3I71A

Ethanolamine utilization microcompartment shell subunit, eutk c-terminal domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
56
structure length
56
Chain Sequence
SADELLALLTSVRQGMTAGEVAAHFGWPLEKARNALEQLFSAGTLRKRSSRYRLKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Mechanisms of a Protein-Based Organelle in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
molecule keywords Ethanolamine utilization protein eutK
total genus 14
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16365 EutK_C Ethanolamine utilization protein EutK C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3i71A00
1JXSA 5L3GA 2A69F 1ZLKA 2WC2A 3P9KA 4AIJA 2ZFWA 3L2CA 4BXUA 2A6EF 2ESNA 5ICFA 1I1GA 1QPMA 1MD0A 1SD6A 1W7PB 1A04A 5TRDA 4JK1X 4G6DA 2XKPA 3SFZA 3WTZA 3S2WA 5FLXZ 2VE9A 4U0VA 3K2ZA 2D1VA 2F5DA 1FYMA 3F21A 3FZVA 4OMZA 4BH9A 2FMLA 1ZARA 3K69A 3LFKA 2EFOA 4LGWA 4EGYA 2H94A 4GO1A 4KMFA 3GWZA 1B9MA 4GYIA 2ZKZA 3P9CA 4A6DA 2VE8A 2GXGA 2HFHA 4RGUA 2QQ9A 3E5UA 5DUKA 2M8EA 3M8EA 2RNJA 3WTXC 4HV5A 4KIGA 4I7HA 1MZBA 2FU4A 3F23A 2IJLA 3EYYA 1ZG3A 3DQVC 1ZRFA 4N0BA 3BP8A 2A68F 1WRJA 2Y75A 5LEJA 2Z5UA 2GIVA 5D5VB 2JPCA 2JPBA 5TJJA 4Y13A 2PFBA 4OIOF 2R7FA 5HLGA 3WU0A 2IA1A 2L3DA 2GQQA 3K1PA 2DTRA 2PMUA 3ZMSA 3C1DA 3HUGA 5D5UB 1YLFA 1IF1A 4BAYA 5CYVA 2ZMEB 1G6NA 5HLIA 1H9TA 2DU9A 1J9IA 3E6MA 4FX0A 3N97A 1FC3A 2P5LC 5HLHA 1ZRCA 5CVRA 5D5WB 1G3TA 4RGRA 4LLGF 3DXJF 3E97A 1ZRDA 3HIFA 3F6OA 4WCGA 5F6FA 3KFWX 1MGTA 2A6HF 1YIOA 2W84A 4UNOA 1GXQA 3E6DA 2RDPA 4BQAA 2JRTA 2DFIA 2QENA 5DV5A 5H6RA 1ULYA 2KRFA 3RKWA 2AXLA 1USSA 1FBQA 2G7HA 2FQ3A 1KQ0A 5E1XA 4U7BA 1XMKA 2CSOA 1R00A 1KGSA 3JSOA 1BI2A 2STTA 4CICA 2EV0A 1I1SA 2DK8A 1XGNA 2DK5A 4DNCA 4R79A 4WXCA 3V7RA 1YYVA 1J75A 2DT5A 2QVOA 5L3EA 4HA8A 1T39A 3T8TA 3JTGA 4HF1A 4D0PA 2MLKA 3EUHA 3HRUA 1V3FA 3KP5A 4LLLA 3LAJA 1LEBA 3RYRA 1TTYA 3L09A 1Z6RA 3C3WA 1IW7F 5H6QA 3IKTA 2O6GE 1ZGJA 1W4MA 1OKRA 3LQRA 4M6XA 3I53A 1R1TA 3WG9A 1HKQA 4MNUA 2YU3A 1TQIA 2PBIA 4U0YA 5HVQC 2XAFA 4ZYGA 