3I6WA

Structure and activation mechanism of the chk2 dna-damage checkpoint kinase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
410
structure length
369
Chain Sequence
b'PWARLWALQDGFANLECVNDNYWFGRDKSCEYCFDEPLLKRTDKYRTYSKKHFRIFREVGPKNSYIAYIEDHSGNGTFVNTELVGKGKRRPLNNNSEIALSLSRNKVFVFFDLTVDDQSVYPKALRDEYIMSKTLGEVKLAFERKTCKKVAIRIISKLNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFPTYLAPEVLVAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase Chk2
publication title Structure and activation mechanism of the CHK2 DNA damage checkpoint kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 103
structure length 369
sequence length 410
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00498 FHA FHA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3i6wA03
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 3i6wA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3i6wA02
4XG6A 4QMZA 3QQGA 4XOZA 3C50A 5CEMA 3FSFA 4JI9A 3TIZA 2WMXA 1HCLA 2W96B 5K5NA 3ORZA 1PXMA 4FV4A 1YXUA 5BMSA 1BMKA 1PW2A 1YDTE 4FZDB 5EDQA 4YC3A 3CGFA 2RFSA 2C6TA 2C3IB 2UZWE 1V0PA 2CKEA 1ZYSA 1XJDA 4MAOA 3FQSA 1KV2A 4GRBA 3BE9A 3IG7A 4I0TA 3L8PA 2X81A 3ZLYA 4O7LA 4ANBA 4QP2A 2OI4X 2WTWA 5HNBA 3Q6WA 2J9MA 4DLIA 4TL0A 4K77A 4QMWA 4F65A 5CXZA 3ACJA 4GG7A 3LCDA 3ZXTA 3IONA 5LVPA 3RCDA 2CKOA 3RI1A 4F9YA 2LGCA 4QCJA 1K9AA 4O7SA 2IW8A 4CNHA 5AR2A 1BI7A 5FP5A 1IA8A 2J90A 2PPQA 5J7HA 4LG4A 1OKVA 3A7FA 3CS9A 3EZRA 2FGIA 4KS7A 4WBOA 5HD7A 4BF2A 4C62A 3VW8A 5HZNA 2OF4A 4GK3A 3QQFA 1Q62A 4XUFA 5AWMA 5A9UA 3KVWA 3F2NA 4BL1A 4ZJJA 2XS0A 2ITNA 4RFMA 5CT7A 4JBPA 5TOZA 2DS1A 3RK9A 5FEDA 4GT4A 2I40A 4BY9E 4AZWA 4IAKA 1JWHA 2JAMA 5CAOA 3QRKA 5LCJA 4IX3A 4AZFA 2J4ZA 4EK5A 2JLDA 2O8YA 4O83A 2NO3A 4GSBA 2YM7A 4LGGA 3VS5A 1XBCA 3EKKA 3SXRA 3RHXA 4XCUA 4DBXA 3UV0A 5C1QB 2WQEA 4X3FB 5K3YA 3DJ7A 3VBTA 2X1NA 2BFYA 1GJOA 3AT4A 3EN6A 3FV8A 3HRCA 2NPQA 3MFUA 3PSBA 4JDKA 5HG7A 3BEAA 4RSSA 4LM5A 1GZKA 2I0HA 1WBSA 2JIIA 4GJ2A 2UW5A 3FKOA 2YCSA 4BGHA 4HVGA 4EJ7A 4MNEB 2W9FB 3ODZX 4OUCA 3TN8A 5AP0A 4EUTA 4HYUA 5AV0A 3HZTA 3GC9A 3MFTA 2XF0A 3JS2A 4PTEA 5DMZA 1RQQA 1KSWA 3O23A 5FBNC 5CS6A 3RP9A 4C38A 2NRYA 2Y0AA 2YEXA 4V04A 2YAAA 2H6DA 2XZSA 2OJGA 3QQUA 5A6NA 1OL1A 3EQIA 5J9LA 5FTGA 3ZLWA 3RGFA 3PLSA 2Z7LA 3PJ3A 1PYXA 4BZDA 4C4JA 4FTAA 4B4LA 3L9LA 3D15A 5IF1A 4XG2A 4FT0A 1Y57A 3KY2A 4U3YA 2R3RA 3CQEA 1Q8UA 5EYDA 3SXFA 3F3UA 3GFWA 4HVIA 4BR3A 2VX3A 1WFCA 3VRZA 3W18A 5BPYA 5AAFA 2BR1A 4QP9A 1M7NA 2DUVA 3TTIA 3UODA 5M57A 3UOJA 3VS7A 4FV5A 4KAOA 4FIFA 4FTNA 3BLQA 4XBRA 3MFRA 4K11A 1O6LA 4CQEA 3UOHA 3AG9A 3DA6A 3V8SA 1PF8A 4BWKA 4DEHA 3R30A 5KMOA 2B9HA 4FT7A 5ANIA 4RA4A 4BVUA 2J0IA 3HL7A 3MPAA 3ZHPC 4I41A 4OR5A 3RHKA 3HMIA 4H1MA 3BV2A 4QQTA 4AOJA 5IEVA 5JGDA 5L8KA 3QCYA 2BZJA 4I0RA 1KOBA 1BLXA 3ZM9A 3I81A 2WIPA 4XS2A 4YPSA 4EOPA 1FHRA 1BUHA 2OW3A 5B7VA 2HXLA 1FBNA 3R0TA 5J9YA 1WBVA 4E6AA 2R3GA 4WNPA 3VA4A 1Z57A 5HGIA 3VIDA 2ERZE 4PDSA 3A7HA 4O27B 3OTUA 3UIMA 4EORA 1J4OA 5M07A 4YBKA 4J99A 4M8TA 4MVFA 4L7FA 3E8DA 1H0WA 3UIBA 2PULA 4DN5A 4H3QA 4DH5A 4GW8A 3F9NA 1FGIA 4WSQA 2PL0A 3CQUA 2JGZA 3FE3A 4PRJA 2OZOA 3QALE 4H3PA 3AXWA 3EL7A 1OITA 4NCTA 5EM8A 4YLLA 2CNUA 1YWRA 1PYEA 4I6BA 5F4NA 5IQEA 4I0SA 4ONAA 3GVUA 3TV7A 5HCZA 4UYAA 1W84A 2NRUA 2PE2A 1KE8A 4ACDA 3PJCA 5G6VA 5AR5A 3OOMA 2W1EA 4C02A 2BUJA 3R01A 2JIVA 4E4NA 3PTGA 5BVKA 4PDPA 4W4VA 1FHQA 4J52A 4ZMFA 4IBMA 5A54A 1OL5A 3IO7A 4CFMA 1WBTA 3K54A 4C4HA 2V55A 2FYSA 4KA3A 4E93A 1G8SA 4OTPA 1ERKA 2BRGA 2IVSA 4UY9A 4U44A 3BHYA 4DA5A 2R3FA 2PE0A 2CNVA 3RWQA 3ZBXA 3AC8A 4E5BA 3GFEA 1NW1A 4FT5A 5CZHA 3OTVA 5LVLA 4D5HA 3PRFA 3QUEA 4FMQA 3I6UA 3ZRKA 4AE9A 2FSLX 5LARA 4IVDA 4R77A 4D0XA 2A2AA 1YXXA 5JQ5A 2OZAB 3F82A 3FZSA 4IVCA 4N57A 3EJ1A 4DFXE 4QRCA 3L8XA 1QL6A 4IVAA 4YJNA 4AUAA 3H9FA 4RZVA 5EM7A 3PY1A 5C8NA 3R04A 4I5CA 3Q4ZA 4G16A 2FEZA 1SMHA 1H1WA 3DPKA 4IB0A 3RPSA 2QKWB 3GB2A 4MXYA 1J4QA 2I0EA 3WILA 3LMIA 2ZMCA 3ENHA 2J0JA 2P2IA 2V5QA 3GCPA 2RL5A 4RFZA 3R8VA 1QMZA 4D58A 2FSTX 4M69B 4N6ZA 3PPZA 3PUPA 1R0PA 4AS0A 4XLIA 5BVOA 3PVGA 2F9GA 4ZXTA 2ITQA 3SRVA 4E1ZA 3OS3A 4TN6A 1UVRA 4FSWA 4M14A 4TYIA 3E87A 2GHMA 5DIAA 4FGRA 5JK3A 5EQPA 3BX5A 1CMKE 4GYGA 4E3CA 4ZY5A 2JDTA 5HVKA 2VTOA 2XEZA 5HBEA 3KREA 5DWRA 3IW7A 4M0YA 3W55A 3EFWA 3KGAA 3BU5A 4D2TA 3EKNA 3EN5A 3C4CA 1DI8A 4EJQA 3UJGA 3FQEA 2C68A 5C4KA 3EL8A 2E9PA 4NM5A 2YABA 4U3ZA 4W4WA 4UMRA 4QMVA 4YTIA 4ZTMA 5GZ8A 5JQ8A 4WIHA 4QNAA 2WOUA 2JDVA 4BDHA 2B9JA 4RC3A 1V0OA 3C4FA 3NS9A 4ACHA 4G3FA 4LOPA 4U79A 3BBTB 4E26A 1SYKA 2QC6A 4GIIA 4QMOA 3F2RA 2QOQA 3IW5A 5D12A 3PZHA 4NH1A 4QPMA 2W1CA 3R00A 5IDPA 3PJ1A 3FBVA 3PWYA 4FBXA 1B6CB 4MHAA 2CSNA 1F5QA 1KWPA 4BGGA 4K6ZA 3MESA 3MA6A 3FMHA 4RMZA 4F9WA 3MH2A 4XHKB 4BBEA 2QU5A 1WVYA 2BHEA 4BKZA 4LYNA 2OJ9A 4C57A 1JBPE 1DI9A 2UZUE 2WTKC 3F5PA 5KMNA 3PJ2A 1REJA 4UMUA 5TKDA 2EU9A 1UU7A 5CF5A 3TNHA 3AMBA 4TYHA 2UW7A 1J1BA 4LI5A 3LFNA 1O6KA 3D5WA 4YURA 4UN0C 3I6WA 4CKJA 1YI4A 2X8DA 3JY9A 4YHFA 2JBOA 5C27A 3PZEA 2PWLA 5LVOA 4L3LA 4FV8A 4LL5A 3LXLA 2XBAA 3POZA 3RMFA 2WMRA 3L9MA 3WZUA 4FTIA 5J9ZA 3OY3A 3HAMA 