3I6WA

Structure and activation mechanism of the chk2 dna-damage checkpoint kinase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
410
structure length
369
Chain Sequence
PWARLWALQDGFANLECVNDNYWFGRDKSCEYCFDEPLLKRTDKYRTYSKKHFRIFREVGPKNSYIAYIEDHSGNGTFVNTELVGKGKRRPLNNNSEIALSLSRNKVFVFFDLTVDDQSVYPKALRDEYIMSKTLGEVKLAFERKTCKKVAIRIISKLNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFPTYLAPEVLVAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and activation mechanism of the CHK2 DNA damage checkpoint kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase Chk2
total genus 103
structure length 369
sequence length 410
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00498 FHA FHA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3i6wA03
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 3i6wA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3i6wA02
1NXKA 3QX4A 4FSNA 2X8IA 4LGGA 3EL8A 5EOBA 2UW6A 3C0HA 1X8BA 1XH7A 4DAWA 2WQEA 4RC4A 4XJ0A 3P9JA 2PVHA 3A7HA 3VVHA 5B2KA 3SG8A 1G3NA 2UW4A 3V5TA 4XRLA 3EQPA 4JLCA 3LMGA 2OF4A 4WG4A 3NUUA 4N6ZA 3TKUA 4DFUA 5C4LA 3IKAA 4H39A 1PXPA 2WEVA 4YJRA 3AMYA 2G01A 3OWJA 3PY1A 4G9CA 4QQCA 5K3YA 4APPA 2UVYA 1ZOHA 2B7AA 1Q99A 4NKSA 3RNYA 4FNXA 5EQPA 2RKUA 5F4NA 3QWJA 4BCNA 4FIHA 4JVGA 1FGKA 3C0GA 2V55A 3EZVA 2QO7A 5HTBA 4PMMA 3MTLA 2YA9A 4CQEA 3RHXA 4JT3A 2RGPA 2UW3A 3KFAA 2P55A 3BV3A 3DQXA 3NUXA 4HVIA 3OZ6A 1IA8A 3IW7A 4A07A 1QMZA 1ZY4A 4JXFA 3ZEWA 1IAJA 2VTAA 1UNGA 2WKMA 2W5BA 4PY1A 4FKLA 3HMOA 5LVLA 5L6WL 3SRVB 3MPAA 4DE4A 3CQWA 4HZSA 4QP9A 3SAYA 4AGDA 3KXZA 3R71A 3POAA 4IVCA 3TJDA 5LVNA 1U54B 4ZK5A 4BCFA 4GIIA 3RM6A 3MB7A 5JH6A 1PXMA 1FQ1B 1VEBA 2E9NA 2ZOQA 4X2KA 1GZ8A 5DA3A 1KOBA 3PXFA 4IVDA 4IM2A 2ZMDA 3C4CA 2C3KA 2QOHA 3G9LX 5TF9A 4O2ZA 3PVGA 2YM7A 4LL5A 3FPMA 2Q0NA 4RVMA 3FZPA 5D7AA 2XUUA 5AWMA 2W7XA 3AQVA 4MBLA 4PWNA 4FIFA 3S00A 2J0KA 3IDBA 5D12A 2W1ZA 1LPUA 3V04A 4AZEA 1B6CB 2BDJA 4MAOA 3TIZA 3MVHA 5ANJA 2QQ7A 2B55A 4G31A 4IW0A 3UOTA 3FYKX 1ERKA 3FSFA 3QCYA 3LXPA 1BKXA 5CLPA 4YZBA 1UNHA 4RC3A 2W1FA 4O0UA 2JIUA 2DQ7X 4EOMA 4QRCA 4WNOA 4BZOA 3EFJA 2C5VA 4FYOA 4JBPA 1K3AA 1ZY5A 2HAKA 3FQSA 3ZFXA 4AFJA 1SVHA 3HA6A 2ITOA 4AGWA 2DWBA 4DITA 3D83A 3BYUA 4P4CA 2RSVA 4RZVA 4U8ZA 3IW4A 1ZLTA 2YJRA 3AC2A 4IAFA 4U80A 3HUBA 3HV7A 3VA1A 4PTEA 4QP4A 4E73A 4S31A 5CAUA 2A0CX 3IOKA 1M2PA 2BZIB 2CKEA 4RIYB 3VWAA 4FVPA 4CFFA 4D9TA 5HE3A 3MH0A 1PMUA 1HCKA 1YDSE 2UZVA 3DV3A 3OS3A 3Q4CA 4GJ2A 4ANLA 1L3RE 4AT3A 4EQMA 2BHEA 4B99A 4R3PA 4GRBA 3TXOA 3G2FA 2QLUA 3QQKA 3LJ0A 3MYGA 5A54A 5I0BA 1KUTA 3E8DA 1OBGA 3P08A 4PPBA 3IQ7A 4I94A 4M68A 3QTIA 2VRXA 4DEDA 4RZWA 1H1SA 4C3FA 1PYEA 2BUJA 4BDHA 5CAQA 4O21A 5AP2A 3UNJA 2OLCA 5M06A 3MVMA 3UNKA 2BKKA 3W16A 4J1RA 3WIGA 4ZSAA 3ACJA 3I4BA 3DOGA 5AR2A 3BV2A 2C6TA 3DXPA 2X1NA 4TW9A 4OTIA 4B7TA 3GVUA 4YZMA 5FM3A 4KIOA 4YNEA 4CMTA 4E26A 4EOIA 5LMBA 4TWOA 3C13A 2IN6A 3ORZA 1VR2A 3LE6A 5HBEA 2WOUA 3LLTA 4QNAA 5AIRA 2NRYA 2UZDA 2ZM1A 3M11A 3EQFA 3FLNC 5FDXA 3VPYA 4WNPA 5GNKA 3LQ8A 3KT9A 1FVTA 4KS7A 2V22A 3UOLA 4TKSA 4BTJA 5HO8A 3VBYA 3NX8A 2I0EA 3VF9A 4RX5A 3LMIA 1MRUA 2BRBA 4RVKA 3SVVA 5CEIA 2G9XA 2X8DA 1STCE 4KB8A 4I6BA 4AXAA 2WMXA 5DEYA 4LM5A 2VWZA 4YJUA 5EDPA 4DT8A 3HGKA 3A62A 2NP8A 4NSTA 3D2KA 2G2HA 3NSZA 5L2WA 4IB1A 1OGUA 5HEZA 2WGJA 5H8BA 4FKRA 3RCDA 3ROCA 5J5TA 2Z7LA 3PA4A 1YRPA 3DAKA 4I1ZA 5J95A 3RPRA 3RKBA 4E6QA 2XKCA 2F7ZE 3MS9A 3TZMA 4KBCA 2YIRA 2GMXA 3EB0A 3VHEA 4IB5A 2OJGA 3R9OA 4JDJA 4XUFA 3UBDA 3MV5A 2GSFA 2W1IA 4ITIA 5DEWA 4DC2A 5A4TA 4XG9A 3UOJA 4HPTE 4PPCA 2BR1A 4RFMA 3SXSA 3OW4A 4OBOA 4QMTA 4F4PA 2XNNA 2X6DA 4CFVA 4BDGA 3PLSA 3H9OA 3CE3A 4RIYA 5L2TA 1J7IA 4WRGA 1RW8A 3VC4A 4L7SA 2JDRA 4FKWA 3JY9A 3OCTA 4XBUA 2FB8A 3LM0A 1YOJA 4GT4A 5CVHA 3DBCA 1L8TA 3LJ2A 3S3IA 4BDDA 4ANNA 1KV1A 5CU6A 4ASEA 2UV2A 4C7TA 3VJOA 5IA4A 3KQ7A 4FV4A 3E93A 4XS2A 5FEEA 4DGLC 3A60A 3RCJA 2ONLA 4F1TA 4F09A 4IX5A 2IVSA 3N9XA 3DY7A 4XG4A 4NTSA 5KO1A 3UDBA 5JGAA 4F64A 5B7VA 2QNJA 1H28A 5CTPA 2V7OA 4UXLA 2VTRA 2H9VA 4JDHA 1YKRA 5EFQA 4ALWA 3KA0A 3IK3A 2ITYA 4O86A 3R04A 5DNRA 1UWHA 3TDVA 5M07A 4ZTQA 1FHRA 5EHLA 3OOMA 3FQHA 1UNLA 5IQIA 1RDQE 1FPUA 2BFYA 3FZ1A 3PVWA 4UMTA 1GOLA 4J53A 5BUIA 4FTOA 5CS6A 4ANOA 3VS6A 1Z5MA 2PVRA 1OZ1A 4ZS0A 3JY0A 4PMSA 3QU0A 4ANMA 3NWWA 1YHVA 2R5TA 2VUWA 4DGMA 4ACDA 3F3VA 4YBJA 5ETCA 1YDTE 2XZSA 3TZ8A 3JYAA 4EHZA 3RK5A 3QL8A 2R3JA 5AX3A 3ID6C 4FSYA 3RPYA 4HGLA 2VTHA 5DLSA 5LCKA 4HW7A 5AA9A 3QA8A 3LCSA 2IZUA 2OXYA 4RC2A 1OITA 1WMKA 2UZOA 5IQAA 5AAGA 1M14A 2R3GA 3KN5A 2BDFA 2CSNA 3OWKA 4Y5QA 4JR3A 2XS0A 5IMEA 3VBQA 3F5UA 3FLQA 1OPKA 3DLZA 3KXXA 1QPCA 4G3GA 4UEUA 3UP7A 1WV3A 4ORKA 1H4LA 4LOPA 2IVVA 2P2IA 2C6LA 5E8ZA 2C6MA 1SZMA 2EXMA 3GCSA 3QUEA 2JKQA 3DQWA 3R6XA 3SA0A 4WIHA 1APME 2W05A 2HZIA 5L3AA 3QTQA 2QHMA 5IA2A 3CJFA 3ZDIA 2YWPA 4X6QC 3MTFA 3WILA 3I79A 4O7VA 5HKMA 3LCOA 3NUYA 2JFMA 4QMZA 4RX7A 4O91A 2OF2A 4FV7A 4KKGA 4ZSLA 1PXOA 4GK4A 3VQUA 5DI1A 4BFMA 4NW6A 2WMUA 2B9FA 2R7BA 3W55A 2UVZA 5T68A 1RE8A 5HO6A 2W96B 3KEXA 5ANEA 4TXCA 2IVUA 5L6OA 3COIA 3PIZA 5AM7A 1R3CA 3CBLA 3AD6A 4HPUE 