1IN5A 1OPCA 4MQ9F 1QBJA 4I0AA 1USTA 1Z05A 3REOA 1W5SA 2AS5F 3BJOA 3ZPLA 3BPXA 3TOBA 3TO9A 3WTSC 2OA4A 2MA3A 3TO6A 3W6KB 4K2EA 4NB5A 1R23A 1OYYA 4O3MA 2O0YA 5FLXK 3VEPA 2HKXA 2HQRA 2NNNA 1TLHB 1LNWA 4EJTA 2KJCA 3FM3A 2L4AA 1SD5A 4MEYF 3ECOA 3R60A 2PQ8A 4PGHA 2VT3A 2VN2A 4RB0A 4P96A 2VOPA 4IRGA 2VT2A 3NEUA 3SZTA 3IKVA 4KIBA 4A0ZA 4PCQA 3GW2A 2XVCA 3KEOA 1HSJA 3CDHA 1DUXC 2PLYA 1YG2A 2P5KA 4HDUA 2XASA 2KIUA 5HDKA 1ZLJA 3DV8A 5H20A 1RZ4A 1FLIA 3GFLA 4U88A 1V4RA 3H3ZA 3WE3A 3ZQ7A 3R4KA 3F3XA 3TGNA 2XUBA 3QAHA 3COAC 2NYXA 2ZO4A 3E3VA 2CYYA 3KZYA 3K1MA 3QOPA 2MBFA 1ZREA 1ZH5A 3U9GA 5ILUA 1J59A 5HS9A 2VXZA 1PDNC 3TDZC 4KNYA 3ECHA 1XCVA 3ELKA 4MHGA 4G6QA 1LQ1A 3HRTA 3L00A 2ZCWA 4ZZDA 1FBSA 3GFMA 4UUVA 4OIQF 2GA1A 3R6SA 3FF5A 1H0MA 2IRFG 4QWQA 2CG4A 3CJNA 5E1WA 5BMZA 4EJWA 4UVCA 3LAPA 1IXCA 3SQNA 5L3CA 2EB7A 1OMIA 3LWFA 3WGIA 2DBBA 2Q2EA 3F22A 2Z99A 1ZG5A 2DLLA 4FHTA 1TBXA 1SFEA 5LGTA 2FBKA 4EM1A 3BJ6A 4HZFA 3ZMTA 2O61A 1IRFA 4Y17A 4ZZLA 2G7UA 2M87A 1ONVA 1QQIA 3VODA 2E1NA 1S7OA 2GA2A 4Q4ZF 2OU2A 4YFXF 3HTUA 2XRNA 2E7XA 3FX3A 3T0YA 2HDCA 3F8NA 1WSUA 1J7KA 1SD7A 5HS8A 3J81K 1G4DA 2IP2A 3V8KA 2PN6A 1R7JA 2OQGA 3JAMZ 2P8TA 3IRRA 2DI3A 2RGVA 4YFNF 3RJPA 1HKTA 3Q5FA 1P4XA 1ON2A 2LF7A 1KYWA 1ZG1A 5LRSA 3PQKA 3G3ZA 4CHUA 2LF8A 3Q9SA 2HGCA 3GYHX 3QPHA 1C0WA 4L5IA 2GWRA 4DQ2A 1QGPA 1J2XA 2D2WA 4R8HA 3E5XA 4JQFA 1B9NA 1JE8A 2P5VA 2KJBA 2R7DA 4Q48A 3T1BA 3RYPA 2HWVA 4HQEA 4IF4A 5FFZA 3DKWA 2M5WA 3RPUA 4MEXF 1BI1A 2VODA 1B59A 1FZPB 1D8JA 4S05A 4A5MA 3I59B 4ENNA 4KICA 3I54A 3FMRA 1LB2A 5ERIA 4XLNF 2HYGD 2W24A 2QQAA 4HV6A 2QYOA 4RS8A 4O5VA 2K7LA 4Q47A 3MZHA 3HRMA 4IRIA 5AIQA 3RKYA 3FXUA 4P9FA 1XSVA 1O3QA 4IRHA 3KLNA 3K0LA 2YR2A 5D8LB 2RC4A 3WTYC 4MTEA 3QU3A 3MFKA 1JHFA 4M9ZA 1HW1A 4KDPA 4ZH4F 4A12A 1KU2A 3B73A 3MEXA 2ZNZA 2VBZA 5A2QK 2RVCA 1KU9A 1LEAA 3GFIA 3WTVC 5BOXA 2OD5A 3E6BA 4UVBA 5D6EA 2CW0F 1S29A 1B4AA 1CF7B 1XDUA 5D5XB 4LB6B 4I98B 3HRSA 1UFMA 1IXSB 3MZYA 3QPTA 4KUMA 1YO5C 2HYFA 5J8CA 2PJPA 3TQNA 3CUOA 2QWWA 1E2XA 