1YDRE 5K4IA 4QTAA 4E5WA 2HZ4A 3QQJA 2E9VA 3HA6A 2BDFA 1KE7A 5KHWA 3DQWA 3KMMA 4J71A 4OAVB 2UW6A 3GC7A 3OT8A 4FL2A 3QKLA 3MH1A 3TNWA 3PIYA 3FI3A 4V0GA 4MH7A 2GNFA 1LEWA 4YNOA 2VX0A 2C30A 2X39A 4PL5A 4NCTC 4LGHA 5D10A 4XRJA 5TT7A 2OH4A 3FMMA 4TWOA 3NNXA 3QKKA 1J1CA 1L3RE 4QMPA 2C6OA 2XIYA 2HIWA 5ITAA 2C5VA 4Y95A 3C4EA 4YO4A 2R3NA 3AC3A 2BTSA 3VVHA 3F7ZA 4BB4A 3DKCA 1A9UA 4RGJA 4RVLA 3O51A 3GP0A 2CGWA 3QWJA 4Z55A 2XNMA 3KRJA 2C6DA 4FTRA 3ALOA 4ZZMA 2RG5A 3UYSA 1IEPA 1OVEA 3OT3A 2BMCA 4KRCA 5EOBA 3V6SA 3QQKA 1P4OA 4GS6A 2ZV9A 4JRVA 3KMUA 3DKOA 4CMOA 4EOLA 5I9XA 4TXCA 4RJ5A 2GU8A 3VS1A 5HIEA 2JKOA 3PXQA 3KRWA 4WSYA 4O0YA 2BCJA 4E20A 4FNWA 4BDIA 3PXKA 1AGWA 3TZ9A 3FC2A 5DRDA 1IG1A 1Z9XA 4FTQA 4R7HA 4MF1A 4I5HA 2YISA 3Q6UA 4IVBA 2H8HA 2WTIA 4FKWA 4G6NA 1CKIA 4ANMA 1S9JA 2W1FA 3MTLA 4L7SA 4WNKA 4GT3A 3BHTA 4ZY6A 3K5UA 3PIZA 4C35A 5CF4A 2OJFE 4AN9A 4MF0A 3QQLA 2YFXA 5FM3A 3VBVA 3TKUA 4DGNA 2UVXA 2CJMA 4RIYA 4C4EA 2CDZA 4BDBA 4HYHA 2XKEA 5CENA 4C8BA 2XA4A 3M2WA 1QPEA 1TVOA 2PZYA 4D28A 5HD4A 5M44A 3ZCLA 3GQSA 3CY2A 5C4LA 2C0TA 4L3JA 5AADA 4IDVA 4C59A 4LQMA 5HE0A 4AU8A 4BIEA 4EC8A 4O7WA 2HZIA 4JDIA 3DDQA 1J7IA 5GJFA 4LV5A 3D7TB 4RA5A 3GU7A 1FMKA 1GAGA 2JIUA 3VBWA 4BI1A 5AM6A 2C5OA 5IH4A 4J8MA 2ACXA 2BDWA 5I3OA 3RKBA 3MSSA 5GZ9A 1B38A 3DXNA 4O0TA 1QPDA 3TEIA 2ETRA 3W1FA 3A4PA 3UG2A 5EI6A 4PUZA 3HVCA 1PXLA 4FIHA 3RZFA 1STCE 4HNFA 3QTXA 4ID7A 2JDRA 4DHFA 5AA8A 2PVKA 5AJQA 2C47A 3DFAA 1ZYLA 3U6IA 4KNBA 4O2PA 4J96A 4QYGA 2HY0A 3D2IA 4FNYA 4P5QA 2C5NA 3ZSGA 2IZSA 2XK7A 3W16A 4EH5A 4FKJA 1XH4A 2PZIA 3QTZA 2XEYA 5E90A 5LVMA 4XP0A 4APPA 4G6OA 5D41A 3OVVA 3VPYA 4ENXA 4GV1A 4F09A 2PMIA 3E8NA 2W99B 2R2PA 2W4KA 4U42A 4FKVA 2BAJA 2PMLX 2VO7A 3FMKA 4KS8A 4XV9A 2I7QA 2JC6A 4Y5QA 4U43A 5TR6A 1H0VA 5GINE 4JJRA 4QP1A 5BVNA 4WG4A 5EW3A 3BPRA 2B9FA 5AV1A 4UMPA 5A8IA 3ZEWA 4DEIA 2CGUA 2W5AA 3TNIA 1B39A 4GVJA 4OT5A 3UBDA 5AUVA 3QHWA 4J1RA 3OCSA 4UV0A 1IASA 4QP8A 5HE1A 4E6CA 4YU2A 5CVFA 1FQ1B 3W8LA 2LAVA 3QBNA 3WBLA 4Q2AA 2O5KA 4YO6A 2BZIB 3CPBA 4IXPA 3U6JA 4GT5A 5IQGA 4AE6A 2YZLA 4ZS0A 4MQ2A 4UEUA 5AV3A 3VS6A 3D5VA 4Z7HA 4RIWA 2F7XE 1VZOA 2H34A 3CTJA 3D5UA 4N4SA 4EH3A 4AGCA 3OXIA 2JITA 4EQUA 5GNKA 4FA2A 4F9BA 4WRSA 4GMYA 5IUHA 2W5HA 3LFBA 4QYYA 4BC6A 3PYYA 4ORKA 2XM9A 4OTQA 4F0GA 4HNIA 4GG5A 2HW6A 3PP1A 4GIHA 3ORNA 4EOMA 4P4CA 5J79A 5LWNA 4O82A 3ERKA 1DM2A 5BYZA 2F2CB 4QMQA 4EKLA 3EQCA 3EQGA 3IDCA 4O1PA 2E9OA 5CQUA 2PUUA 3COHA 3I0OA 3F69A 3QTSA 3V5TA 3NCZA 3LFFA 3VULA 1URWA 1XR1A 3F5UA 3MA3A 3NPCA 4D1SA 3NYNA 4NTTA 3IECA 4RT7A 5EOLA 4ZTQA 2YLEA 2IVUA 2QG5A 3I1AA 4F0FA 1PKDA 3E92A 2VTLA 3BE2A 2VWVA 1YWVA 4P90A 5FWKK 2VTPA 2YJRA 2GCDA 3IGOA 2JD5A 2YM4A 3PA3A 4J7BA 5DRBA 1H27A 1OUYA 3IKAA 4EQMA 3FYJX 5JRQA 5HI2A 4FZFB 2VWBA 4ERKA 3VF8A 4AZVA 2A1AB 3IQ7A 2Y8OA 4IZ5A 5KZ0A 2XK4A 2W5BA 3CSVA 5FXSA 2A19B 4JOAA 2C6EA 5HLWA 4DGGA 3L1SA 4MD9E 2XKCA 1WBOA 3LCKA 5IH5A 4A9YA 4O7NA 1WCCA 4B9DA 2E9NA 3KF7A 3GCSA 4FIIA 5JZNA 2XYNA 5CY3A 3U4WA 3V5LA 5BUJA 1J4LA 2IO6A 2WTKB 3UNKA 4BBMA 1NVRA 4Z9LA 3EFLA 4IEBA 4MYGA 2PSQA 3UO4A 3R7IA 3UO5A 1H07A 2YITA 4RIXA 4RJ8A 2JAVA 4UWYA 4C2VA 4C3FA 3P79A 2CHLA 1MUOA 3QA0A 3V6RA 4EOOA 4TW9A 4BI2A 2AYPA 5L2IA 5L2WA 4ZSEA 3BGPA 4JR3A 2YDIA 1W0XC 3HUFA 3ZDUA 2IZRA 4XBUA 4C2WA 3R73A 2JKDA 3BIZA 1U5QA 3DK3A 3R6XA 2QURA 3FI2A 3KXGA 4PDOA 5JFWA 3OD6X 4EKKA 3UQCA 4OBPA 5HCYA 3SC1A 4WG5A 5KHXA 2HK5A 4YJTA 3QFVA 5DR6A 4RVKA 1TQPA 4ZSLA 2YCFA 5IQIA 5KMJA 2FO0A 4JBOA 1LUFA 3JY0A 3M42A 5IQFA 4A7CA 3MY1A 4LL0A 3P08A 4CGAA 2OWBA 3TDVA 5CTPA 3C5IA 2FSOX 5BMMA 4I5PA 3OWPA 3DBEA 4A4OA 2QOIA 3NAYA 3HYHA 3VUTA 5KMMA 4F6WA 2UZLA 5AM7A 3SXSA 1G6GA 5HCXA 3HMNA 4G31A 1YOLA 3WARA 3F5GA 4D4VA 4FKIA 3WZJA 4AT5A 4PTGA 3GCVA 3ORLA 4USEA 5HIDA 4H87A 1OKYA 3QF9A 4X2NA 3MH0A 5IISA 3MJ1A 4FKLA 2HWOA 3HNGA 4IH8A 4RJ6A 3FL5A 4EL9A 1PXPA 3DTCA 3C0HA 4FTMA 5AP4A 5EYKA 2WB8A 2Y9QA 4IAYA 4D9UA 1UV5A 3QC4A 4FOCA 3VW6A 5K4JA 2O3PA 4Y85A 2CKQA 3PA4A 5JGBA 4O91A 1XBAA 3ZC5A 4O96A 5HBHA 4BWPA 2WTJA 3QCSA 4XRLA 2BZHB 3E8EA 3GC0A 3HDNA 3CE3A 3ELVA 1SVEA 4DH8A 3VHEA 3ZLXA 4BGQA 3BV3A 3RK7A 5E8WA 5HLPA 3RINA 3AC1A 3LZBA 4IMYA 4NJ3A 4I21A 5AMNA 4NKAA 3GQLA 4ASZA 3A7IA 3DCVA 1K3JA 3HV6A 3QRUA 5JFXA 5J87A 4YZNA 5CF6A 3DZQA 4S34A 4DITA 2VZ6A 2GS7A 1H8FA 1UNGA 4JXFA 2F49A 4N70A 4RJ3A 2YIQA 4GU9A 4A9RA 1YJMA 3QYWA 3CPCA 2P55A 3L9NA 4JQ7A 4IWQA 4NW5A 1SNUA 4WOVA 4A4LA 4EOJA 3IOKA 3DDPA 5C26A 2ITTA 2WU7A 2WD1A 3NNUA 3DNEA 1UKIA 3GGFA 5KUPA 3HEGA 3ULIA 3MTFA 1JSVA 3EQPA 2X2LA 2XVDA 3C4XA 3FHRA 2VUWA 3KMWA 3A8XA 4GH2A 2BIYA 2WAJA 4MEDA 4WBBB 1Q8YA 3THBA 3V51A 4BBFA 5LXMA 4QYHA 4P5ZA 4S32A 5L2QA 3NDMA 4BI0A 3SRVB 2GDOA 3QYZA 1GXCA 2OO8X 4M7IA 3R9HA 4GEOA 4AXAA 4FTLA 4USFA 2VRXA 5HVJA 5L2SA 4L9IA 3V8WA 3ORTA 2VTHA 4NWMA 4TT7A 5HO6A 5CEIA 3RTPA 2XBJA 3CY3A 4H3BA 1G8AA 3OMVA 4K1BA 4IB1A 1PXIA 4WRGA 4A9SA 3P9JA 2W1DA 2IJMA 4YLKA 5ANGA 5HG9A 4BTJA 1OKZA 2YDKA 3LCOA 4NK9A 3RALA 2VTSA 4EGXA 4LOOA 2YWPA 5IDNA 3LMGA 2YM6A 3P0MA 2XIKA 4KRDA 3IW6A 1WVXA 5FTQA 1LGPA 3UMZA 4YJQA 3NYXA 5T3QA 3D0EA 2UW9A 3R8UA 3QUDA 4AA0A 4IW0A 3L8VA 4IANA 3CQWA 2O63A 