3A 2J5FA 3LQ5A 3LHJA 3OBJA 5CU2A 1GIJA 3ZBXA 4U8ZA 4EBVA 1VZOA 3ALNA 5D7AA 4JIVD 4BBFA 3QZHA 3UMXA 2NRYA 4A9TA 3QTWA 2E9NA 4R77A 3DFCB 3O71A 4GCJA 2BUJA 2X8DA 5FLFA 3MVHA 2ITWA 4DYMA 3EN7A 2C6MA 4K0YA 4NKAA 4U0IA 4FOBA 1G6GA 4EQUA 5A54A 1MJSA 4MAOA 2AQXA 3G9NA 4DN5A 4EHGA 1JKLA 3UPXA 3MDBA 2BALA 4FV9A 1UA2A 1O9UA 2UW5A 3PZEA 1H25A 3CR0A 3RPOA 4GYIA 4WUAA 4CZUA 5D11A 3LCOA 5KMIA 1PW2A 1Y8GA 1RW8A 3PSBA 1NY3A 4GK2A 2VTIA 2R3FA 4ZTSA 5AV1A 4OTHA 4DGLC 3SA0A 2RFEA 4I21A 5FP6A 4AW2A 3EQGA 3R01A 3PWYA 4QP7A 2CGWA 4D4YA 3A8WA 3BHUA 3QTRA 4FVPA 3U9CA 3GU7A 2E9UA 2C3KA 3I6UA 3KMMA 3FZTA 3HV6A 3BBWA 5K0KA 2WTWA 3G90X 3NX8A 3OXIA 4IWOA 4JBOA 3ZHPC 2ITYA 3LMIA 3VS4A 2OF4A 3RAKA 2X0GA 2QU6A 3A61A 5FD2A 4AFEA 2JDVA 1A48A 3H9FA 4DFBA 4OBPA 3VA4A 3HMIA 2A4LA 4JDHA 4WG5A 3Q6WA 2VWVA 2VWXA 2X6EA 1MRUA 1ZY5A 3ZC6A 1W8CA 4OTDA 4G5PA 3HL7A 5M57A 1GZKA 4BGQA 3ATSA 2UZTA 3C4ZA 2QO7A 3TDVA 3QZFA 2JD5A 3HKOA 4IZYA 5A8IA 2GMXA 4YJUA 1PYEA 2RG6A 4FL3A 3R8UA 2XNBA 1JSTA 3LMGA 4OTQA 1CKPA 1O6KA 4ZTRA 3U51A 3O23A 2YIRA 3ZEWA 5LQFA 3KQ7A 4L52A 5CTPA 3NVKI 3HMNA 4QYEA 4RJ4A 1W7HA 2J5EA 3VS0A 2AYPA 5AAFA 4AS0A 4F9BA 1PHKA 4IZAA 2W96B 4S2ZA 4C58A 3TL8A 2XRUA 4H3BA 2W17A 4KAOA 2BDWA 4G6LA 4U9AA 4OW8A 4M0YA 2VTHA 1DI8A 4D0WA 2YCFA 2C6IA 2FGIA 3JS2A 2X7GA 3M42A 4ZMEA 4K1BA 1YDSE 4ZXTA 3DQWA 3TKIA 2QHMA 4X6RA 4Z7HA 2VO7A 4O1OA 3ID6C 1K9AA 3W2QA 2XANA 5AJQA 1P4OA 4O0UA 2Z2WA 2Z7LA 3POAA 3OTVA 4HPTE 3SVVA 5A6OA 4KIQA 4YU2A 4D1ZA 4W4XA 4DGMA 1Y91A 3P7AA 3FXZA 1KOBA 4XG9A 3K5VA 5IEYA 5C4VA 3ALOA 3UJGA 2VRXA 3V8TA 5AR4A 3IW8A 4JDJA 3GXLA 5HVJA 1IAJA 3DXQA 3NLBA 4FYOA 1KHXA 3MPTA 2C5NA 3PZHA 3HYHA 5DEYA 3L8SA 3VW6A 2PVRA 4FG8A 3ODYX 5IA2A 3W0QA 4UBAA 