3I6WA

Structure and activation mechanism of the chk2 dna-damage checkpoint kinase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
410
structure length
369
Chain Sequence
PWARLWALQDGFANLECVNDNYWFGRDKSCEYCFDEPLLKRTDKYRTYSKKHFRIFREVGPKNSYIAYIEDHSGNGTFVNTELVGKGKRRPLNNNSEIALSLSRNKVFVFFDLTVDDQSVYPKALRDEYIMSKTLGEVKLAFERKTCKKVAIRIISKLNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFPTYLAPEVLVAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and activation mechanism of the CHK2 DNA damage checkpoint kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase Chk2
total genus 103
structure length 369
sequence length 410
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00498 FHA FHA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3i6wA03
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 3i6wA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3i6wA02
3R8PA 4FZFB 1FPUA 4D28A 3QX4A 4IDVA 2VWBA 1GXCA 1PXJA 2OIDA 2R3OA 4PPBA 4XH6A 3RPSA 1M14A 4IHPA 4DE4A 3R7GA 2GMXA 3DB8A 3A8XA 5BVNA 1S9IA 4GV1A 4TRLA 5HNGA 3RK9A 3LXPA 4QO9A 1NVSA 2B9JA 2YITA 3FY0A 3IGOA 4L3PA 1W83A 3ITZA 2VTAA 4RFYA 1REKA 4YC6A 5F4NA 2C6DA 5JK3A 5E8ZA 1UNHA 3ULIA 4G9CA 4E20A 3DKOA 4FIIA 4W9WA 3S1HA 4GK2A 4JBPA 1J4QA 5CXHA 4QRCA 3COMA 4O6LA 4DH7A 4YHTA 4C57A 4DEIA 4ACMA 4EZ3A 4BDEA 2C5OA 2ETMA 4FKQA 1B6CB 5ANGA 4CV9A 3R9OA 4DLJA 4USFA 5C4KA 4O2PA 3QQHA 3V6SA 2RGPA 1J4PA 3VUDA 4KINA 5KCVA 1O9UA 1REJA 3A61A 3RNYA 2W5HA 5BUJA 1OI9A 5AR4A 1KE8A 2P3GX 3THBA 5CSPA 3EL8A 4RMZA 5C26A 3I7BA 3W55A 1JNKA 4F9BA 4FKJA 4D9TA 1YI6A 2W1ZA 4PMMA 5AAGA 4BCGA 2XCHA 2KB4A 1CKPA 2R64A 4EYMA 4ZTLA 1YHVA 4YO6A 3TNQB 4IANA 3WI6A 4OTWA 2O8YA 3MFSA 4G3CA 2QO9A 4ITJA 3DGKA 3QZHA 4PL5A 3MFRA 1OBDA 4DFUA 3GCQA 1J3HA 2VO7A 2X9EA 3R6XA 3KULA 3F9NA 3CGOA 3LXNA 3AC2A 3VHKA 2XZSA 2ZOQA 3C50A 4FUXA 3RZBA 2IZRA 4CV8A 3IONA 3DB6A 2WAJA 1ZY5A 2CGWA 2ETKA 5CAPA 2C6EA 2C3IB 2JBPA 4U44A 4XCUA 5DRBA 5HIDA 2JDRA 4K77A 4ZSAA 3R7UA 4LGHA 1YXVA 3QWJA 5F9EA 2F7EE 3FMJA 4I5MA 2JDTA 5IF1A 3VRZA 5K5NA 4UY9A 2ITYA 5EW8A 2DYLA 3DK6A 3KC3A 4O83A 4R3CA 1XH7A 5IQFA 3I79A 4QQ5A 3TACA 3VS5A 3VUHA 3JYAA 3FXZA 4BFMA 4BCMA 1TQPA 2CCIA 1KUTA 2B0QA 4L46A 2X8EA 2PZ5A 3QUPA 3UJGA 1VEBA 2J0KA 4EUUA 3MDYA 4F6UA 2FUMA 5TO8A 3Q4CA 4W4VA 5IZFA 5HTIA 2JIUA 2W06A 3CY3A 5DEYA 4D0WA 5HGIA 3PE2A 4FNZA 4YTHA 1PMVA 5CQUA 4RWIA 4Y85A 3QGYA 2PE1A 1B38A 3QD3A 2IVSA 4AT3A 1DI9A 2OFUA 4G17A 3KF7A 4RZWA 4DAWA 3FMEA 5IUIA 4NM0A 5HTCA 4FEWA 1U54B 3MSSA 2PVHA 4YZCA 4DFNA 2XEZA 4O38A 3SOAA 4MD8E 2IVUA 4I20A 3DZOA 4E6CA 3SRVA 4EJNA 2B54A 5IEVA 4YO4A 1YVJA 4A9UA 1XO2B 4IX5A 4MVFA 4YLKA 1V1KA 2V55A 2XM8A 4CTCA 3OW3A 4NZWB 5GIOE 4LUEA 1OIRA 3F61A 4QPAA 3LM0A 3SQQA 2QOHA 3TN8A 3COHA 3MH1A 4AP7A 4JONA 2QOLA 1WBSA 2PZYA 2QODA 3IKAA 3O71A 3OP5A 1YRPA 4ZLZA 4IWQA 3SW4A 5AV1A 3MB6A 4C2VA 3OHTA 4TYEA 2FO0A 4G1WA 4DEEA 2BTRA 2IW6A 2WD1A 5I5ZA 4BCHA 1MZKA 3QZGA 5AUTA 4HCUA 2HIWA 4PDSA 3NW5A 4FBXA 2ZB1A 2QVSE 3BEAA 3OCSA 4FG8A 5H8EA 3RWQA 4YU2A 2QLQA 4HPTE 1VYZA 2XK7A 5K5XA 4HCTA 5CX9A 2WOTA 3ZUTA 2YACA 5AADA 2WQMA 3KRJA 4IQ6A 4XP0A 4QMNA 4Q9ZA 3U6IA 4KBCA 5AM6A 4PTGA 2O2UA 5EOLA 5DR6A 4AZFA 3W2OA 2BRGA 4QMYA 1V0BA 4I0TA 3GENA 4FZDB 5HO6A 1PXLA 5HCYA 4I94A 4BCPA 4I22A 1URCA 2XIXA 4FSRA 4F7NA 4BIDA 5GHVA 4NIFB 5HD4A 4RRVA 4ZTNA 5I0BA 1GJOA 3ELVA 1O6LA 3KN6A 5ITAA 3PA5A 4HVHA 3Q04A 1XKKA 4RJ7A 4RLLA 3VC4A 3FPMA 2UVYA 1ZMUA 3D5UA 1XQZA 5FBOA 4EWQA 4QMZA 1PYEA 3TZMA 4FSYA 1YXSA 4ID7A 3TJCA 5KMMA 1SYKA 5IA4A 4RIWB 3ELJA 5JGAA 3LVPA 4K33A 4TWPA 2HWOA 3WZJA 2B9IA 3O8UA 2C47A 2XRUA 4BTKA 4L6QA 3PVUA 3K2LA 2C6IA 2EXMA 4IAAA 4TYIA 5CF5A 3QD0A 4KAOA 5J79A 2XP2A 2EXCX 3QKMA 1Q5KA 4Y83A 3K54A 4EOOA 1NVQA 3FI3A 1IA8A 4BYJA 5KX8A 3OMVA 1OB3A 3QCXA 5EDRA 2JQIA 3CBLA 5DMZA 5JZJA 3D15A 4CG8A 3RCJA 4R3RA 3ZFXA 4HZSA 1P5EA 1OKWA 2UW0A 4RZVA 5LCJA 3HX1A 1TKIA 3R7OA 3VVHA 3HAVA 5CT7A 3QQKA 1H27A 2C6KA 3ZFMA 3LFBA 3UNNA 3ZSGA 3UOLA 4J71A 3E93A 3IECA 3EZVA 4Y46A 5CSXA 3HYHA 3ZEWA 4LRKA 3HRFA 3LFDA 4S2ZA 1UWJA 3KCKA 5CAQA 3UG1A 2VO0A 4HGTA 4KABA 4RJ6A 5CVFA 1YWNA 2GNFA 4GK3A 4BZDA 2GU8A 3F3UA 2GFSA 1KV1A 3DBEA 5F1ZA 5DR9A 5D41A 3D94A 3Q6WA 4PTCA 3M11A 2YAKA 4LG4A 5EHOA 1QMZA 2RFNA 2XNOA 1JOWB 3JS2A 4OBPA 5AV2A 3PVGA 4EJ7A 4XP2A 3G6HA 5CASA 1ZMWA 5BVEA 3WF7A 3HUBA 3LE6A 3WIKA 4FEQA 2ZMCA 3MIYA 4FTTA 3E88A 1UKHA 3PFQA 4YUQA 3OTVA 2OICA 2XIYA 3ORIA 4MHAA 3VA4A 5LMKA 5A4TA 4TYHB 2OH4A 5E8UA 5A4CA 4QP1A 4QP6A 4WRGA 3BQRA 3R1NA 2GSFA 5HG5A 4ANNA 3HVCA 5IEYA 3NNUA 3QTWA 4KSPA 2CLXA 4L7SA 3EOCA 4H1JA 5FLFA 4EUTA 5KKRC 5J1WA 3PIZA 2QG7A 5AUYA 5E9EA 1SZMA 5DEWA 4AZVA 3FYJX 5IA0A 4PDPA 2EH0A 1WBPA 2ZV8A 2QOOA 3N4VA 3SGCA 2R3MA 2YCFA 3KY2A 3KMWA 3ALNA 3NUXA 3OWPA 4N6ZA 4TTHB 4XG6A 4NCTA 3ULZA 3KK9A 5IA2A 1Q4LA 3LKMA 3P9JA 3NNWA 4HZRA 2OJ9A 3VJOA 2XNPA 3ACJA 4DITA 2PVNA 4UMPA 3QTQA 3HRBA 5DA3A 4BTMA 5FDPA 3S2PA 3TNHA 4QOXA 4GUBA 3FL4A 2CLQA 4MX9A 3ZEPA 1IEPA 4CKIA 2CKEA 2ITZA 3ZRMA 3NIZA 3PXQA 4B8MA 4X3FB 2QNJA 4R5SA 4DTKA 4F99A 1ZZ2A 3PLAE 1PMEA 3WIGA 4ANMA 4EC9A 2IJMA 3G90X 2OJJA 4DFYA 2UZNA 4EQCA 4QP8A 5JT2A 5DBXA 