4GL9A 4M84A 4YSJA 4MXAA 2CCIA 2RFDA 4CMTA 4BCIA 4RZWA 3KB7A 4LUDA 3ZONA 5H3QA 4IADA 4FYOA 5FXQA 4EBVA 4M67A 2PVNA 3GENA 2J51A 3BU3A 1LPUA 4FV0A 1XBBA 2OF2A 3B8QA 3VQHA 3W2QA 4D1XA 4HVDA 5E50A 3WYYA 1M14A 4EWQA 2XIXA 5IZFA 3QZFA 3NSZA 3PE1A 4B0GA 5HG8A 4EZ7A 2BRFA 3PPKA 3W33A 4BICA 1H4LA 3OWKA 4ZOGA 3BYVA 5HNGA 3RPRA 3NYVA 4OT6A 3UNZA 2R3IA 2BAQA 3RPYA 1U5RA 4D55A 2HXQA 4UWCA 5F9EA 3T3UA 4ZTSA 1FMOE 5L2TA 4ZZNA 3SAYA 4IWDA 4KABA 3CJFA 2VWIA 4PWNA 4I20A 4L68A 3VS0A 4BCGA 4EC9A 4FV2A 5KMLA 1WV3A 3PO8A 3QWKA 4EK4A 2C5YA 4JBVA 2X4FA 2BROA 4W8EA 1PY5A 3R9DA 2JDSA 2ZM1A 5CLPA 2RFEA 4AW2A 4O7YA 4FG8A 4F9AA 3UVQA 4ZY4A 1OIYA 2B52A 4JQ8A 4UMTA 3E3PA 2CN5A 2CMWA 2CLXA 4JIKA 2X4ZA 2ZMDA 2BALA 4PP9A 3KXHA 3I7CA 3GBZA 1M2RA 2YN8A 4AOIA 2EUFB 2GNLA 4U6RA 4L42A 4WO5A 5BNJA 5IA3A 4O0VA 5EI8A 4EBWA 3A62A 2R3PA 2OKRA 3DBDA 3SX9A 3HV3A 2Y7JA 3RBWA 4JLCA 5H9BA 2AFFA 2R0UA 4UXQA 3F6XA 1CM8A 3Q96A 4DFUA 2ITYA 2VTNA 3DLZA 4BN1A 3O2MA 3VUHA 3KEXA 1PXNA 3MJ2A 4IAIA 4RWJA 3LFDA 4XH6A 4B6LA 4BDEA 5HE3A 4BCKA 2QOBA 4RBLA 3QTQA 1H24A 1MRUA 5I9VA 1BKXA 3BU6A 1YKRA 3S3IA 4D4RA 4EH6A 5I9ZA 4X7QA 1OKWA 3N4TA 4D4YA 4HPUE 4E73A 4FK6A 4KB8A 4NIFA 1Q99A 2IPXA 2BPMA 5JEBA 3VO3A 5CEOA 4DT8A 1VR2A 4DH1A 5H8GA 1XH8A 4FV9A 1YXSA 2WFYA 4QYEA 2J0MB 4AZSA 4ZZOA 4JX3A 3BZ3A 4QTCA 3LJ2A 2RIOA 4TWCA 4FT3A 2GNJA 4LMNA 2YM3A 1OIUA 2OK1A 3R7EA 2PUNA 5JFSA 1OPKA 4QNYA 4YTHA 3RPOA 4I3ZA 4TY1A 4AQCA 4AW0A 4F70A 3DXQA 4QMXA 4RQKA 3UP2A 3RM7A 2JQJA 4XV3A 4QMYA 2VNYA 2Q0NA 1LP4A 4ZTRA 5I5ZA 5HTIA 5M06A 4LFIA 5KE0A 2WNTA 2Z02A 3W2PA 3GU8A 2XK6A 4EQCA 4I6HA 3AT2A 5HO8A 3CCNA 3I5ZA 3VN9A 4AFEA 1T46A 1QPCA 2HY81 1R3CA 2VO3A 4RIYB 4Y46A 2NNWB 3VUKA 5IUIA 4TNBA 5FDPA 1W98A 3DKFA 1PMEA 3VAPA 2KB3A 2W1ZA 4G6LA 2A27A 1ND4A 3LLAA 1DS5A 3UC3A 1ZOHA 3FLNC 3WF9A 5IH6A 5AUYA 2WTCA 1SM2A 5CALA 3RCJA 1R21A 3NW6A 4M3QA 3KXNA 5CAPA 1FVVA 3DK6A 4CZUA 4ZTLA 3RM6A 5E8SA 3FPQA 4KD1A 3FZ1A 5CYIA 3R8ZA 3BLRA 4NFNA 4RX9A 4XG4A 4AG8A 2XT9B 5BYYA 5HU3A 4RFYA 3HRFA 4UB7A 1G3GA 5LJJA 1U4DA 3L9PA 3SW7A 3KT9A 5E9EA 4LRJA 3KXMA 3GEQA 5LCKA 2W06A 4ACGA 4MBIA 3FEGA 3QZIA 4EOQA 5IQCA 3B2WA 3OOGA 2XNOA 4FKOA 2ITPA 4QOXA 4RX8A 5EHLA 4JR7A 4X2JA 2J7TA 4YZDA 2PE1A 2DYLA 3G0EA 2OXDA 4QPSA 4J98A 3GQIA 3R2YA 4DFBA 2VGOA 5HKMA 4KIKA 5BVFA 1H1QA 2PVLA 3S95A 5CAVA 4RWLA 3VJNA 2YERA 1GIJA 4I94A 2XRUA 1OGUA 2BDJA 3TNPC 1ZLTA 3ORPA 3T9TA 3MH3A 2ETKA 3RAKA 3U9CA 4BCHA 4D2VA 3FZTA 2ZVAA 3Q52A 4QD6A 4RWIA 3RZBA 4C3RA 5M53A 4FKSA 3E93A 3EWHA 4CG9A 3UC4A 1OIRA 4O1OA 3ANRA 2OIQA 3NEWA 4O7ZA 5JKGA 5KZIA 4QTEA 4IX5A 2HCKA 4NUSA 2W17A 4N0SA 3KN6A 1ZYDA 3QU0A 3H3CA 2RG6A 4HCTA 4LRMA 4O6EA 4R1YA 4RIWB 5A3XA 4IE9A 5D11A 3GNIB 3OFMA 2FA2A 5A4LA 4Y73A 1M2PA 1J7LA 4OTWA 3PP0A 2OH0E 2R3HA 3R8PA 1J7UA 4AX8A 3ATSA 4EK6A 2ZJWA 4FL3A 3WF6A 2JFLA 3DBCA 1ZMWA 3FI4A 4NEUA 2ZYBA 3R1QA 5CEKA 5CEQA 3CTHA 5CSPA 2JQIA 1L8TA 3ZDIA 2XJ2A 1UWJA 2GNIA 4FSUA 4FTCA 3OW4A 3FY0A 4QPAA 5CAUA 5DFPA 2WELA 1MRVA 4HJOA 4XMOA 3VS3A 4EHGA 3COMA 3HUEA 1M7QA 2BRNA 4QP7A 3OZ6A 3F88A 3T8OA 3UMXA 3F7WA 3ZO2A 4A9TA 3TJCA 1Y8GA 4BWXA 2OG8A 3HA8A 2R0IA 3KULA 2B54A 4EYMA 4M68A 2RKUA 2VTIA 2C0OA 3RAIA 4OLIA 4IACA 1VEBA 3Q9XA 4FV1A 4PMMA 3FY2A 4ZS4A 1JKTA 4P2KA 1ZMVA 1UU3A 3H9RA 3KK9A 1Q3DA 3Q4TA 2B53A 4HZSA 4O0WA 4U97A 1W8CA 5ETFA 1MQBA 4G3CA 3Q9YA 2PMOX 3BYUA 4X2KA 4PPBA 3VWAA 2BKKA 3PLAE 2Z7QA 5HEZA 5IU2A 3R7OA 1NT2A 2W3OA 2A0CX 4BDFA 1IAHA 1YQJA 4X6RA 5AP3A 2VO0A 3O7LB 4RRVA 3W2OA 1A48A 4D2PA 2QOHA 3PIXA 4O0UA 4I4FA 5ANKA 3MGYA 3S0OA 4GFMA 2R3MA 2HAKA 2EXEA 2UVYA 5FRIA 4CFWA 2VU3A 3CTQA 4UBAA 4BIDA 3PXYA 3NUPA 3HMMA 2QOKA 4IFCA 2XKDA 2WQBA 2G01A 2YIYA 3UIUA 3WF5A 1SNXA 4YTFA 4G9CA 4ZTNA 4EH9A 4JVGA 4MXXA 4RIXB 3W10A 3A4OX 2O2UA 4YC8A 2B1PA 2PVHA 5DT0A 2OSCA 3P4KA 3CEKA 3PWDA 3HMPA 4XV1A 4EZ3A 2ZDTA 4AT4A 3BELA 2VD5A 4M0ZA 3FZOA 4Y5HA 4FNZA 4LGDA 3SLSA 4U45A 3WE4A 4C4FA 4O7RA 1K2PA 5EQYA 4YGAA 2BAKA 3F61A 1U46A 4GVAA 2WMBA 3QA8A 4C61A 2UZOA 2HYYA 2Y6OA 4J53A 3KXZA 5AIKA 4MWIA 3N51A 3VRYA 4CT1A 4D0WA 1Q3WA 1XHAA 1YI3A 4D5KA 3QXPA 4DTKA 4IX6A 3DBQA 1GIHA 1LR4A 1ZARA 1ZY5A 4QP3A 3KK8A 3TXOA 4CFFA 4FEQA 4D2WA 3UN0A 3GCQA 4JG6A 5EDRA 4HW7A 4RVTA 5CSVA 4BZNA 3AD6A 3FZPA 5D9HA 3VA1A 3SV0A 2CN8A 5L6OA 2WGJA 3MVJA 4ACCA 2B9IA 2R5TA 3BYSA 3UPZA 1PKGA 3OW3A 3WE8A 4O81A 1R0EA 3C51A 3FLZA 4PQNA 4DH7A 4A06A 3S00A 4FKPA 5K5XA 3CIKA 4IWOA 1MRYA 1WBPA 4O21A 3MVLA 2XRWA 4CTCA 3F3WA 3IOPA 5IQBA 3HRBA 3LFCA 4YC6A 5M51A 1OI9A 3FL4A 1TKIA 5CI6A 5EW9A 2O64A 1HOWA 4DTAA 4RQVA 5ETIA 4YHTA 3GU5A 3MV5A 4ZP5A 3UNJA 1OBDA 4DEEA 5DN3A 2E9UA 3DB8A 3O7LD 5KBQA 2QR7A 2P3GX 1UNLA 5LMKA 5IA4A 2QOLA 4YJRA 2WEIA 4U40A 2WXVA 4DGOA 3P23A 5HICA 5LOHA 2BRMA 3QQHA 4CMUA 4QMSA 5ICPA 3C4WA 3DT1A 3L8SA 5KO1A 3V04A 4BFMA 4DFYA 4PF4A 4MK0A 4O7TA 3HMOA 4FG9A 3ID6C 3DV3A 4AGUA 3BHVA 4O38A 4X6QC 4LMUA 2W1IA 3WZDA 4GKHA 5I3RA 3ELJA 2OJIA 5HX8A 4BCOA 3LPBA 2BILB 2UW8A 3MDBA 4V05A 3UNMA 3GU4A 4E8AA 5J1VA 4AGDA 1G3NA 4F7NA 4XG7A 2GS2A 4ALVA 3JVRA 4NSTA 3E7VA 4I5MA 4L52A 3OP5A 4EOIA 1YDSE 2QCSA 3QCXA 1YI6A 1RDQE 4HCUA 4HGLA 4RVMA 3PSCA 4Q5HA 3DJ6A 1K3NA 4KKGA 4ALUA 2YIXA 