5L3DA 3TO7A 2J5PA 1T0FA 4OIRF 4GXOA 5D4SA 1L0OC 3WODF 4YFKF 2IW5A 4IJAA 2V1XA 1FY7A 3I58A 1XGMA 1FBUA 2KIMA 1DPRA 2LSOA 2MH9A 4M9SA 4A6EA 3B02A 1XD7A 5JHUA 4L5JA 3I71A 1U5TC 3I0TA 1IRGA 2WV0A 1BN5A 4L9TA 1KU7A 2UXNA 1BC8C 2OBPA 1XMAA 1BBYA 5LRRA 5AIPA 3J81Z 3KEQA 3W6JB 4OOIA 3ISPA 1B1BA 3KP7A 2H6CA 3V7SA 1R36A 3R61A 5FD5A 2J5OA 1P6RA 3QP6A 4TV7A 1FWZA 1B6AA 3WGHA 1D5VA 2EFWA 1S8NA 1F1ZA 3O2PE 2YSRA 4Q5SF 1O3TA 1KYZA 4A0XA 3FM5A 3FMQA 4RB1A 1R1UA 5D6FA 3WGGA 1BIBA 3U2RA 2F5CA 1FPQA 1P4WA 1O57A 1CGPA 1PP8F 3J80K 3L9FA 3F8CA 4EVIA 3HOTA 3J80Z 1G3SA 2BYVE 3J7AO 1IN8A 5DCMB 2KIFA 1BOAA 3EYIA 4GYGA 5CVUA 1R1VA 2F5EA 1XB4A 1QZZA 1WI9A 5ILVA 2XAJA 4FT8A 3MWMA 1TNTA 3TOAA 3M9AA 4RAZA 2L54A 3ULQB 1LVAA 4L9NA 1QO0D 1Z6TA 2YX4A 3IC7A 2NRAC 3ZMDA 4KFCA 3FXRA 4I01A 3IL2A 3M8FA 1HXDA 4LB5A 1K79A 3EDPA 3KLOA 3OV8A 1WKMA 1XSDA 5K1YA 5AONA 1EV7A 1OYWA 3GLXA 3LA2A 1YW8A 4KIFA 2LDUA 2XV4S 3IRQA 3RDIA 4WXHA 3SZPA 5J8FA 1R58A 2Z3YA 2KKOA 2A07F 4IVNA 2P6TA 2RKHA 5JFRA 5HS7A 3BDDA 3DFGA 1LDJA 5IT9Z 1FSEA 1LJ9A 2E7WA 4LJZF 4S04A 3WTUC 5LBQA 5L3BA 1SFUA 4XLPF 5JR3A 3O3KA 5K5OA 4FX4A 4Z2YA 4YIIA 1K78B 2FNPA 2DAOA 3F6VA 3GO5A 2HR3A 3BROA 1ZGAA 5BPIA 4ESJA 5HDGA 4ESBA 2UWMA 4R1HA 1HW5A 1T98A 2ETHA 5A2QZ 2DO7A 3HYIA 1GHCA 1RUNA 2MH2A 4HLYA 3CO7C 3GX4X 3V4GA 1EH6A 5K5QA 5CVVA 4HYEA 1DP7P 1FX7A 4IHTA 3I5UA 3IHUA 1Z9CA 1L3LA 2O03A 1G3YA 1J0RA 2COMA 1GVJA 3IWZA 3HSFA 3GFJA 4ESFA 4PZJA 1O3SA 3DPLC 2Z9OA 3RKXA 3CUQA 4AIKA 1H9GA 1I5ZA 2GXBA 3VB2A 1QNTA 4A2UA 2EFPA 4LD5A 5ICCA 2ACJA 1R22A 1Z91A 4G94A 4KYWA 2LNBA 5HOOA 2RQPA 4ON0A 5DCFA 4JBAA 4CXFA 4G8XA 2STWA 1P2FA 2PMHA 3NRVA 2P4WA 1IN7A 1UHMA 1MJAA 5ICGA 4CDGA 1U5TA 5E17F 2VC1A 1QZYA 1P92A 3DPTA 1ZHFA 1RIOH 2XROA 4IPAA 5LHIA 4M74A 4ZYDA 4P55A 3ZMZA 2CWEA 4WWCA 2LKPA 2CFXA 4YG2F 2HOEA 3KETA 2RN7A 2O3FA 4HF0A 4RB2C 4P5OA 2ADUA 2EFNA 3LA3A 1UB9A 4EM2A 4EV0A 2PI0A 4WF2A 1SFXA 4KMUX 2NS0A 1TW3A 2IVMA 1FYLA 5FFXA 1HW2A 4KA4A 4OU0A 3KP2A 2K4JA 1EH7A 3ABTA 2QLZA 4ETSA 3SHFA 2HQNA 1PUEE 3BZ6A 