3EQDA 3BHUA 3LFQA 4RIXA 3R63A 3NLBA 3KMMA 2QOBA 3RHKA 4EC8A 2FVDA 3HV4A 4GK4A 3RNIA 4BN1A 3W2RA 4TYJA 3QRUA 4UN0C 3PWDA 4V05A 4IZ7A 4ANOA 2Z02A 5HO7A 3L8PA 3D2IA 2C68A 3KVXA 4CGAA 2A0TA 1RJBA 4WD5A 5AP5A 3PUPA 3H4JA 3Q3BA 4D1SA 4A9SA 2NRYA 2FEZA 4IX4A 2PVJA 3CKXA 1Q8UA 4GJ2A 2GFCA 3UIBA 5AA8A 4L42A 4IEBA 4BCFA 2VWZA 1YQJA 3DLSA 3O7LB 4MWIA 3FI4A 4WNOA 2IZTA 4IVDA 4YJRA 3DJ6A 3V5WA 4BICA 3NR9A 4JT3A 4ZP5A 3C5UA 4XLVA 5AV4A 1ZYLA 5EDPA 4FSMA 5ANJA 4JI9A 4RWJA 5DPVA 3BWFA 5BVWA 4GKIA 3A7IA 3UVRA 4FV1A 4KBAA 3RKBA 3ZH8A 4PX6A 5BUEA 2Y6MA 4GT4A 4RGJA 4IZAA 4UEUA 5G1XA 2WU7A 4IAYA 4TPTA 4A07A 1FBNA 4BDJA 3RHXA 2J51A 3QBNA 4O7LA 3DQXA 3ZCLA 1J7IA 1JKTA 4MXAA 4G34A 3VBYA 3WZEA 5IH6A 4O6EA 3OS3A 1YOMA 3UE4A 3SVVA 3OUKA 3VUKA 1PXIA 4FKLA 4ITHA 3IS5A 2VRXA 4R77A 3LXKA 4ITIA 5TR6A 4DG3E 1YI4A 4CFWA 4EK4A 3MPMA 4MF1A 3PXKA 3WF5A 3UOKA 5AP6A 1K3AA 4RWKA 3VBTA 5DHJA 2YIRA 4E73A 1LR4A 4G3FA 1GZKA 3A8WA 3PO8A 1ZWSA 1GZOA 2R3NA 4ZZNA 1V0PA 4AU8A 3D9VA 4X2KA 3FMMA 5CNOA 3RJCA 1ZOEA 1GNGA 3PE1A 3U9NA 4LI5A 1OPJA 4ANSA 2ZM3A 1H07A 4UWYA 3BELA 5H9BA 2YHVA 3NPCA 1Q3WA 2NO3A 4OTQA 1U46A 3ZUVA 4O7YA 3VBXA 1TQMA 2FH9A 3QQUA 4V0GA 5CALA 3T9IA 4F1TA 2ERKA 2R7BA 2HWPA 4LFIA 4TYHA 1WMKA 4YZBA 5GJGA 1FGKA 3DS6A 2BAKA 2UW6A 4M13A 4C3PA 4FIHA 4IW0A 4M0YA 4PF4A 4DYMA 2VD5A 4NWMA 5HCXA 2P0CA 4BDHA 5ETFA 2YABA 5GZ9A 5E8VA 1LP4A 2WMRA 4QTDA 4B99A 3HGKA 2BHEA 2WMBA 3C4WA 5ETAA 3UO6A 4AGDA 2XNBA 4YMJA 4X3FC 4O86A 2BIYA 3O50A 3E8NA 3PTGA 5FTOA 5ACKA 2DWBA 3RM7A 3MFUA 5KMKA 3MVHA 3PJ3A 2XKFA 3NWWA 4U6RA 5J7HA 2J7TA 4O7VA 3RPVA 3R00A 4EWHA 5AP2A 3NYOA 4IH8A 4PY1A 4CQGA 4YP8A 2PULA 4ARKA 1FVTA 2BROA 3E62A 4CRLA 1WV3A 1PXMA 2BVAA 4UZDA 4GFGA 3MV5A 1BL7A 2UW9A 3RAWA 2B7AA 1JKLA 3CTJA 3TXOA 2CNQA 2YJSA 3VPYA 1M7QA 5DR2A 1YJMA 1J4OA 1WAKA 2C1BA 2J5FA 2RFDA 4U5JA 4Y5HA 3GQIA 3IPHA 3R7VA 2XS0A 3ZTXA 2WMTA 2KKLA 4YHJA 1BX6A 2W9FB 4U42A 4YJOA 4DN5A 2XNEA 4QQCA 2C5XA 1CM8A 1OKVA 5ICPA 4BR3A 3FUPA 4GUEA 5HCZA 5FXRA 3EJ1A 5CYIA 4HGLA 2YDKA 1CDKA 4ZSEA 5TF9A 4XLIA 5I3RA 3R1SA 4N57A 5CEMA 4MNFA 4EHGA 3KRLA 3CS9A 3FZPA 5T6KA 2O0UA 1A48A 5AX9A 4U97A 5JSMA 4GRBA 3BZ3A 3UTOA 4R1VA 1QPEA 5E8WA 1R78A 4M69A 5AP1A 5F94A 2BRFA 2BALA 4G3GA 1T46A 5IUHA 4I6FA 4LRJA 3RCDA 3DQWA 5CU6A 4AW0A 3T3UA 4AWIA 3F3VA 3ORTA 5EM6A 4O81A 5IEXA 3NUUA 5EK7A 2XA4A 4Q5EA 3QA8A 2HAKA 2HCKA 1PF8A 2XBJA 4LGGA 5KMOA 4GT3A 5CI7A 3I6UA 4U40A 2RFEA 1Q8ZA 2FGIA 3B2TA 3B2WA 1UU7A 2OXYA 3RI1A 4AOJA 4EH6A 4EL9A 4ZOGA 3AOXA 4ASXA 4EBVA 4LOPA 1G6GA 5HVKA 3ORKA 4HNFA 3CPBA 4RIYA 3ZBFA 5AUWA 4PDYA 1AD5A 4K1BA 4A9YA 5HLWA 3C0HA 4ZMFA 2WOUA 2XYUA 3BE9A 4KKGA 3NUPA 4EQMA 3QX2A 3QC4A 2X2LA 4IB1A 4R3PA 2ITWA 4F9YA 4CCUA 4AT5A 3I4BA 5EQPA 2KTYA 4O91A 1AGWA 3OZ6A 2EUFB 2WEVA 4JX3A 5AP4A 2ACXA 2PZPA 2WPAA 3I1AA 4HYUA 5JFXA 4J1RA 3TNWA 4CD0A 4YBJA 5FEDA 4EQUA 1QU5A 2W96B 4F1MA 5GJDA 5T68A 3PZHA 5AIRA 3WE4A 5LQFA 5BMSA 3FWQA 3LLAA 3VUGA 5AUUA 2PVFA 2XK6A 3UVPA 3VUTA 2J90A 4IM0A 4I21A 3VS1A 5CEQA 4L67A 3F5UA 3KULB 4L8MA 3GGFA 4WBBB 3FPQA 4ZZOA 1BYGA 3QCSA 5CVHA 3EKKA 3HV5A 2C4GA 3DT1A 1YDSE 3VUMA 3AXWA 5IPJA 1ZRZA 1JKSA 3BLQA 4EH5A 3W2CA 4O0VA 2BR1A 3DBFA 2YAAA 5CQWA 5HTBA 3MA3A 3TG1A 2UZUE 3GUBA 4FSNA 4G3DA 2OGVA 4IC8A 5B0XA 2Z60A 4NJ3A 3C4ZA 3ZS5A 4CT2A 3VBVA 2ZDTA 1HOWA 3ETAA 4H3PA 5L6WL 4CMTA 1H01A 2ZV9A 3VN9A 4CEGA 5BUIA 3TZ7A 3VF9A 1YHSA 2J9MA 4ANQA 4C2WA 4O1OA 2BUJA 1TQIA 5EG3A 2W1EA 4P7EA 4UWBA 3LOKA 2EB3A 4ZXTA 4EK6A 3Q60A 2QHNA 1ZY4A 3I60A 4ACCA 4CNHA 2PUPA 4MXXA 5FD2A 3ZXZA 4YC8A 5BYYA 5A9UA 2IZSA 2JKKA 2XKCA 2G1TA 3G0FA 3HMOA 4MH7A 4MYGA 5FM3A 5CEIA 4M69B 3Q9WA 5C01A 5DI1A 4AE9A 4BCNA 3NRMA 5FEQA 5FTQA 4NIFA 3UIXA 2AC5A 4IWDA 2HZIA 3S4QA 3UYSA 4DG0E 3OXIA 3PXRA 4DFLA 5CF4A 2B9FA 2PVMA 1NT2A 1Q8TA 3MWUA 4JIAA 3VS0A 3UMZA 5J87A 3TNIA 4GU6A 1H25A 3QYZA 3C0IA 1OKZA 2C30A 4FR4A 3IW7A 4IJ9A 4RSSA 4P2KA 1YWVA 4M8TA 3MVLA 4AFJA 4IIRA 4D9UA 4AN2A 3UQCA 3MYGA 3ZDUA 3R22A 1YI3A 4LL0A 3Q52A 4CZYB 1A9UA 1SVEA 5E8XA 5LWNA 2PYWA 4U0IA 1Q62A 3ROCA 3BYSA 2VN9A 2PWLA 3JVSA 1SVGA 2W1FA 3QQJA 4AW1A 4IACA 4FIFA 4JAJA 2IPXA 2YERA 2F4JA 2J0IA 3AMAA 5M4UA 3P5KA 3ZU7A 1Z57A 4DGGA 3UV0A 2J2IB 1BLXA 3FLWA 1W7HA 2Z7QA 3T8OA 3V04A 1JWHA 1WBTA 1IRKA 4L01A 3RP9A 1XH9A 1XR1A 3BV3A 4UYAA 2BZJA 4R7HA 3U8WA 5L8JA 1OBGA 3VS6A 4C33A 5I9WA 2UZWE 3ZHPC 5LVPA 4BWXA 3HV3A 4S32A 1TVOA 4DGLC 5IMEA 4FEXA 1H1PA 5ANKA 3UOTA 2XCKA 2BRHA 1W82A 3D7ZA 4M66A 2RKUA 3A60A 4PTEA 5FWKK 4EH2A 4IAZA 2GNGA 3LXLA 4FTQA 2XMYA 4KNBA 5KHXA 3KFAA 2QCSA 3NZ0A 3PVBA 4Z3VA 1U54A 2BFXA 5FDXA 4G2SA 1PKDA 3O0GA 4BYIA 2I0YA 5FM2A 3RAKA 3PWYA 2OZOA 3JPVA 1OMWA 5KNJA 3OF0A 3ZLWA 4KA3A 4O0SA 4F6SA 5JH6A 5HE1A 3ORXA 2WHBA 4V0GB 3DFCB 4C4JA 3KN5A 2PVRA 3HP5A 4HGSA 3W33A 5I9UA 4ZTSA 3E3BX 4EZ7A 3UZRA 4GG7A 1PXPA 1WVYA 3RPRA 3C7QA 3MPAA 4FI1A 3FAAA 4U79A 3CKWA 2C0TA 4FTLA 4FZ7A 3RK5A 1PY5A 4F9AA 1CSNA 3I5ZA 4H87A 4R7BA 1JSUA 2YLEA 5J9LA 5BX0A 3L8VA 3WBLA 4NFMA 5DIAA 3OOGA 5AWMA 4J96A 1W84A 1ZYDA 3OVVA 4O27B 3FMLA 3GU8A 5HE3A 4BCIA 3SG9A 2J5EA 2O64A 5B2MA 4QMOA 4CZUA 4W8DA 2YWVA 3W2PA 3R9HA 4NYEA 2X9FA 3EQFA 5DOSA 2OI4X 3HUEA 2RG5A 