4QPSA 5EJGA 5GNKA 5LMKA 4WRRA 3UYSA 4J97A 3F5XA 2VO0A 3ZONA 1H00A 3EQPA 4FKWA 4PRJA 3FI2A 5CU6A 4DT9A 3FYKX 4XJ0A 4HYUA 4TYGA 5AMNA 4YJPA 3S95A 5JQ8A 4ITHA 3DJ6A 2VX1A 3TJDA 3PLSA 2VN9A 4BDBA 5DYJA 3NUSA 3GU8A 3GENA 4WNMA 1OPKA 2PVNA 4ANNA 2QG5A 4M15A 3EH9A 1CDKA 2C6EA 3RHXA 5IQAA 1ST0A 3GC9A 3C50A 2VTTA 4IVCA 2JLDA 2PVFA 2PMLX 3QF9A 3Q32A 4IE9A 4ANBA 1UU7A 1T46A 2DUVA 2PE1A 3OMVA 4NUSA 5A4TA 5D9HA 1WV3A 1PMNA 4CT1A 5JEOA 3DKCA 4O83A 3FUPA 2YACA 2C6LA 1ZOGA 5EH0A 4EK6A 1JLUE 3UZTA 4CFUA 1UU3A 4IM3A 4XEYA 4O7YA 4YZMA 3ZCLA 3EQFA 4YJSA 1RJBA 1R39A 2FUMA 2GDOA 2P2HA 2GHMA 2O63A 4M84A 2W4JA 2XK9A 1JBPE 4QQCA 5KMLA 5L8LA 1VEBA 2XNMA 3ZS5A 3GCQA 2C4GA 3T3VA 4AP7A 2O3PA 3AXWA 5ETIA 4DH1A 3W2RA 3ZLSA 1FQ1B 2I2AA 3HAVA 4MBJA 4QD6A 3ULZA 1R21A 2CGXA 4MYGA 3VF9A 4PDPA 4F7JA 3F9NA 3SXRA 5CF5A 3WZJA 3ZUUA 3DKGA 3R7YA 1FMOE 1YHWA 3B2WA 3Q9YA 4YHTA 5JH6A 5CSXA 2YM3A 3AC1A 4EQCA 2R3OA 1Q3DA 1IR3A 3M2WA 1TZDA 4RJ3A 5ANKA 1PXIA 3NYNA 4CKJA 3CY3A 3VS1A 4HVHA 3UQFA 1UHTA 2PWLA 4C4EA 2UZWE 3UG2A 1ZYDA 4UV0A 3QUEA 2WTIA 5JN2A 5KX8A 3G0FA 3F5PA 1GAGA 2ACXA 4G16A 3BE2A 5CWZA 3I0OA 5CU4A 4CXAA 4FA2A 1STCE 4M66A 4QTAA 2JDSA 1OKWA 4UMTA 1DD1A 4QP6A 1REJA 5IQFA 2VO3A 1URWA 1KSWA 2WPAA 3PE2A 2VO6A 4I94A 4NSTA 4V0GB 5E8SA 3ZLYA 3LFBA 3LW0A 4YGAA 4C0TA 2E9VA 5HG8A 1ZYLA 2I2DA 4O7ZA 4JG8A 3ZM9A 4EOQA 3QWKA 5DHRA 4O7VA 3Q6UA 4FTNA 3EKNA 2WMQA 1OVEA 2CPKE 2VD5A 3IS5A 3OZ6A 2XKFA 4R7HA 2XKDA 4U7ZA 2C0IA 2JEDA 3ZEPA 4BTJA 3AC3A 3H3CA 3RMFA 3LFAA 3PXYA 5HVKA 3NUPA 1P14A 4EH9A 4XOZA 3CSVA 3PPJA 4JIWD 4C3PA 3ETAA 2CCIA 2C69A 5M09A 1SVEA 5AP6A 3Q4ZA 3W8LA 3DBCA 4YSJA 2R3PA 3ZFMA 4E26A 3D5VA 2JC6A 4FZAB 3KXHA 4R7IA 4TY1A 3KULB 3PY0A 1WVYA 4TT7A 