2WWYA 2ZJ2A 3DP7A 4OIPF 1S7AA 3F8MA 4G9YA 1BJAA 2DPDA 4KN4X 2K27A 3HHHA 1HSTA 4CYDA 4NHJA 3IWFA 2W57A 1YTYA 3HOSA 1MDMA 4WK8F 2RV8A 4HLXA 1S6LA 4M6YA 4AIHA 3LSTA 3FMSA 2V1UA 3MCZA 4WXDA 1X3UA 3V8LA 5CVJA 2V9VA 1FYKA 5IT9K 5EEHA 5LHGA 3AAFA 2P7VB 3P7NA 1O7LA 5J6XA 2ISYA 1O3RA 2VOOA 4LG0B 3K9TA 4I0BA 4F7ZA 4UHTA 4NQWA 2K4BA 1ZYRF 2GAUA 2BEOA 1IXRC 2Q8KA 1BC7C 3ZMVA 4UVAA 2M30A 2K02A 2YPRA 1U5TB 5FO5A 2XGXA 3ZP5A 3QRFF 5E18F 4ASNA 1ON1A 1SD4A 2XAHA 1IN6A 1D8KA 2R3SA 5ED4A 3M7GA 1NHAA 3F8FA 1IAWA 1O7FA 2FE3A 1STZA 4I02A 5K5RA 3GEZA 1W5TA 4KT5C 2IA2A 2D1HA 1TQMA 2X4HA 5L3FA 4UXNA 4O6JA 5ILSA 5CLSA 4CZZA 2K86A 3HHGA 4L9VA 4HOBA 1K6OA 1U6GA 2V6CA 2UZKA 3ABUA 2PEXA 3C7JA 2IA0A 4ENMA 1REPC 5LGNA 4N9HA 1XN7A 1RUOA 4U7DA 4ENJA 3RIRA 4G7HF 3TKYA 3ROUA 2W85A 3LA7A 1U8RA 4P9UA 5LLQA 3QU6A 4MTDA 2A3SA 2WTEA 1FT9A 2H09A 2YX7A 4RGXA 4RB3C 5E8IA 4M71A 5CVIA 1W7PD 2FNAA 2H27A 1XDSA 3HSEA 2DQLA 1BI0A 4B09A 5EEGA 3GZ6A 2JSCA 4L0ZB 1LDDA 3H3UA 1K7AA 1S3JA 2ISZA 4I09A 2M45A 2OZUA 3R0AA 3BY6A 2OZ6A 3BPVA 4OMYA 4M9XA 1JGSA 2EA4A 2EFQA 2EV6A 2P6SA 4L0YB 4B8XA 1TW2A 3D0SA 5CJ9A 3JSPA 3E6CC 2Q0OA 2ESHA 4UV8A 1UHWA 1XCBA 2QZ8A 3F8BA 5E8GA 4MQVA 5DDGA 3PFIA 1HQCA 2FXAA 1YW9A 1R5HA 3GVAA 2FBHA 3VFZA 3JTHA 2HTJA 1YS7A 1JHHA 5JI6A 3LQQA 3Q9VA 4GCVA 4HX7A 1GXPA 2BE5F 2VBXA 4HW0A 1DPUA 5DD8A 5D4RA 3ZMUA 1PP7U 4BNCA 1MJBA 3KP4A 3U1DA 4ZYHA 1KQ8A 3CUQC 2L01A 4LLNA 2FBIA 4A0YA 1YS6A 3KP3A 2XHKA 3N4MA 1RI7A 2DPUA 1VTNC 1XGOA 4ENKA 4EMSA 3OOPA 2CGPA 2OQRA 2L02A 2V79A 3FXQA 1BIAA 2JZYA 2XAGA 2QUFA 3KP6A 4HAMA 5BPDA 1MJ9A 1TNSA 2QQBA 5D8KB 5E1ZB 3JAMK 2DW4A 2EK5A 2ZBKA 1ZN2A 4U0WA 3GZ5A 5JVTA 4EJUA 2DQRA 1AWCA 2V1DA 4QLCU 2QM3A 1FOKA 2A61A 3JW4A 1WQ2A 6PAXA 3HSRA 3I59A 1K78A 4IXAA 5DD4A 1P4AA 1I6XA 4HX4A 4YIFA 3PQJA 2W25A 2P7CB 3V7CA 1F4KA 2HZTA 4HX8A 4UV9A 2G9WA 3VOEA 5F1RA 4XSZF 1U78A 3P9IA 1YQAA 5LEKA 4I2OA 1ODDA 2HTSA 4IHSA 4E70A 2TDXA 5DUIA 3DF8A 3V8JA 1E17A 3RI4A 5DYMA 3GUDA 3EETA 2FA5A 2NAZA 4LG0A 2FMYA 3ERED 4AWXB 3GF2A 2Y0MA 5F64A 