4KIPA 4M14A 1GOLA 5H8BA 5CI6A 4I4EA 3BGZA 3ENHA 1Q97A 3GU5A 5AR8A 3UODA 4AX8A 5JKGA 5LVLA 2KULA 3BLRA 3OD6X 3PJ2A 4E1ZA 1GIHA 1UA2A 4CT1A 3MPTA 2O5KA 3GQLA 3HEGA 1G8SA 2LAVA 3UC3A 4UX9A 1JSVA 3LPBA 2FSTX 5C27A 4FV2A 3QD2B 3PJCA 3GC0A 4F7JA 3UN0A 3LMIA 2PZIA 2WMQA 2BZIB 3QRJA 3WYYA 1IAJA 2BPMA 5FUTA 1U4DA 1PXNA 3VA1A 1RE8A 2YM5A 3DXNA 1KOAA 4OUCA 5EI8A 3DK7A 4Y73A 3ZSIA 4C4IA 4C34A 5L8KA 4K9YA 4FOCA 4YGAA 4D1XA 2IWIA 2YCRA 4HVIA 1H28A 3TTJA 3MVMA 4ONAA 3MH0A 2C0OA 2H8HA 3E8CA 3RPYA 1OL6A 4JDIA 3BIZA 1M2RA 3V5JA 4OR5A 4WNKA 4DH8A 5GIPE 4CMUA 3QZFA 1E1VA 2VTLA 4WO5A 5TOZA 1J7LA 3PP1A 1PMUA 4AS0A 4D58A 1E1XA 4JX7A 3QWKA 3ZDIA 1BL6A 2WELA 2WTVA 3KKVA 3AGMA 1SNXA 3N4UA 3WZUA 4XG7A 2NPQA 2JITA 3GEQA 2VAGA 4KRCA 4TXCA 1G8AA 2XIRA 4FV5A 2PPQA 4CSVA 2UVXA 3VWAA 3ORMA 4NH1A 2QC6A 2LGCA 4C4EA 4U3YA 4DG2E 5BYLA 1KSWA 3H3CA 4ASZA 3QC9A 3QTUA 2A4LA 4FV7A 2QU6A 3Q9XA 5CF6A 4QTAA 4DT8A 4MAOA 4TT7A 2E9OA 3TEIA 5A14A 4M12A 1RQQA 3ANQA 3L9NA 4OTDA 2CKPA 3G5DA 4Z55A 4DGNA 2I0VA 3DDPA 4CLIA 1R21A 4W9XA 3FZRA 4XMOA 3FZ1A 4PMSA 3PY3A 2F9GA 2ITNA 2H6DA 3R2BA 2P55A 3DBCA 3ANRA 3OWJA 4EOJA 3B8QA 3UQGA 5CNNA 3F69A 3ZRLA 4FK3A 2JKQA 3R8LA 2BDWA 2UZOA 3R1QA 2V7AA 5TE0A 2PTKA 4XNEA 4BWKA 4QP9A 4IAKA 4BC6A 3AT2A 3E64A 3H30A 4FV6A 5CU4A 3KL8A 3FE3A 3MY5A 1W8CA 5DFPA 3T9TA 5AMNA 3GXLA 3UZPA 3BU5A 4ZEGA 1G3GA 3R1YA 4ACHA 2ITTA 1SVHA 3GC9A 3PIYA 1OECA 4HYSA 4JLCA 4DEGA 4ZS0A 4KRDA 4QYEA 4O96A 3K3IA 4WA9A 2YJRA 3TKHA 4AW2A 3U54A 3IK3A 1CMKE 4F64A 4IZ5A 3Q53A 5ANIA 4NEUA 2WQBA 3Q9ZA 3NX8A 4OAUC 4BGHA 3EWHA 3L8XA 4EK5A 4YJQA 2Q83A 3S3IA 2XM9A 2QKWB 4GT5A 4RJ3A 2B1PA 2VTJA 1MRYA 5J5TA 1KE9A 4TKSA 3NNVA 1T45A 2ZV2A 1GY3A 3Q5IA 4MKCA 1YJ5C 2XNGA 2E9PA 3FC2A 2R2PA 3MA6A 4OT5A 1KWPA 4O7NA 3ZZWA 1M52A 1YWRA 2AYPA 4JJRA 4MBJA 2UVZA 3E3PA 4QPSA 5EQEA 3BHTA 3ZO1A 1JSTA 4E3CA 5AA9A 1YW2A 1KE5A 4FT9A 4FT5A 2VZ6A 4A9RA 5CY3A 4TYGA 4FUYA 3KEXA 3R71A 3GU6A 3G15A 5DYJA 3A7JA 1K9AA 4HVSA 1XH5A 5FG8A 3KVWA 4FT3A 2GHLA 1KE7A 4X6QC 4WT6A 4DBNA 5AR5A 4XEYA 1K2PA 3P7AA 3WZDA 3OWKA 2OF4A 2XYNA 3U51A 4LUDA 3L8SA 2OF2A 3QALE 4C35A 3GQSA 3DKFA 4TNDA 4FNXA 4DTAA 3R83A 4GKHA 4FTOA 4BDBA 1URWA 2XBAA 4QYGA 5D12A 3PXYA 3VQHA 3UO4A 4DH5A 3KRXA 5T3QA 5KMNA 2C69A 3UNKA 3FM8A 1STCE 1Y6AA 1VJYA 3MN3A 3PXZA 2BILB 1ZLTA 2HXLA 3ZXTA 3Q32A 5C03A 4KIOA 5AUZA 2C5VA 5EKNA 4YZMA 3DAJA 2VU3A 3T3VA 2X7OA 4BI2A 3I5NA 5H3QA 2HZNA 4R5YA 4XOZA 3UOJA 5KZ0A 3MTLA 4H3QA 4G31A 3GOPA 3QTXA 5BYZA 4E93A 3ZMMA 3UP7A 3AG9A 4XG9A 4C36A 4QCJA 4HVDA 4JNWA 1QPDA 3QGWA 4XV2A 2XB7A 3CCNA 3FQSA 3LLTA 2YZLA 3UDBA 2XK3A 4DEBA 4ENYA 5M55A 5KMLA 3L9LA 4DCAA 2X7FA 3BYUA 2ONLC 2C3JA 3JY0A 1YKRA 4MNEA 3EYHA 5HE2A 4QQTA 2JQLA 4OLIA 3H0YA 1Y8YA 2DQ7X 5LMBA 2W1HA 5H2UA 3WZKA 3BQCA 3P0MA 3FKLA 5LOHA 4B9DA 3LJ0A 4F0GA 3HMMA 3ZSHA 1WLNA 2Z7SA 1WZYA 5E50A 5A3XA 3LMGA 1SNUA 4M84A 3TI1A 4O0XA 2VNWA 2ONLA 4H39A 2CJMA 2E9VA 3ATSA 3KU2A 3NAYA 5IA5A 3TZ8A 3TKIA 3BEGA 1UJXA 5FP5A 5IQHA 5JFVA 1OITA 1UNLA 4NTSA 4O7TA 4E4XA 1ZYSA 2EWAA 1YXUA 3NYVA 4G6NA 4U41A 3TV7A 4BCKA 4C3FA 4DEAA 2BRBA 2HW7A 4JS8A 4ZSJA 3QCQA 4BDFA 1U5RA 3MB7A 4FIJA 4NKSA 5I3OA 3ELSA 4FV3A 2XT9B 2GPHA 4XG8A 4D4SA 1IAHA 3NCGA 2R3JA 3ORZA 4KKEA 5HG8A 2WNTA 3HMIA 2WXVA 3POAA 2PVKA 3HL7A 1RW8A 4HVGA 4RVKA 3EHAA 2YIWA 2O3PA 2QONA 5L2SA 4UZHA 5JRQA 4ZJJA 1J1BA 5DH3A 4BDCA 2IG7A 2YM6A 3IDPA 1W98A 1H1SA 3QLGA 2XNNA 2PY3A 3FXWA 2OIQA 2HW6A 2JKMA 3POZA 4IZYA 5C8NA 2I1MA 4DTBA 4FF8A 4FNYA 4YNOA 1DI8A 2CSNA 2R7IA 4EHVA 1FMOE 4FSWA 4RA5A 4BKJA 1J4LA 3LMHA 4UALA 4I3ZA 3ID6C 3C4FA 5AIKA 2RIOA 5KBQA 3QKKA 3PPKA 5AP3A 3VAPA 3WARA 3BHYA 3QXOA 4ZSLA 3ZO2A 4YJNA 2QQ7A 4S31A 3C9WA 3EYGA 5E7RA 2CPKE 3LHJA 2FSOX 3QTZA 4JDKA 3U4UA 4AOTA 3EFJA 3A99A 3IGGA 4GVAA 4YZNA 5JGDA 1UHTA 4NT4A 4A4OA 4EOLA 4TWNA 5EQYA 4U7ZA 5JGBA 4FOBA 3U4WA 3BWJA 5M09A 4DGMA 4DH3A 1JQHA 3D4QA 3VW6A 4YLJA 2VX0A 4D4RA 3UYTA 1I44A 3TCPA 4GIHA 3ZM4A 4X3FA 3FYKX 3OUNA 4X6RA 5JMSA 2YLFA 3FZOA 3EQRA 1LEWA 3HECA 3QKLA 3VHEA 2UZLA 3Q4UA 3MY0A 5BMMA 3U9CA 3N9XA 3D14A 1H00A 4FTJA 4XOYA 3ZC6A 4M67A 2ESMA 4XHKB 5A46A 2QO7A 4Y5QA 3TJDA 1X8BA 1Q99A 3BBWA 4NM5A 5HICA 5EYMA 4C4GA 3PY0A 3BYMA 3FQHA 3EFKA 4YNEA 5FP6A 4W4XA 5CANA 3C4XA 3VW8A 4TW9A 5IISA 2PUNA 4BCQA 2P2IA 5AV3A 2UW8A 5AX3A 4FA2A 5KMIA 1J91A 2VO6A 2J6MA 4RC2A 4JBQA 3GCPA 5HQ0A 1FHQA 2J0MB 5M08A 3AC3A 4Q5HA 3RBWA 4RC3A 5DN3A 4EOSA 5J1VA 4JBVA 3E92A 3LFCA 4FL1A 1R3CA 3P86A 3LQ8A 3ET7A 5DG5A 4C61A 5IQDA 2X4FA 2XK4A 3F5GA 3SD0A 2BZHB 4F9WA 4D5KA 5ETCA 3P78A 2BIKB 1Q61A 2QI8A 3IOKA 4FSQA 5BVDA 3V6RA 4YSJA 5CEOA 4J97A 4PPCA 1K2NA 4RA4A 3LM5A 3Q2MA 2P2HA 3GCUA 1PJKA 5K0KA 4HOKA 4X2JA 4KD1A 3UVQA 5I4NA 3OEZA 4YZ9A 2R3IA 1H1QA 4M3QA 4FKVA 1QPJA 1WBNA 4EHEA 3TUDA 2UZVA 1VZOA 4RVTA 2ZMDA 2C6LA 5AEPA 2WTKB 4TNBA 3P79A 4QMSA 3LCTA 5F20A 5LCKA 2X8DA 4WKQA 4F7LA 4TY1A 4YTCA 1OUYA 1VYWA 3BHHA 4F6WA 4J52A 2C3KA 4FKIA 3IW5A 1U59A 4FZAB 4IAFA 5HOAA 1PKGA 5ETIA 4KUJA 2XKEA 2V22A 4F70A 5CAUA 3KK8A 5M44A 4D2TA 4MF0A 2CHLA 3KREA 3O8PA 4QD6A 5F95A 3GFEA 3QLFA 3LJ1A 1W0XC 4USEA 4BCJA 4O0UA 2C6OA 2OKRA 3A7GA 3KB7A 3NNXA 3PG3A 5HHWA 2ZV7A 3UGCA 4AAAA 