4QMLA 3G9NA 5IA5A 3BCEA 2CJMA 3BZ3A 2UW7A 1OPLA 4QTCA 1JNKA 3H9FA 4MX9A 2YM4A 4WHZA 3M42A 1CSNA 1Q8TA 3BHHA 3FHRA 2XK3A 5DVRA 2JPEA 1H1RA 4YTCA 3PIXA 3F82A 4IBMA 5BVNA 2FH9A 2CGUA 3QCSA 3NRMA 3ZO4A 4G5PA 5G6VA 3W2CA 3EQCA 1DI9A 3QRJA 4PX6A 3DNDA 3QYZA 3TV4A 4Z16A 3TL8A 3F69A 3Q53A 1QCFA 4IEBA 4X2NA 1QPJA 2BAQA 3UC3A 1H1QA 2J0LA 4BDIA 4ZIMA 3W33A 4OR5A 5IQGA 3L1SA 4YJQA 2OJFE 1SYKA 2QCSA 2B54A 2GHMA 2XIXA 5CEKA 4RG0A 4CLJA 1Q62A 2Q0BA 4L8MA 5AV4A 3ACKA 4FL1A 2RFSA 4V04A 1LR4A 5M44A 3HX1A 1BUHA 2YWVA 3CEKA 4EOJA 3ZFMA 4RJ3A 4CZTA 4D0WA 5CVFA 4A4XA 5A4CA 3AC5A 5KBQA 4RJ8A 3GU7A 4A4LA 3GENA 4YJVA 3UZTA 4CKRA 2SRCA 4LV5A 4MXYA 4BI2A 4O7WA 4WOVA 2BFXA 3LJ1A 4B8MA 4E5WA 5B2MA 3H4JA 4S2ZA 4OAUC 4MH7A 3DFAA 4S30A 1QPDA 2XP2A 3MFRA 2VWIA 4CG8A 1YXTA 3PWDA 5D10A 5EHOA 2GPHA 3QQGA 2I1MA 4YTHA 4YPDA 5AA8A 2F2CB 3POOA 4J52A 5M55A 2R9SA 1EH4A 1VJYA 3LM5A 3P23A 4Z9LA 5JK3A 3NS9A 5IQHA 3RMFA 3O7LD 3QQJA 3BU3A 2PPQA 4XMOA 2C3JA 4YNOA 5M08A 4IAYA 3DKCA 5C4KA 3DGKA 5A8IA 4YC3A 5HBHA 3R2BA 4YTFA 4H36A 3R00A 2B1PA 2J50A 2Y4PA 3ORNA 4FICA 3IG7A 4EK4A 5LCJA 3QRKA 4ERKA 1XO2B 2UW5A 3A7GA 1TQMA 5HOAA 2ACXA 3OBGA 3PDTA 3GEQA 4YLKA 2E2BA 3WF6A 4F1OA 3DXQA 3L9PA 4XYFA 5CI7A 5ITAA 2FSTX 5K4IA 4TN6A 4ERWA 5CEMA 4CTCA 2G2IA 4DN5A 5CF5A 3SW7A 1MZKA 3GGFA 2A2AA 4GG5A 5F20A 5HNBA 4LL0A 3POZA 1P2AA 5IH4A 5E8VA 3BWFA 3EFKA 2KFUA 3CJGA 3CPBA 3TV7A 4F6SA 3U9CA 4FTRA 1OKWA 2C3IB 1OL5A 2JITA 1XH8A 3FI2A 1SNUA 4CSVA 4CVAA 3IGOA 2C0IA 2PZRA 2VO7A 1XH4A 4C3PA 4QP2A 2CLQA 4XBRA 4V01A 4CZUA 4WRSA 3R01A 5FBOA 3OUKA 3V5QA 2YAKA 2XIZA 4PNKA 3KMWA 4O81A 4MXXA 3O17A 4FODA 4TT7A 5GZ9A 1JPAA 3G15A 2OFUA 5BQ0A 4G6NA 5IQEA 2BRGA 2O63A 4EOOA 5DR2A 4RJ6A 3LFSA 5FDPA 3OBJA 4E3CA 1WBVA 2C0TA 5KE0A 3HUFA 3DKGA 3RNIA 1BI7A 3HEGA 3F5GA 4ZXTA 4DCEA 5AFVA 1W8CA 2JKMA 2CN8A 3BYVA 3BIZA 1OBDA 5IF1A 3OUNB 2REIA 2JBPA 3QZFA 4DH3A 4YZNA 3OT8A 1U5QA 3MWUA 3WE4A 3QUPA 3OWLA 3E64A 4H1JA 3R8ZA 4QTBA 2A4LA 3LW0A 2ITNA 3PPZA 4HCUA 4ENXA 2QD9A 4TWCA 5A14A 3QXPA 4IE9A 5LXMA 4EHEA 2ZV8A 1ATPE 2X7FA 4KWPA 4FKGA 5AP6A 3MB6A 4O6EA 1LUFA 2R0UA 1K2MA 3R8VA 3F5XA 4DFNA 3MA3A 3I81A 3LZBA 2XK8A 1M2RA 1JLUE 3C5UA 4AG8A 4ZLOA 4GKHA 1DM2A 3FMKA 1FVRA 4DEIA 5FEDA 3UIUA 4K18A 4B9DA 3UE4A 4OTWA 4XP2A 4LI5A 4GFMA 1PY5A 4N4SA 4NWMA 4R5SA 4MQ2A 3F9NA 4EKLA 5GINE 4AT5A 1ZZ2A 4ENYA 2X0GA 4LRMA 1P5EA 4HOKA 4NFNA 2I0HA 2PVLA 5K0XA 4DFLA 3F3ZA 4YJOA 5M57A 2YACA 5JRSA 4GEOA 4OW8A 2DS1A 3O23A 5M4CA 3I0MA 3UO5A 2ITZA 1BX6A 4LUEA 3W2OA 4KKEA 3ZYAA 4M0YA 4FL2A 4YZCA 3RINA 2O3PA 2PZPA 5EDQA 3QCXA 4C2WA 1A06A 3TNWA 4WKQA 3QKLA 4GL9A 3WIKA 4USDA 5HCYA 3DBFA 3ROYA 3QF9A 3RAWA 3Q96A 4W4VA 4EQUA 3FC2A 4O7NA 2JAVA 3LFEA 4GMYA 3NUPA 4N70A 4QYHA 4FTMA 3W1FA 3VUMA 4EKKA 3RZBA 4BWXA 2BAJA 5FXQA 3K5UA 4FIJA 1GAGA 3PY3A 5CENA 4V05A 4J8NA 4MVFA 3Q9YA 4QO9A 2BAKA 3FMHA 4MXCA 3BEAA 4G17A 4BIDA 5LMKA 3A4OX 3D14A 4I93A 3QALE 4GT3A 4LMNA 5CT0A 3SDJA 1DAYA 2BRMA 4MNEB 2IO6A 1H24A 2XT9B 2W9FB 3OW3A 3QUDA 3KN6A 5C9CA 4AWIA 4Z55A 5IDPA 3MY1A 1J4QA 3FXXA 4AN3A 4QQTA 3H10A 4Y95A 4CD0A 2WB8A 3HRFA 4II5A 4PV0A 1GIHA 2YIXA 4FZFB 3MFSA 5HE2A 5IUGA 4FKVA 5T3QA 3C51A 2HW6A 3UQCA 3BYSA 2QODA 4C34A 1UA2A 3P1AA 4LG4A 4HYUA 5ACBC 3TTJA 4G3EA 2CGXA 1OUYA 3RZFA 4A7CA 4ONAA 2IZSA 1H00A 4HGEA 3HAVA 2QO2A 4H1MA 1URWA 3PUPA 2FO0A 3NUAA 2VTOA 2XKFA 4L42A 3VULA 3ZO3A 1KE9A 3PXZA 2PMIA 4U5JA 3CQUA 3KK8A 4HVSA 2C0OA 3NYNA 2ZAZA 1IA9A 2WHBA 1PMVA 3ZCLA 4DF3A 1YOLA 4A9YA 2XCHA 4RWJA 2HK5A 3AD4A 5GHVA 3QGYA 4YHTA 3ZZEA 4DINA 2C4GA 4E93A 2YCFA 4U3ZA 4IIRA 4JG8A 3HECA 3D5UA 1SVEA 3QRIA 4PMTA 4APCA 1NVRA 2PVKA 3ODYX 4TWNA 4ZSEA 3WZJA 1JBPE 1NVQA 3TJCA 3PJ1A 3DPKA 3AGMA 2QU6A 4BHZA 4BDAA 4DCAA 2Z02A 3FZSA 2WMWA 4RWKA 3A7IA 5AUWA 3LCDA 3ORTA 4GYGA 4IX4A 4JQ8A 3LPBA 1FVVA 3HKOA 3K3JA 5AP4A 3TIYA 4FBXA 2ZB1A 3U6HA 5JQ5A 3VRYA 1YJ5C 4YTIA 3KULA 4RIOA 5BVWA 4U41A 2F7EE 3R30A 4CEGA 5M56A 4OTRA 4OBQA 2YITA 3FLYA 5H8EA 3QXOA 3T8OA 3Q2JA 3CXWA 4EOKA 4P7EA 3ZDUA 4QYEA 5AUVA 3L8PA 4AQCA 5J1WA 5EDRA 2XBAA 3MDYA 5E92A 1KOAA 1QU5A 2F7XE 3BYMA 3DA6A 4O0TA 3BI6A 3BWJA 2FSLX 5JN2A 3SLSA 1OB3A 4AUAA 1R0PA 4USFA 4UMPA 3FQEA 2OSCA 4Y73A 3FLSA 1QL6A 4BTMA 4O0WA 3UN0A 2W4KA 3GI3A 4GUBA 4PQNA 4XP0A 3OMVA 4S32A 5HTCA 2BTSA 4RJ4A 4U6RA 4IQ6A 1OKZA 4BDFA 2W5HA 5CSXA 5JKGA 1XWSA 3PJCA 5DWRA 4NTTA 3OFMA 3KRLA 3VJNA 3UMZA 1Y6AA 4BDCA 3P86A 4L52A 4MF1A 3G0EA 3RVGA 3MY0A 3JVRA 4BR3A 2CKOA 3TG1A 2W4JA 2HELA 3AXWA 3IDPA 4M69A 3T9IA 2R3HA 4FNWA 4D5HA 2Y8OA 4MQ1A 5CSVA 3TCPA 5IQDA 1OL6A 3OCGA 4IACA 3BGPA 4BKYA 3LFBA 4YO4A 3ALNA 4IDTA 3QTSA 3OXTA 5E8YA 2YLFA 3V8SA 2J5FA 5HLNA 2XMYA 4RT7A 4DEBA 2PUPA 5GZAA 4CFWA 4EONA 2XNOA 4LMUA 4R6VA 4FSTA 4DEEA 4F63A 3CPCA 4RIWA 2RG5A 3ANQA 2OZAB 4EH9A 4F1MA 4FUYA 4IB3A 5M51A 2PWLA 1J4OA 3F3WA 3JUHA 4XP3A 5CVGA 5FXSA 2OJ9A 5J7HA 2PYWA 3N4VA 5HHWA 2I0VA 2JDTA 2UZTA 3FXZA 3TKIA 4PTGA 1B39A 4RLLA 4XV1A 1G8AA 1CMKE 5FBNC 4L45A 3EH9A 2IW9A 3A4PA 3R7YA 1Q97A 4FTAA 4S34A 3UZRA 4XX9A 4D5KA 4F0IA 4PDYA 3ZSIA 2Y7JA 3CS9A 3PSCA 5EYMA 3DU8A 3FLZA 4FV3A 1NVSA 3TNHA 4CYIA 3OCBA 5CQWA 4EJ7A 4E5AX 3LHJA 3ORPA 3BBWA 5AJQA 2XNMA 