4KNBA 3CD3A 2OJGA 4IWPA 4CFFA 5E50A 2IPXA 4IDVA 2PE0A 1OL5A 4Y85A 3VIDA 1FGIA 4XP2A 3UV0A 1YHSA 4D2SA 1OUKA 3E93A 4AAYA 2YIYA 5CF4A 4AZEA 2QOOA 4FTTA 5IEVA 3DV3A 4S33A 5HE1A 5IQBA 4YJRA 4D58A 3UNKA 2F57A 2E2BA 2YM5A 4YZCA 5ACKA 3SD0A 2IZTA 4DFZE 4HZSA 5AR5A 2RIOA 4C4FA 2BMCA 5AUWA 1MRVA 4XS2A 2YAAA 4FKUA 3RNYA 4BZDA 4D28A 3QU0A 3FHIA 4QYFA 2GU8A 5F94A 4KKHA 4HYIA 5F20A 4BDDA 4ZY5A 2QCSA 1U4DA 4FV0A 3OWPA 2UW9A 2LAVA 4R6VA 3FI8A 4Q5HA 4AXCA 1LGPA 4O96A 5LMAA 3E3PA 4R1VA 3PFQA 4QP2A 2F7ZE 3PXKA 4X7QA 5AFVA 4EH4A 4YHFA 4DFUA 4RJ5A 5B2LA 4LG4A 2WFYA 3KRXA 4EHZA 1M7QA 2YABA 3DOGA 4RBLA 5AV0A 2CDZA 3QZGA 3KCFA 3C4WA 3VRZA 3W18A 3FMHA 4FF8A 4EHVA 3DLSA 2PL0A 4IFGA 4RX9A 5CQUA 1FMKA 3SW4A 3W10A 4AX8A 2XCHA 4DG3E 1J4KA 3TNIA 2XYNA 3UZPA 3A99A 3C4XA 3ROYA 5E8TA 2C68A 2ZM4A 4QMTA 4YLKA 2G2HA 2R0UA 1OBDA 5DR6A 4XBUA 4ENXA 4EJQA 3KMUA 3L9NA 4NM0A 3VO3A 3DA6A 4ACGA 3MWUA 2HZ4A 2ZAZA 4O91A 4XG3A 5CXHA 2C47A 5CAVA 3UQCA 3GQIA 1J1CA 4BZOA 4ANMA 1TFFA 3W2OA 4JG7A 4FEWA 1U46A 3UVRA 3TI1A 4QDVA 5AAGA 2PUUA 5EHLA 3PYYA 3D83A 2PPQA 4QMQA 4F9CA 3LCSA 1VJYA 3NPCA 5HCXA 4BCHA 4QMOA 1PXMA 3EB0A 3TNQB 3V6RA 4ZIMA 2BKZA 3I7CA 3NNVA 1Z9XA 2GTNA 4BBEA 3ELSA 3CCNA 3NWWA 4XLVA 4MUQA 3Q9WA 3MIYA 1SUWA 4DGOA 3JVRA 3I0MA 4Q5EA 4DEIA 2CGVA 3S3IA 3LMHA 4OT6A 3TNHA 4ANLA 3VZCA 3DXNA 4J53A 3QTUA 3N4TA 2UW0A 2QD9A 5G1XA 5DWRA 4DA5A 2Z7SA 3O8PA 3HGKA 3IDCA 2PMOX 3OXTA 3Q60A 4FVRA 3ZZWA 5HTCA 4LV5A 1IASA 4O0RA 4DEEA 1J1BA 4I5HA 2HZ0A 5FXSA 4ANOA 3E5AA 3RCDA 2G15A 1XH8A 3EZVA 3R7UA 2IZSA 1NVQA 4DITA 2ZV2A 4FV2A 5J9LA 4XG2A 3ZO1A 3PXQA 1FHRA 4KRCA 2YZLA 4GJ3A 4EOMA 4HVSA 1QPEA 1JNKA 4LMUA 5GIOE 2OI4X 1YKRA 3AGLA 3DQXA 3Q52A 5TKDA 5ANEA 3PJ1A 2BRBA 