4CQEA 2VTOA 2B53A 2VV9A 2REIA 5M57A 2RG6A 4KB8A 4WG3A 4ANBA 5D7VA 5IUGA 5B2KA 3W8LA 3EN4A 4FG7A 4UMQA 4DGOA 4OTPA 5GNKA 3CJGA 5EFQA 4ZTHA 4XBRA 2H34A 4H36A 3M1SA 4GVJA 1WVWA 3OT8A 4HYIA 5EM7A 3R8VA 3EZRA 3AD4A 4MEDA 3Q6UA 3KXNA 4A7CA 5TT7A 4I6QA 3OG7A 4IFGA 1BI8A 3CQWA 2W4JA 5EYCA 5C9CA 3R28A 4XP3A 2UW4A 4I24A 4K18A 2X7GA 2WEIA 1KE6A 3QAME 4QMVA 1G5SA 3G9NA 4RIWA 5IMXA 5E8TA 4BI0A 1B39A 1H8FA 3UOHA 4IWPA 4QMPA 1ZYJA 1XBCA 5EKOA 3F6XA 3WOWA 3I0OA 3PXFA 5TKDA 2Z2WA 4NU1A 4XS2A 3W18A 4O1PA 4E7WA 4ZTRA 3CTHA 2Y4IB 4F65A 1MQBA 5HNIX 2JPEA 2ITOA 4ERWA 4DFBA 4ZK5A 1K2MA 4J99A 1YXTA 3N51A 4GIIA 4K8AA 4U8ZA 2VTMA 4Z7GA 3R0TA 4OTGA 4BHZA 4DBXA 3C0GA 4YHFA 4AGCA 2EB2A 4ZY5A 3S0OA 1G3NA 2NRUA 4JVGA 4E6AA 4WG4A 3PZEA 2KB3A 3R2YA 4FL3A 3PRFA 4YPSA 1Y57A 2YEXA 5M51A 2PMIA 4RJ4A 1R1WA 4C4FA 5HORA 3U6JA 5I9YA 2OZAA 4G6LA 4DEDA 3QHWA 5EOBA 4NM3A 3UMXA 2P33A 3FQEA 1MP8A 5J7BA 1P4OA 3A2CA 2FA2A 2PE2A 4G2FA 4QTCA 4XV9A 3V5LA 3R8UA 3G33A 1PHKA 3OY3A 4I6BA 4XG2A 4E5WA 5J8IA 3DY7A 4HNIA 5DT0A 2OW3A 2OJGA 4XUFA 2BKZA 2QKRA 3V5QA 3R73A 4U3ZA 1F5QA 2W4KA 4JIKA 5HNBA 2CN8A 3DCVA 2OJFE 4IB5A 4EK3A 3AD6A 4ZZMA 2C0IA 5AAEA 4AZWA 1CKIA 2JBOA 1DMZA 1GZ8A 3SW7A 4RT7A 1UU8A 3IW6A 2WTJA 2VWUA 2VWIA 1ZOHA 1OL2A 3FI2A 4UWCA 5DRDA 4ALUA 1MRUA 3IDCA 4L68A 4OTFA 3SAYA 2BZKB 2R3RA 4BDKA 4CRSA 2CDZA 4EI4A 2CNUA 2R3GA 4BGQA 4CKRA 4EGXA 3ROYA 4O0TA 4QNYA 4UV0A 2FF4A 4V01A 5J9ZA 2CKQA 4B6LA 4ZIMA 5HIBA 1QL6A 5JQ8A 3GB2A 3OCTA 4WUNA 3NW7A 3NUYA 3E5AA 3SLSA 3DKCA 3O7LD 3MY1A 4BGGA 3U6HA 4CTBA 4YJUA 2GQSA 4O82A 3WF8A 4KWPA 3F5PA 3QA0A 4RWLA 5FGKA 4Z7HA 1ZZLA 4NJDA 4FYNA 4E4LA 4BZNA 3M42A 3RINA 3LCDA 1FQ1B 1WCCA 2HZ4A 3EB0A 2JDVA 4RG0A 3MVJA 3OROA 5CZIA 3R9DA 5IQGA 2J4ZA 3PA4A 5FXSA 4QMXA 5EHYA 2JQJA 4QMUA 2YCSA 2IW9A 3Q96A 4K2RA 5EW3A 4FX3A 2CN5A 4IX6A 3IQ7A 5AP0A 3IW4A 3FV8A 4O7ZA 4IADA 2BFYA 5HBHA 2Z7RA 4FMQA 3JXWA 1JVPP 3FLSA 5HI2A 5GJFA 2XVDA 2QURA 3OT3A 3TL8A 3ZOSA 5CF8A 4WSQA 4EZ5A 3OXZA 4QYHA 3HV6A 5E92A 3FLYA 3SOCA 4QTEA 1ATPE 3O17A 5CTPA 1S9JA 3A62A 2JKOA 4PP7A 4NK9A 4F09A 3FLZA 2YN8A 3RZFA 4U80A 1UU9A 1DAWA 4EH4A 1H0WA 2B52A 3TDWA 2CGXA 3MGYA 1R0EA 3EN9A 2W0JA 5FQDC 2QR7A 1Q41A 2W05A 4I0SA 4AN3A 4MCVA 3W10A 3PY1A 2R5TA 3GOKA 4B8LA 3FL5A 3HDMA 2B9HA 4FKRA 3EN7A 5EDQA 2JDSA 3G9LX 4MD9E 5A6OA 5M4CA 3CQUA 1PRYA 4O0YA 3KMUA 3GCSA 2JKDA 4FKSA 3H10A 5EYKA 5B2LA 5BVKA 3OUNB 4QPMA 2F7ZE 5CLPA 4CFFA 4R8QA 2JDOA 4WIHA 1ZAOA 1XBBA 3DA6A 4IB0A 4IVCA 5KUPA 2BAJA 2IO6A 1FVRA 3CXWA 4P5QA 3SA0A 5M4IA 5KO1A 4BBFA 4E5AX 4JOAA 5L2QA 3QRTA 4O21A 3Q9YA 2PVLA 2ZDUA 4S30A 3PIXA 2WMAA 3OXTA 2FYSA 2GDOA 3KXGA 5AR3A 4YURA 2WIPA 2O65A 2G1LA 2AUHA 3TDVA 5GZ8A 4EK8A 4EYJA 3DKGA 5AR7A 1Y8GA 3NDMA 5DJOA 3MJ2A 3NUAA 1OIQA 1J1CA 4S33A 3KCFA 4ZY6A 5KBRA 4UB7A 2NNWB 4H58A 5EW9A 4AGUA 3BX5A 4QYFA 3ZFYA 2GQRA 5CAVA 4LQMA 2R3LA 3R01A 4NUSA 3D83A 3VRYA 5IKWA 3W1FA 3R8MA 4XRJA 2VNYA 3H9RA 3TIYA 4FT7A 3UPXA 4EOMA 1YDTE 4F9CA 1H26A 5IH5A 5KHWA 4LGDA 5D9HA 5EHLA 2PUIA 3RALA 3MBLA 4H3BA 3TZ9A 1LGQA 4FYOA 2XK9A 3F2NA 3UIUA 4YZDA 3ZLXA 1Q24A 4E6QA 1OZ1A 4C4HA 4QP7A 3IW8A 5KZIA 4YTIA 3SC1A 2W1GA 5IQCA 2I6LA 4FODA 1BUHA 1VR2A 4QMTA 5FBNC 1J7UA 2E9UA 2OZAB 2RF9A 3R04A 4FGBA 4DINA 3F2AA 2PMLX 3FDNA 4IXPA 3CC6A 2GS7A 2Y9QA 3E63A 4L52A 4ZTMA 4PQNA 1R39A 3KRRA 3CJFA 4GYGA 3ERKA 2HY81 3RVGA 3GFWA 4X7QA 3ZONA 2W3OA 2WKMA 3MW1A 4TL0A 4PL3A 2PSQA 2XJ0A 3GC8A 4P5ZA 3FHRA 2X2MA 3RK7A 4OAVB 4KIKB 3ZUUA 4QQJA 2X6EA 3BRBA 3LQ3A 3QXPA 3BV2A 4A4XA 2F49A 2CKOA 3P08A 3QRIA 3BI6A 3QF9A 3CD3A 5CS6A 3OW4A 4HW7A 4AUAA 4GH2A 4O7WA 3PSDA 1Z9XA 4RBLA 3NUNA 3FLQA 3ZBXA 4CZTA 2AC3A 3BBTB 4I4FA 3DJ5A 5CT0A 3UPZA 3E7OA 4LM5A 2CNVA 3BKBA 2XKDA 5FTGA 1M2PA 1PW2A 3LFFA 2GS6A 3UQFA 3LFNA 2VTNA 2Y7JA 3UP2A 3WF9A 2UZBA 4UXLA 3H9OA 3II5A 5E1SA 2XF0A 4ZLYA 2WTKC 3DBDA 1GIJA 4RX5A 1RDQE 4U45A 3V5TA 1OGUA 4EKKA 2OH0E 3VS7A 5HZNA 2OK1A 3CE3A 3FSKA 1WBWA 3ODYX 4IMYA 3FSFA 2QU5A 3I0QA 3ORNA 4D0XA 1HCKA 4CFMA 3S00A 4DT9A 2VWWA 5KMJA 3BHVA 2BRNA 2GS2A 5J95A 2W1IA 4KS7A 4ZSGA 4BWPA 5LMKC 2WFYA 4JAIA 4N4SA 4U43A 4FEVA 4MNEB 2EXEA 2W5AA 4FZ6A 1IR3A 4ALWA 4BHNA 2PU8A 3OBJA 4WG5A 2GHMA 4DCEA 4PNKA 5M53A 1OL5A 3BU3A 3MTFA 3EQPA 4FKTA 4C8BA 4XBUA 3TIZA 2IVVA 3GI3A 4JBOA 4D55A 4MXCA 2A1AB 4IX3A 4JXFA 4X21A 4EBWA 3ZC5A 5DE2A 4PL4A 2HY0A 4WRSA 2A0CX 2WIHA 4CCBA 3HP2A 4UBAA 3JR1A 4CFNA 3RWPA 5AM7A 4FK6A 1XH8A 3UNMA 4KSQA 2WTCA 3GT8A 4XV3A 3DAKA 3ZYAA 5H8GA 4HCVA 1FGIA 4F0IA 5FEEA 5IU2A 1LEZA 4O2ZA 4C3RA 4DH1A 5CVGA 3E87A 1P4FA 1I09A 2WU6A 5IDPA 3H0ZA 4ORKA 4ANLA 1PXKA 1M7NA 3JUHA 2WZJA 3AMBA 1Q8YA 1WBVA 2Y4IC 3FZTA 3KXZA 3V8WA 2WGJA 1J4KA 3SG8A 1H1WA 1YDRE 3CD8A 3RM6A 4P90A 4BTFA 4I92A 4FGRA 2WTDA 1OM1A 2ITQA 4MWHA 4D5HA 3VJNA 1IA9A 3ATTA 4QMLA 2OXXA 4FTIA 5GINE 2WQOA 2GNJA 3OFMA 5CXZA 3EFLA 2R3KA 1FOTA 1OIYA 1JAMA 2VTIA 2X2KA 3F66A 3MI9A 3OEFX 4MD7E 5AAFA 3FI8A 3GVUA 3PRIA 4I93A 4C37A 4IM2A 4TWOA 4F0FA 4HPUE 4XJ0A 2BTSA 3F7WA 4I0RA 4PV0A 4IBMA 4RVLA 3VNTA 4OBQA 4D2PA 4EKLA 4G16A 3K3JA 3KRWA 2FSMX 5HE0A 5HX8A 4FKWA 5HG9A 3CSVA 3LW0A 3QQFA 3QCYA 2A27A 2YM3A 3QFVA 4J8MA 3I6WA 4FNWA 2OU7A 3NIEA 5JRSA 