2FEZA 2VC0A 4G7OF 4EQQA 1FP1D 5KK1A 5ICEA 4LFUA 1MDMB 1Z1DA 1SMTA 3D5LA 4LMYA 3M1EA 2XIGA 2ELHA 1F9NA 5HDNA 3MQ0A 2H6BA 1UCRA 1SAXA 1D3YA 1FNNA 1BI3A 4AVPA 2ZNYA 4RAYA 2UXXA 3F72A 2Y48A 1IN4A 2F2EA 5LGUA 3CO6C 3WE2A 3EQLF 4KN7X 2PG4A 3CTAA 1FP2A 2VBWA 3L7WA 2EWNA 2Z33A 1YFHA 1U2WA 2MC3A 2F5FA 3ZN0A 3I4PA 5FD6A 3H92A 1Y0UA 4EM0B 2HEOA 5DCMA 4MGRA 4PGGA 1OYIA 2CQKA 4HBLA 1IUYA 2FOKA 1G3WA 2BBYA 3BOQA 1ZAOA 3HTSB 4L9JA 4BHPA 1J5YA 4GGGA 4HF2A 3WU1B 2BV6A 1Z7UA 2EV5A 4BHBA 4OINF 4Y15A 4M72A 5BS6A 4EGZA 3TDUC 2VONA 1DDNA 4RGSA 1Q1HA 3SXYA 5KVRA 2IT0A 1XSXA 1CF7A 1LDKB 1TQPA 3MAJA 3BJAA 4XRFA 2D45A 2FF4A 5FGMA 4LK1F 1AOYA 1I27A 2M1BA 3WTWC 2C6YA 1HKSA 3WTTC 3CUQB 1R5GA 3T8RA 1W7PA 3R0JA 1T2KA 2A5YB 3C18A 4XBFA 2XKOA 4PDKA 4A5NA 2MLGA 4G7ZF 2NNYA 5E20A 1KQ9A 4N9IA 5IT3A 4M73A 3G73A 1T6SA 3O6BB 5BQTA 4CO8A 1YW7A 4EJOA 3ZN1A 4ZYEA 1XGSA 1SMYF 1FSHA 2FSWA 2HKOA 3KZZA 2JT1A 1EH8A 2VBYA 4EJVA 4WX9A 4L18B 3ML6A 2OAZA 2JTVA 3KCCA 1RNLA 2ZXJA 3BWGA 3FWEA 2GZWA 2EJRA 2FRHA 4CGZA 3K1NA 3QP5A 3I64A 3RTRA 1KA8A 1T38A 1KU3A 4XSXF 4AD9A 3CLOA 3RPQA 5DEQA 1F5TA 2IPQX 4BYYA 1HBXG 4HQMA 2E1CA 2X0LA 3T5XA 3E5QA 5LHHA 4LK0F 1IZ1A 2QBYA 2L4MA 4H0EA 1WWXA 2ZMEA 3DEUA 4BHCA 2O8XA 3NQOA 2HS5A 1MKMA 2CO5A 2EA2A 3FHZA 1BM9A 4HDVA 2BGCA 2QBYB 3KE2A 2XAQA 2MD5A 2B0LA 5FB2A 3GXOA 1OR7A 1U3EM
chains in the Genus database with same CATH superfamily
2AHQA 2F4OB 2V9PA 3BCAA 1JXSA 5L3GA 5C44J 3CMEI 2A69F 2CJJA 1ZLKA 1FIAA 2WC2A 3P9KA 1JUSA 4AIJA 2ZFWA 2KQRA 2EBIA 3G1LA 3L2CA 4BXUA 2Q1ZB 1P7IA 4ANJA 1Y1WJ 2HOAA 2A6EF 2ESNA 2LLKA 2E60A 3G2BA 5ICFA 1I1GA 1QPMA 2VKVA 4E7JA 1MD0A 1ZTRA 2X1DA 2R7TA 1SD6A 1W7PB 4E7IA 1A04A 5TRDA 1YJNI 4B3XA 4JK1X 5EDNA 4G6DA 4BQNA 1VQ9I 1TT5B 2MG4A 2R7UA 1XMXA 2XKPA 3SFZA 3WTZA 1LFPA 1D1CA 5DM7F 2JVGA 4B4CA 5M5XJ 3S2WA 5FLXZ 2VE9A 4U0VA 1RC9A 3K2ZA 4C2MJ 2D1VA 3MKWB 2F5DA 1FYMA 2BXZA 1D0ZA 3F21A 3FZVA 1W36D 2DDBA 3VYUB 1OCTC 4OMZA 4BH9A 2FMLA 1QVUA 1ZARA 3K69A 3LFKA 2EFOA 4LGWA 4EGYA 3DBHB 2H94A 4GO1A 5J4YA 4KMFA 