3IDBA 1WCCA 4YPSA 5C9CA 3TZMA 4AOIA 2QOFA 1MRYA 3HRCA 4F0GA 4K6ZA 2R4BA 3QD3A 4NTSA 1ZMWA 3R71A 4L68A 3PA3A 4A4OA 5BUJA 1MZKA 2VTQA 3O51A 4F4PA 2W1CA 2R3RA 2QOLA 2CN8A 3D4QA 4X3FA 2XJ0A 2PUPA 3WZDA 3W1FA 4D4VA 2HELA 3IOPA 1OL7A 2J9MA 3TUDA 4J1RA 4FK3A 3EFJA 4WSQA 3LFNA 5DHTA 4LRJA 1R0PA 2GFSA 4PNIA 1M2PA 2OKRA 5HO6A 2QLUA 4EH7A 4HYSA 4JAIA 1H1QA 2V0DA 1H26A 3BU5A 3FWQA 5EM7A 3ORKA 2XM8A 4BDFA 5EOBA 3KRWA 1KE9A 4F9AA 3W2SA 1XMMA 4AAAA 3IKAA 4D5HA 3QTQA 1QL6A 2OZAB 4X21A 4IW0A 3UVQA 5C8KA 5LVPA 5IPJA 3QQLA 4UWYA 3V3VA 4GK4A 2XIKA 1PRYA 4QEBA 3DFAA 3MVMA 2I7QA 3PXRA 1ZOQA 2ITUA 2YDKA 3QUPA 3HDMA 5AP5A 4XBRA 3D7TA 4NFMA 3MH0A 4NM5A 5HHWA 4HYHA 3PVWA 1R1WA 3P1AA 3NUNA 4FKJA 4XOYA 4OTRA 5IMXA 2I1WA 4FZFB 1KE8A 2F9GA 4Y95A 3OCSA 4U81A 5DHUA 4PV0A 3WE4A 5DLSA 1HOWA 3DNEA 1OIRA 3V5TA 4DTAA 3OOMA 4ZLZA 4QMSA 2OJFE 4RWIA 3NNXA 4HGEA 4FG7A 4PDOA 4TWCA 3DZQA 2GHGA 4WO5A 5M44A 1SVHA 3AC5A 4FIEA 4PUZA 2WQNA 3TCPA 3MFUA 3BIZA 5E1SA 3FI4A 3PY3A 5EM5A 3G6HA 4R3PA 3KC3A 3PA4A 3V7YA 3H0ZA 5CAUA 4E4MA 4NW6A 4X3JA 5CSHA 3GOKA 3SW7A 5EYCA 3MBLA 4QQTA 4XV9A 4ACMA 4EEVA 4O7NA 1J3HA 4A9RA 4AGUA 2WTJA 3SOAA 4E6AA 3L9PA 4F1MA 1OPJA 2FSMX 5LWMA 3A62A 3Q9XA 1Z0SA 2ZV7A 3VA1A 1OKZA 1YVJA 4M3QA 3CKXA 1B6CB 2QOKA 4IAYA 4NCTA 1UWJA 1TQIA 2F7XE 5J5TA 4FNWA 3QQKA 5CQWA 5BNJA 2JBPA 2X4ZA 2VX0A 3FL4A 4GG5A 4L7SA 5EI6A 4RJ8A 5C1QB 2HXLA 4C3FA 3FJQE 3HA8A 3F2NA 1OIQA 3GOPA 4B8MA 4JJRA 4PDYA 5E8XA 3BL7A 2GCDA 4OAUC 3BCEA 4FSTA 1YDRE 3FQHA 3AC4A 4U44A 4GYGA 1CMKE 5J79A 4IAKA 5CEMA 4AZVA 2IG7A 4R8QA 4EUTA 1VYWA 1YRPA 4FZ6A 3H4JA 4C4IA 2FA2A 2Q5FA 3VNTA 4R78A 5EJIA 3WI6A 2Y4PA 4I0TA 3VUMA 3NR9A 2XAOA 2VWYA 5B0XA 3HA6A 4XLIA 3LZBA 5M4IA 4CYJA 4BI1A 