4LMUA 3ACKA 3BE2A 4RJ5A 4X0MA 1CTPE 1UNGA 3HLLA 4FICA 2ITPA 4KS8A 2X0GA 1DS5A 1O6YA 1NXKA 5BVOA 3CTQA 2OWBA 4E4MA 1SMHA 4XX9A 5DVRA 3PP0A 2ITVA 4G5JA 3PJ8A 3MDBA 5E4HA 2YIQA 4L3LA 3FMHA 4F63A 2G01A 5CAOA 1JLUE 2R0IA 3DPKA 1XWSA 3C5IA 4FKOA 3LFSA 5JQ5A 2YM7A 3DTCA 2EU9A 3SXRA 3VS3A 4BDGA 1OUKA 3O2MA 4JR3A 2RL5A 2GQGA 1YXXA 1UV5A 5K9IA 4QMWA 3V3VA 2A2AA 2FB8A 3R7EA 3QTSA 4BDIA 3DDQA 2HK5A 2C6MA 2WMVA 2WQNA 5HVJA 3R7YA 3L1SA 3DTWA 4EHZA 4XG4A 4AFEA 2VGPA 4XRLA 3VBQA 4X2NA 2VTPA 2I0EA 4JDJA 2Q0NA 2PK9A 3P4KA 2H9VA 4EORA 3LFEA 5J5SA 5IQEA 2W5BA 4H05A 4ACGA 4UMRA 3O51A 4FG9A 1H24A 1Q8WA 5IA1A 5AR2A 1JKKA 2OSCA 5K3YA 3TWJA 3MESA 4CYJA 3IO7A 3UG2A 4CMOA 3G51A 5AUXA 3NW6A 5E1EA 3OCGA 4Y72A 5BQ0A 3ODZX 2ZM4A 2R0UA 1ZYCA 4GJ3A 4I23A 4OTIA 5AJQA 3UNZA 4C58A 2QLUA 5IG1A 3TUCA 3LAUA 4BF2A 4CVAA 5EI6A 1CKJA 3CQEA 3GU7A 4ENXA 3E7VA 3GCVA 3IOPA 4EH9A 4FL2A 3WILA 3F3ZA 3EH9A 3ZO3A 4X2FA 2JFLA 4YBKA 4R7IA 3I81A 2YDJA 3POOA 4WUAA 3AT3A 2JFMA 5D7AA 3LFAA 1Y91A 3R7IA 5LWMA 4KIKA 2OLCA 3R9RA 3ZM9A 1MUOA 2BKKA 5K4IA 5EH0A 4AE6A 3L9PA 5C4LA 3A7FA 3DJ7A 3HA6A 4FKPA 4NTTA 3OY1A 4PWNA 2YIXA 4JQ7A 1H1RA 4X3JA 3WE8A 5L8LA 4WOVA 2HZ0A 1LPUA 4QMQA 3HX4A 3C4CA 1FMKA 3HNGA 5IDNA 3NYNA 2A19B 2QOIA 3D0EA 5L6PA 2ITUA 3A4OX 3CPCA 3DK3A 4LOOA 4FTAA 4OTRA 3REPA 3SKCA 4CFVA 5HIEA 5D11A 5HX6A 2X39A 1YOLA 3KT9A 3AMYA 1NVRA 3EN6A 2QG5A 1JPAA 1OPLA 3FLNC 3RPOA 3PDTA 1V0OA 3QUEA 2CSWA 4J98A 4DHFA 5A6NA 3O8TA 4F7SA 4Q2AA 3IDBA 4GFMA 3VULA 4AZSA 5LMAA 4AW5A 4BL1A 1DM2A 1F0QA 4W8EA 4B7TA 2BAQA 2JD5A 2OG8A 2IVTA 4JG8A 3R8ZA 4E8AA 2Z7LA 4FVRA 3FMDA 4RPVA 4F08A 1OVEA 4II5A 4EOPA 5L6OA 3UZTA 3ALOA 3B8RA 4FTCA 4JRNA 3NEWA 4QMMA 3O96A 2XUUA 4MBLA 4O0RA 5AV0A 4DFXE 4CLJA 5M06A 5IQIA 2CGVA 1BMKA 4DC2A 2PE0A 3PPZA 5LJJA 1Y6BA 2C1AA 3P7CA 2R3PA 3FXXA 2X6DA 2VTHA 4TZRA 4O7RA 3PLSA 4YJVA 4D2RA 3AC4A 3Q5ZA 4L44A 4PRJA 3V51A 4CYIA 3VS2A 5K0XA 3V5PA 4P4CA 5ANDA 5HLPA 3KXMA 4PMPA 5HU3A 4L43A 4C0TA 1NW1A 4BKZA 3RGFA 4A0EA 2O63A 4XV1A 1MQ4A 2C5NA 4APPA 2NP8A 3FEGA 4AA4A 2ZVAA 1OKYA 2E2BA 3NS9A 2XIZA 1LUFA 4I6HA 3FHIA 4ZY4A 2BHHA 2OXDA 1KOBA 3VIDA 4C02A 4RJ8A 4RFZA 4NKAA 3W2SA 2X8IA 4N6YA 3UC4A 3QUDA 5AP7A 4AT4A 4BIBA 4QYYA 4JRVA 3ZLYA 3H9FA 5CENA 5HBEA 3Q2JA 5CU0A 2SRCA 2QD9A 3BYOA 5HU9A 1UKIA 2F2CB 3IG7A 2P4IA 3C4EA 4XYFA 3V01A 3OWLA 2F7XE 3D7TB 4RX7A 5ACBC 3QTIA 4UMUA 4LMNA 5JEBA 1ZARA 2ZYBA 3Q4ZA 2J50A 4QT1A 2CGUA 2PMOX 3MFTA 4OBOA 4AZTA 3TT0A 3BGQA 4Y8DA 4UXQA 4NM7A 4MQ2A 5G6VA 2V62A 3BGPA 3QQGA 5EYDA 2OBJA 4AXAA 1QCFA 4D4YA 2YZAA 3BCEA 4QNAA 4D2SA 3TTIA 3R9NA 3FMKA 3UMWA 2B4SB 4DF3A 2Y8OA 2R3FA 3RAHA 3E8EA 2CCHA 4RLKA 4BBMA 4JQEA 3C51A 4FV4A 3NSZA 1H08A 4HJOA 3EL7A 4O84A 3FKOA 3EQBA 4JQ8A 4PNIA 5FRIA 2JLDA 5A4QA 4CG9A 2JIVA 4G9RA 3CY2A 3CR0A 4FVPA 4PDOA 3VBWA 5JFSA 2G2FA 4EEVA 3FY2A 4K6ZA 4RVMA 2DUVA 4WSYA 3LCOA 4E4NA 2GCDA 1JBPE 4ACDA 5BVFA 3CEKA 4I41A 2W1CA 4WNMA 5HD7A 5BPYA 2GNLA 3BU6A 5DT3A 2V7OA 4GW8A 2XEYA 1K3JA 4R78A 4EJQA 2GHGA 3VO3A 5C8MA 4MTAA 2QO2A 5A4LA 4HYHA 1K3NA 4OW8A 1XH4A 1GZNA 2V0DA 4R6VA 4ERKA 2OFVA 2UZTA 4C62A 2VTTA 5DNRA 5E90A 3AC1A 4M97A 3R21A 4IFCA 3AC5A 4AA0A 3F2RA 4ALVA 3QL8A 4LOQA 3W8QA 1Z5MA 2UZDA 2XK8A 5DLSA 4RQVA 5IQBA 4JL9A 1H4LA 3HZTA 3TKUA 4AG8A 4NCTC 2BDFA 3KF4A 4TN6A 3PPJA 3SDJA 4IM3A 3CLYA 5JFWA 2YM8A 4OTHA 3NAXA 2UV2A 4BY9E 3QTRA 4K11A 4U9AA 4DEHA 4OGRA 4I5PA 4EONA 1BKXA 2VWVA 1ZMVA 4YJPA 2V5QA 2G15A 3R30A 1OL7A 2VX1A 1GAGA 3QYWA 4QTBA 4AGWA 5HEZA 2QR8A 5ANOA 4EH8A 3FJQE 5HKMA 3I7CA 4PP9A 5HBJA 4CXAA 4NSTA 4YLLA 4DA5A 4FVQA 4D2VA 3AC8A 3W2QA 4M68A 2YCQA 4G6OA 1L3RE 2UZEA 1O6KA 3DLZA 4RIXB 3EIDA 2OO8X 5HVYA 2BMCA 4FTUA 4R1YA 2X1NA 4I1ZA 3UIMA 4EOKA 1WFCA 2AFFA 3D2KA 2PL0A 3Q4TA 2F2UA 4S34A 5M56A 4W4YA 1IG1A 2Y0AA 3LCKA 1NA7A 2WB8A 2UW7A 1L8TA 3C13A 4B0GA 3BLHA 1WVXA 2I0HA 2UW5A 2VUWA 2I40A 2QOKA 3P7BA 4GMYA 3G0EA 4IAIA 3W32A 4RX9A 3CP9A 3FBVA 4FE2A 2XRWA 2QOCA 2JIIA 3A4PA 3L9MA 4MXOA 5HG7A 3HA8A 5LARA 3FC1X 2PIEA 1P2AA 3PVWA 2YISA 4RIOA 2VTSA 4FSTA 2G2HA 5I9XA 5EM5A 1ND4A 5E8YA 3NUSA 3PJ1A 4KKHA 4RIYB 2H96A 2CMWA 1KV2A 2XH5A 2QOFA 1IASA 3NCZA 4EOIA 2BCJA 4E5BA 4MK0A 2C3LA 2IW8A 4MQ1A 3RTPA 4LYNA 3F82A 2GNHA 2R3QA 2GTNA 3KA0A 3EFWA 3V8SA 4C38A 4YSMA 4DFZE 1BI7A 3OTUA 4OT6A 1DAYA 4BZOA 4CKJA 3S95A 2G9XA 3R02A 3MS9A 1MRVA 4RQKA 4UMTA 4AA5A 3A7HA 2OIBA 4IDTA 3HAMA 3M2WA 4J95A 4KBKA 4FIEA 1R0PA 4M7IA 5ANEA 2HENA 4IE9A 4BTJA 2BRMA 3LJ2A 4YTFA 4WBOA 5CEPA 2XJ2A 4FTRA 2YDIA 4B4LA 4J53A 2JAVA 4K0YA 4AZEA 3EQCA 3KQ7A 4GSBA 4AN9A 3VF8A 3HMPA 3DXQA 3K5VA 2RSVA 4ZJIA 5M4FA 2WMXA 3PA3A 4XG3A 2HOGA 3SX9A 1SM2A 4ASEA 4ZJVA 5I9ZA 2Z8CA 4CFXA 5BNJA 5I9VA 4JG6A 3UO5A 4BRXA 5FXQA 5L2WA 2YWPA 4BCOA 1HCLA 3TNPC 3QU0A 3DAEA 4D1ZA 5IQAA 5D1JA 4E26A 5KKRB 1FINA 2Q0BA 1UU3A 2B55A 2W9ZB 3BYVA 3F3WA 4L9IA 2WTIA 4KIQA 2VTQA 4O0WA 4USDA 2HYYA 3JY9A 5CU3A 3TV6A 2PUUA 5L2IA 4ZTQA 5AFVA 3NMUF 2PMNX 4G3EA 2Y6OA 4U81A 3WF6A 2R4BA 1PYXA 2OJIA 3EQGA 5C1QB 1UVRA 2W17A 2WMSA 3DOGA 4MXZA 2ETRA 3GNIB 5CSWA 2PZRA 4IVBA 3U87A 1A06A 4C7TA 4YPDA 2WMWA 3EQIA 4JG7A 4LV5A 4TWCA 1GIIA 3COIA 3KXHA 5DGZA 4WNPA 3SRVB 3G6GA 2JGZA 2GNIA 3PSCA 