4FEXA 4JRVA 4PTCA 4CV9A 4YSJA 5FTOA 4C3RA 1XR1A 4JRNA 3II5A 4O1PA 1J1CA 2JC6A 2HY81 1Q8WA 2Z7QA 3GP0A 3KF7A 4F7JA 4QCJA 1ZWSA 5IG1A 4L7FA 4LOOA 3WE8A 5DPVA 2QVSE 3IGGA 1PXJA 4MWIA 4AW1A 3RBWA 1PKGA 4N6YA 5FEQA 1J4KA 3R8LA 2C6EA 2YDJA 4FK6A 4E6DA 3EQRA 5BNJA 1UHTA 3EOCA 3F88A 4EH3A 4XNEA 3ZRMA 2WD1A 3O51A 4XHKB 2GNHA 3LVPA 4QP3A 2QOFA 4AW2A 4AFEA 2OJIA 1ZYDA 4BYIA 1H01A 4E1ZA 3KB7A 4F6WA 5HORA 1U46A 3R8PA 4NM7A 1K3JA 3VBWA 4FEVA 2OGVA 2A27A 4F0FA 3HRCA 1UU7A 5E7RA 3UVRA 4I6FA 4BICA 1Z57A 2WXVA 4L43A 4K8AA 4QP8A 3QCQA 5K5XA 2PUNA 2YERA 1R1WA 4O7ZA 3C5IA 1P14A 2VNYA 3TUCA 4OTDA 3LXLA 2JKOA 4DTKA 5TOZA 1MP8A 2PMNX 4ZMFA 4JAIA 3FI4A 3QFVA 4E7WA 5J9ZA 4BC6A 4FZ6A 5LOHA 4MCVA 3NNWA 4UZDA 3ODZX 4FV9A 3TM0A 3QLFA 1AGWA 3R28A 2QG7A 4KIQA 1GIJA 3PIYA 4NM3A 2BMCA 3KXMA 1BYGA 4O6LA 4RBLA 3MY5A 3ZH8A 4D2RA 3GCVA 4CT2A 3C4WA 1GJOA 3RAHA 4DFZE 5EI2A 5EQYA 5FD2A 4FKIA 4JX3A 3U51A 3P5KA 4FKQA 2P3GX 3G6HA 4O0YA 4DBNA 4DH5A 3VS5A 4F9CA 2PZ5A 3OT3A 4K77A 4RVLA 3ZOSA 1OMWA 3COMA 4U0IA 4CG9A 4WSYA 4EUUA 3ZHPC 2AYPA 3KU2A 3SC1A 3TT0A 2VN9A 4KUJA 3OCSA 3DFCB 3WYYA 2VGOA 5L8KA 4Z7HA 3NLBA 3CGFA 3CTHA 5CQUA 5J8IA 4F70A 3LCTA 4H3BA 5H2UA 5CYIA 4R5YA 2JKKA 2HIWA 4AZVA 4EZ5A 4GK3A 1JSTA 1W82A 2P0CA 5CSPA 1LGPA 5GZ8A 1WZYA 1H8FA 5C01A 2X7OA 4AZSA 3GCQA 4X7QA 4ANQA 3GC0A 5CSWA 4QMUA 5BX0A 4PDOA 5KX8A 5FTQA 3SG9A 1Q3DA 3HV6A 2PMOX 4U79A 3V5LA 3RPOA 4I5HA 2ERKA 4OAVB 4F9AA 3WI6A 3PZEA 4FZ7A 4RFZA 5DOSA 5J1VA 4W4XA 3UO4A 3MFTA 3CKXA 4NM0A 3HX4A 3FHIA 4MTAA 1OKYA 2QOLA 4IADA 4K9YA 4N57A 1GZOA 3FZTA 4KS8A 4JS8A 1DMZA 4EZ3A 4ZSJA 4AA4A 1SMHA 4R1YA 4RWLA 4PPAA 3TUBA 2GDOA 2Y6MA 3PY0A 5HESA 3F3UA 3UPZA 2WPAA 4IZ7A 2OH0E 1G3GA 3R7GA 2O64A 4QMWA 4GUEA 4CQGA 4D2VA 1Q8ZA 2GS6A 2PE1A 4NKAA 4FKTA 4PNIA 2F9GA 3FJQE 3R21A 4GYIA 4YJSA 4BI0A 2WOTA 3QQLA 3VS2A 4F6UA 3F3TA 5EM5A 2C3LA 3AC1A 1TKIA 3MFUA 3FMDA 3UNZA 4EK6A 2JGZA 2UW0A 4QNYA 3QRUA 3FMJA 4DFXE 3V8WA 3UV0A 2OKRA 4RPVA 2EU9A 2ITQA 5CAOA 3QQUA 4NH1A 3ERKA 4P5ZA 5E8XA 3ELSA 3LCKA 4DLIA 4NK9A 3OUNA 4W9XA 2FEZA 3KMMA 3H0ZA 4E6CA 1Y91A 4PMPA 4PDPA 3PVBA 3NCGA 4FYNA 5CZIA 3C7QA 3EIDA 2CMWA 2R3RA 4HGTA 4FSWA 3U8WA 2GS2A 5AMNA 3FY2A 1Q5KA 2ZV7A 4DTAA 4FKUA 4NU1A 5J9LA 4BN1A 3MDBA 2J90A 5H8GA 4AU8A 4RX9A 4BIEA 2E9OA 3VS0A 2JDSA 1XQZA 4WBOA 2FYSA 3MPTA 3WF5A 2BZKB 3EL7A 2GS7A 3FMNA 3OTUA 3ZM9A 5HI2A 3EQDA 3DTWA 4ASXA 4IX6A 3R73A 3PFQA 1H1WA 2WZJA 1XH5A 3HMIA 2WO6A 3PP0A 1NW1A 3BGZA 3NYXA 2PK9A 2EB2A 4E20A 4EOPA 5KMMA 4FX3A 3F2RA 2QI8A 3IO7A 5D7VA 3AT2A 1H27A 4RJ7A 3VUHA 4JX7A 4WO5A 3RWPA 5CALA 1VZOA 1MUOA 5E8SA 4OTPA 4DEHA 5DG5A 2WTIA 1J4LA 5A6OA 4JAJA 3TTIA 3DDQA 3I5NA 4K11A 2Z60A 4FZDB 5GJDA 5HVKA 4YHFA 4OTQA 1ND4A 5I9VA 2OW3A 2XNPA 2QLQA 4BBMA 3NYVA 4BZDA 4F0GA 1FBNA 3OVVA 5K0KA 3HL7A 2PZIA 2OIDA 3BELA 1OKVA 3MBLA 3VW8A 3E5AA 2YIYA 4FSMA 4MWHA 1IG1A 3LFNA 3V51A 4ZLZA 4N0SA 4FIGA 3E7VA 4BDEA 4O96A 5KZ0A 4GU6A 5HLWA 3MIYA 3ATTA 5IQFA 3DS6A 4G16A 1M7NA 3GCPA 3HV3A 4J7BA 3CD3A 4NW5A 5E8WA 3ZLYA 2C5OA 1KSWA 4IWOA 5I9ZA 2WEIA 4ZY6A 4FR4A 2B53A 3HMNA 4LUDA 1ZOEA 4FKOA 3VNTA 5HO7A 3SGCA 1YJMA 3C4XA 2G15A 5EM8A 3VUTA 3ZU7A 1R39A 1KE5A 1H08A 3B8QA 3QC4A 5A3XA 4ACHA 1FMKA 2VTLA 5CF6A 5ETIA 2V62A 4G3FA 2W1EA 3CTQA 3W8LA 3GOPA 4HNIA 4DH8A 3P78A 4O2PA 5D41A 4U97A 2E9UA 4ZZMA 4F9WA 2RG6A 3I60A 3LFAA 3GFWA 3I7BA 4U3YA 1G8SA 4GIHA 4W4WA 3QTUA 1AD5A 3LXKA 4I92A 4FEWA 4FTLA 4HCTA 3RP9A 3K2LA 4EK8A 3F2AA 4IB0A 3FAAA 4BF2A 4ACCA 4KAOA 1TQPA 3HNGA 4YHJA 3FPQA 4AW0A 4H87A 2VWBA 4R78A 1CKPA 3D15A 3E92A 4E8AA 4LV8A 3S95A 2OU7A 3TZ9A 3TZ7A 3VS3A 1REJA 4M3QA 4RA4A 3UOKA 2OJJA 3E7OA 2PE0A 4FG9A 4DA5A 2QR7A 3BE2A 3IECA 4IH8A 3QAME 2O2UA 3RALA 4G5JA 5BYLA 5LMAA 2XVDA 4RJ5A 4UZHA 5DR6A 1WBWA 4KIKB 4C37A 3Q4TA 3QHRA 2VWXA 3EKNA 4KKHA 2RL5A 1YXUA 1V0PA 3MJ2A 4FF8A 2VV9A 4IC8A 3VIDA 3ZC6A 3ZM4A 1JSVA 5FP6A 4FV2A 4AOTA 4EH7A 5HD4A 3DLSA 2GU8A 4HYIA 4BCKA 2OG8A 3WF8A 4L46A 2XNBA 4R1VA 5EH0A 3TN8A 2ZYBA 2GQRA 1CKIA 2WIHA 1K2PA 4WNKA 3U4WA 4EOSA 4I3ZA 1Q24A 3VRZA 4YC8A 5CZHA 2WTJA 1OM1A 3GC7A 4Q2AA 5DH3A 2PTKA 2OZAA 2ITWA 2A19B 3C50A 4FTCA 2WAJA 3PYYA 3G90X 4R7HA 3EN9A 5HLPA 3VUKA 4C2VA 1YHSA 2J5EA 3LFCA 5BMMA 5EW3A 3E87A 1FGIA 1YI4A 2XCKA 4W4YA 1YWRA 2OZOA 3AMAA 3THBA 2QKRA 3V8TA 3P0MA 3WBLA 5DYJA 3L8SA 5TE0A 3F6XA 5BMSA 5KMIA 1XBAA 3I0OA 3P4KA 4LQMA 4OLIA 3ORLA 5AP1A 3PRIA 4FTIA 5EYDA 4JG6A 3OTVA 1Q61A 4M8TA 4TYHA 4MD9E 5C27A 4IWDA 5JMSA 3CR0A 3NYOA 4V0GA 2VU3A 2ETMA 3E62A 3P7CA 3FI3A 4BZNA 4O27B 4QMVA 4QPMA 2OH4A 1K3QA 4KBKA 4EYJA 5LWNA 5CU3A 5AR8A 3V3VA 3I6WA 1WVXA 3TEIA 5A4QA 4BVUA 4EC8A 2X4ZA 5DN3A 3C4FA 1FHQA 5JSMA 3WZUA 1GZNA 1TQIA 3SOAA 4RIXA 4R7BA 4YO6A 3UZPA 2R64A 4MXOA 4AA5A 4CRSA 1WVYA 4TYIA 1MQ4A 5C8KA 4FG8A 2GTMA 5EI8A 4W9WA 3CSVA 4A9SA 2I6LA 2E9VA 1OPJA 4GVJA 4XG7A 5IH5A 5AEPA 4EOLA 2VTQA 1ZARA 3BLHA 3QD3A 4D4VA 2ITPA 5JZNA 2JDOA 4QMMA 2EB3A 4ID7A 2HENA 4ANBA 3ORMA 4UN0C 3QD2B 5CAVA 3NNXA 4RRVA 2VD5A 2VZ6A 4L68A 5DBXA 5KHXA 4FMQA 5C1QB 4O0SA 2HYYA 5A46A 1Z9XA 5D9HA 5LARA 4KA3A 2PZYA 1YHWA 4TYEA 4U7ZA 5CXHA 4FV1A 2JAMA 2UUEA 5I9YA 3Q5IA 3I0NA 5AAEA 4E4LA 4X2FA 5HU9A 2B9HA 3TKHA 4JBVA 