3HRBA 4F63A 4L43A 4UMRA 4RX5A 1LR4A 5A14A 4KINA 4C62A 4X3FB 4ZOGA 3AD6A 4AXAA 4RWLA 2WXVA 3GCUA 3NIZA 4FZDB 4ZK5A 4FTAA 3VWAA 1PMVA 3SHEA 2OW3A 4FKGA 5HI2A 5K3YA 3QD4A 4WSYA 2OO8X 1QWTA 3LXKA 4C57A 4D9TA 5D12A 3DSHA 1GJOA 4DH8A 5LMKC 4ZMFA 3BHYA 4AN2A 4S34A 3GC0A 4U3YA 4EH5A 3UE4A 1L3RE 1A9UA 2PE2A 2OWBA 3HUEA 4AXFA 2NPQA 4YZNA 5IA5A 5KUPA 2ZM3A 4OLIA 4RA4A 4DEAA 4F7SA 1U0TA 3G5DA 4FJVA 2W5HA 4XMOA 4DH5A 5J1VA 4ZTHA 4CFVA 2HOGA 3QX4A 3H9RA 1P2AA 4KB8A 4RIWB 5HG7A 2ZYBA 3HMMA 4N70A 2GFCA 1MQBA 5CANA 2QOIA 1APME 3OTUA 4MTAA 3D5UA 4RZVA 4E5BA 5CALA 2W99B 2XIRA 2QOHA 2R3LA 4DDGA 4IJPA 4R5YA 4OTPA 2PULA 2PYWA 1K3QA 1UVRA 4BTKA 5KMOA 2HZNA 4EK8A 4D9UA 4ZZMA 4E4LA 4FSNA 2F2CB 2GNJA 1XJDA 3WILA 5IH6A 2PVKA 5HCZA 1KV2A 4AT4A 4IFCA 3AGMA 2ONLA 2P3GX 4EYJA 2BCJA 5AP7A 4S32A 3LE6A 3MW1A 1QCFA 2R3QA 3RAHA 1XMLA 2CCHA 3LXPA 2AC5A 3EQBA 1F0QA 2Z7RA 4IC8A 3H10A 4J7BA 2ZB1A 3IGGA 5LCKA 3L8VA 5AIKA 4MXOA 5L6PA 4TL0A 2GHLA 4J96A 3S2PA 2CKEA 4J71A 5KHXA 2V62A 4EJ7A 1JPAA 2OU7A 3VQUA 4FSWA 4PNKA 5I9XA 4AXDA 1Q41A 3RJCA 2BROA 3FHRA 4LFIA 1FINA 4AE6A 1RE8A 4RIOA 4UYAA 1GIHA 1HCKA 2ETKA 5T6KA 4FKTA 2RG5A 2YWVA 5HIBA 5GINE 2R64A 4KBCA 3AT4A 4GJ2A 4L46A 1KE7A 3DJ5A 3SG8A 3T9IA 2CKPA 5GJGA 3RK7A 2ITZA 2RFSA 4I92A 5HU9A 5I5ZA 3BU3A 4D2RA 1AD5A 4R7BA 5FBNC 5H8BA 1TKIA 3MN3A 4ACDA 3HECA 5L2IA 2C0OA 4YR8A 3ZFXA 2NO3A 1V0PA 1QU5A 2G2FA 4DY6A 1YT5A 3GC7A 3VUDA 4RIYB 4F6UA 3SOCA 4IDTA 1M7NA 3P7CA 4AWIA 5FTGA 2C6TA 1ZYJA 3WOWA 3C7QA 4WT6A 4D2TA 2HW7A 1IAHA 1OKYA 2QQ7A 3QRTA 5EW3A 4H87A 4CMOA 3GCSA 2R3KA 3WF9A 2XKEA 4M0ZA 2XNEA 2XUUA 4H39A 3V8SA 3V04A 4C2WA 1ZLTA 4FKIA 4QTDA 3PUPA 4G1WA 1U7FB 4PY1A 2P55A 4OUCA 5L6WL 3UOTA 5IDPA 2PZYA 3ORZA 