5LVMA 5EM8A 4HGEA 2ZB0A 4FTKA 3ENMA 2VWYA 1OL1A 3C1XA 2WTWA 4IJPA 3WYXA 4G5PA 4NW6A 4D2WA 4PUZA 3CIKA 4L45A 4V04A 3ZRKA 5A54A 3MH3A 3GP0A 4A9TA 3TM0A 3GU4A 4A4LA 5GZAA 4BDDA 3QHRA 1XHAA 5IA3A 3MH2A 5D10A 4GU9A 4FSUA 3GC7A 4GG5A 1FVVA 3LZBA 3PG1A 4JDHA 4N0SA 3LCSA 4QP2A 5CU2A 5CSHA 3U55A 4Z16A 2UUEA 4GYIA 2PHKA 3QZIA 4O22A 4YC3A 2C6TA 4NFNA 5E8SA 2DS1A 3SXFA 5A4EA 2GTMA 2QHMA 2XIKA 4RX8A 3TV4A 4YR8A 3I0NA 5B7VA 5L2TA 3LQ5A 4I5HA 3COKA 4PPAA 4QP4A 4IWOA 3DU8A 3SXSA 2X4ZA 5DWRA 1ZOGA 3MJ1A 4L53A 3HUCA 3AT4A 5DT4A 3D7TA 4D4VA 3ORLA 3EMGA 2W1DA 3K5UA 1FHRA 4FKUA 1K3QA 4FSZA 4GL9A 4J7BA 3P23A 1M17A 1YHWA 4PMTA 5HESA 5JN2A 1LGPA 1NY3A 2JEDA 2VWXA 4ASDA 2WO6A 4ZS4A 3FKNA 4JR7A 1P14A 3VQUA 4CFUA 2HXQA 4RFMA 4M0ZA 4WHZA 3F88A 2R3HA 3F5XA 5IH4A 4AACA 2IZUA 3KXXA 1U5QA 4D9VA 3ZZEA 5EI2A 2F57A 4ZAUA 5LVOA 3HUFA 1OPKA 1XBAA 1YOJA 3OC1A 3DBQA 4LRMA 4YJTA 1AQ1A 1ZXEA 3ORPA 5K4JA 3N4TA 4BDAA 3ZLSA 3AQVA 2EVAA 2QOQA 3NYXA 2RFSA 4EH3A 5KE0A 4BVUA 5AUVA 4FV9A 3GBZA 3QD4A 1ERKA 3HDNA 3QQLA 4H1MA 4Q9SA 2E9NA 3SV0A 3V8TA 2XJ1A 5LVNA 3DXPA 3P1AA 4BKYA 4MXYA 5HLNA 3O23A 4GS6A 3BPRA 3PSBA 2YIYA 3F3TA 3D5XA 3LIJA 3TUBA 3NVKI 2G2IA 4AF3A 4E6DA 2J0LA 3DNDA 3HMNA 3UBDA 2JAMA 4FEUA 2W4OA 5M07A 4A06A 4EOQA 1EH4A 3OOMA 4BI1A 3DFAA 4ZLOA 4GFOA 5CEKA 3CGFA 3KGAA 2Y4PA 4M15A 5HO8A 1QPCA 3HRCA 2W7XA 4IB3A 1E9HA 4BIEA 3VUIA 5JZNA 3NVMB 4X2GA 3I0MA 3AGLA 2I7QA 4W4WA 1XJDA 1XH6A 3FZSA 3MIAA 4GEOA 4N70A 1Q3DA 2WMUA 2VGOA 4BBEA 4L3JA 3RMFA 4NW5A 4NL0A 4O7SA 3AD5A 2UW3A 4AOIA 3HKOA 4FIGA 3G2FA 2J0JA 4FTNA 4L7FA 5L4QA 2ITXA 3NGAA 2C5YA 3PYYA 2ZAZA 3E8DA 3DNEA 4YJSA 3VS4A 3DZQA 4EH7A 3D5VA 3DV3A 3HV7A 1WBOA 4FV0A 3W16A 5L3AA 4AQCA 5C8KA 5CWZA 5CZHA 2ZJWA 4Z9LA 2VTRA 3ZO4A 2BDJA 5LXMA 2ERZE 4APCA 3OBGA 3EKNA 3EN5A 1H0VA 3QRKA 4MBIA 4UYNA 5E91A 4FTMA 3UNJA 2JC6A 5CSVA 2VO3A 4FKGA 2FSLX 4FT0A 1APME 1M2QA 2X81A 4RC4A 5A8IA 2W99B 4J8NA 4LL5A 2YFXA 4I5CA 4IVAA 1UWHA 4L00A 4QP3A 4DLIA 3D5WA 3SHEA 2KFUA 1PMNA 2HELA 2VX3A 4FV8A 1PXOA 2XNMA 2PVYA 3RAIA 3FMNA 5J9YA 2ZM1A 4IC7A 4BB4A 4F4PA 4LV8A 2WQEA 4GCJA 1F3MC 3F7ZA 2YA9A 4FC0A 2LC1A 4F1OA 4C59A 1OIUA 3EQHA 2IN6A 2R9SA 2YM4A 4Y95A 3OCBA 4ZMEA 3JVRA
chains in the Genus database with same CATH superfamily
3R8PA 4FZFB 1FPUA 4D28A 3QX4A 4IDVA 2VWBA 1GXCA 1PXJA 2OIDA 2R3OA 4PPBA 4XH6A 3RPSA 1M14A 4IHPA 4DE4A 3R7GA 2GMXA 3DB8A 3A8XA 5BVNA 1S9IA 4GV1A 4TRLA 5HNGA 3RK9A 3LXPA 4QO9A 5DHUA 1NVSA 2B9JA 2YITA 3FY0A 3IGOA 4L3PA 1W83A 3ITZA 2VTAA 4RFYA 1REKA 4YC6A 5F4NA 2C6DA 5JK3A 5E8ZA 1UNHA 3ULIA 4G9CA 4E20A 3DKOA 4FIIA 4W9WA 3S1HA 4GK2A 4JBPA 1J4QA 5CXHA 4QRCA 3COMA 4O6LA 4DH7A 4YHTA 4C57A 4DEIA 4ACMA 4EZ3A 4BDEA 2A98A 2C5OA 2ETMA 4FKQA 1B6CB 5ANGA 4CV9A 3R9OA 4DLJA 4USFA 5C4KA 4O2PA 1Z0UA 3QQHA 3V6SA 1ST4A 2RGPA 1J4PA 3VUDA 4KINA 5KCVA 1O9UA 1REJA 3A61A 3RNYA 2W5HA 5BUJA 1OI9A 5AR4A 1KE8A 2P3GX 3THBA 5CSPA 3EL8A 4RMZA 5C26A 3I7BA 3W55A 1JNKA 4F9BA 4FKJA 4D9TA 1YI6A 2W1ZA 4PMMA 5AAGA 5EJIA 4BCGA 2XCHA 2KB4A 1CKPA 2R64A 4EYMA 4ZTLA 1YHVA 4YO6A 3TNQB 4IANA 3WI6A 4OTWA 2O8YA 3MFSA 4G3CA 3P5JC 2QO9A 4KU0D 4ITJA 3DGKA 3QZHA 4PL5A 3MFRA 1OBDA 4DFUA 3GCQA 1J3HA 2VO7A 2X9EA 3R6XA 3KULA 3F9NA 3CGOA 3LXNA 3AC2A 3VHKA 2XZSA 2ZOQA 3C50A 4FUXA 3RZBA 2IZRA 4CV8A 3IONA 3DB6A 2WAJA 1ZY5A 2CGWA 2ETKA 5CAPA 2C6EA 2C3IB 2JBPA 4U44A 4XCUA 5DRBA 5HIDA 1YT5A 2JDRA 4K77A 4ZSAA 3R7UA 4LGHA 1YXVA 1G88A 3QWJA 5F9EA 2F7EE 3FMJA 4I5MA 2JDTA 5IF1A 3VRZA 5K5NA 4UY9A 2ITYA 5EW8A 2DYLA 3DK6A 3KC3A 4O83A 3W0QA 3W0RA 4R3CA 1XH7A 5IQFA 3I79A 4QQ5A 3TACA 3VS5A 3VUHA 3JYAA 3FXZA 4BFMA 4BCMA 1TQPA 2CCIA 1KUTA 2B0QA 3NFGB 4L46A 2X8EA 2PZ5A 3QUPA 3UJGA 1VEBA 2J0KA 4FRFA 3MDYA 4EUUA 2FUMA 5TO8A 4F6UA 2XXSA 3Q4CA 4W4VA 1G8JA 5IZFA 5HTIA 4R9PA 1YGSA 2JIUA 2W06A 3CY3A 5DEYA 4D0WA 5HGIA 3PE2A 4FNZA 4YTHA 1PMVA 5CQUA 4RWIA 4Y85A 3QGYA 2PE1A 2QV7A 1B38A 3QD3A 2IVSA 4AT3A 1DI9A 2OFUA 4G17A 3KF7A 4RZWA 4DAWA 3FMEA 5IUIA 4NM0A 5HTCA 4FEWA 1U54B 3MSSA 2PVHA 4YZCA 3VZCA 4DFNA 2XEZA 4O38A 3SOAA 4MD8E 2IVUA 4I20A 3DZOA 4E6CA 3SRVA 4EJNA 2B54A 5IEVA 3NFFB 4YO4A 1YVJA 4A9UA 1XO2B 4IX5A 4MVFA 4YLKA 1V1KA 2V55A 2X0PA 2XM8A 4CTCA 4QDEA 4JMQA 4AXDA 3OW3A 4NZWB 5GIOE 4LUEA 1OIRA 3F61A 4QPAA 3LM0A 3SQQA 2QOHA 3TN8A 3COHA 3MH1A 4AP7A 3GMJA 4JONA 2QOLA 1WBSA 2PZYA 2QODA 3IKAA 3O71A 3OP5A 1YRPA 4ZLZA 4IWQA 3SW4A 5AV1A 3MB6A 4C2VA 3OHTA 4TYEA 2FO0A 4G1WA 4DEEA 3W0SA 2BTRA 2IW6A 2WD1A 5I5ZA 4BCHA 1MZKA 3QZGA 5AUTA 4HCUA 2HIWA 4PDSA 3NW5A 4FBXA 2ZB1A 2QVSE 3BEAA 3OCSA 4FG8A 5H8EA 3RWQA 4YU2A 2QLQA 4HPTE 1VYZA 2XK7A 5K5XA 4HCTA 5CX9A 2WOTA 3ZUTA 2YACA 5AADA 2WQMA 3KRJA 4IQ6A 4XP0A 4QMNA 4Q9ZA 3U6IA 4KBCA 5AM6A 4PTGA 2O2UA 5EOLA 5DR6A 3W0NA 4AZFA 3W2OA 2BRGA 4QMYA 1V0BA 4I0TA 3GENA 4FZDB 5HO6A 1PXLA 5HCYA 4I94A 4BCPA 4I22A 1URCA 2XIXA 4FSRA 4F7NA 5DHSA 5EJHA 4BIDA 5GHVA 4NIFB 5HD4A 4RRVA 4ZTNA 5I0BA 1GJOA 3ELVA 1O6LA 3KN6A 5ITAA 3PA5A 4HVHA 3Q04A 3DITA 1XKKA 4RJ7A 4RLLA 3VC4A 3FPMA 2UVYA 1ZMUA 3D5UA 1XQZA 5FBOA 4EWQA 4QMZA 1PYEA 3TZMA 4FSYA 1YXSA 4ID7A 3TJCA 5KMMA 1SYKA 5IA4A 3VZBA 4RIWB 3ELJA 1KHXA 5JGAA 3LVPA 4K33A 4TWPA 2HWOA 3WZJA 2B9IA 