3MDYA 4FVPA 4M66A 4CLJA 3D9VA 3MFSA 3LXKA 3UP7A 1XH6A 3Q2JA 4BCMA 4S31A 4BDAA 4IFGA 4R5SA 4M97A 4ZTHA 4FKRA 4IJPA 1JLUE 4K0YA 4AN2A 5M08A 3FPMA 2EXMA 2UZBA 2CCHA 3ALNA 4TRLA 3OCTA 3TDWA 1TQIA 2FB8A 1GZNA 3PY3A 5J7BA 5IEXA 3E3BX 3M1SA 5H2UA 4ZJVA 4YP8A 3UE4A 2QNJA 2EB2A 4RG0A 4ZMEA 4NU1A 4WUAA 2J6MA 2X6DA 2PU8A 2FUMA 3MWUA 2OXYA 5ANDA 3R7GA 2J0LA 4RX5A 4A07A 4FSNA 3RNYA 3EQHA 2Z60A 3D83A 3IW4A 3VBYA 3FI8A 5M09A 2R9SA 4Q9SA 3RPVA 2BZKB 3FWQA 3Q04A 3E88A 4C4GA 5FXRA 5HIBA 4TZRA 4KIQA 3POAA 3DNDA 3BQRA 4I1ZA 4AA5A 3EFJA 4PX6A 4NYEA 2C3JA 2WEVA 3FXXA 4XG9A 5E92A 3AC4A 1JNKA 3MB6A 2WTVA 4IB3A 4BCNA 4YUQA 5CVGA 5HHWA 3TWJA 2HENA 1M2QA 3NW5A 4MBJA 3PSDA 2V62A 4M69A 1H28A 2HWPA 2ZV2A 3OHTA 5J8IA 4L46A 4YBJA 3W8QA 3LXNA 4ZK5A 3UYTA 4AP7A 1WBNA 3UVPA 3KN5A 5EQEA 5K9IA 3FMEA 2QVSE 3ORMA 4YPDA 3AMAA 5JRSA 3QUPA 2XK8A 4R8QA 1OPJA 4AW5A 3U4UA 2P2HA 1J91A 3NUYA 5H8BA 2JBPA 2VTMA 2IN6A 3D4QA 5DA3A 3D2KA 2PY3A 5FEEA 5LWMA 3HX4A 3CR0A 3C5UA 4C0TA 4JX7A 1XWSA 2X2KA 4J97A 2XM8A 4JNWA 1P14A 5AV2A 4C3PA 4CKIA 1KV1A 3MW1A 2JQLA 4XEYA 3KFAA 3OF0A 2WIHA 4GK4A 5M55A 4YZ9A 3FXWA 3UIXA 3SVVA 1UHTA 5CU4A 3P78A 4H36A 3NRMA 5AR8A 2G9XA 3NNWA 3OCBA 4W4YA 3O50A 4OAUC 3DQXA 5KMIA 5IEYA 1XH7A 2YZAA 2GTNA 4BDGA 4JAJA 4K33A 4MBLA 2XNBA 1CKJA 3TKHA 1YOJA 5AUWA 5J1WA 2UZDA 2VWZA 3KU2A 4K18A 4ZIMA 3EN4A 1ZAOA 5CX9A 5JN2A 3LFQA 4PPCA 5E8YA 4DEGA 4EH2A 4F08A 3R22A 2PHKA 2V22A 3EFKA 4FTJA 4F63A 2WMQA 5A6OA 3FLQA 4KUJA 1U59A 1WMKA 2RF9A 3N4UA 3P1AA 3VUMA 3AD4A 2HZ0A 2ZB1A 5BX0A 2GPHA 1OECA 1HCKA 5HVYA 4BYIA 1KE5A 5AV4A 3BKBA 4BDKA 3ZRLA 5GZAA 5KBRA 3KKVA 5CAQA 5CF8A 2HOGA 1MP8A 4KKHA 2BIKB 4IM2A 4GUEA 4UZHA 5ACKA 1WLNA 2C3LA 1PMNA 4DFNA 5EK7A 4CZTA 3HLLA 1VYZA 5EKOA 3QD4A 4QQ5A 3WI6A 2PUPA 4DT9A 5T68A 3T3VA 3GUBA 4Z7GA 1Y91A 2X8EA 3MN3A 4OTRA 3LLTA 4DINA 4YMJA 4D1ZA 1JKKA 4LOQA 1U54A 3Q32A 5AP6A 3OEZA 3FXZA 4S2ZA 2W1HA 2XNEA 5CVHA 5CANA 1YWNA 4FODA 4NIFB 4BCQA 3FZRA 1J4KA 3MIAA 4RJ4A 3QLGA 2GTMA 3QLFA 4OTIA 4DAWA 4TWNA 5B0XA 4GCJA 3G9LX 1VJYA 3NUNA 4Y72A 3QX2A 2FF4A 1UU9A 5HLNA 5J5TA 3FKNA 1BI8A 3EH9A 5HO7A 3QCQA 4KIPA 4L6QA 4ZAUA 5JT2A 3CGOA 1K3QA 1W82A 3POOA 3TTJA 2QHNA 4L67A 4U8ZA 3R9NA 3ENMA 2W4JA 4U41A 2RFNA 3FUPA 3UQGA 1V1KA 2ITVA 4FSTA 5HE2A 2P4IA 4II5A 4O7VA 3VF9A 5GJGA 4PP7A 2R3LA 4AZEA 4ZSJA 3SGCA 2GNHA 3E7OA 3ZOSA 3BHUA 3QAME 4BRXA 3IGGA 5JGAA 3BYMA 4NT4A 2QI8A 2XK9A 3H0YA 3EHAA 4KBAA 3KXXA 4PNIA 4QMTA 3LCSA 4ZSGA 5ACBC 2YIWA 4MKCA 4DGMA 3HUCA 5FP6A 3MIYA 3GOKA 1K3AA 4OGRA 3BCEA 1ZWSA 3HP5A 5A46A 3DBFA 5AR7A 5I9YA 5A14A 5CXHA 4O86A 3JYAA 3REPA 5HU9A 4XG8A 3GT8A 3S1HA 4PPAA 3ZXZA 4G3DA 4I4EA 3B8RA 2JPEA 4YNEA 4XG3A 3G90X 4IIRA 5DGZA 4MXOA 1UA2A 4DG0E 4HVHA 2JKQA 2X7OA 3K2LA 4HZRA 4AACA 2IVVA 4UALA 3NUXA 2OBJA 2OICA 1JVPP 1ZYCA 2YHVA 4U5JA 4AOTA 5IUGA 5CU3A 3DOGA 4U81A 3KA0A 4JDHA 4G5JA 5D1JA 3EOCA 4L00A 3IDPA 3DAEA 4FTUA 3TM0A 4DYMA 4BDJA 1Q97A 2ITUA 4WNMA 2OXXA 3OWLA 2C3KA 3A60A 3VS2A 4OTGA 4HGEA 3OUNA 4E7WA 2ETMA 2YLFA 2EWAA 2C6KA 4F1OA 1GNGA 4JDJA 4Z3VA 3R7UA 1KUTA 5C03A 3ZMMA 1NVSA 5EHOA 3MPMA 3QRTA 4DCEA 2QOCA 2F57A 3ZFMA 1P5EA 5FM2A 1TQMA 4JT3A 4ANLA 2WPAA 2BVAA 5JH6A 3ATTA 1Z5MA 1DAWA 1H08A 4IM3A 4KIKB 4AAAA 1H1RA 5AP2A 1G5SA 3Q5ZA 4L53A 1K2NA 2EVAA 2V7AA 4IAAA 4ASEA 1UJXA 4C36A 3EQRA 4BCJA 3NX8A 2H9VA 3LXPA 3D7TA 1H1SA 4JG7A 4Z16A 4UZDA 3G5DA 3SQQA 3V3VA 5A4QA 5DEYA 1GY3A 2QKRA 3ZRMA 3FYKX 2WO6A 3ORXA 3IS5A 3GCUA 4EEVA 1OZ1A 4N6YA 3OBGA 3KCFA 3AGLA 3P5KA 4TWPA 3RNIA 4FT9A 4RLKA 2XB7A 5F95A 2WMWA 2UV2A 2KULA 3E64A 3QL8A 3ROCA 5HNIX 3EN7A 4OTFA 2XJ1A 5DT4A 1XQZA 1AD5A 1IR3A 2GFSA 1E1VA 2ITOA 4FSZA 4ALWA 4EK8A 1Y8YA 1LGQA 3U51A 2VTAA 1H00A 5HESA 3Q2MA 3O17A 3MB7A 1IA9A 1IAJA 5FEQA 3BGQA 3CXWA 3UGCA 5IMEA 2NP8A 1MQ4A 3HV7A 4MWHA 2VWXA 4UYNA 4HGTA 5EHYA 5E1EA 5E7RA 3ZO1A 5CQWA 2ITXA 5AAGA 3EB0A 3CBLA 4FE2A 3E5AA 2Z2WA 5M56A 3ZZWA 3SW4A 2J5EA 4FICA 3PG3A 4PL3A 4V01A 3R7VA 4O0XA 4F64A 3ZFYA 1ZOEA 2X9EA 5FUTA 5HTCA 1NY3A 2XNNA 4X21A 4FVQA 4DG2E 3AC5A 4JQEA 4EH7A 4GJ3A 5GHVA 1PRYA 2VWUA 3LJ0A 3ZSHA 2ZV8A 3HUBA 1Q61A 3NIZA 4JG8A 4M12A 5EW8A 5FTOA 4DC2A 4QP6A 4E5AX 4KKEA 3NWWA 4QMUA 5ANOA 2XCKA 4F1TA 3KULB 4JAIA 4O0SA 3RK5A 2F4JA 3ZZEA 3R1NA 3V5WA 4AGWA 2G15A 4JRNA 5DT3A 4FKQA 5HX6A 3O8TA 4TYEA 1FVRA 4NFMA 2Q83A 2CSWA 3ODYX 3ZYAA 3ANQA 1I44A 5ETAA 5FD2A 4RWKA 5A4TA 3GI3A 2QQ7A 3LAUA 1FVTA 3F2AA 4TYHB 3TL8A 2VWWA 3QGWA 3NNVA 1PMUA 3LIJA 4FSRA 5FDXA 4AA4A 4IB5A 5E1SA 4ANQA 1PXKA 4JL9A 2QO7A 4YR8A 5KCVA 2QOFA 4FI1A 5E91A 3ORIA 2UZVA 2QODA 5LMAA 2QONA 4YZCA 2F7EE 3K3JA 3UOKA 4E4LA 4CFXA 3RVGA 5L4QA 4H39A 3VBQA 4I93A 1K2MA 3ETAA 3R71A 1OUKA 2R3OA 5IA5A 4ITHA 3KRXA 3KCKA 4KBKA 1V0BA 2B4SB 3V5QA 3F3ZA 2JDOA 2QG7A 4QTBA 3C4ZA 1RE8A 4USDA 5C01A 3V5JA 3F66A 2C6LA 3OEFX 5FQDC 2VTTA 1Q5KA 2A4LA 4CLIA 3V5PA 2REIA 2B0QA 2WHBA 5GJDA 2GNGA 4ARKA 3GOPA 3WIGA 3FJQE 3R1SA 1QPJA 2UZEA 3FMNA 4FUXA 4V0GB 3VHKA 4RX7A 3DKGA 3R63A 4KINA 3R83A 3CKXA 3MS9A 2O0UA 3SHEA 1CDKA 3R28A 4ASXA 4DH3A 4EONA 5E4HA 4H58A 3RWPA 3TIYA 3SKCA 3JXWA 2GSFA 3HX1A 4MX9A 2PVJA 3JUHA 4I24A 4IX4A 4DBNA 1P4FA 4YTCA 3A8WA 4R78A 2R7BA 3FQHA 3DAJA 1OIQA 