2HNHA 3GWZA 1B9MA 4V2FA 2DYRH 4GYIA 3K4CA 1A31A 1AKHA 2OTLI 2V7FA 3LOCA 1HF0A 2DJNA 2ZKZA 3P9CA 1JKRC 4GDFA 1QHHD 4CA0A 4BJ6C 4A6DA 1MMGA 2VE8A 3M1CA 1LPQA 2GXGA 2HFHA 4RGUA 1U9NA 2QQ9A 3H36A 3E5UA 3VSKA 5DUKA 2M8EA 5LFAA 3M8EA 1QPIA 4RBOA 2RNJA 1DQUA 3WTXC 4HV5A 1VFCA 2DOAA 4KIGA 3FXOA 2KL4A 1MSEC 4I7HA 1MZBA 2FU4A 3CMYA 1ERDA 2E36A 3F23A 2IJLA 3EYYA 1K61A 1ZG3A 2K9LA 3DQVC 1ZRFA 2VKDA 1J09A 5EEAA 1W0TA 4N0BA 5B1AH 3OIOA 3NWTA 3LSPA 3BP8A 2DCEA 2A68F 2RQQA 4XRSA 1WRJA 2Y75A 5LEJA 2L7FP 2Z5UA 2QKLB 2GIVA 5D5VB 2JPCA 2M34A 1IV8A 2JPBA 2KRCA 5TJJA 4Y13A 2PFBA 4OIOF 3GTOJ 5EYRA 2R7FA 5HLGA 2OCEA 3WU0A 5J1RA 2IA1A 2WY8Q 3AKZA 3LNQA 2VPLA 2L3DA 2GQQA 1BW6A 1PVEA 3K1PA 2VQLA 2BZTA 2DTRA 1TWAJ 2PMUA 3ZMSA 3C1DA 1Y0NA 5JHFA 5GP9A 3HUGA 5D5UB 3VDXA 4NDLA 3CC2I 1YLFA 1T56A 1IF1A 4BAYA 5CYVA 2ZMEB 1G6NA 5HLIA 1H9TA 2DU9A 3BR6A 2VIXA 1J9IA 3E6MA 3IAM2 4FX0A 3N97A 1FC3A 2P5LC 5HLHA 1ZRCA 5CVRA 2BY1A 3BZCA 3K10A 5D5WB 1G3TA 4RGRA 4LLGF 3I4NJ 1YITI 3HOWJ 3RZDJ 4C2TA 3DXJF 2WAQA 3E97A 3FKIJ 3OYAA 1ZRDA 3CD6I 3HIFA 3F6OA 2RAEA 3KZIC 4WCGA 3FBIB 2DA3A 5F6FA 3N05A 3KFWX 1MGTA 2A6HF 2VL8A 1YIOA 2W84A 4A3FJ 4UNOA 3S1RJ 1GXQA 3E6DA 3FXJA 4JOMA 3IH4A 2R7OA 3LSJA 2RDPA 3OYLA 5B5EC 1E3PA 4BQAA 5IYDJ 2JRTA 2M7BA 2DFIA 3G6EI 4AU7A 2QENA 5DV5A 4ZDPA 5IYCJ 2M3AA 1WJCA 5H6RA 3SEQA 1ULYA 2KRFA 2IS6A 3RKWA 5IP9J 2AXLA 2HVRA 1USSA 1FBQA 2G7HA 1A5JA 2FQ3A 2ZXWH 3OY9A 3HPHA 1MSFC 1KQ0A 4I76A 1R6RA 5E1XA 4U7BA 1XMKA 2CSOA 2BHZA 1WPKA 2HU9A 1R00A 4XLEA 3OR2C 3HGYA 1YOVB 3BR1A 2GBYA 3E1SA 1FTZA 1KGSA 4E7LA 3S16J 3JSOA 1JTYA 4XICA 1IC8A 1BI2A 2STTA 4CICA 1SEUA 2EV0A 1I1SA 2GLOA 1ZKGA 4XKBA 3W3CA 2DK8A 2GXAA 1XGNA 2NVXJ 2JUGA 2DK5A 4DNCA 4R79A 5E3OA 4WXCA 2CMPA 2HI3A 3V7RA 1YYVA 1J75A 2DT5A 2QVOA 4NC8A 5L3EA 3GBGA 4ABZA 4HA8A 1T39A 3T8TA 2CH0A 1S7EA 2BXYA 3JTGA 4HF1A 4XOTA 4D0PA 3CCEI 2MLKA 5GTHC 3EUHA 3HRUA 1V3FA 3KP5A 4LLLA 3OYIA 3LAJA 1LEBA 3RYRA 1TTYA 3L09A 1Z6RA 2HOSA 3DKYA 2E35A 3C3WA 1IW7F 5H6QA 3IKTA 2O6GE 1YJWI 4XIDA 3WHBA 3CDLA 