3D5VA 3DBDA 4EQCA 4XLVA 2WTKB 4AX8A 3P7AA 3Q4ZA 4WT6A 4DFYA 3MW1A 3F7WA 3FI8A 4MXAA 2C1AA 4FTKA 4PDSA 1I44A 3NW7A 5GJFA 1O9UA 3W18A 4BKZA 2X81A 2XF0A 4YLJA 1T45A 3DK3A 2A0TA 3W8QA 3BEGA 4RGJA 3FE3A 2WMTA 2WMQA 1YI3A 3Q9ZA 2X4FA 3DZOA 4UYAA 2Q83A 4C58A 4FZAB 4PL3A 5EYCA 3E3BX 3FMLA 4G2SA 1BMKA 4NCTA 2VO0A 2QOCA 4AA0A 3AC8A 3FXWA 3QTRA 4G2FA 3KRJA 4MBIA 1E1XA 1YWNA 2C5XA 3L8XA 4AS0A 4HNFA 3CY2A 4BKJA 3VUIA 2BTRA 4F7NA 3LKMA 2PY3A 2C47A 4ASZA 3UG1A 2W17A 4OT6A 3NDMA 3CQEA 5E1SA 5EG3A 4XV2A 3GOKA 5C8MA 1M17A 3SV0A 1JKKA 3ZEPA 4FKSA 1J91A 3ZUVA 5FLFA 4DEGA 2ONLC 3HUEA 2YM6A 3KKVA 4ZS4A 3AOXA 2XRUA 3VBXA 2JQLA 5FM2A 4IVAA 4LRKA 1V0BA 2E9PA 3OWPA 3KGAA 4KIPA 4TTHB 3TI1A 5FWKK 3PA3A 4X3JA 5HIEA 3NMUF 4I0SA 3NCZA 4L44A 4C36A 1WFCA 5F94A 4C4IA 3JR1A 4H58A 4J99A 1QPEA 3ZTXA 3PZHA 4BRXA 4O0RA 5AAFA 1XJDA 5AUUA 3U6JA 2BVAA 3TNIA 4BY9E 3SD0A 1WLNA 1IR3A 4QTEA 2WU7A 4TYHB 3K5VA 5M53A 4O7YA 4BHNA 4YPSA 4C4EA 4Z7GA 3GU6A 4K33A 4D9UA 3RWQA 4EORA 5FUTA 1KE6A 2J9MA 3VO3A 3V5JA 1M7QA 1JSUA 1U59A 3UOHA 5LVMA 5HCXA 2WTKC 3BQCA 2R3LA 3EN5A 4I4EA 3KRRA 5F1ZA 3UVQA 5CU2A 2CDZA 4GV1A 1H26A 2KB3A 2ITXA 5AV1A 4WA9A 2OXDA 1YW2A 5BVOA 2IWIA 5LMKC 4CZYB 2GFCA 4JIKA 3KXGA 2XBJA 2XK4A 5BVEA 5LQFA 2F2UA 2X8EA 2BRHA 2YZAA 2P4IA 3G0FA 4GT5A 3NW6A 1SNXA 3UNNA 2KKLA 2ZM4A 5IEVA 2XIRA 4R3CA 2YIWA 3REPA 4EK3A 4DFBA 1R0EA 4U45A 2C6DA 3G5DA 4XEYA 4EK5A 4X0MA 4C4FA 4BCGA 2FSMX 3ZO2A 3ITZA 2ZV2A 4MD8E 4MXZA 3KY2A 3PXRA 3EFLA 4JG7A 1TVOA 4TNBA 2R4BA 3MA6A 3SW4A 5HE0A 1IRKA 4C57A 3QKKA 5LVOA 4ZTHA 3ORIA 4QD6A 3ENMA 5JGBA 2VTIA 3OROA 4H3QA 4MBJA 2PL0A 2XM9A 4UX9A 4UBAA 2PVJA 2X2MA 1Q4LA 2HCKA 2GNLA 3FC1X 4OTFA 2KTYA 4OTHA 3PSDA 5HG8A 4FT9A 3ZBXA 1J7LA 3VUGA 1BI8A 2W0JA 4LYNA 2VX1A 3F66A 4FKJA 4OTGA 3D4QA 2XKDA 3ELVA 4BB4A 5HQ0A 2VWUA 4EEVA 3IDCA 4HVGA 3HMMA 2C5NA 3D7ZA 4OUCA 2EWAA 3R9RA 4UB7A 2WMBA 3TNPC 4YZ9A 1U54A 5IPJA 4E4NA 5DMZA 5EM6A 3C4EA 4I0RA 3E8EA 2C6IA 4X2GA 5TKDA 4JONA 3RJCA 3L8VA 2YISA 4I0TA 3DNEA 3MSSA 4UYNA 1XHAA 4MKCA 2RFNA 3BLRA 4A0EA 3GNIB 4JR7A 3QBNA 3MPMA 5A9UA 2Y6OA 1NY3A 3HUCA 3JXWA 3Q6WA 4FSUA 3VUDA 4ALUA 4CFUA 1E1VA 2Z7RA 1G5SA 3NZ0A 4K6ZA 5T6KA 2QG5A 4GVAA 5ANKA 4C61A 2PUUA 4QT1A 1IASA 4F7SA 5KKRB 5JFVA 4A9UA 2PULA 5AUXA 2AC5A 3FZOA 1DS5A 4CFMA 5EHYA 3FV8A 5D11A 5E1EA 2YCSA 3BHTA 4UY9A 3KREA 1YVJA 3FL5A 3SXRA 4CCBA 4O7RA 5BVKA 4BCPA 2YHVA 2CNVA 3EN6A 4O22A 5I9XA 5JFSA 3MGYA 4EI4A 4ZJVA 4H05A 3D5XA 3A99A 1PXLA 5B0XA 5J79A 1UU8A 4D2WA 3N51A 2WU6A 4XG2A 1R21A 4IAZA 3OXIA 4FTNA 3WZEA 3ULIA 1IEPA 4J95A 4EHGA 4FTUA 2VTNA 2XB7A 5AV3A 3TNQB 3VW6A 4AAAA 2YABA 3KVWA 5AX9A 3R9NA 2KB4A 3UIXA 2YFXA 4IVBA 4Z3VA 3W2QA 4RWIA 2HOGA 3FM8A 4RQKA 5CXZA 3O2MA 3O0GA 3GQIA 2Z7SA 4D4YA 4BGHA 4V0GB 2BPMA 4OT5A 2RFDA 4EH4A 2PSQA 3GXLA 4C62A 4LFIA 3EMGA 3FKNA 5JFXA 5CSHA 1PRYA 2YIQA 4AZFA 1YXVA 4IC7A 4RLKA 3GQLA 3I6UA 4D4SA 3E3PA 2IZTA 1UU9A 3Q52A 4M14A 3RTPA 5CANA 1ZXEA 4Q5HA 2IG7A 3CIKA 4FG7A 3C0IA 3CGOA 4L67A 2WMRA 3L9LA 2GNIA 2YM3A 1REKA 3D0EA 2P33A 3BX5A 4LGDA 2EUFB 3DK6A 3AC4A 3HRBA 4ZTSA 2VTPA 4FNZA 1LEZA 1CM8A 4ZEGA 3AGLA 5AUZA 1YDRE 3PXKA 4CFNA 4ZY5A 1J7UA 4BDKA 1JVPP 1CTPE 4ZTNA 2VO6A 4IX3A 3NW5A 4X2JA 2CKPA 4AZTA 2BROA 3I1AA 5CU4A 5BVFA 4Q9SA 4CYJA 5A4LA 3FKOA 2QR8A 1J4PA 3OF0A 3RHKA 1OI9A 4FL3A 2WQBA 4Y83A 4AN2A 5M4IA 1U5RA 4MF0A 1CDKA 3EQIA 3AMBA 3FYJX 4OBPA 3QX2A 3S0OA 5DT0A 3UODA 1M52A 2BHHA 4C38A 4G34A 4I41A 3R63A 2QKWB 3PPJA 3ZSHA 3NNVA 2QHNA 2AC3A 4EBVA 4F65A 1W7HA 4CRLA 4CGAA 3Q32A 1OUKA 2ZDTA 4Y8DA 3SQQA 3NPCA 3U55A 3CKWA 4YZDA 3NUNA 5FRIA 2OIQA 2JDVA 5DRBA 5KKRC 4ACGA 3RK7A 1MQBA 3VBVA 3FDNA 1FMOE 4EH8A 3HVCA 2QOOA 4WG3A 2EVAA 2R3FA 1YQJA 3V5WA 5IEXA 3WARA 1KE8A 2HWOA 3ZC5A 3RI1A 2FA2A 3ZFYA 4FV8A 2UZLA 4Q9ZA 2R7IA 4QOXA 4ZZNA 3V6RA 3DT1A 2CSWA 4LRJA 5E90A 5HX8A 2Z8CA 3ZSGA 3A7JA 4BYJA 1LGQA 4DTBA 4FNYA 3ETAA 5AUTA 2UZUE 4YJNA 2NO3A 3R1QA 5FG8A 1Q3WA 5IDNA 5GJGA 4AOJA 1YWVA 3R9HA 4FK3A 3NVKI 4IM3A 1ZZLA 4UMUA 1P4FA 5IQCA 4AACA 5C8NA 5LWMA 5L6PA 4C33A 1OL7A 4O0XA 4R3RA 3D7TB 4BDBA 4I21A 4JI9A 1WBOA 1OIYA 3OOGA 4U44A 5AR3A 3KCKA 3R22A 2ZVAA 3EWHA 4FOCA 3ZMMA 3O8TA 1UWJA 2WFYA 2R3KA 1NT2A 1SM2A 1BLXA 5HCZA 4QTDA 3R9DA 3BHYA 4QMXA 2IVTA 1Y8YA 4DH7A 4UXQA 2CPKE 3MJ1A 2VX0A 4MHAA 4D2TA 3GQSA 1ZYSA 3ZS5A 3N4UA 4FI1A 3U4UA 4ZTMA 3HP5A 4O82A 3WZDA 4B8LA 3LOKA 3NAXA 4X3FA 2R2PA 3QGWA 2VNWA 4PL5A 2YM5A 4FC0A 5FTGA 4X3FB 3S4QA 2QC6A 2XJ2A 5HG5A 2PVMA 2I7QA 4HZRA 4ARKA 4RX8A 2PVFA 4M0ZA 3EN7A 3EQBA 3D2IA 5IA3A 4Y85A 3KRWA 4KRCA 3O7LB 3QYWA 4BI1A 1M2QA 3QRTA 4IDVA 2LAVA 2R3NA 5JRQA 3PP1A 4GFOA 5KMNA 3RPSA 3C4ZA 3UGCA 5KMKA 4NYEA 4BDJA 5L2IA 3R02A 4E5BA 2EXEA 2GNJA 4CKJA 4FT3A 4IXPA 1KWPA 1URCA 3K54A 4WD5A 4WUNA 5FXRA 3PA5A 5DRDA 2W1DA 2G2FA 5DHJA 2V0DA 2VTMA 5JFWA 2F57A 4PP9A 1RJBA 3KK9A 1PXKA 4IWQA 5G1XA 4DG0E 4M13A 2J0MB 3W10A 4CKIA 3ZZWA 3B8RA 3O8PA 3NUSA 3PRFA 1PJKA 4BWPA 3LAUA 4DG3E 4XV3A 3UMWA 3OP5A 3UP2A 3HLLA 3KMUA 2HWPA 1YI6A 5FQDC 3L9NA 4L3LA 4JL9A 3KF4A 4J97A 2VWVA 3GFEA 4K0YA 4P2KA 4XV9A 5AP0A 3NIEA 4EUTA 3FY0A 3NAYA 2R3IA 4NFMA 1IAHA 2F4JA 3VQHA 3RAIA 3D5WA 2WMVA 4Q5EA 2PE2A 5ANGA 2CCHA 