2R4BA 3R1YA 1Q41A 3I0QA 3HV4A 3LE6A 2I0YA 4LV8A 4C34A 5AX3A 4EK3A 5TO8A 5BUIA 2WQNA 4CSVA 5CI7A 4FSYA 1UU8A 5M4CA 3DTWA 3Q9WA 5CASA 1REKA 4APCA 5DHJA 5FG8A 4M15A 1WAKA 4FIGA 4R6VA 4U7ZA 3HP2A 2DWBA 1PXOA 2AUHA 2PZRA 3TI1A 2IZUA 4JONA 4HPTE 4IHPA 3UMWA 4EZ5A 3NW7A 3R9RA 4BZOA 2FH9A 3H30A 4E6DA 4WA9A 3PPJA 3NUAA 1ZXEA 2QO2A 5E8XA 4ZLYA 2J2IB 1KE6A 5E8VA 3A7GA 5BUEA 4MD8E 4ERWA 1JAMA 4G2FA 5I9UA 2CNQA 2VAGA 4K9YA 4ANNA 4PMTA 4YSMA 4FG7A 4GKIA 5FGKA 3OWJA 3FLSA 3KRRA 3KF4A 3FMJA 4L43A 2Z7RA 3PE2A 3R8LA 4B99A 4XYFA 3ZEPA 4G5PA 5JFVA 2XCHA 4D2RA 2R3QA 3SDJA 4PMPA 3O71A 5TE0A 3K5VA 2EH0A 5AUZA 3OROA 2OIDA 3NLBA 3QX4A 2ZB0A 3UZRA 2A0TA 1Q4LA 5C8KA 4OTHA 3QTWA 2PVMA 5AP7A 3RAHA 5BQ0A 1GOLA 5CEPA 2WOTA 2X0GA 4JIAA 1JKLA 2QLUA 4G2SA 2XUUA 3A99A 4O84A 3D7ZA 4BIBA 4FV3A 3TUBA 2C69A 3FMDA 2WQMA 4WHZA 2JEDA 3UNNA 4H05A 3U55A 4D4SA 1W7HA 4EI4A 1FPUA 3AQVA 2OIBA 1ZRZA 2Y6MA 5IQDA 3SOCA 1J3HA 3Q5IA 2R3JA 2W7XA 3WYXA 4QQJA 1YHWA 2C5XA 3RJCA 1J4PA 1YRPA 2OJJA 3NR9A 3EMGA 3ULZA 4D9TA 3ZU7A 2WMTA 3IK3A 4FK3A 4E4MA 2AC5A 2J5FA 2SRCA 5DJOA 3QHRA 4AF3A 4BTKA 5IA0A 5KKRC 1S9IA 3FHIA 2C4GA 3CD3A 2BTRA 4FOBA 3BRBA 4NZWB 4Y8DA 4EH4A 4UMQA 5IA1A 3C7QA 1P2AA 5AAEA 2XK3A 5C8MA 4OW8A 2YM5A 3NGAA 2Z8CA 2OFUA 5HQ0A 3TNQB 1UWHA 1F3MC 3ZSIA 4KSPA 4AN3A 2JKMA 4E6QA 3CD8A 4DEDA 3BQCA 3FM8A 1VYWA 2PMNX 4O22A 5AP5A 1APME 3LHJA 5DNRA 4NKSA 5AUTA 1WVWA 4UWBA 5EG3A 1KOAA 4E4XA 4HCVA 3HGKA 4CYIA 3WF7A 4EOKA 3LQ5A 2UW4A 2RGPA 3G2FA 5M4UA 4YJUA 1WZYA 1EH4A 1ZOGA 4MTAA 4BCPA 3PVBA 1PMVA 3Q3BA 3Q4UA 5A4EA 3NUSA 5ANEA 5F20A 3AGMA 5BVEA 1SVHA 4G17A 4FZAB 1YXVA 3EZVA 4YZBA 2GQRA 4FZ6A 3PG1A 4FGBA 3VJOA 5ETCA 2XMYA 3ET7A 3EN9A 1XKKA 2G1TA 1PXJA 4S33A 4F0IA 4FVRA 4EHEA 2OLCA 1R1WA 2WMVA 5EM6A 3SOAA 4XOYA 2BHHA 5HTBA 4ITJA 3F5XA 3LM0A 2G2IA 2J0KA 4GU6A 2ZM4A 5EI2A 3C9WA 2QD9A 4FEXA 4FC0A 3PJ8A 5AX9A 2X7GA 3P7AA 4FZ7A 4BDDA 2ZDUA 1OB3A 4AWIA 5A4CA 1BYGA 4MQ1A 5CU0A 4XX9A 2JFMA 3F3VA 4HGSA 3ZS5A 5FBOA 4PNKA 3AT3A 5J5SA 3D14A 4W8DA 3HECA 1OL7A 4G1WA 4HYSA 3WF8A 3ZH8A 3UQFA 4D9VA 3PRIA 4X2FA 3MY5A 2YM8A 4IAZA 1KE9A 4C37A 3C13A 1JOWB 4ANSA 4BKJA 4FV6A 3TKIA 3G9NA 5DYJA 1I09A 4FV7A 3COKA 2C6IA 4LUEA 3I0NA 2OU7A 3JR1A 3QTUA 2P0CA 4FIJA 3VUDA 4F9CA 3I5NA 4C58A 5B2LA 3QZGA 3UVRA 2YA9A 4ASDA 4J8NA 3DB6A 3DU8A 4MNFA 2YDJA 5J95A 4RC2A 2XKFA 4R1VA 2Y4IC 3LJ1A 4I23A 4YZMA 3T9IA 1UNHA 4XJ0A 4X3FA 2I6LA 3R9OA 4CV8A 4DG3E 4PY1A 1YHSA 2ZM3A 3KRLA 3NAXA 2W0JA 4ITIA 4C33A 4ENYA 3ZTXA 3K3IA 5EM5A 2GQSA 4RIOA 1ZYJA 4GFOA 4DEBA 5KX8A 2GFCA 2XJ0A 4UXLA 3PA5A 4EHVA 1R39A 5F1ZA 2UW0A 3DGKA 4NM7A 2ESMA 2HZNA 4HYIA 3WZEA 1DAYA 5BVDA 3N4VA 2ERKA 3LFSA 5HG5A 4MNEA 3PVUA 2XH5A 3IDBA 4X2GA 5E8TA 3FAAA 4WNOA 3UDBA 4QYFA 2WTDA 2IG7A 2ITZA 3UO6A 3MYGA 2VO6A 4CEGA 1W83A 3EQDA 4CCUA 3UOTA 3OUKA 5AR4A 3FKLA 3U9NA 3EYHA 3LVPA 1R78A 3LMHA 4BYJA 3VNTA 3UPXA 5EH0A 2LC1A 3Q9ZA 4EYJA 1U54B 3KL8A 3ZO3A 1CKPA 4RLLA 2EB3A 4QMMA 3QKMA 3BWJA 3FLWA 3PDTA 4I6FA 2CLQA 4TKSA 5ANJA 1YOMA 2G2FA 4FKGA 5EYMA 5AEPA 3C1XA 3B2TA 5BYLA 4CYJA 1Q24A 2CGXA 3A61A 4GUBA 4MCVA 3I0MA 1X8BA 4CT2A 4CXAA 4A0EA 5AA9A 3R7YA 3KC3A 2PYWA 1Q8ZA 3TZ8A 2C1AA 5HOAA 3SA0A 5AFVA 5DEWA 4XV2A 4D2SA 4IDTA 5IKWA 4BDCA 1NVQA 4DE4A 3S4QA 4FKUA 2WMSA 3ACKA 2VV9A 2Q0BA 2YACA 2AC3A 3DAKA 3MPTA 3P7CA 4WT6A 5I4NA 4KBCA 2F2UA 1SVGA 1BL6A 2VTRA 5CSXA 3BWFA 2YAKA 3VUGA 4PTCA 4ZEGA 5DG5A 5DR9A 3PY0A 5JZJA 4IWPA 3BYOA 4CV9A 2XNPA 5IG1A 3Q4CA 5T6KA 2BFXA 4RPVA 4FIEA 4YJSA 4R3PA 4BHZA 4F7JA 1BX6A 2X6EA 4QT1A 4U9AA 3MBLA 5FLFA 3HDMA 3LOKA 3VC4A 2XIRA 2FSMX 1BL7A 4FKTA 4WUNA 4CRLA 4MXCA 5IMXA 4W4XA 3TJDA 4F1MA 2YWVA 3VUIA 3G51A 1ZMUA 5CSWA 3PVWA 4IC7A 4CVAA 3EYGA 3G33A 5DR2A 2HELA 2VGPA 3LW0A 5L3AA 4O0RA 4OTDA 3JVSA 5H8EA 5TF9A 3TZMA 3ZUVA 1CSNA 4A4XA 2QU6A 4F4PA 3II5A 2QOOA 3DJ5A 2G2HA 4B7TA 1LEZA 4L8MA 1OPLA 4BTFA 1AQ1A 2V7OA 3DY7A 4CFUA 3GU6A 5DLSA 4EOSA 1WBWA 5AP1A 2R7IA 3OUNB 3UOLA 2P33A 4KWPA 1GZ8A 3D94A 3VBXA 3O8UA 5AR3A 2X2MA 3Q53A 3H4JA 4TPTA 3IPHA 3TACA 1H26A 3W2SA 4AZTA 4DF3A 3MI9A 3H9OA 5CNNA 4OBQA 3SG8A 2VN9A 1JKSA 2V0DA 4MXZA 3AD5A 4P7EA 2FVDA 3Q60A 4PDYA 4DCAA 1FOTA 4OBOA 4PMSA 3WZKA 4TTHB 4DTBA 1NA7A 5CSHA 3EQBA 3F3TA 4X3JA 2IW6A 1JSUA 4B8MA 4C7TA 5LMBA 5K0KA 2UW3A 2XNGA 4PV0A 3ZFXA 4EHZA 5DOSA 4YJVA 3QD2B 5JMSA 4FTOA 3KQ7A 4ZJIA 3ZO4A 3S2PA 2IZTA 2PK9A 3COIA 5HBJA 5GIPE 2WQOA 3QD3A 4I92A 4G3GA 2OZAA 1RW8A 2XP2A 3DFCB 4IM0A 2QR8A 4NM3A 5L6PA 1QCFA 5KKRB 3BI6A 5AUXA 2PVYA 1UKHA 1M17A 3QRIA 3W32A 1A06A 1O9UA 1RJBA 2W1GA 3ZC6A 2ONLA 2GMXA 4CTBA 4FEVA 3R2BA 2GHLA 2QHMA 3PXZA 4CRSA 5AUUA 4NL0A 2KTYA 2F7ZE 3U8WA 3CP9A 2R3KA 4J95A 4YHJA 2HW7A 3GC8A 1YW2A 2IWIA 2UUEA 3FC1X 3FSKA 3HKOA 3O0GA 3QRJA 4L01A 2C0IA 2ZAZA 4IZAA 5D7AA 5G1XA 4PL4A 4BKYA 4CFNA 3OG7A 4O2ZA 2OGVA 3OBJA 4U80A 4W9WA 2VX1A 1M52A 4W9XA 2PZPA 3FLYA 3DXPA 4U0IA 5LQFA 3VS4A 4M13A 1OL2A 3BEGA 3FMLA 3MY0A 2IVTA 4Y83A 4I22A 4NTSA 3MVMA 3TV4A 4XLVA 2CPKE 3TV6A 3BBWA 3N9XA 5IQAA 3U54A 2UZNA 4FL1A 3CC6A 4F7SA 2UVZA 5CZIA 5BVWA 2YJSA 2XYUA 1FGKA 4X3FC 5D7VA 3ZBFA 5L8LA 1GZOA 3V01A 3ELSA 4QP4A 2Y4PA 4QQCA 5JSMA 2CGVA 1ATPE 2C1BA 2C6MA 3KVXA 4G3EA 3RAWA 