2IS4A 3TP3A 1ZGJA 1W4MA 2PMZA 2JA7J 1ORKA 4V2GA 1OKRA 4IO9F 3LQRA 4M6XA 5KNLA 3OS1A 3PUFA 3I53A 3PM1A 1R1TA 3VSLA 3WG9A 3DWLE 4EATA 1Z7LA 2MYSA 4DYQA 1HKQA 4MNUA 3M3YJ 2Q2EB 2YU3A 1TQIA 2ZJQF 2PBIA 4U0YA 2ICWG 1X19A 5HVQC 3OYNA 2XAFA 1JGGA 4BUPA 3PFYA 4ZYGA 5DTDA 4M3GA 1ZELA 1IN5A 1OPCA 1OCCH 3FISA 4PK4A 4MQ9F 2DT6A 2A5WA 1R9TJ 4PSXA 1QBJA 4I0AA 1USTA 1Z05A 3REOA 2MSYA 3F9KA 1W5SA 1K6YA 3HL2A 2AS5F 3BJOA 3ZPLA 4AM3A 2KPMA 3BPXA 3KIOA 1RKWA 3TOBA 3TO9A 3WTSC 3BZKA 1APLC 3TW7A 2M4GA 2OA4A 1DP3A 2MA3A 3ERMA 3TO6A 1PYVA 3W6KB 4K2EA 4NB5A 2L0KA 1WH7A 2E19A 1R23A 2CW8A 1OYYA 3CJRB 2LTPA 4O3MA 2O0YA 3CESA 5FLXK 2XF6A 3VEPA 4F92B 2HKXA 2HQRA 3OIQA 2JRMA 2NNNA 1TLHB 1LNWA 2VPRA 4EJTA 1D0XA 3WU2C 4PJMA 1N25A 3ABLH 3LSRA 2KJCA 3VWBA 4BDZA 1V55H 3FM3A 2B9SA 3GTJJ 2L4AA 1SD5A 2K9MA 2Y30A 3Q0VA 4MEYF 3ECOA 3R60A 4XK4A 1ZGWA 2PQ8A 4PGHA 2VT3A 2VN2A 4RB0A 4P96A 3L2VA 5TISC 2VOPA 4PJNA 4IRGA 3BTJA 1P9QC 2DA2A 2VT2A 4BGDA 3NEUA 1Y1VJ 3OYCA 3SZTA 3IKVA 4KIBA 3SJMA 4A0ZA 4PCQA 1ETXA 3GW2A 2XVCA 3KEOA 3ZOBA 1HSJA 3ZQQA 4NC7A 3CDHA 1I3AA 3A4CA 1DUXC 2PLYA 2CUJA 1YG2A 3BG7A 1X3ZB 2A05A 4C9YA 5FKKA 2P5KA 4XN0A 4HDUA 2XASA 2KIUA 5HDKA 2HXIA 1OCRH 1ZLJA 2W1OA 2Y9YA 3DV8A 5H20A 2VLAA 1RZ4A 1FLIA 3TW6A 1OCPA 3GFLA 4U88A 1V4RA 3PUBA 2L2OA 3H3ZA 3OYMA 3Q3SA 3OYDA 3ABKH 3WE3A 3ZQ7A 3R4KA 2ID3A 3F3XA 3TGNA 2XUBA 3QAHA 2NYXA 2ZO4A 3E3VA 3COAC 2CYYA 3KZYA 3QYFA 3K1MA 3QOPA 3GTMJ 1WJBA 2EIJH 4Z6YA 2MBFA 5IP6A 1ZREA 9ANTA 3LSIA 1ZH5A 3U9GA 4E7KA 1VZ0A 2LYCA 2X1EA 5ILUA 1J59A 3VYTB 5HS9A 2FJ1A 2VXZA 2QSGX 4XQFA 3S8PA 1XTAA 2VXDA 1A35A 4N4NB 1PDNC 3TDZC 5F0CA 4KNYA 2YU9J 4BQOA 3GMEA 3MKLA 3ECHA 1XCVA 4IQ4A 3ELKA 5FKNA 3NWSA 2L9VA 4MHGA 4G6QA 1QRYA 1LQ1A 3FK6A 1M1EB 3HRTA 1WH5A 4CZCA 4V19K 3L00A 2JA6J 3PSIA 1U8BA 1R49A 2ZCWA 2GIZA 1RESA 4ZZDA 1FBSA 3GFMA 2EILH 4RM3A 5DM6F 3J7ZI 3CMAI 2XSDC 2VB6A 4UUVA 4OIQF 2GA1A 3R6SA 4HNTA 3BQYA 1V5GA 3HG9A 3FF5A 2VUMJ 2GOXB 2P0WA 1H0MA 3BTIA 2IRFG 3FXMA 3S14J 4QWQA 4XKCA 4PFOA 2CG4A 3CJNA 5E1WA 1VNDA 