2Y9QA 5BUEA 2ESMA 4GJ3A 4QPSA 5CI6A 3S1HA 3KRXA 5L2SA 2XNEA 1V1KA 4EL9A 3EFWA 5I9UA 4ZTLA 3A8WA 3ALOA 5I3RA 2JQJA 5B2LA 2ZB0A 5EW9A 4M15A 5HG7A 3CCNA 3E63A 3H0YA 4EC9A 3OG7A 2JLDA 2JEDA 4HYHA 3UVPA 4EGXA 4KSQA 4DBXA 3BU6A 2ZMCA 4L00A 4RVTA 4FA2A 1O6YA 3VF8A 2C68A 1GNGA 2HZ0A 2ZM3A 4IAIA 3WF7A 4BCQA 4IMYA 4QPAA 2W99B 4JQ7A 4FV6A 4YLLA 4AE9A 2Y0AA 5AR7A 2FF4A 3NIZA 3I5ZA 5JQ8A 2VGPA 1J1BA 5IUIA 5K4JA 3I0QA 5HIBA 2OICA 4TYJA 2YZLA 3COHA 4QQ5A 4KINA 4GCJA 2XKEA 3RK9A 1ZMVA 3MIAA 4IFCA 3ZONA 2WQNA 5KCVA 2UW9A 3EQGA 5D1JA 2YLEA 4ZZOA 5A6NA 2J51A 2OO8X 2YDKA 4J8MA 1K2NA 4M69B 5AR5A 4BWKA 3U87A 4C4HA 1W98A 3B2TA 2RF9A 4IJPA 2BZJA 4JBOA 1O6KA 2GNFA 4KBAA 1GXCA 2BIKB 3HDMA 4AP7A 1PYXA 3IPHA 3MH1A 4I5PA 2XH5A 2ETRA 3OY3A 4C35A 5IA0A 2VWWA 3FKLA 2XEYA 5DT4A 4ZTRA 4CMOA 2W1HA 3PLAE 4K1BA 1PMEA 3DB8A 4D4RA 5CAPA 3BHVA 4QP7A 3ZBFA 3HDNA 3Q6UA 1ZMWA 4UWCA 5HTIA 5JGDA 1YXSA 2CNUA 2QOKA 2C5YA 4YURA 1PHKA 5BUJA 5AIKA 3O50A 4E6AA 3ELJA 4USEA 3OEZA 3PJ8A 3VAPA 2GFSA 4QYFA 2R3OA 3QA0A 4UMQA 4I20A 5EW8A 5ACKA 3EN4A 3TACA 2R0IA 1Q41A 4XG6A 4BCIA 4F7LA 4HCVA 3R7IA 4LOQA 4MNFA 5IU2A 2YN8A 3CTJA 5CY3A 5LVPA 4HJOA 5E4HA 2PUIA 4EH6A 3DZQA 1UKIA 3OHTA 3COKA 1GZKA 1BL7A 4F9BA 4G3CA 3SXFA 4YBKA 3K3IA 5HICA 3R8MA 3LLAA 4ITJA 5TR6A 2X39A 5BPYA 5E9EA 5I4NA 5CT7A 5IISA 5JT2A 4PF4A 1HCLA 4X6RA 4PRJA 4ZJJA 3AT3A 5E50A 3QTZA 4ZSGA 3QQHA 3R7EA 4CLIA 3UJGA 3PTGA 4WG5A 2Y4IB 3HZTA 2CCIA 1YXXA 4WSQA 5E8UA 5AP5A 3RPVA 3KXNA 3JVSA 4RIXB 2RFEA 5DT3A 5F9EA 2W1CA 2CNQA 5HE1A 5E91A 4ITHA 2X9FA 3KXHA 1OIQA 3UMXA 3BYOA 3PSBA 4DH1A 5IZFA 3V5PA 4D1SA 4EJNA 2J6MA 4XLIA 1PKDA 3ZLSA 4OGRA 4IZAA 5ANIA 3PJ2A 3Q3BA 3DAJA 3ET7A 3QKMA 5H9BA 4F08A 5HX6A 4B0GA 2IW6A 3ZLXA 1I09A 3BKBA 5AV0A 1FINA 4ALVA 4O84A 1YOMA 3PPKA 3VS7A 5ICPA 5HU3A 4DGOA 2XA4A 3A7FA 4G9RA 2B9IA 1ZYCA 4EOQA 2BRFA 2UW8A 5DJOA 2WQOA 4C0TA 5JZJA 2WIPA 3G6GA 1MRVA 4PUZA 1Y57A 3VBTA 1XH6A 3GT8A 2B4SB 3QZHA 2QO9A 3QTXA 4NZWB 3BBTB 3W2RA 4C59A 2LC1A 2ZDUA 3CLYA 1XH9A 5J7BA 5EKNA 4EYMA 4BBEA 4D0XA 3NGAA 3UIMA 3R1SA 2CN5A 3FWQA 4JBQA 2XIYA 3GUBA 4HYSA 4MNEA 4BTKA 4IM0A 4B6LA 5L4QA 3LQ3A 5HNGA 3V6SA 4DLJA 2NPQA 3R0TA 4O83A 5ANDA 5EQEA 2GCDA 3R8UA 4HGSA 3WOWA 4FT5A 2IW8A 2JBOA 4U9AA 1WBPA 2FUMA 2H8HA 1Y8GA 1O6LA 2GTNA 3I7CA 3ATSA 4ZOGA 2PMLX 5AP7A 2V7AA 3EJ1A 4H3PA 4E4XA 4AZWA 3BLQA 5AADA 5FGKA 3IW5A 4KRDA 4TPTA 3ZO1A 3AG9A 1K9AA 2HZNA 5ANOA 4BBFA 1S9IA 3GCUA 1R78A 4FGRA 4Y5HA 1U4DA 4DGGA 4QMPA 3LMHA 5CEOA 3N4TA 4GKIA 3BHUA 3BPRA 2J0IA 4RSSA 4AGUA 2NNWB 2WNTA 2Z2WA 2B52A 2XK9A 4BGGA 1GIIA 2W1GA 5F95A 3AC3A 1SVGA 4D1XA 5KMLA 1H0VA 5HD7A 4FVQA 4CV8A 4D9VA 4DT9A 4L53A 4XG3A 2OBJA 5CEQA 3PXYA 4ACMA 5KBRA 5CWZA 2IPXA 5EOLA 2C6KA 3B2WA 3PVUA 4I6QA 4AOIA 2IZRA 2J0JA 5I5ZA 3TWJA 3ZRLA 5CEPA 2C6OA 4C02A 5I3OA 2J4ZA 1LEWA 3FL4A 3PJ3A 4FTQA 2AUHA 3SKCA 4XG8A 4DYMA 1JWHA 1WCCA 3QTWA 4GFGA 4L3JA 4CXAA 4D2SA 3TUDA 5AR4A 1VYZA 3ZUUA 4YSMA 4D55A 1H07A 4BGQA 1W83A 5IMXA 4BTFA 4I23A 2HY0A 4TNDA 1JQHA 3R83A 5J5SA 1Y6BA 1F3MC 1GY3A 2R3PA 1XBCA 3KC3A 1AQ1A 3QLGA 3E8NA 4MYGA 4PL4A 5EM7A 4G6LA 3DB6A 3KCFA 4R7IA 1BL6A 2BCJA 5EYKA 5K9IA 2YCRA 5EI6A 2XEZA 4UMRA 4O0VA 4D2PA 2WMSA 4FTTA 3DK7A 4XOYA 3C1XA 4YJPA 4D28A 2G1TA 2XIKA 4G3DA 1UV5A 2NRUA 4IAKA 4J71A 2PVYA 4BCHA 1VYWA 5GIPE 5IQBA 1PW2A 2DUVA 2YAAA 2YEXA 2H96A 3HA8A 3T3UA 4EJQA 3ENHA 2DYLA 2WTVA 3H3CA 3ORXA 4ZJIA 1K3NA 3UTOA 3F5PA 2XJ1A 1Q8UA 2X7GA 5HZNA 4EBWA 3SRVA 4JIAA 3HV5A 4I4FA 3VHKA 2W06A 3UQGA 3PO8A 4W8EA 3G51A 4WUAA 3FMMA 4M66A 5TO8A 4IZ5A 5BVDA 2XNGA 2ERZE 2VO3A 4ANSA 2CHLA 2GNGA 1ZAOA 1NA7A 2BZHB 3Q9WA 4JDIA 4NUSA 3FZRA 4I5CA 2QOQA 3PG3A 5HVYA 1XBBA 3IW6A 3UYSA 3NVMB 4QYYA 4L6QA 3F2NA 1JKLA 3ZXZA 2QONA 3H30A 5EKOA 5K5NA 1ZYLA 3ZRKA 1WVWA 5HG9A 5LJJA 3IONA 2YCQA 4ZLYA 5A4EA 1JOWB 4FEQA 4QP1A 3R7UA 5L8LA 2UZEA 4QP6A 3UYTA 4FIEA 3QWKA 4YP8A 5JEBA 1H1PA 1H0WA 1UJXA 2BILB 2HW7A 4A9RA 4ZAUA 3S2PA 2GHLA 2OFVA 4I6HA 5HBJA 4ZP5A 4NIFB 2PHKA 3MESA 3GU8A 3DDPA 2ITVA 1F5QA 4M84A 4RFYA 3UPXA 5KNJA 3ULZA 4ZMEA 3MVLA 4R77A 2JKDA 3A61A 4RIWB 4O7LA 3DJ5A 2WQMA 4FV0A 1DI8A 2J7TA 4GK2A 4J98A 3R7VA 3D9VA 4AT4A 2F49A 2I40A 4MD7E 4QMOA 5GIOE 1PF8A 1WBNA 4CT1A 3PG1A 3DJ6A 3PE2A 3F61A 3LFFA 4IANA 5M4UA 1Q8YA 3H9RA 1PXNA 4AF3A 2W5AA 4D1ZA 3DXNA 2VAGA 2P2HA 2ITTA 4YC6A 5DR9A 4JDKA 5CX9A 3FBVA 5E8TA 3W32A 3KL8A 2X9EA 4IWPA 4B4LA 3T9TA 4NM5A 4HVHA 3LFDA 4DHFA 4YR8A 4IZYA 4W8DA 3A2CA 4Y46A 3LIJA 1OL2A 4RMZA 4DEAA 4NL0A 2FGIA 4F9YA 1J3HA 4I22A 4L3PA 4NIFA 4BCOA 1UKHA 2R3QA 1HOWA 2H6DA 4TY1A 1S9JA 4KABA 2XYUA 2ZJWA 4MEDA 3SX9A 3TDWA 2WTCA 4XRJA 3QZGA 3RM7A 2JQIA 4UWBA 2QU5A 1JKSA 3VA4A 4FUXA 4Y72A 1JAMA 3GU5A 1LP4A 4BCJA 2EXCX 4JNWA 3UQFA 3QD0A 1RQQA 4U42A 3U6IA 4FSQA 5EK7A 1MRYA 2EH0A 3LXNA 1FOTA 4FVRA 3R2YA 2CKQA 3P79A 4M7IA 4TRLA 4C8BA 2V5QA 2HXQA 4IHPA 3C9WA 3QQFA 5IKWA 4UALA 1KE7A 3DCVA 4IAAA 3PE1A 2QURA 1UVRA 3Q5ZA 4M12A 2OIBA 4JJRA 3VS4A 4XOZA 1OECA 1WBTA 3KULB 4ZY4A 3JPVA 4FGBA 5AM6A 3EZRA 5ETFA 2FSOX 4PP7A 3ORKA 3G33A 3FMEA 5M09A 5KMJA 3U9NA 2X2KA 5AUYA 2I0YA 5KMOA 4HVDA 4NJDA 4ASDA 5M4FA 5L2QA 1PMNA 2FVDA 4U43A 3O8UA 3RAKA 4R8QA 3VS1A 4EWHA 2RIOA 