5KNJA 4FTTA 4QTDA 4R3RA 5B2KA 4QMNA 2JKKA 3U6HA 1SZMA 3AOXA 3EQFA 4ACMA 4F7LA 4ZLZA 2J50A 3O96A 3OC1A 3TUCA 2EXCX 4LRKA 3DLSA 4BHNA 2PIEA 4IAFA 4R5YA 3GXLA 3R21A 5IA2A 2WMUA 4DGLC 1YXTA 2W05A 4BTMA 1MZKA 2PVFA 3ZUUA 4EUUA 5B2MA 3DZOA 3IW8A 2H96A 3CJGA 1H01A 4CD0A 1XO2B 4NM0A 5DH3A 3QXOA 3HV5A 1OBGA 1YVJA 4CZYB 4CFVA 4ANOA 5M4FA 4NW6A 5EFQA 3ZUTA 3ORKA 4HOKA 4DFZE 4A9UA 4XP3A 2VTJA 2RSVA 4QO9A 4X0MA 2G1LA 3G6HA 3LCTA 4I6QA 4FSQA 4YLJA 1QU5A 3LFEA 5IQHA 2I1MA 4FUYA 4YJPA 2R64A 3SD0A 1NXKA 2E2BA 1OM1A 1E1XA 5I0BA 5IPJA 3LKMA 4JS8A 1ZZLA 5E8ZA 3I7BA 4MD7E 1FINA 2Y4IB 3PXFA 5E8UA 5F94A 3QD0A 4C4IA 5DBXA 1YHVA 4FTKA 4GFGA 4F99A 3PXRA 3H0ZA 3LM5A 4UX9A 2ZOQA 3OXTA 4KSQA 3ZM4A 3P86A 4CKRA 1JQHA 1O6YA 5CNOA 5I9WA 3CLYA 1ZY4A 2WZJA 2W9ZB 4FNXA 4FR4A 2I0VA 4ZSAA 4AW1A 1OL6A 3PFQA 4O6LA 5LMKC 5HORA 2PUIA 4FEUA 1Q8TA 3I60A 4CQGA 2B7AA 3LQ8A 3BLHA 2PVRA 2XIZA 5CU6A 2VTQA 4QMLA 4F6UA 3QZHA 3R8MA 5DVRA 3SG9A 3G6GA 3ZLSA 1F0QA 3G0FA 4H1JA 4RJ7A 1CTPE 2ITWA 5DPVA 4WD5A 3A7JA 5CU2A 2QLQA 2YCQA 4R7IA 4BCFA 3V8TA 3M11A 4R3CA 4KIOA 4TYJA 1Y6AA 3I79A 2X8IA 2GS6A 3DS6A 4XNEA 4B8LA 1Q8WA 1DMZA 1GIIA 3TG1A 4GYIA 2VNWA 1PHKA 3NYOA 3FDNA 3WOWA 3TCPA 3UTOA 5L6WL 2QO9A 3OY1A 1YJ5C 1H25A 4FF8A 1IRKA 3AMYA 3JPVA 3LQ3A 2ZV7A 2YCRA 4RC4A 4F6SA 5LVNA 2WKMA 3UG1A 3U87A 1URCA 3E62A 2X7FA 3AC2A 4L44A 3NCGA 4YJOA 3A2CA 5KMKA 1T45A 5EYCA 3QTIA 2YIRA 3DK7A 3WIKA 4G9RA 5DI1A 5CWZA 4CCBA 2BRBA 2O65A 3HAVA 3OXZA 1ZZ2A 4EWHA 3TUDA 4WKQA 2WU6A 2VWYA 3NIEA 4DFLA 3QC9A 2KKLA 5DE2A 2OFVA 3CKWA 3ITZA 4L3PA 4FEWA 3W2CA 5K0XA 4K2RA 4IZ7A 1E9HA 4GK2A 3QTRA 2IW9A 3C0IA 3ROYA 2GHGA 5L8JA 4IQ6A 4JBQA 2UZTA 4TNDA 4EH8A 5AIRA 3P7BA 3R02A 4AT3A 2KB4A 4K8AA 3QGYA 5CT0A 4TYGA 3E8CA 4DLJA 2DQ7X 3BGZA 1XH5A 3NZ0A 4HVSA 3UZPA 4S30A 4IC8A 2CKPA 3H10A 3LFAA 4ZLOA 4R7BA 2PTKA 2W4OA 4FSMA 3I4BA 1JSTA 3BHHA 2B55A 5EDPA 2KFUA 2PZ5A 3NUUA 5M4IA 1H1PA 2BRHA 3EIDA 3O8PA 2ONLC 4L45A 4Q5EA 3NVKI 2GQGA 1OMWA 4XP2A 3VQUA 3E63A 3OCGA 3TZ7A 4Q9ZA 3NMUF 1JPAA 4FX3A 3C0GA 3MVHA 4IZYA 4AFJA 2WMAA 4CG8A 3NVMB 3W2RA 4IJ9A 1PJKA 3G15A 5EKNA 2Z7SA 2BKZA 3TT0A 1XH9A 4G34A 3D5XA 4WG3A 5C9CA 4NJDA 4EJNA 4FYNA 5GIOE 3UZTA 1Y6BA 4DEAA 2X9FA
chains in the Genus database with same CATH superfamily
4XG6A 4QMZA 3QQGA 4XOZA 3C50A 5CEMA 3FSFA 4JI9A 3TIZA 2WMXA 1HCLA 2W96B 5K5NA 2JGRA 3ORZA 1PXMA 4FV4A 1YXUA 5BMSA 1BMKA 1PW2A 1YDTE 4FZDB 4WERA 5EDQA 4YC3A 3CGFA 2RFSA 3V8QA 2C6TA 2C3IB 2UZWE 2ZFYA 1V0PA 2CKEA 1ZYSA 1XJDA 4MAOA 3FQSA 1KV2A 4GRBA 3BE9A 3IG7A 4I0TA 3L8PA 2X81A 3ZLYA 4O7LA 4ANBA 4QP2A 2OI4X 2WTWA 5HNBA 3Q6WA 2J9MA 4DLIA 4TL0A 4K77A 4QMWA 4F65A 5CXZA 3ACJA 4GG7A 3LCDA 3ZXTA 3IONA 5LVPA 3RCDA 2CKOA 3RI1A 4F9YA 2LGCA 4QCJA 1K9AA 1U7FA 4O7SA 2IW8A 4CNHA 5AR2A 1BI7A 5FP5A 1IA8A 2J90A 2PPQA 5J7HA 4LG4A 1OKVA 3A7FA 3CS9A 3EZRA 2FGIA 4KS7A 4WBOA 5HD7A 4BF2A 4C62A 3VW8A 5HZNA 2OF4A 4GK3A 3QQFA 1Q62A 4XUFA 5AWMA 5A9UA 3KVWA 3F2NA 4BL1A 1TFFA 4ZJJA 2XS0A 2ITNA 4RFMA 5CT7A 4JBPA 5TOZA 2DS1A 3RK9A 5FEDA 4GT4A 2I40A 4BY9E 4AZWA 4IAKA 1JWHA 2JAMA 5CAOA 3QRKA 5LCJA 4IX3A 4AZFA 2J4ZA 4EK5A 2JLDA 2O8YA 4O83A 2NO3A 4GSBA 2YM7A 4LGGA 3NFFB 3VS5A 1XBCA 3EKKA 3SXRA 3RHXA 4XCUA 4DBXA 3UV0A 5C1QB 2WQEA 4X3FB 5K3YA 3DJ7A 3VBTA 2X1NA 2BFYA 1GJOA 3AT4A 3EN6A 3FV8A 3HRCA 2NPQA 3MFUA 3PSBA 4JDKA 5HG7A 3BEAA 4RSSA 4LM5A 1GZKA 2I0HA 1WBSA 2JIIA 4GJ2A 2UW5A 3FKOA 2YCSA 4BGHA 4HVGA 4EJ7A 4MNEB 2W9FB 3ODZX 4OUCA 3TN8A 5AP0A 4EUTA 4HYUA 5AV0A 3HZTA 3GC9A 3MFTA 2XF0A 3JS2A 4PTEA 5DMZA 1RQQA 1KSWA 3O23A 5FBNC 5CS6A 3RP9A 4C38A 2NRYA 2Y0AA 2YEXA 4V04A 2YAAA 2H6DA 2XZSA 2OJGA 3QQUA 5A6NA 1OL1A 3EQIA 5J9LA 5FTGA 3ZLWA 3RGFA 3PLSA 2Z7LA 3PJ3A 1PYXA 4BZDA 4C4JA 4FTAA 4B4LA 3L9LA 3D15A 3W0SA 5IF1A 4XG2A 4FT0A 1Y57A 3KY2A 4U3YA 2R3RA 3CQEA 1Q8UA 5EYDA 3SXFA 3F3UA 3GFWA 4HVIA 4BR3A 2VX3A 1WFCA 3VRZA 3W18A 5BPYA 5AAFA 2BR1A 4QP9A 1M7NA 2DUVA 3TTIA 3UODA 5M57A 3UOJA 3VS7A 4FV5A 2AN1A 4KAOA 4FIFA 4FTNA 3BLQA 4XBRA 3MFRA 4K11A 1O6LA 4CQEA 3UOHA 3AG9A 4AAYA 3DA6A 3V8SA 1PF8A 4BWKA 4DEHA 3R30A 5KMOA 2B9HA 4FT7A 5ANIA 4RA4A 4BVUA 5JELA 1ST0A 2J0IA 3HL7A 3MPAA 3ZHPC 4I41A 4OR5A 3RHKA 3HMIA 4H1MA 3V80A 3BV2A 4QQTA 4AOJA 5IEVA 5JGDA 5L8KA 1G8KA 3QCYA 2BZJA 4I0RA 1KOBA 1BLXA 3ZM9A 3I81A 2WIPA 4XS2A 4YPSA 4EOPA 1FHRA 1BUHA 2OW3A 5B7VA 2HXLA 1FBNA 3R0TA 5J9YA 1WBVA 4E6AA 2R3GA 4WNPA 3VA4A 1Z57A 5HGIA 3VIDA 2ERZE 4PDSA 3A7HA 4O27B 3OTUA 3UIMA 4EORA 1J4OA 5M07A 4YBKA 4J99A 4M8TA 4MVFA 4L7FA 3E8DA 1H0WA 3UIBA 2PULA 4DN5A 4H3QA 4DH5A 4GW8A 3F9NA 1FGIA 4WSQA 2PL0A 3CQUA 2JGZA 3FE3A 4PRJA 2OZOA 3QALE 4H3PA 3AXWA 3EL7A 1OITA 4NCTA 5EM8A 3VZCA 4YLLA 2CNUA 1YWRA 1U0RA 1PYEA 4I6BA 5F4NA 5IQEA 4I0SA 4ONAA 3GVUA 3TV7A 5HCZA 4UYAA 1W84A 2NRUA 2PE2A 1KE8A 4ACDA 3PJCA 5G6VA 5AR5A 3OOMA 2W1EA 4C02A 2BUJA 3R01A 2JIVA 4E4NA 3PTGA 5BVKA 4PDPA 4W4VA 1FHQA 4J52A 4R9PA 4IBMA 5A54A 4ZMFA 2IF8A 1OL5A 3IO7A 4CFMA 1WBTA 3K54A 4C4HA 2V55A 2FYSA 4KA3A 4E93A 1G8SA 4OTPA 1ERKA 2BRGA 2IVSA 4UY9A 4U44A 3BHYA 4DA5A 2R3FA 2PE0A 2CNVA 3RWQA 3ZBXA 3AC8A 4E5BA 3GFEA 1NW1A 4FT5A 5CZHA 3OTVA 5LVLA 4D5HA 3PRFA 3QUEA 4FMQA 3I6UA 3ZRKA 4AE9A 