3O8UA 2C47A 2XRUA 4BTKA 4L6QA 3PVUA 3K2LA 2C6IA 2EXMA 4IAAA 4TYIA 5CF5A 3QD0A 4KAOA 5J79A 2XP2A 2EXCX 3QKMA 1Q5KA 4Y83A 3K54A 4EOOA 1NVQA 3FI3A 1IA8A 4BYJA 5KX8A 3OMVA 1OB3A 3QCXA 5EDRA 2JQIA 3CBLA 5DMZA 5JZJA 3D15A 4CG8A 3RCJA 4R3RA 3ZFXA 4HZSA 1P5EA 1OKWA 2UW0A 4RZVA 5LCJA 3HX1A 1TKIA 3R7OA 3VVHA 3HAVA 5CT7A 3QQKA 1H27A 2C6KA 3ZFMA 3LFBA 3UNNA 3ZSGA 3UOLA 4J71A 3E93A 3IECA 2JGRA 3EZVA 4Y46A 5CSXA 3HYHA 3ZEWA 4LRKA 3HRFA 3LFDA 4S2ZA 1UWJA 3KCKA 5CAQA 3UG1A 2VO0A 4HGTA 4KABA 4RJ6A 5CVFA 1YWNA 2GNFA 4GK3A 4BZDA 2GU8A 3F3UA 2GFSA 1KV1A 3DBEA 5F1ZA 5DR9A 5D41A 3D94A 3Q6WA 4PTCA 3M11A 2YAKA 4LG4A 5EHOA 1QMZA 2RFNA 2XNOA 1JOWB 3JS2A 4OBPA 5AV2A 1KHUA 3PVGA 4EJ7A 4XP2A 3G6HA 5CASA 1ZMWA 5BVEA 3WF7A 3HUBA 3LE6A 3WIKA 4FEQA 5C4VA 2ZMCA 3MIYA 4FTTA 3E88A 1UKHA 1W2DA 3PFQA 4YUQA 3OTVA 2OICA 2XIYA 3ORIA 4MHAA 3VA4A 5LMKA 5A4TA 4L02A 4TYHB 2OH4A 5E8UA 5A4CA 4QP1A 4QP6A 4WRGA 3BQRA 3R1NA 4DY6A 2GSFA 5HG5A 4ANNA 3HVCA 5IEYA 3NNUA 3QTWA 4KSPA 2CLXA 4L7SA 3EOCA 4H1JA 5FLFA 4EUTA 5KKRC 5J1WA 3PIZA 2QG7A 5AUYA 5E9EA 1SZMA 5DEWA 4AZVA 3FYJX 5IA0A 4PDPA 2EH0A 1WBPA 2ZV8A 2QOOA 3N4VA 3SGCA 2R3MA 2YCFA 3KY2A 3KMWA 3ALNA 3NUXA 3OWPA 4N6ZA 4TTHB 4XG6A 4NCTA 3ULZA 3KK9A 5IA2A 1Q4LA 3LKMA 3P9JA 3NNWA 4HZRA 2OJ9A 3VJOA 2XNPA 3ACJA 4DITA 2PVNA 4UMPA 3QTQA 3HRBA 5DA3A 4BTMA 5FDPA 3S2PA 3TNHA 4QOXA 4GUBA 3FL4A 2CLQA 4MX9A 3ZEPA 1IEPA 4CKIA 2CKEA 2ITZA 3ZRMA 3NIZA 3PXQA 4B8MA 4X3FB 2QNJA 4DHIB 4R5SA 4DTKA 4F99A 1ZZ2A 3PLAE 1PMEA 3WIGA 4ANMA 4EC9A 2IJMA 3G90X 2OJJA 4DFYA 2UZNA 4EQCA 4QP8A 5JT2A 5DBXA 3EQDA 3BHUA 3LFQA 4RIXA 3R63A 3NLBA 3KMMA 2QOBA 3RHKA 4EC8A 2FVDA 3DSHA 3HV4A 4GK4A 3RNIA 4BN1A 3W2RA 4TYJA 3QRUA 4UN0C 3PWDA 4V05A 4IZ7A 2I2CA 4ANOA 2Z02A 5HO7A 3L8PA 3D2IA 2C68A 3KVXA 4CGAA 3AFOA 2A0TA 1RJBA 4WD5A 5AP5A 3PUPA 3H4JA 3Q3BA 4D1SA 4A9SA 2NRYA 2FEZA 4IX4A 2PVJA 3CKXA 1Q8UA 4GJ2A 2GFCA 3UIBA 5AA8A 4L42A 4IEBA 4BCFA 2VWZA 1YQJA 3DLSA 3O7LB 4MWIA 3FI4A 4WNOA 2IZTA 4IVDA 4YJRA 3DJ6A 3V5WA 4BICA 3NR9A 4JT3A 4ZP5A 3C5UA 4XLVA 5AV4A 1ZYLA 5EDPA 4FSMA 5ANJA 4JI9A 4RWJA 5DPVA 3BWFA 5BVWA 4GKIA 3A7IA 3UVRA 4FV1A 4KBAA 3RKBA 3ZH8A 4PX6A 5BUEA 2Y6MA 4GT4A 4RGJA 4IZAA 4UEUA 5G1XA 2WU7A 4IAYA 4TPTA 4A07A 1FBNA 4BDJA 3RHXA 2J51A 3QBNA 4O7LA 3SG8A 3DQXA 3ZCLA 1J7IA 1JKTA 4MXAA 4G34A 3VBYA 3WZEA 5IH6A 4O6EA 3OS3A 1YOMA 3UE4A 3SVVA 3OUKA 3VUKA 1PXIA 4FKLA 4ITHA 3IS5A 2VRXA 4R77A 3LXKA 4ITIA 5TR6A 4DG3E 1YI4A 4CFWA 4EK4A 3MPMA 4MF1A 3PXKA 3WF5A 3UOKA 5AP6A 1K3AA 4RWKA 3VBTA 5DHJA 2YIRA 4E73A 1LR4A 4G3FA 1GZKA 3A8WA 3PO8A 1ZWSA 1GZOA 2R3NA 4ZZNA 1V0PA 4AU8A 3D9VA 4X2KA 3FMMA 5CNOA 3RJCA 1ZOEA 1GNGA 3PE1A 3U9NA 4LI5A 1OPJA 4ANSA 2ZM3A 1H07A 4UWYA 3BELA 5H9BA 2YHVA 3NPCA 1Q3WA 2NO3A 4OTQA 1U46A 3ZUVA 4O7YA 3VBXA 4WERA 1TQMA 2FH9A 3QQUA 4V0GA 5CALA 4AAYA 3T9IA 4F1TA 2ERKA 2R7BA 2HWPA 4LFIA 4TYHA 1WMKA 4YZBA 5GJGA 1FGKA 3DS6A 2BAKA 2UW6A 4M13A 4C3PA 4FIHA 4IW0A 4M0YA 4PF4A 4DYMA 2VD5A 4NWMA 5HCXA 2P0CA 1U7FA 3W0MA 4BDHA 5ETFA 2YABA 5GZ9A 5E8VA 1LP4A 2WMRA 4QTDA 4B99A 3HGKA 2BHEA 2WMBA 3C4WA 5ETAA 3UO6A 4AGDA 2XNBA 4YMJA 4X3FC 4O86A 2BIYA 3O50A 3AKJA 3E8NA 3PTGA 5FTOA 5ACKA 2DWBA 3RM7A 3MFUA 5KMKA 3MVHA 3PJ3A 2XKFA 3NWWA 4U6RA 5J7HA 2J7TA 4O7VA 3RPVA 3R00A 4EWHA 2P1RA 5AP2A 3NYOA 4IH8A 4PY1A 4CQGA 4YP8A 2PULA 4ARKA 1FVTA 2BROA 3E62A 4CRLA 1WV3A 1PXMA 2BVAA 4UZDA 4GFGA 3MV5A 1BL7A 2UW9A 3RAWA 2B7AA 1JKLA 3CTJA 3TXOA 2CNQA 2YJSA 3VPYA 1M7QA 5DR2A 1YJMA 1J4OA 1WAKA 2C1BA 2J5FA 2RFDA 4U5JA 4Y5HA 3GQIA 3IPHA 3R7VA 2XS0A 3ZTXA 2WMTA 2KKLA 4YHJA 1BX6A 2W9FB 4U42A 4YJOA 4DN5A 2XNEA 4QQCA 2C5XA 1CM8A 1OKVA 5ICPA 4BR3A 3FUPA 4GUEA 5HCZA 5FXRA 3EJ1A 5CYIA 4HGLA 2YDKA 1CDKA 4ZSEA 5TF9A 4XLIA 5I3RA 3R1SA 4N57A 5CEMA 4MNFA 4EHGA 3KRLA 3CS9A 3FZPA 5T6KA 2O0UA 1A48A 5AX9A 4U97A 5JSMA 4GRBA 3BZ3A 3UTOA 4R1VA 1QPEA 5E8WA 1R78A 4M69A 5AP1A 5F94A 2BRFA 2BALA 4G3GA 1T46A 5IUHA 4I6FA 4LRJA 3RCDA 3DQWA 1TFFA 5CU6A 4AW0A 3T3UA 4AWIA 3F3VA 3ORTA 5EM6A 4O81A 5IEXA 3NUUA 5EK7A 2XA4A 4Q5EA 3QA8A 2HAKA 2HCKA 1PF8A 2XBJA 4LGGA 5KMOA 4GT3A 5CI7A 3I6UA 4U40A 2RFEA 1Q8ZA 2FGIA 3B2TA 3B2WA 1UU7A 2OXYA 3RI1A 4AOJA 4EH6A 4EL9A 4ZOGA 3AOXA 4ASXA 4EBVA 4LOPA 1G6GA 5HVKA 3ORKA 4HNFA 3CPBA 4RIYA 3ZBFA 5AUWA 4PDYA 1AD5A 4K1BA 4A9YA 5HLWA 3C0HA 5DHRA 4ZMFA 4DDIA 2WOUA 2XYUA 3BE9A 4KKGA 3NUPA 4EQMA 3QX2A 3QC4A 2X2LA 4IB1A 1Z0SA 4R3PA 2ITWA 4O4DA 4CCUA 4F9YA 4A4YA 4AT5A 3I4BA 5EQPA 2KTYA 4O91A 1AGWA 3OZ6A 2EUFB 2WEVA 4JX3A 5AP4A 2ACXA 2PZPA 2WPAA 3I1AA 4HYUA 5JFXA 4J1RA 3TNWA 4CD0A 4YBJA 5FEDA 4EQUA 1QU5A 2W96B 4F1MA 5GJDA 5T68A 3PZHA 5AIRA 3WE4A 5LQFA 5BMSA 3FWQA 3LLAA 3VUGA 5AUUA 2PVFA 2XK6A 3UVPA 3VUTA 2J90A 4IM0A 4I21A 3VS1A 5CEQA 4L67A 3F5UA 3KULB 4L8MA 3GGFA 4WBBB 3FPQA 4ZZOA 1BYGA 3QCSA 5CVHA 3EKKA 3HV5A 2C4GA 3DT1A 1YDSE 3VUMA 3AXWA 5IPJA 1ZRZA 1JKSA 2IF8A 3BLQA 4EH5A 3W2CA 4O0VA 2BR1A 3DBFA 2YAAA 5CQWA 5HTBA 1Y3HA 3MA3A 3TG1A 2UZUE 3GUBA 4FSNA 4G3DA 2OGVA 4IC8A 5B0XA 2Z60A 4NJ3A 3C4ZA 3ZS5A 4CT2A 3VBVA 2ZDTA 1HOWA 3ETAA 4H3PA 5L6WL 4CMTA 1H01A 2ZV9A 3VN9A 4CEGA 5BUIA 3TZ7A 3VF9A 1YHSA 2J9MA 4ANQA 4C2WA 4O1OA 2BUJA 1TQIA 5EG3A 2W1EA 4P7EA 