4QMQA 1OIUA 1DAWA 2VTTA 2Y4IC 2IJMA 3BGQA 3UC4A 2XM8A 4QYGA 3HV4A 4GU9A 4GH2A 3EYHA 4KIKA 4BCMA 2GQSA 1P4OA 2UZWE 5C03A 2YDIA 3BQRA 3NNUA 4RA5A 2XRWA 3FSKA 1ZRZA 4KD1A 2YJSA 4P5QA 4YGAA 5BYYA 5J9YA 1UU3A 4TZRA 4XH6A 5C26A 2C1BA 2PIEA 5TT7A 3NR9A 3QZIA 4CTBA 3UO6A 2C69A 2O65A 2YM8A 3RGFA 4F99A 3QHWA 3UNMA 3OEFX 2PU8A 4YU2A 2HZ4A 4DG2E 3M2WA 4QQJA 2OWBA 1B38A 5CASA 5KUPA 1A48A 4GSBA 4NEUA 5CF8A 3IOPA 5IEYA 2BALA 3DKFA 3CD8A 3GU4A 4GW8A 3O71A 3JS2A 3F7ZA 4NJ3A 2G1LA 1JKTA 5HIDA 2VTSA 4CMUA 4RQVA 4DGNA 2WMAA 4BIBA 2KULA 1G6GA 2OI4X 3OD6X 3U54A 2PVNA 4O7SA 3WF9A 2XK6A 1KV2A 2B0QA 4CNHA 5IA1A 3W2PA 1V0OA 3NEWA 3EKKA 1ZMUA 3Q04A 1OIRA 2LGCA 4XCUA 4GG7A 4YMJA 2X2LA 4L9IA 1F0QA 3P7BA 1A9UA 3PXQA 3MI9A 4IJ9A 2BIYA 3DBEA 2B9JA 4JQEA 3ZUTA 2JFLA 4EWQA 3R7OA 2WTWA 3D94A 3QC9A 3OC1A 4WBBB 4D58A 2BRNA 4MK0A 1ZOGA 3V01A 3GBZA 3WZKA 4FSZA 3EQHA 5J87A 3FUPA 1PXIA 4A4OA 2XK7A 1ZYJA 4KNBA 4FT7A 3AT4A 3VN9A 2H34A 3GC8A 1CKJA 4P90A 3R1YA 2W3OA 3OY1A 3PWYA 3FLWA 3DKOA 3MN3A 4FSRA 3SHEA 3UG2A 5CNOA 1H25A 2J2IB 4A06A 3Q9XA 3MH3A 4EH5A 1W84A 3DAEA 2HXLA 4TL0A 4K2RA 2JIVA 3CP9A 3HP2A 2VX3A 3MVJA 3HMPA 1W0XC 4FT0A 4O38A 4BL1A 4FV5A 5I9WA 3GC9A 4FIIA 2GQGA 3CC6A 3IS5A 5L8JA 4A9TA 1OVEA 1WAKA 4GS6A 4LGHA 4O1OA 4AW5A 3UIBA 4G1WA 3GB2A 4IFGA 3Q2MA 3EHAA 4AGCA 4FEUA 2BDWA 4X21A 2CGWA 2WELA 4J96A 2GHGA 1XKKA 2BKZA 5AV2A 3M1SA 4O7TA 3MH2A 3BRBA 2ITUA 2ETKA 2W9ZB 3DTCA 5CU0A 4FKPA 2C30A 4YUQA 1OL1A 2A1AB 2W4OA 4EH2A 3E88A 3KVXA 5DFPA 3AD5A 4EZ7A 4NCTC 2CGVA 3E8CA 2WTDA 3CY3A 5IUHA 3IW8A 3L9MA 3T3VA 3A8XA 3LFQA 4NT4A 5BYZA 5DGZA 1WBSA 5ETAA 4WNMA 5DIAA 4I5MA 4UV0A 1E9HA 2R3MA 2QOBA 2OXXA 3HYHA 4L01A 2XYNA 3LQ5A 3EYGA 4C4JA 2VWYA 4M67A 4FTJA 4KSPA 2O8YA 4M97A 3DJ7A 3BU5A 2QOIA 2OK1A 4QMSA 4U40A 3W2SA 5KZIA 3TV6A 4CCUA 3D7TA 4QTAA 4AN9A 3Q60A 5CNNA 4AE6A 2XJ0A 5AP3A 4FE2A 4TWPA 3WYXA 3HAMA 2UVXA 2UZNA 5FP5A 4TYGA 3ANRA 5HVJA 3O96A 5KHWA 3BE9A 4QMNA 5CF4A 5DE2A 2VTJA 4QMYA 3DBQA 3ZXTA 1T46A 3Q4UA 4G6OA 3QD4A 3OXZA 2UZBA 5H3QA 2JIIA 4JOAA 5HGIA 2AFFA 3SOCA 2CLXA 4E4MA 4CFXA 2O5KA 4EHVA 4UWYA 4U81A 2X6EA 4YJTA 4S33A 3FEGA 3ZLWA 5HNIX 2JD5A 2ZV9A 3R1NA 4I24A 4C4GA 4X3FC 5IH6A 4FOBA 2O0UA
chains in the Genus database with same CATH superfamily
1NXKA 3QX4A 2I2AA 4FSNA 2X8IA 4LGGA 3EL8A 5EOBA 2UW6A 3C0HA 1X8BA 1XH7A 4DAWA 2WQEA 4RC4A 4XJ0A 3P9JA 2PVHA 3A7HA 3VVHA 5B2KA 3SG8A 1G3NA 2UW4A 3V5TA 4XRLA 3EQPA 4JLCA 3LMGA 2OF4A 4WG4A 3NUUA 4N6ZA 3TKUA 4AQKA 4DFUA 3IKAA 5C4LA 4H39A 1PXPA 2WEVA 4YJRA 3AMYA 2G01A 3OWJA 3PY1A 4G9CA 4QQCA 5K3YA 4APPA 2UVYA 1ZOHA 2B7AA 1Q99A 4NKSA 3RNYA 4FNXA 5EQPA 2RKUA 5F4NA 3QWJA 4BCNA 4FIHA 4JVGA 1FGKA 3C0GA 2V55A 3EZVA 2QO7A 5HTBA 4PMMA 3MTLA 2YA9A 4CQEA 3RHXA 4JT3A 4DHJA 2RGPA 2UW3A 3KFAA 2P55A 3BV3A 3DQXA 3NUXA 5DHUA 4HVIA 3OZ6A 1IA8A 3IW7A 4A07A 1QMZA 1ZY4A 4JXFA 3ZEWA 1IAJA 2VTAA 1UNGA 3VZCA 2WKMA 2W5BA 4PY1A 4FKLA 3HMOA 5LVLA 5L6WL 3SRVB 3MPAA 4DE4A 3CQWA 4HZSA 4QP9A 3SAYA 4AGDA 3KXZA 3R71A 3POAA 4IVCA 4BJJB 3TJDA 5LVNA 1U54B 4ZK5A 4BCFA 4GIIA 4F78A 3RM6A 3MB7A 5JH6A 1PXMA 1FQ1B 1VEBA 2E9NA 2ZOQA 4X2KA 1GZ8A 5DA3A 1KOBA 3PXFA 4IVDA 4IM2A 1XMMA 2ZMDA 3C4CA 2C3KA 2QOHA 3G9LX 5TF9A 4O2ZA 3PVGA 2YM7A 4LL5A 3FPMA 2Q0NA 4RVMA 3FZPA 5D7AA 2XUUA 5AWMA 2W7XA 3AQVA 4MBLA 4PWNA 4FIFA 3S00A 2J0KA 3IDBA 5D12A 2W1ZA 1LPUA 3V04A 4AZEA 1B6CB 2BDJA 4MAOA 3TIZA 3MVHA 5ANJA 2QQ7A 2B55A 4G31A 4IW0A 3UOTA 3FYKX 1ERKA 3FSFA 3QCYA 3LXPA 1BKXA 5CLPA 4YZBA 1UNHA 4RC3A 2W1FA 4O0UA 2JIUA 2DQ7X 4EOMA 4QRCA 4WNOA 4BZOA 3EFJA 2C5VA 4FYOA 4JBPA 1KHUA 1K3AA 1ZY5A 2HAKA 3FQSA 3ZFXA 4AFJA 1SVHA 3HA6A 2ITOA 4AGWA 2DWBA 4DITA 3D83A 3BYUA 4P4CA 2RSVA 4RZVA 4U8ZA 3IW4A 1ZLTA 2YJRA 3AC2A 4IAFA 4U80A 3HUBA 3HV7A 3VA1A 4PTEA 4QP4A 4E73A 4S31A 5CAUA 2A0CX 3IOKA 1M2PA 2BZIB 2CKEA 4RIYB 3VWAA 4FVPA 4CFFA 4D9TA 5HE3A 1G88A 3MH0A 1PMUA 1HCKA 1YDSE 2UZVA 3DV3A 3OS3A 3Q4CA 4GJ2A 4ANLA 1L3RE 4AT3A 4EQMA 2BHEA 4B99A 4R3PA 4GRBA 3TXOA 3G2FA 2QLUA 3QQKA 3LJ0A 3MYGA 5A54A 5I0BA 1KUTA 3E8DA 1OBGA 1W2DA 3P08A 4PPBA 3IQ7A 4I94A 4M68A 3QTIA 2VRXA 4DEDA 4RZWA 1H1SA 4C3FA 1PYEA 1W2FA 2BUJA 4BDHA 5CAQA 4O21A 5AP2A 3UNJA 2OLCA 5M06A 3MVMA 3UNKA 2BKKA 3W16A 4J1RA 3WIGA 4ZSAA 3ACJA 3I4BA 3DOGA 5AR2A 3BV2A 2C6TA 3DXPA 2X1NA 4TW9A 4OTIA 4B7TA 3GVUA 4YZMA 1TFFA 5FM3A 4KIOA 4YNEA 4CMTA 4E26A 4EOIA 5LMBA 4TWOA 3C13A 2IN6A 3ORZA 1VR2A 3LE6A 5HBEA 2WOUA 3LLTA 4QNAA 5AIRA 2NRYA 2UZDA 2ZM1A 3M11A 3EQFA 3FLNC 5FDXA 3VPYA 4WNPA 5GNKA 3LQ8A 3KT9A 1FVTA 4KS7A 2V22A 3UOLA 4TKSA 4BTJA 5HO8A 3VBYA 3NX8A 2I0EA 3VF9A 4RX5A 3LMIA 1MRUA 2BRBA 4RVKA 3SVVA 5CEIA 2G9XA 2X8DA 1STCE 4KB8A 4I6BA 4AXAA 2WMXA 5DEYA 4LM5A 2VWZA 4YJUA 5EDPA 4DT8A 3HGKA 3A62A 2NP8A 4NSTA 3D2KA 2G2HA 3NSZA 5L2WA 4IB1A 1OGUA 5HEZA 2WGJA 5H8BA 4FKRA 3RCDA 3ROCA 5J5TA 2Z7LA 3PA4A 1YRPA 3DAKA 4I1ZA 5J95A 3RPRA 3RKBA 4E6QA 2XKCA 5DHPA 2F7ZE 3MS9A 3TZMA 2ZFYA 4KBCA 2YIRA 2GMXA 3EB0A 3VHEA 4IB5A 2OJGA 4A4YA 3R9OA 4JDJA 4XUFA 3UBDA 2X0OA 2GSFA 2W1IA 3MV5A 4ITIA 5DEWA 4DC2A 4XG9A 3UOJA 4HPTE 4PPCA 2BR1A 4RFMA 3SXSA 3OW4A 4OBOA 4QMTA 4F4PA 2XNNA 2X6DA 4CFVA 4BDGA 3PLSA 3H9OA 3CE3A 4RIYA 5L2TA 