2FSLX 5LARA 4IVDA 4R77A 3TMOA 4D0XA 2A2AA 1YXXA 5JQ5A 2OZAB 3F82A 3FZSA 4IVCA 4N57A 3EJ1A 4DFXE 4QRCA 3L8XA 1QL6A 4IVAA 4YJNA 2I2CA 4AUAA 3H9FA 4RZVA 5EM7A 3PY1A 5C8NA 3R04A 4I5CA 3Q4ZA 4G16A 2FEZA 1SMHA 1H1WA 3DPKA 4IB0A 3RPSA 2QKWB 3GB2A 4MXYA 1J4QA 2I0EA 3WILA 3LMIA 2ZMCA 3ENHA 2J0JA 2P2IA 2V5QA 3GCPA 2RL5A 4RFZA 3R8VA 1QMZA 4D58A 2FSTX 4M69B 4N6ZA 3PPZA 3PUPA 1R0PA 4AS0A 4XLIA 5BVOA 3PVGA 2F9GA 4ZXTA 2ITQA 3SRVA 4E1ZA 3OS3A 4TN6A 1UVRA 4FSWA 4M14A 4TYIA 3E87A 2GHMA 5DIAA 4FGRA 5JK3A 3V8PA 5EQPA 3BX5A 1CMKE 4GYGA 4E3CA 4ZY5A 2JDTA 5HVKA 2VTOA 2XEZA 5HBEA 3KREA 5DWRA 3IW7A 4M0YA 3W55A 3EFWA 3KGAA 3BU5A 4D2TA 3EKNA 3EN5A 3C4CA 1DI8A 4EJQA 3UJGA 3FQEA 2C68A 5C4KA 3EL8A 2E9PA 4NM5A 2YABA 4U3ZA 4W4WA 4UMRA 4QMVA 4YTIA 4ZTMA 5GZ8A 5JQ8A 4WIHA 4QNAA 3PFNA 2AEGA 2WOUA 2JDVA 4BDHA 2B9JA 4RC3A 1V0OA 3C4FA 3NS9A 4ACHA 4G3FA 4LOPA 4U79A 3BBTB 4E26A 1SYKA 2QC6A 4GIIA 4QMOA 3F2RA 2QOQA 3IW5A 5D12A 5BV3A 3PZHA 4NH1A 4QPMA 2W1CA 3R00A 5IDPA 3PJ1A 3FBVA 3PWYA 4FBXA 1B6CB 4MHAA 2CSNA 1F5QA 1KWPA 4BGGA 4K6ZA 3MESA 3MA6A 3FMHA 4RMZA 4F9WA 3MH2A 4XHKB 4BBEA 2QU5A 1WVYA 2BHEA 4BKZA 4LYNA 2OJ9A 4C57A 1JBPE 1DI9A 2UZUE 2WTKC 3F5PA 5KMNA 2X0QA 3PJ2A 1REJA 4UMUA 5TKDA 2EU9A 1UU7A 5CF5A 3TNHA 3AMBA 4TYHA 2UW7A 1J1BA 4LI5A 3LFNA 1O6KA 3D5WA 4YURA 4UN0C 3I6WA 4CKJA 1YI4A 2X8DA 3JY9A 4YHFA 2JBOA 5C27A 4QEBA 3PZEA 2PWLA 5LVOA 4L3LA 4FV8A 4LL5A 3V8NA 3LXLA 2XBAA 3POZA 3RMFA 2WMRA 3L9MA 3WZUA 4FTIA 5J9ZA 3OY3A 3HAMA 1YDRE 5K4IA 4QTAA 4E5WA 2HZ4A 3QQJA 2E9VA 3HA6A 2BDFA 1KE7A 5KHWA 3DQWA 3KMMA 4J71A 4OAVB 2UW6A 3GC7A 3OT8A 4FL2A 3QKLA 3MH1A 3TNWA 3PIYA 3FI3A 4V0GA 4MH7A 2GNFA 1LEWA 4YNOA 2VX0A 2C30A 2X39A 4PL5A 4NCTC 4LGHA 5D10A 4XRJA 5TT7A 2OH4A 3FMMA 4TWOA 3NNXA 3QKKA 1J1CA 1L3RE 4QMPA 2C6OA 2XIYA 2HIWA 5ITAA 2C5VA 4Y95A 4LDTA 3C4EA 4YO4A 2R3NA 3AC3A 2BTSA 3VVHA 3F7ZA 4BB4A 3DKCA 1A9UA 2AQXA 4RGJA 4RVLA 3T5PA 3O51A 3GP0A 2CGWA 3QWJA 4Z55A 2XNMA 3KRJA 2C6DA 4FTRA 3ALOA 4ZZMA 2RG5A 3UYSA 1IEPA 1OVEA 3OT3A 2BMCA 4KRCA 5EOBA 3V6SA 3QQKA 1P4OA 4GS6A 2ZV9A 4JRVA 3KMUA 3DKOA 4CMOA 4EOLA 5I9XA 4TXCA 4RJ5A 2GU8A 3VS1A 5HIEA 2JKOA 3PXQA 3KRWA 4WSYA 4O0YA 2BCJA 4E20A 4FNWA 4BDIA 3PXKA 1AGWA 3TZ9A 3FC2A 5DRDA 1IG1A 1Z9XA 4FTQA 4R7HA 4MF1A 4I5HA 2YISA 3Q6UA 4IVBA 2H8HA 2WTIA 4FKWA 4G6NA 1CKIA 4ANMA 1S9JA 2W1FA 3MTLA 4L7SA 4WNKA 4GT3A 3BHTA 4ZY6A 3K5UA 3PIZA 4C35A 5CF4A 4BJJA 2OJFE 4AN9A 4MF0A 3QQLA 2YFXA 5FM3A 3VBVA 3TKUA 4DGNA 2UVXA 2CJMA 4RIYA 4C4EA 2CDZA 4BDBA 4HYHA 2XKEA 5CENA 4C8BA 2XA4A 3M2WA 1QPEA 1TVOA 2PZYA 4D28A 5HD4A 5M44A 3ZCLA 3GQSA 3CY2A 1XMLA 5C4LA 2C0TA 4L3JA 5AADA 4IDVA 4C59A 4LQMA 5HE0A 4AU8A 4BIEA 4EC8A 4O7WA 2HZIA 4JDIA 3DDQA 1J7IA 5GJFA 2XXSA 4LV5A 3D7TB 4RA5A 3GU7A 1FMKA 1GAGA 2JIUA 3VBWA 4BI1A 5AM6A 2C5OA 5IH4A 4J8MA 2ACXA 2BDWA 5I3OA 3RKBA 3MSSA 5GZ9A 1B38A 3DXNA 4O0TA 1QPDA 3TEIA 2ETRA 3W1FA 3A4PA 3UG2A 5EI6A 4DHIB 4PUZA 3HVCA 1PXLA 4FIHA 3RZFA 1STCE 4HNFA 3QTXA 4ID7A 2JDRA 4DHFA 5AA8A 2PVKA 5AJQA 2C47A 3DFAA 1ZYLA 3U6IA 4KNBA 4O2PA 4J96A 4QYGA 2HY0A 3D2IA 4FNYA 4P5QA 2C5NA 3ZSGA 2IZSA 2XK7A 3W16A 4EH5A 4FKJA 1XH4A 2PZIA 3QTZA 2XEYA 5E90A 5LVMA 4XP0A 4APPA 4G6OA 5D41A 3OVVA 3VPYA 4ENXA 4GV1A 4F09A 4AXFA 2PMIA 3E8NA 2BONA 2W99B 2R2PA 2W4KA 4U42A 4FKVA 2BAJA 2PMLX 2VO7A 3FMKA 4KS8A 4XV9A 2I7QA 2JC6A 4Y5QA 4U43A 5TR6A 1MR1A 4WRRA 1H0VA 4V24A 5GINE 4JJRA 4QP1A 5BVNA 4WG4A 5EW3A 3BPRA 2B9FA 5AV1A 4UMPA 5A8IA 3ZEWA 4DEIA 2CGUA 2W5AA 3TNIA 1B39A 4GVJA 4OT5A 3UBDA 5JEMA 5AUVA 3QHWA 4J1RA 3OCSA 4UV0A 1IASA 4QP8A 5HE1A 4E6CA 4YU2A 5CVFA 1U7FB 1FQ1B 3W8LA 2LAVA 3QBNA 3WBLA 4Q2AA 2O5KA 4YO6A 2BZIB 3CPBA 4IXPA 3U6JA 4GT5A 5IQGA 4AE6A 2YZLA 4ZS0A 4MQ2A 4UEUA 5AV3A 4KU0D 3VS6A 3D5VA 4Z7HA 4RIWA 2F7XE 1VZOA 2H34A 3CTJA 3D5UA 4N4SA 4EH3A 4AGCA 3OXIA 1MJSA 2JITA 4EQUA 5GNKA 4FA2A 4F9BA 3ML1A 4WRSA 4GMYA 1SUWA 5IUHA 2W5HA 3LFBA 4QYYA 4O4EA 4BC6A 3PYYA 4ORKA 2XM9A 4OTQA 4F0GA 4HNIA 4GG5A 2HW6A 3PP1A 4GIHA 3ORNA 4EOMA 1W2CA 4P4CA 5J79A 5LWNA 4O82A 3ERKA 1DM2A 5BYZA 2F2CB 4QMQA 4EKLA 3EQCA 3EQGA 3IDCA 4O1PA 2E9OA 5CQUA 2PUUA 3COHA 3I0OA 3F69A 3QTSA 3V5TA 3NCZA 3LFFA 3VULA 1URWA 1XR1A 3F5UA 3MA3A 3NPCA 4D1SA 3NYNA 4NTTA 3IECA 4O4FA 4RT7A 5EOLA 4ZTQA 2YLEA 2IVUA 2QG5A 3I1AA 4F0FA 1PKDA 3E92A 2VTLA 3BE2A 2VWVA 1YWVA 4P90A 5FWKK 3V7WA 2VTPA 2YJRA 2GCDA 3IGOA 2JD5A 2YM4A 3PA3A 4J7BA 5DRBA 1H27A 1OUYA 3IKAA 4EQMA 3FYJX 5JRQA 5HI2A 4FZFB 2VWBA 4ERKA 3VF8A 4AZVA 2A1AB 3IQ7A 2Y8OA 4IZ5A 5KZ0A 2XK4A 2W5BA 3CSVA 5FXSA 2A19B 4JOAA 2C6EA 5HLWA 4DGGA 3L1SA 4MD9E 2XKCA 1WBOA 3LCKA 5IH5A 4A9YA 1YT5A 4O7NA 1WCCA 4B9DA 2E9NA 3KF7A 3GCSA 4FIIA 5JZNA 2XYNA 5CY3A 3U4WA 3V5LA 5BUJA 1J4LA 2IO6A 2WTKB 3UNKA 4BBMA 1NVRA 4Z9LA 3EFLA 4FJVA 4IEBA 4MYGA 2PSQA 3UO4A 3R7IA 3UO5A 1H07A 2YITA 4RIXA 4RJ8A 2JAVA 4UWYA 4C2VA 4C3FA 3P79A 2CHLA 1MUOA 3QA0A 3V6RA 4EOOA 4TW9A 4BI2A 2AYPA 5L2IA 5L2WA 4ZSEA 3BGPA 4JR3A 2YDIA 1W0XC 3HUFA 3ZDUA 2IZRA 4XBUA 4C2WA 3R73A 2JKDA 3BIZA 1U5QA 3DK3A 3R6XA 2QURA 3FI2A 3KXGA 4PDOA 5JFWA 3OD6X 4EKKA 3UQCA 2I2DA 4OBPA 5HCYA 3SC1A 4WG5A 5KHXA 2HK5A 4YJTA 3QFVA 5DR6A 4RVKA 1TQPA 4ZSLA 2YCFA 5IQIA 5KMJA 2FO0A 