4FV7A 3CC6A 5IKWA 2HWOA 4EC9A 4GT4A 5KHWA 3I6WA 4C59A 1DEVA 3PPKA 3FC1X 5B2KA 2J90A 1ZOEA 1DI9A 2YDJA 4HVDA 2QOQA 3GCVA 4BZNA 4WBBB 3EWHA 3SAYA 1PMEA 2J7TA 4G34A 3MH1A 4BDAA 3AT2A 5HE2A 2R2PA 3DB6A 5CEKA 5IDNA 5IISA 5C4LA 3U87A 3LFQA 4O27B 2EXMA 3MPMA 2R3JA 4AA4A 3A7HA 3OEZA 2A2AA 3OWKA 2J0IA 3FMEA 3FMMA 3OUNB 3P4KA 4I6LA 4DF3A 3K54A 3LFSA 3C4CA 4NZWB 4OTIA 4IWQA 3TEIA 3WARA 4EH3A 2PVMA 4MHAA 3JUHA 4N6YA 3PFYA 1H1SA 2W06A 2OK1A 3MA3A 4BCMA 1XBAA 4ID7A 1LP4A 3AQVA 2KFUA 2X7OA 3DU8A 4RRVA 4IZ5A 3VN9A 4AA5A 5K0XA 4RG0A 5LVNA 3RGFA 3ODZX 2ZFYA 3QGYA 4H1MA 4RX8A 4O0XA 1WFCA 4PPCA 3KVXA 5HOAA 4BJJB 3E7VA 3NFGB 4OTWA 1JWHA 3M11A 2VTOA 5CX9A 2B9IA 2V7AA 4IANA 1KE5A 3TIZA 4NM3A 4WHZA 2JKMA 5KCVA 2UZNA 2PZ5A 4I5MA 4K2RA 4BCQA 2YM8A 4PPBA 2V22A 4PTGA 4QT1A 3E7OA 4APPA 3R1YA 1G8JA 1G8SA 1F3MC 4BB4A 2VTAA 4O1PA 3QC4A 2XZSA 4MVFA 1F5QA 5JKGA 4QCJA 3BHTA 1FVVA 4QP9A 4GMYA 4D9VA 1G8AA 3HV4A 1PXOA 2WOUA 2G2IA 3UOJA 4K8AA 2YIXA 4FV1A 3ENHA 3EQCA 5FDPA 3F6XA 3CE3A 5DRDA 4AN3A 1BX6A 2CLXA 4QDEA 3RAIA 3FMKA 3RK5A 3VS2A 3LLTA 4EOIA 3VVHA 2ZDTA 3VUGA 4EOPA 4I22A 3CLYA 4G31A 5IQEA 3CP9A 5ANDA 4A9YA 1H0WA 3FC2A 4IVDA 3OBGA 3W0MA 3MJ2A 5KKRB 4PDSA 5AR8A 4YZBA 2UZEA 3AFOA 4G2SA 4F0IA 4O4EA 4O4BB 1K3AA 3C0GA 4BKYA 5L3AA 1SNXA 4M67A 4KA3A 5AUXA 5L8JA 3ZM4A 4V24A 4CV8A 1TQPA 3EN9A 3DNDA 3W33A 2X9EA 2JDOA 2PSQA 4M68A 2OZOA 1Y6AA 2UW3A 2VZ6A 3QQJA 4M97A 3OROA 3LIJA 3R8VA 4ACCA 3FAAA 3BYMA 3CBLA 4O6LA 3R21A 4AG8A 3O7LD 4PL5A 4KKEA 1BLXA 3NUYA 5HEZA 1YXUA 4FTKA 4U5JA 5DT4A 2RL5A 4H05A 4DHIB 4LGHA 5HE0A 4LYNA 2ERKA 4QMWA 3MH2A 3C9WA 4MD7E 5K5NA 4GT3A 1PY5A 3RCJA 3RAWA 2W1EA 1R3CA 3SRVA 4YMJA 5AP2A 2CNUA 3ANQA 1OECA 4IB5A 3OT3A 3HRFA 2WTKB 4AW1A 