1J7IA 4WRGA 1RW8A 3VC4A 4L7SA 2JDRA 4FKWA 3JY9A 3OCTA 4XBUA 2FB8A 3LM0A 1YOJA 4GT4A 5CVHA 3DBCA 1L8TA 3LJ2A 3S3IA 4BDDA 4ANNA 1KV1A 5CU6A 4ASEA 2UV2A 4C7TA 3VJOA 5IA4A 3KQ7A 4FV4A 3E93A 4XS2A 5FEEA 4DGLC 3A60A 3RCJA 5DHSA 2ONLA 3NFGB 4F1TA 4F09A 4IX5A 2IVSA 3N9XA 3DY7A 4XG4A 4NTSA 5KO1A 3UDBA 5JGAA 4F64A 5B7VA 2QNJA 1H28A 5CTPA 4FJVA 2V7OA 4UXLA 2VTRA 2H9VA 4JDHA 1YKRA 5EFQA 4ALWA 3KA0A 3IK3A 2ITYA 4O86A 3R04A 3V8RA 5DNRA 1UWHA 2XARA 3TDVA 5M07A 4ZTQA 1FHRA 5EHLA 3OOMA 3FQHA 1UNLA 5IQIA 1RDQE 1FPUA 2BFYA 3FZ1A 3PVWA 4UMTA 1GOLA 4J53A 5BUIA 4FTOA 5CS6A 4ANOA 3VS6A 1Z5MA 2PVRA 2XAOA 1OZ1A 4ZS0A 3JY0A 4PMSA 3QU0A 4ANMA 3NWWA 1YHVA 2R5TA 2VUWA 4DGMA 4ACDA 3F3VA 4YBJA 5ETCA 1YDTE 2XZSA 3TZ8A 3JYAA 4EHZA 3RK5A 3QL8A 2R3JA 5AX3A 3ID6C 4FSYA 3RPYA 4HGLA 2VTHA 5DLSA 5LCKA 4HW7A 5AA9A 3QA8A 3LCSA 2IZUA 2OXYA 4RC2A 1OITA 1WMKA 2UZOA 5IQAA 5AAGA 1M14A 2R3GA 3KN5A 2BDFA 2CSNA 3OWKA 4Y5QA 4JR3A 2XS0A 5IMEA 3VBQA 3F5UA 3FLQA 1OPKA 3DLZA 3KXXA 1QPCA 4G3GA 4UEUA 3UP7A 1WV3A 4ORKA 1H4LA 4LOPA 2IVVA 2P2IA 2C6LA 5E8ZA 2C6MA 1SZMA 2EXMA 3GCSA 3QUEA 2JKQA 3DQWA 3R6XA 3SA0A 4WIHA 1APME 2W05A 2HZIA 5L3AA 3QTQA 2QHMA 5IA2A 3CJFA 3ZDIA 2YWPA 4X6QC 3MTFA 3WILA 3I79A 4O7VA 5HKMA 3LCOA 3NUYA 2JFMA 4QMZA 4RX7A 4O91A 2OF2A 4FV7A 4KKGA 4ZSLA 1PXOA 4GK4A 3VQUA 5DI1A 4BFMA 4NW6A 2WMUA 2B9FA 2R7BA 3W55A 2UVZA 5T68A 1RE8A 5HO6A 2W96B 3KEXA 5ANEA 4TXCA 2IVUA 5L6OA 3COIA 3PIZA 5AM7A 1R3CA 3CBLA 3AD6A 4HPUE 4QMLA 3G9NA 5IA5A 3BCEA 2CJMA 3BZ3A 3AKJA 2UW7A 1OPLA 4QTCA 1JNKA 3H9FA 4MX9A 2YM4A 4WHZA 3M42A 1CSNA 1Q8TA 3BHHA 3FHRA 2XK3A 5DVRA 2JPEA 1H1RA 4YTCA 3PIXA 3F82A 4IBMA 5BVNA 2FH9A 2CGUA 3QCSA 3NRMA 3ZO4A 4G5PA 5G6VA 3W2CA 3EQCA 2I2CA 1DI9A 3QRJA 4PX6A 3DNDA 3QYZA 3TV4A 4Z16A 3TL8A 3F69A 3Q53A 1QCFA 4IEBA 4X2NA 1QPJA 2BAQA 3UC3A 1H1QA 2J0LA 4BDIA 4ZIMA 3V7WA 3W33A 4OR5A 1DD1A 5IQGA 3L1SA 4YJQA 2OJFE 1SYKA 2QCSA 2B54A 2GHMA 2XIXA 5CEKA 4RG0A 1U7FB 4CLJA 1Q62A 2Q0BA 4L8MA 5AV4A 3ACKA 4FL1A 2RFSA 4V04A 1LR4A 5M44A 3HX1A 1BUHA 2YWVA 3CEKA 4EOJA 1ST0A 3ZFMA 4RJ3A 4CZTA 4D0WA 5CVFA 4A4XA 5A4CA 3AC5A 5KBQA 2NYAA 4RJ8A 3GU7A 4A4LA 3GENA 4YJVA 3UZTA 4CKRA 2SRCA 4LV5A 4MXYA 4BI2A 4O7WA 4WOVA 2BFXA 3LJ1A 4B8MA 4E5WA 5B2MA 3H4JA 4S2ZA 4OAUC 4MH7A 3DFAA 4S30A 1QPDA 2XP2A 3MFRA 2VWIA 4CG8A 1YXTA 3PWDA 5D10A 5EHOA 2GPHA 3W0MA 3VONA 3QQGA 2I1MA 4YTHA 1Z0SA 4YPDA 5AA8A 2F2CB 3POOA 4J52A 5M55A 2R9SA 1EH4A 1VJYA 3LM5A 3P23A 4Z9LA 5JK3A 3NS9A 5IQHA 2BONA 3RMFA 3O7LD 3QQJA 3BU3A 2PPQA 4XMOA 2C3JA 4YNOA 5M08A 4IAYA 3DKCA 5C4KA 3DGKA 5A8IA 4YC3A 5HBHA 3R2BA 4YTFA 4H36A 3R00A 2B1PA 2J50A 2Y4PA 3ORNA 4FICA 3IG7A 4EK4A 5LCJA 3QRKA 4ERKA 1XO2B 2UW5A 3A7GA 1TQMA 5HOAA 2ACXA 3OBGA 3PDTA 3GEQA 4YLKA 2E2BA 3WF6A 4F1OA 3DXQA 3L9PA 4XYFA 5CI7A 5ITAA 2FSTX 5K4IA 4TN6A 4ERWA 5CEMA 4CTCA 2G2IA 4DN5A 5CF5A 3SW7A 1MZKA 3GGFA 2A2AA 4GG5A 5F20A 5HNBA 4LL0A 3POZA 1P2AA 5IH4A 5E8VA 3BWFA 3EFKA 2KFUA 3CJGA 3CPBA 3TV7A 4F6SA 3U9CA 4FTRA 1OKWA 2C3IB 1OL5A 2JITA 1XH8A 3FI2A 1SNUA 4CSVA 4CVAA 3IGOA 2C0IA 2PZRA 2VO7A 1XH4A 4C3PA 4QP2A 2CLQA 4XBRA 4V01A 4CZUA 4WRSA 3R01A 5FBOA 3OUKA 2AEGA 3V5QA 2YAKA 2XIZA 4PNKA 3KMWA 4O81A 4MXXA 3O17A 4FODA 4TT7A 5GZ9A 1JPAA 3G15A 2OFUA 5BQ0A 4G6NA 5IQEA 2BRGA 2O63A 4EOOA 5DR2A 4RJ6A 3LFSA 5FDPA 1Z0ZA 3OBJA 4E3CA 1WBVA 2C0TA 5KE0A 3HUFA 3DKGA 3RNIA 1BI7A 3HEGA 3F5GA 4ZXTA 4DCEA 3VZBA 5AFVA 1W8CA 2JKMA 2CN8A 3BYVA 3BIZA 1OBDA 5IF1A 3OUNB 2REIA 2JBPA 3QZFA 4DH3A 4YZNA 3OT8A 1U5QA 3MWUA 3WE4A 3QUPA 3OWLA 3E64A 4H1JA 3R8ZA 4LV7A 4QTBA 2A4LA 3LW0A 2ITNA 3PPZA 4HCUA 4ENXA 2QD9A 4TWCA 5A14A 3QXPA 4IE9A 5LXMA 4EHEA 2ZV8A 1ATPE 2X7FA 4KWPA 4FKGA 5AP6A 3MB6A 4O6EA 1LUFA 2R0UA 1K2MA 3R8VA 3F5XA 4DFNA 3MA3A 3I81A 3LZBA 2XK8A 1M2RA 1JLUE 3C5UA 4AG8A 4ZLOA 4GKHA 1DM2A 3FMKA 1FVRA 4DEIA 5FEDA 3UIUA 4KU0D 4K18A 4B9DA 3UE4A 4OTWA 4XP2A 4LI5A 4GFMA 1PY5A 4N4SA 4NWMA 4R5SA 4MQ2A 3F9NA 4EKLA 5GINE 4AT5A 1MK2A 1ZZ2A 4ENYA 2X0GA 4LRMA 1P5EA 4HOKA 4NFNA 2I0HA 2PVLA 5K0XA 4DFLA 3F3ZA 4YJOA 5M57A 2YACA 5JRSA 4GEOA 4OW8A 2DS1A 3O23A 4AXEA 5M4CA 3I0MA 3UO5A 2XALA 2ITZA 1BX6A 4LUEA 3W2OA 4KKEA 3ZYAA 4M0YA 4FL2A 4YZCA 3RINA 2O3PA 2PZPA 5EDQA 3QCXA 4C2WA 1A06A 3TNWA 4WKQA 3QKLA 4GL9A 3WIKA 4USDA 5HCYA 3DBFA 3ROYA 3QF9A 3RAWA 3Q96A 4W4VA 4EQUA 3FC2A 4O7NA 2JAVA 3LFEA 4GMYA 3NUPA 4N70A 4QYHA 4FTMA 3W1FA 3VUMA 4EKKA 3RZBA 4BWXA 2BAJA 5FXQA 3K5UA 4FIJA 1GAGA 3PY3A 5CENA 4V05A 4J8NA 4MVFA 3Q9YA 4QO9A 2BAKA 3FMHA 4MXCA 3BEAA 4G17A 4BIDA 5LMKA 3A4OX 3D14A 4I93A 3QALE 4GT3A 4LMNA 5CT0A 3W0OA 3SDJA 1DAYA 2BRMA 4MNEB 2IO6A 1H24A 2XT9B 2W9FB 3OW3A 3QUDA 3KN6A 5C9CA 4AWIA 4Z55A 5IDPA 3MY1A 1J4QA 3FXXA 4AN3A 4QQTA 3H10A 4Y95A 4CD0A 2WB8A 3HRFA 4II5A 4PV0A 1GIHA 2YIXA 4FZFB 3MFSA 5HE2A 5IUGA 4FKVA 5T3QA 3C51A 2HW6A 3UQCA 3BYSA 2QODA 4C34A 1UA2A 3P1AA 4LG4A 4HYUA 5ACBC 3TTJA 4G3EA 2CGXA 1OUYA 3RZFA 4A7CA 4ONAA 2IZSA 1H00A 4HGEA 3HAVA 2QO2A 4H1MA 1URWA 3PUPA 2FO0A 3NUAA 2VTOA 2XKFA 4L42A 3VULA 3ZO3A 1KE9A 4L02A 3PXZA 2PMIA 4U5JA 3CQUA 3KK8A 4HVSA 2C0OA 3NYNA 2ZAZA 1IA9A 2WHBA 1PMVA 3ZCLA 4DF3A 1YOLA 4A9YA 2XCHA 4RWJA 2HK5A 3AD4A 5GHVA 3QGYA 4YHTA 3ZZEA 