4UWBA 4AXFA 3LOKA 2EB3A 4ZXTA 4EK6A 3Q60A 1MJSA 2QHNA 1ZY4A 3I60A 4ACCA 4CNHA 2PUPA 4MXXA 5FD2A 3ZXZA 4YC8A 5BYYA 5A9UA 2IZSA 2JKKA 2XKCA 2G1TA 3G0FA 3HMOA 4MH7A 4MYGA 5FM3A 5CEIA 4M69B 3Q9WA 5C01A 5DI1A 4AE9A 4BCNA 3NRMA 5FEQA 5FTQA 4NIFA 3UIXA 2AC5A 4IWDA 2HZIA 3S4QA 3UYSA 4DG0E 3OXIA 3PXRA 4DFLA 5CF4A 2B9FA 2PVMA 1G8KA 1Q8TA 3MWUA 4JIAA 3VS0A 3UMZA 5J87A 3TNIA 4GU6A 1H25A 3QYZA 3C0IA 1OKZA 2C30A 4FR4A 3IW7A 4IJ9A 4RSSA 4P2KA 1YWVA 4M8TA 3MVLA 4AFJA 4IIRA 4D9UA 4AN2A 3UQCA 3MYGA 3ZDUA 3R22A 1YI3A 4LL0A 3Q52A 4CZYB 1A9UA 1SVEA 5E8XA 5LWNA 2PYWA 4U0IA 1Q62A 3ROCA 3BYSA 2VN9A 2PWLA 3JVSA 1SVGA 2W1FA 3QQJA 4AW1A 4IACA 4FIFA 4JAJA 2IPXA 2YERA 2F4JA 2J0IA 3AMAA 5M4UA 3P5KA 3ZU7A 1Z57A 4DGGA 3UV0A 2J2IB 1BLXA 3FLWA 1W7HA 2Z7QA 3T8OA 3V04A 1JWHA 1WBTA 1IRKA 4L01A 3RP9A 1XH9A 1XR1A 3BV3A 4UYAA 2BZJA 4R7HA 3U8WA 5L8JA 1OBGA 3VS6A 4C33A 5I9WA 2UZWE 3ZHPC 5LVPA 4BWXA 3HV3A 4S32A 1TVOA 4DGLC 5IMEA 4FEXA 1H1PA 5ANKA 3UOTA 2XCKA 2BRHA 1W82A 3D7ZA 4M66A 2RKUA 3A60A 4PTEA 5FWKK 3V8RA 4EH2A 4IAZA 2GNGA 3LXLA 4FTQA 2XMYA 4KNBA 5KHXA 3KFAA 2QCSA 3NZ0A 4O4CA 3PVBA 4Z3VA 1U54A 2BFXA 5FDXA 4G2SA 1PKDA 3O0GA 4BYIA 2I0YA 1U7VA 5FM2A 3RAKA 3PWYA 2OZOA 3JPVA 1OMWA 5KNJA 3OF0A 3ZLWA 4KA3A 4O0SA 4F6SA 5JH6A 5HE1A 2XAOA 3ORXA 2WHBA 4V0GB 3DFCB 4C4JA 3KN5A 2PVRA 3HP5A 4HGSA 3W33A 5I9UA 4ZTSA 3E3BX 4EZ7A 3UZRA 4GG7A 1PXPA 1WVYA 3RPRA 3C7QA 3MPAA 4FI1A 3FAAA 4U79A 3CKWA 2C0TA 4FTLA 4FZ7A 3RK5A 1PY5A 4F9AA 1CSNA 3I5ZA 4H87A 4R7BA 1JSUA 2YLEA 5J9LA 5BX0A 3L8VA 3WBLA 1J2FA 4NFMA 5DIAA 3OOGA 5AWMA 4J96A 1W84A 1ZYDA 3OVVA 4O27B 3FMLA 3GU8A 5HE3A 4BCIA 3SG9A 2J5EA 2O64A 5B2MA 4QMOA 4CZUA 4W8DA 2YWVA 3W2PA 2ZFYA 3R9HA 4NYEA 2X9FA 3EQFA 5DOSA 2OI4X 3HUEA 2RG5A 4KIPA 4M14A 1GOLA 5H8BA 5CI6A 4I4EA 3BGZA 3ENHA 1Q97A 3GU5A 5AR8A 3UODA 4AX8A 5JKGA 5LVLA 2KULA 3BLRA 3OD6X 3PJ2A 4E1ZA 1GIHA 1UA2A 4AXCA 4CT1A 3MPTA 2O5KA 3GQLA 3HEGA 1G8SA 2LAVA 3UC3A 4UX9A 1JSVA 5JEKA 3LPBA 2FSTX 5C27A 4FV2A 3QD2B 3PJCA 3GC0A 4F7JA 3UN0A 3LMIA 2PZIA 2WMQA 2X0OA 2BZIB 3QRJA 3WYYA 1IAJA 2BPMA 5FUTA 1U4DA 1PXNA 3VA1A 1RE8A 2YM5A 3DXNA 1KOAA 4OUCA 5EI8A 3DK7A 4Y73A 3ZSIA 4C4IA 4C34A 5L8KA 4K9YA 4FOCA 4YGAA 4D1XA 2IWIA 2YCRA 3AKLA 4HVIA 1H28A 3TTJA 3MVMA 4ONAA 3MH0A 2C0OA 2H8HA 3E8CA 3RPYA 1OL6A 4JDIA 3BIZA 1M2RA 3V5JA 4OR5A 4WNKA 4DH8A 2BONA 4CMUA 5GIPE 3QZFA 1E1VA 2VTLA 4WO5A 5TOZA 1J7LA 3PP1A 1PMUA 4AS0A 4D58A 1E1XA 4JX7A 3QWKA 3ZDIA 1BL6A 2WELA 2WTVA 3KKVA 3AGMA 1SNXA 3N4UA 3WZUA 4XG7A 2NPQA 2JITA 3GEQA 2VAGA 4KRCA 4TXCA 1G8AA 2XIRA 4FV5A 2PPQA 1TZDA 4CSVA 2UVXA 3VWAA 3ORMA 4NH1A 2QC6A 2LGCA 4C4EA 4U3YA 4DG2E 5BYLA 1KSWA 3H3CA 4ASZA 3QC9A 3QTUA 2A4LA 4FV7A 2QU6A 3Q9XA 5CF6A 4QTAA 4DT8A 4MAOA 3BL9A 4TT7A 2E9OA 3TEIA 5A14A 4M12A 1RQQA 3ANQA 3L9NA 4OTDA 2CKPA 3G5DA 4Z55A 4DGNA 2I0VA 3DDPA 4CLIA 1R21A 4W9XA 3FZRA 4XMOA 3FZ1A 4PMSA 3PY3A 2F9GA 2ITNA 2H6DA 3R2BA 2P55A 3DBCA 3ANRA 3OWJA 4EOJA 3B8QA 3UQGA 5CNNA 3F69A 3ZRLA 4FK3A 2JKQA 3R8LA 2BDWA 2UZOA 3R1QA 2V7AA 5TE0A 2PTKA 4XNEA 4BWKA 4QP9A 4IAKA 4BC6A 3AT2A 3E64A 3H30A 4FV6A 5CU4A 2AEGA 5BV3A 3KL8A 3FE3A 3MY5A 1W8CA 5DFPA 3T9TA 5AMNA 3GXLA 3UZPA 3BU5A 4ZEGA 1G3GA 3R1YA 4ACHA 2ITTA 1SVHA 3GC9A 3PIYA 1OECA 4HYSA 4JLCA 4DEGA 4ZS0A 4KRDA 4QYEA 4O96A 3K3IA 4WA9A 2YJRA 3TKHA 4AW2A 3U54A 3IK3A 1CMKE 4F64A 4IZ5A 3Q53A 5ANIA 4NEUA 2WQBA 3Q9ZA 3NX8A 4OAUC 4BGHA 3EWHA 3L8XA 4EK5A 4YJQA 2Q83A 3S3IA 2XM9A 2QKWB 4GT5A 4RJ3A 2B1PA 2VTJA 1MRYA 5J5TA 1KE9A 4TKSA 3NNVA 1T45A 2ZV2A 1GY3A 3Q5IA 5BVIA 4MKCA 1YJ5C 2XNGA 2E9PA 3FC2A 2R2PA 3MA6A 4OT5A 1KWPA 4O7NA 3ZZWA 1M52A 1YWRA 2AYPA 4JJRA 4MBJA 2UVZA 3E3PA 4QPSA 5EQEA 3BHTA 3ZO1A 1JSTA 4E3CA 5AA9A 1YW2A 1KE5A 4FT9A 4FT5A 2VZ6A 4A9RA 5CY3A 4TYGA 4FUYA 3KEXA 3R71A 3GU6A 3G15A 5DYJA 1U0RA 3A7JA 1K9AA 4HVSA 1XH5A 5FG8A 3V8PA 3KVWA 4FT3A 2GHLA 1KE7A 4X6QC 4WT6A 4DBNA 5AR5A 4XEYA 1K2PA 3P7AA 3WZDA 3OWKA 2OF4A 2XYNA 3U51A 4LUDA 3L8SA 2OF2A 3QALE 4C35A 3GQSA 3DKFA 4TNDA 4FNXA 4DTAA 3R83A 4GKHA 4FTOA 4BDBA 1URWA 2XBAA 4QYGA 5D12A 3PXYA 3VQHA 3UO4A 4DH5A 3KRXA 5T3QA 5KMNA 2C69A 3UNKA 3FM8A 1STCE 1Y6AA 1VJYA 3MN3A 3PXZA 1DEVA 2BILB 1ZLTA 2HXLA 3ZXTA 3Q32A 5C03A 4KIOA 2X0QA 2C5VA 5AUZA 5EKNA 4YZMA 3DAJA 3KIOC 2VU3A 3T3VA 2X7OA 4BI2A 3I5NA 5H3QA 4O4EA 2HZNA 4R5YA 4XOZA 3UOJA 5KZ0A 1W2FA 3MTLA 4H3QA 4G31A 3GOPA 2I1WA 3QTXA 5BYZA 4E93A 3ZMMA 3UP7A 3AG9A 4XG9A 4C36A 4QCJA 4HVDA 4JNWA 1QPDA 3QGWA 4XV2A 2XB7A 4DDGA 4O4BB 3CCNA 3FQSA 3LLTA 2YZLA 3UDBA 2XK3A 4DEBA 4ENYA 5M55A 5KMLA 3L9LA 4DCAA 2X7FA 3BYUA 2ONLC 2C3JA 3JY0A 1YKRA 4MNEA 3EYHA 5HE2A 4QQTA 2JQLA 4OLIA 3H0YA 1Y8YA 2DQ7X 5LMBA 2W1HA 5H2UA 3WZKA 3BQCA 3P0MA 3FKLA 5LOHA 4B9DA 3LJ0A 4F0GA 3HMMA 3ZSHA 1WLNA 2Z7SA 1WZYA 5E50A 5A3XA 3LMGA 1SNUA 4M84A 3TI1A 4O0XA 2VNWA 2ONLA 4H39A 2CJMA 2E9VA 3ATSA 3KU2A 3NAYA 5IA5A 3TZ8A 3TKIA 3BEGA 1UJXA 5FP5A 5IQHA 5JFVA 1OITA 1UNLA 4NTSA 4O7TA 4E4XA 1ZYSA 2EWAA 1YXUA 3NYVA 4G6NA 4U41A 3TV7A 4BCKA 4C3FA 4DEAA 2BRBA 2HW7A 4JS8A 4ZSJA 3QCQA 4BDFA 1U5RA 3MB7A 4FIJA 4NKSA 5I3OA 3ELSA 4FV3A 2XT9B 2GPHA 4XG8A 4D4SA 5JEOA 3NCGA 2R3JA 3ORZA 4KKEA 5HG8A 2WNTA 3HMIA 2WXVA 3POAA 2PVKA 3HL7A