3MB7A 3PO8A 2F2UA 5HNIX 4JQ8A 2YISA 3KKVA 5LJJA 3OUKA 2UZBA 3ZDIA 5E8YA 4IACA 3ZTXA 5FEEA 3R1QA 3KEXA 4Z55A 4JMQA 1XKKA 1OGUA 3ZXTA 3O5AA 3UNJA 4MNEB 3ORPA 4EBWA 5BVDA 4WA9A 5LOHA 3SDJA 1QMZA 1LUFA 3F3UA 1KOAA 1J4QA 3LLAA 4UALA 4O2PA 2JFMA 3NW5A 5ETFA 3PP0A 4AQCA 5IQHA 5J9YA 4L3PA 4X3FC 2IEWA 3PJCA 2CHLA 2XIZA 4F9WA 2ITNA 4FGBA 3VHKA 4USFA 2QV7A 4FT5A 3GU5A 3TXOA 1BL6A 5JK3A 4O7LA 4FSRA 3BYUA 2UZVA 5CSWA 4QYYA 5FXQA 4O84A 2HENA 3MY1A 5HCYA 2W1FA 1OL2A 4XG8A 3NVMB 3B2TA 2WMRA 4IVBA 4BCIA 3ZZEA 4XX9A 2WMBA 3Q53A 5B7VA 4EH6A 2QKRA 4EL9A 3F2RA 3ZC5A 3TJCA 2HIWA 3O2MA 3RP9A 4FSMA 1O6LA 2PUIA 3TV4A 2ZDUA 3MB6A 3R7OA 4L67A 4NYEA 2Q0BA 2PIEA 2YHVA 5C8MA 2VTRA 4O0YA 2EU9A 2P33A 4MEDA 4YC6A 3BYSA 3Q4CA 5KNJA 1UU9A 4XRLA 5BYZA 1OIUA 4WUNA 1OKVA 3VJNA 2VWZA 3I5NA 3BGQA 5IQDA 3FMNA 4HGSA 5L2QA 2XIXA 4AW5A 3TWJA 4EWHA 4MQ2A 5BPYA 3L9LA 3LQ8A 3AMBA 4I23A 4ALWA 3CQUA 1G88A 4DHJA 4CMUA 3MESA 2E9OA 4Y72A 1H24A 4W4WA 5EYDA 2R3GA 4OT5A 5KE0A 5D7VA 3TV7A 3V6SA 1YWNA 1MQ4A 5I9ZA 4KS8A 3MI9A 3R02A 5IA0A 3R30A 3UBDA 5EDQA 4R3CA 4N0SA 2G1TA 4Q2AA 2WMTA 3BLQA 2O64A 2Y9QA 5E8VA 1ZY4A 3CQWA 3BRBA 4K9YA 1Q5KA 2C6OA 3E8DA 3ORTA 5DGZA 3CY2A 3AT3A 5EW9A 3TTIA 5IA1A 1WVXA 4FUXA 2CLQA 5CSVA 4NWMA 5CXZA 3FQEA 1DMZA 3QWJA 4BCOA 4ZJVA 1CTPE 4RGJA 1TQMA 4IMYA 3NUXA 4FTOA 1QPCA 4JLCA 5KZIA 1Z57A 4Q9ZA 4EH8A 3R2YA 4FIFA 4EZ7A 3GT8A 2JAVA 3QQUA 4NM7A 1Q24A 4ASZA 4NCTC 1K2MA 4CTBA 3A7JA 3BZ3A 4IX3A 2UVZA 3CTJA 4FIJA 4JBVA 4QOXA 2UW4A 3UDZA 3TKHA 1M17A 4X6QC 2YAKA 3DDQA 4EH2A 5CU0A 2FEZA 1UNGA 3GU4A 3CXWA 3I4BA 5JRSA 2AC3A 4ZSEA 3BE9A 3LCDA 3QQFA 4AA0A 4DC2A 1E9HA 3GVUA 3L9MA 3LPBA 3QBNA 3DS6A 3DKOA 4X0MA 3GP0A 4OBQA 3REPA 3LCKA 2XYUA 2C6DA 3NYVA