4DINA 2C4GA 4E93A 2YCFA 4U3ZA 3V80A 4IIRA 4JG8A 3HECA 3D5UA 1SVEA 3QRIA 4PMTA 4APCA 1NVRA 2PVKA 3ODYX 4TWNA 4ZSEA 3WZJA 1JBPE 1NVQA 3TJCA 3PJ1A 3DPKA 3AGMA 2QU6A 4BHZA 4BDAA 4DCAA 3V8PA 2Z02A 3FZSA 2WMWA 4RWKA 3A7IA 5AUWA 3LCDA 3ORTA 4GYGA 4IX4A 4JQ8A 3LPBA 1FVVA 3HKOA 3K3JA 4O4FA 3TIYA 4FBXA 2ZB1A 3U6HA 5JQ5A 3VRYA 1YJ5C 4YTIA 4MUQA 3KULA 4RIOA 5BVWA 4U41A 2F7EE 3R30A 4CEGA 5M56A 4OTRA 4OBQA 2YITA 3FLYA 5H8EA 3QXOA 3T8OA 3Q2JA 3CXWA 4EOKA 4P7EA 3ZDUA 4QYEA 5AUVA 3L8PA 4AQCA 5J1WA 5EDRA 2XBAA 3MDYA 5E92A 1KOAA 1QU5A 2F7XE 3BYMA 3DA6A 4O0TA 3BI6A 3BWJA 2FSLX 5JN2A 3SLSA 1OB3A 4AUAA 1R0PA 4USFA 4UMPA 3FQEA 2OSCA 4Y73A 3FLSA 1QL6A 4BTMA 4O0WA 3UN0A 2W4KA 3GI3A 2IEWA 4GUBA 4PQNA 3OMVA 4S32A 4XP0A 5HTCA 2BTSA 4RJ4A 4U6RA 4IQ6A 1OKZA 4BDFA 2W5HA 5CSXA 2XAMA 5JKGA 1XWSA 3PJCA 5DWRA 4NTTA 3OFMA 3KRLA 3VJNA 3UMZA 1Y6AA 4BDCA 3P86A 4L52A 4MF1A 3G0EA 3RVGA 3MY0A 3JVRA 4BR3A 2CKOA 3TG1A 2W4JA 2HELA 3AXWA 3IDPA 4M69A 3T9IA 2R3HA 4FNWA 4D5HA 2Y8OA 4MQ1A 5CSVA 3TCPA 5IQDA 1OL6A 3OCGA 4IACA 3BGPA 4BKYA 3LFBA 4YO4A 3ALNA 4IDTA 3QTSA 3OXTA 5E8YA 2YLFA 3V8SA 2J5FA 5HLNA 2XMYA 4RT7A 4DEBA 2PUPA 5GZAA 4CFWA 4EONA 2XNOA 4LMUA 4R6VA 4FSTA 4DEEA 4F63A 3CPCA 2I1WA 4RIWA 2RG5A 3ANQA 2OZAB 4EH9A 4F1MA 4FUYA 4IB3A 5M51A 2PWLA 1J4OA 3F3WA 3JUHA 4XP3A 5CVGA 5FXSA 2OJ9A 5J7HA 2PYWA 3N4VA 5HHWA 2I0VA 2JDTA 2UZTA 3FXZA 3TKIA 4PTGA 1TZDA 1B39A 4RLLA 4XV1A 1G8AA 1CMKE 5FBNC 4L45A 3EH9A 2IW9A 3A4PA 3R7YA 1Q97A 4FTAA 4S34A 3UZRA 4XX9A 4D5KA 4F0IA 4PDYA 3ZSIA 2Y7JA 3CS9A 3PSCA 5EYMA 3DU8A 3FLZA 4FV3A 1NVSA 3TNHA 4CYIA 3OCBA 5CQWA 4EJ7A 4E5AX 3LHJA 3ORPA 3BBWA 5AJQA 2XNMA 4FEXA 4JRVA 4PTCA 4CV9A 4YSJA 5FTOA 4C3RA 1XR1A 4JRNA 3II5A 4O1PA 4WRRA 1J1CA 2JC6A 2HY81 1Q8WA 2Z7QA 3GP0A 3KF7A 4F7JA 4QCJA 1ZWSA 5IG1A 4L7FA 4LOOA 3WE8A 5DPVA 2QVSE 3IGGA 1PXJA 4MWIA 4AW1A 3RBWA 1PKGA 4N6YA 5FEQA 1J4KA 3R8LA 2C6EA 2YDJA 4FK6A 4E6DA 3EQRA 5BNJA 1UHTA 3EOCA 3F88A 4EH3A 4XNEA 3ZRMA 2WD1A 3O51A 4XHKB 2GNHA 3LVPA 4QP3A 2QOFA 4AW2A 4AFEA 2OJIA 1ZYDA 4BYIA 1H01A 4E1ZA 3KB7A 4F6WA 4JIWD 5HORA 1U46A 3R8PA 4NM7A 1K3JA 1U7FA 3VBWA 4FEVA 2OGVA 2A27A 4F0FA 3HRCA 1UU7A 5E7RA 3UVRA 4I6FA 3W0QA 4BICA 1Z57A 2WXVA 4L43A 4K8AA 4QP8A 3QCQA 5K5XA 2PUNA 2YERA 1U0TA 1R1WA 4O7ZA 3C5IA 1P14A 2VNYA 3TUCA 4OTDA 3LXLA 2JKOA 4DTKA 5TOZA 1MP8A 2PMNX 4ZMFA 4JAIA 3FI4A 3QFVA 4E7WA 5J9ZA 4BC6A 4FZ6A 5LOHA 4MCVA 3NNWA 4UZDA 3ODZX 1J2FA 4FV9A 3TM0A 3QLFA 1AGWA 3R28A 2QG7A 4KIQA 1GIJA 3PIYA 4NM3A 2BMCA 3KXMA 1BYGA 4O6LA 4RBLA 3MY5A 3ZH8A 4D2RA 3TMOA 3GCVA 4CT2A 3C4WA 1GJOA 3RAHA 4DFZE 5EI2A 5EQYA 5FD2A 4FKIA 4JX3A 3U51A 2I2BA 3P5KA 4FKQA 2P3GX 3G6HA 4O0YA 4DBNA 4DH5A 3VS5A 4F9CA 2PZ5A 3OT3A 4K77A 4RVLA 3ZOSA 1OMWA 3COMA 4U0IA 4CG9A 4WSYA 4EUUA 3ZHPC 2AYPA 3KU2A 3SC1A 3TT0A 2VN9A 4KUJA 3OCSA 3DFCB 3WYYA 2VGOA 5L8KA 4Z7HA 3NLBA 3CGFA 3CTHA 5CQUA 5J8IA 4F70A 3LCTA 4H3BA 5H2UA 5CYIA 4R5YA 2JKKA 2HIWA 4AZVA 4EZ5A 4GK3A 1JSTA 1W82A 2P0CA 5CSPA 1LGPA 5GZ8A 1WZYA 1H8FA 5C01A 2X7OA 4AZSA 3GCQA 4X7QA 4ANQA 3GC0A 5CSWA 4QMUA 5BX0A 4PDOA 5KX8A 5FTQA 3SG9A 1Q3DA 3HV6A 2PMOX 4U79A 3V5LA 3RPOA 4I5HA 2ERKA 4OAVB 4F9AA 3WI6A 3PZEA 4FZ7A 4RFZA 5DOSA 5J1VA 4W4XA 3UO4A 3MFTA 3CKXA 4NM0A 3HX4A 3FHIA 4MTAA 1OKYA 2QOLA 4IADA 4HAOA 4K9YA 4N57A 1GZOA 3FZTA 4KS8A 4JS8A 1DMZA 4EZ3A 4ZSJA 4AA4A 1SMHA 4R1YA 4RWLA 4PPAA 3TUBA 4QDVA 2GDOA 2Y6MA 3PY0A 5HESA 3F3UA 3UPZA 2WPAA 4IZ7A 3P5JC 2OH0E 1G3GA 3R7GA 2O64A 4QMWA 4GUEA 4CQGA 4D2VA 1Q8ZA 2GS6A 2PE1A 4NKAA 4FKTA 4PNIA 2F9GA 3FJQE 3R21A 4GYIA 4YJSA 4BI0A 2WOTA 3QQLA 3VS2A 4F6UA 3F3TA 5EM5A 2C3LA 3AC1A 1TKIA 3MFUA 3FMDA 3UNZA 4EK6A 2JGZA 2UW0A 4QNYA 3QRUA 3FMJA 4DFXE 3V8WA 3UV0A 2OKRA 4RPVA 5EJGA 2EU9A 2ITQA 5CAOA 3QQUA 4NH1A 3ERKA 4P5ZA 5E8XA 3ELSA 3LCKA 4DLIA 4NK9A 3OUNA 5EJFA 4W9XA 2FEZA 3KMMA 3H0ZA 4E6CA 1Y91A 4PMPA 4PDPA 3PVBA 3NCGA 4FYNA 5CZIA 3C7QA 3EIDA 2CMWA 2R3RA 4HGTA 4FSWA 3U8WA 2GS2A 5AMNA 3FY2A 1Q5KA 2ZV7A 4DTAA 4FKUA 4NU1A 5J9LA 4BN1A 3MDBA 2J90A 5H8GA 4AU8A 4RX9A 4BIEA 2E9OA 3VS0A 2JDSA 1XQZA 4WBOA 2FYSA 3MPTA 3WF5A 2BZKB 3EL7A 2GS7A 3FMNA 3OTUA 3ZM9A 5HI2A 3EQDA 3DTWA 4ASXA 4IX6A 3R73A 3PFQA 1H1WA 2WZJA 1XH5A 3HMIA 2WO6A 3PP0A 1NW1A 3BGZA 3NYXA 2PK9A 2EB2A 4E20A 1DEVA 4EOPA 5KMMA 4FX3A 3F2RA 2QI8A 3IO7A 5D7VA 3AT2A 1H27A 4RJ7A 3VUHA 4JX7A 4WO5A 3RWPA 5CALA 1VZOA 1MUOA 5E8SA 4OTPA 4AXCA 4DEHA 5DG5A 2WTIA 1J4LA 5A6OA 4JAJA 3TTIA 3DDQA 3I5NA 4K11A 2Z60A 4FZDB 5GJDA 5HVKA 4YHFA 4OTQA 1ND4A 5I9VA 2OW3A 2XNPA 2QLQA 4BBMA 3NYVA 4BZDA 4F0GA 1FBNA 3OVVA 5AP4A 3HL7A 5K0KA 2PZIA 2OIDA 3BELA 1OKVA 3MBLA 3VW8A 1XMLA 3E5AA 2YIYA 4FSMA 4MWHA 1IG1A 3LFNA 3V51A 4ZLZA 4N0SA 4FIGA 3E7VA 4BDEA 4O96A 5KZ0A 2XXSA 4GU6A 5HLWA 3MIYA 3ATTA 5IQFA 3DS6A 4G16A 1M7NA 3GCPA 3HV3A 4J7BA 3CD3A 4NW5A 5E8WA 3ZLYA 2C5OA 1KSWA 5JEOA 4IWOA 5I9ZA 2WEIA 4ZY6A 4FR4A 4JMQA 2B53A 3HMNA 4LUDA 1ZOEA 4FKOA 3VNTA 5HO7A 3SGCA 1ST4A 1YJMA 3C4XA 2G15A 5EM8A 3VUTA 3ZU7A 1R39A 1KE5A 1H08A 3B8QA 3QC4A 5A3XA 4ACHA 1FMKA 2VTLA 5CF6A 2A98A 5ETIA 2V62A 4G3FA 2W1EA 3BLAA 3CTQA 3W8LA 3GOPA 4HNIA 4DH8A 3P78A 4O2PA 5D41A 4U97A 2E9UA 4ZZMA 4F9WA 2RG6A 3I60A 3LFAA 3GFWA 3I7BA