4JBOA 1LUFA 3JY0A 3M42A 5IQFA 4A7CA 3MY1A 4LL0A 3P08A 4CGAA 2OWBA 3TDVA 5CTPA 3C5IA 2FSOX 5BMMA 4I5PA 3OWPA 3DBEA 4A4OA 2QOIA 3NAYA 3HYHA 3VUTA 5KMMA 4F6WA 2UZLA 5AM7A 3SXSA 1G6GA 5HCXA 3HMNA 4G31A 1YOLA 3WARA 3F5GA 4D4VA 4FKIA 3WZJA 4AT5A 4PTGA 3GCVA 3ORLA 4USEA 5HIDA 4H87A 1OKYA 3QF9A 4X2NA 3MH0A 5IISA 3MJ1A 1DEVA 4FKLA 2HWOA 3HNGA 4IH8A 4RJ6A 3FL5A 4EL9A 1PXPA 3DTCA 3C0HA 4FTMA 5AP4A 5EYKA 2WB8A 2Y9QA 4IAYA 4D9UA 1U7VA 1UV5A 3QC4A 4FOCA 3VW6A 5K4JA 2O3PA 4Y85A 2CKQA 3PA4A 5JGBA 4O91A 1XBAA 3ZC5A 4O96A 5HBHA 3W0NA 4BWPA 2WTJA 3QCSA 4XRLA 2BZHB 3E8EA 3GC0A 3HDNA 3CE3A 3ELVA 1SVEA 4DH8A 3VHEA 3ZLXA 4BGQA 3BV3A 3RK7A 5E8WA 2I2AA 5HLPA 3RINA 3AC1A 3LZBA 4IMYA 4NJ3A 4I21A 5AMNA 4NKAA 3GQLA 1Z0SA 4ASZA 3A7IA 3DCVA 1K3JA 4FRFA 3HV6A 3QRUA 1QWTA 5JFXA 5J87A 4DHJA 4YZNA 5CF6A 3DZQA 4S34A 4DITA 2VZ6A 2GS7A 1H8FA 1UNGA 4JXFA 2F49A 4N70A 4RJ3A 2YIQA 4GU9A 4A9RA 1YJMA 4F78A 3QYWA 3CPCA 2P55A 3L9NA 4JQ7A 4IWQA 4NW5A 1SNUA 4WOVA 4A4LA 4EOJA 3IOKA 3DDPA 5C26A 4I6LA 2ITTA 2WU7A 2WD1A 3NNUA 3DNEA 1UKIA 3GGFA 5KUPA 3HEGA 3ULIA 3MTFA 1JSVA 3EQPA 2X2LA 2XVDA 3C4XA 3FHRA 2VUWA 3KMWA 3A8XA 4GH2A 2BIYA 2WAJA 4MEDA 4WBBB 1Q8YA 3THBA 3V51A 4BBFA 5LXMA 4QYHA 4P5ZA 4S32A 5L2QA 3NDMA 4BI0A 3SRVB 2GDOA 3QYZA 1GXCA 2OO8X 4M7IA 3R9HA 4GEOA 4AXAA 4FTLA 4USFA 2VRXA 5HVJA 5L2SA 4L9IA 3V8WA 3ORTA 2VTHA 3W0OA 4NWMA 4TT7A 5HO6A 1KHXA 5CEIA 3RTPA 2XBJA 3CY3A 4H3BA 1G8AA 3OMVA 4K1BA 4IB1A 1PXIA 4WRGA 4A9SA 3P9JA 2W1DA 2IJMA 4YLKA 5ANGA 5HG9A 4BTJA 1OKZA 2YDKA 3LCOA 4NK9A 3RALA 2VTSA 5EJHA 4EGXA 4LOOA 2YWPA 5IDNA 5DHUA 3LMGA 2YM6A 3P0MA 2XIKA 4KRDA 3IW6A 1WVXA 5FTQA 1DD1A 1LGPA 3UMZA 4YJQA 3NYXA 5T3QA 3D0EA 3DSHA 2UW9A 3R8UA 3QUDA 4AA0A 4IW0A 3L8VA 4IANA 3CQWA 2O63A 4GL9A 4M84A 4YSJA 4MXAA 2CCIA 2RFDA 4CMTA 4BCIA 4RZWA 1YGSA 3KB7A 4LUDA 3ZONA 5H3QA 4IADA 4FYOA 5FXQA 4EBVA 4M67A 2PVNA 3GENA 2J51A 3BU3A 1LPUA 5EJIA 4FV0A 1XBBA 2OF2A 3B8QA 3VQHA 3W2QA 4D1XA 4HVDA 5E50A 3WYYA 1M14A 4EWQA 2XIXA 5IZFA 3QZFA 3NSZA 3PE1A 4B0GA 5HG8A 4EZ7A 2BRFA 4DDIA 3PPKA 3W33A 4BICA 1H4LA 3OWKA 4ZOGA 3BYVA 5HNGA 3RPRA 3NYVA 4OT6A 3UNZA 2R3IA 2BAQA 3RPYA 1U5RA 4D55A 2HXQA 4UWCA 5F9EA 3T3UA 4ZTSA 1FMOE 5L2TA 4ZZNA 3SAYA 4IWDA 4KABA 3CJFA 2VWIA 4PWNA 4I20A 4L68A 3VS0A 4BCGA 4EC9A 4FV2A 5KMLA 1WV3A 2I2FA 3PO8A 3QWKA 4EK4A 2C5YA 4JBVA 2X4FA 2BROA 4W8EA 1PY5A 3R9DA 2JDSA 2ZM1A 5CLPA 2RFEA 4AW2A 4O7YA 4FG8A 4F9AA 3UVQA 4ZY4A 1OIYA 2B52A 4JQ8A 4UMTA 3E3PA 2CN5A 2CMWA 2CLXA 4JIKA 2X4ZA 2ZMDA 2BALA 4PP9A 3KXHA 3I7CA 3GBZA 1M2RA 2YN8A 4AOIA 2EUFB 2GNLA 4U6RA 4L42A 4WO5A 5BNJA 5IA3A 4O0VA 5EI8A 4EBWA 3A62A 2R3PA 2OKRA 3DBDA 3SX9A 3HV3A 2Y7JA 3RBWA 4JLCA 3AKJA 5H9BA 2AFFA 2R0UA 4UXQA 3F6XA 1CM8A 3Q96A 4DFUA 2ITYA 2VTNA 3DLZA 4BN1A 3O2MA 3VUHA 3KEXA 1PXNA 3MJ2A 4IAIA 4RWJA 3LFDA 4XH6A 4B6LA 4BDEA 5HE3A 4BCKA 2QOBA 1ZOQA 4RBLA 3QTQA 1H24A 1MRUA 5I9VA 1BKXA 4DHZA 3BU6A 1YKRA 3S3IA 4D4RA 4EH6A 5I9ZA 4X7QA 1OKWA 3N4TA 4D4YA 4HPUE 4E73A 4FK6A 4KB8A 4NIFA 1Q99A 2IPXA 2BPMA 5JEBA 3A77A 3VO3A 5CEOA 4DT8A 1VR2A 4DH1A 5H8GA 1XH8A 4FV9A 1YXSA 2WFYA 4QYEA 2J0MB 4AZSA 4ZZOA 4O4BB 4JX3A 3BZ3A 4QTCA 3LJ2A 2RIOA 4TWCA 4FT3A 2GNJA 4LMNA 2YM3A 1OIUA 2OK1A 3R7EA 2PUNA 5JFSA 1OPKA 4QNYA 4YTHA 3RPOA 4I3ZA 4TY1A 4AQCA 4AW0A 4F70A 3DXQA 4QMXA 4RQKA 3UP2A 3RM7A 2JQJA 4XV3A 4QMYA 2VNYA 2Q0NA 1LP4A 4ZTRA 5I5ZA 5HTIA 4BJJB 4LFIA 5M06A 5KE0A 2WNTA 1VLRA 3W2PA 2Z02A 3GU8A 2XK6A 4EQCA 4I6HA 3AT2A 5HO8A 3CCNA 3I5ZA 3VN9A 4AFEA 1T46A 1QPCA 2HY81 1R3CA 2VO3A 4RIYB 4Y46A 2NNWB 3VUKA 5IUIA 4TNBA 5FDPA 1W98A 3DKFA 1PMEA 3VAPA 2KB3A 2W1ZA 4G6LA 2A27A 1ND4A 3LLAA 1DS5A 3UC3A 1ZOHA 3FLNC 3WF9A 5IH6A 5AUYA 2WTCA 1SM2A 5CALA 3RCJA 1R21A 3NW6A 4M3QA 3KXNA 5CAPA 1FVVA 3DK6A 4CZUA 4ZTLA 3RM6A 5E8SA 3FPQA 4KD1A 3FZ1A 5CYIA 3R8ZA 3BLRA 4NFNA 4RX9A 4XG4A 4AG8A 2XT9B 5BYYA 5HU3A 4RFYA 3HRFA 4UB7A 1G3GA 5LJJA 1U4DA 3L9PA 3SW7A 3KT9A 5E9EA 4LRJA 3KXMA 3GEQA 5LCKA 2W06A 4ACGA 4MBIA 3FEGA 4JIVD 3QZIA 4EOQA 5IQCA 3B2WA 3OOGA 2XNOA 4FKOA 2ITPA 4QOXA 4RX8A 5EHLA 4JR7A 4X2JA 2J7TA 4YZDA 2PE1A 2DYLA 3G0EA 2OXDA 4QPSA 4J98A 3GQIA 3R2YA 4DFBA 2VGOA 5HKMA 4KIKA 5BVFA 1H1QA 2PVLA 3S95A 5CAVA 4RWLA 3VJNA 2YERA 1GIJA 5BVIA 4I94A 2XRUA 1OGUA 2BDJA 3TNPC 1ZLTA 3ORPA 3T9TA 3MH3A 2ETKA 3RAKA 3U9CA 4BCHA 4D2VA 3FZTA 2ZVAA 3Q52A 4QD6A 4RWIA 3RZBA 4C3RA 5M53A 4FKSA 3E93A 3EWHA 4CG9A 3UC4A 1OIRA 4O1OA 3ANRA 2OIQA 3NEWA 4O7ZA 4AXCA 5JKGA 5KZIA 4QTEA 4IX5A 2HCKA 4NUSA 2W17A 4N0SA 3KN6A 1ZYDA 3QU0A 3H3CA 2RG6A 4HCTA 4LRMA 4O6EA 4R1YA 4RIWB 5A3XA 4IE9A 5D11A 3GNIB 3OFMA 2FA2A 5A4LA 4Y73A 1M2PA 1J7LA 4OTWA 3PP0A 2OH0E 2R3HA 3R8PA 1J7UA 4AX8A 3ATSA 4EK6A 2ZJWA 4FL3A 3WF6A 2JFLA 3DBCA 1ZMWA 3FI4A 4NEUA 2ZYBA 3R1QA 5CEKA 3AKLA 5CEQA 3CTHA 5CSPA 2JQIA 1L8TA 3ZDIA 2XJ2A 1UWJA 2GNIA 4FSUA 4FTCA 3OW4A 3FY0A 4QPAA 5CAUA 5DFPA 2WELA 1MRVA 4HJOA 4XMOA 3VS3A 4EHGA 3COMA 3HUEA 1M7QA 2BRNA 4QP7A 3OZ6A 3F88A 3T8OA 3UMXA 3F7WA 3ZO2A 4A9TA 3TJCA 1Y8GA 4BWXA 3PUFC 2OG8A 3HA8A 2R0IA 3KULA 2B54A 4EYMA 4M68A 2RKUA 2VTIA 2C0OA 3RAIA 4OLIA 4IACA 1VEBA 3Q9XA 4FV1A 4PMMA 3FY2A 4ZS4A 1JKTA 4P2KA 1ZMVA 1UU3A 3H9RA 3KK9A 1Q3DA 3Q4TA 2B53A