4MO7A 4DBQA 5BMZA 1B72A 2Y69H 4EJWA 4CCLA 3HUGB 4UVCA 1IXCA 3LAPA 5C4XJ 2OCCH 3SQNA 1MNDA 3QQAA 1BR2A 5L3CA 2DYSH 2EB7A 1H89C 1OMIA 1JKPC 5FLMJ 1GUUA 3LWFA 4HSTA 3WGIA 2DBBA 2Q2EA 3F22A 3JRFA 2Z99A 1ZG5A 2DLLA 4FHTA 3CC4I 1TBXA 1SFEA 5LGTA 2FBKA 2DA7A 3KEYA 3OYHA 1JT0A 4EM1A 3I3LA 4XORA 2DMNA 1E3HA 3BJ6A 4HZFA 1PUFB 3ZMTA 4D9JA 2O61A 1IRFA 1YJ9I 4Y17A 4ZZLA 5FRMA 5EGOA 2G7UA 3G71I 3GLLA 2M87A 3U21A 2E1MC 1ONVA 1QQIA 4Y52J 3AFHA 2L9NA 3VODA 2E1NA 3ZXSA 1S7OA 3O8HA 1B8IB 2R7RA 2GA2A 2JA2A 3M07A 3QPSA 3GTKJ 4Q4ZF 2OU2A 4YFXF 5KAIC 4DOZA 2OC6A 3HTUA 4YELA 2ECBA 2XRNA 2E7XA 3FX3A 3T0YA 2HDCA 3UNGC 4RAFA 3CP2A 3CCUI 3F8NA 1X1DA 1WSUA 1J7KA 2Z1DA 3H5AA 2UV1A 1SD7A 2CV1A 3ZQCA 1AHDP 5HS8A 5M5WJ 4LIUA 3J81K 1G4DA 3CJTB 2IP2A 3V8KA 3GTQJ 1Z0XA 2PN6A 2LKXA 1R7JA 2JMWA 2OQGA 3JAMZ 2L9SA 4Y3OA 2E1MB 2P8TA 3IRRA 2DI3A 2RGVA 2HQ5A 1GDTA 5FJ8J 4YFNF 3RJPA 3VYSB 1HKTA 1D1BA 3Q5FA 1P4XA 3O8GA 1IRXA 1ON2A 2LF7A 1KYWA 1ITYA 5K7ZA 1ZG1A 3AL0B 5LRSA 3PQKA 4D7MA 3FDYA 3G3ZA 4CHUA 3PNTA 2LF8A 4BXXJ 3Q9SA 1NG7A 4A3MJ 2HGCA 2WB1A 3BT9A 3GYHX 3OYFA 3QPHA 1C0WA 4L5IA 2GWRA 2ZSIB 2LREA 4DQ2A 1QGPA 3AG2H 1J2XA 2IAIA 4JP0A 2WY7Q 2VJIA 1UAAA 2D2WA 4R8HA 5KCMA 3E5XA 3I9V2 4JQFA 1B9NA 1JE8A 2P5VA 2KJBA 2R7DA 4Q48A 1ZK8A 3T1BA 3RYPA 2HWVA 4HQEA 1TP4A 4IF4A 3VPRA 4HNVA 2M7AA 5FFZA 3DKWA 2M5WA 3UKGA 4A3KJ 3RPUA 2VKEA 4FISA 2MABA 2EZLA 5HODA 1N77A 4MEXF 2E2JJ 2JJ7A 1E0EA 3HGGA 2EQRA 1BI1A 1MNMC 1B59A 2VODA 1FZPB 4XRSG 4XLNF 1LVKA 1VQ8I 1D8JA 4B47A 4S05A 3ZRGA 3M8JA 4A5MA 3I59B 4ENNA 4ZDOA 4KICA 3I54A 2WB1N 3FMRA 2VQGA 1WJ5A 5ERIA 4RMNA 1LB2A 3HKZA 2W24A 2HYGD 2P81A 2QQAA 4HV6A 1UJ8A 1X3WB 2QYOA 4O5VA 4RS8A 2R5ZA 2XPVA 2K7LA 1O4XA 3CCLI 4Q47A 3MZHA 3HRMA 2DN0A 3CCSI 4IRIA 5AIQA 4A3DJ 3RKYA 4OWRB 3FXUA 3RQIA 1SFOJ 3BG3A 4P9FA 1YHQI 1XSVA 4X1EA 1O3QA 4IRHA 2R7XA 3KLNA 1D0YA 3K0LA 1B72B 5IP7J 1IRZA 3GTPJ 3HEFA 2M9HA 1Y6IA 2YR2A 5D8LB 2RC4A 3WTYC 4MTEA 3DTKA 3QU3A 3MFKA 1JHFA 1HA8A 1XC5A 4M9ZA 1BOBA 1HW1A 2E34A 4ZH4F 4KDPA 1PJRA 3AL0C 4B1RA 4A12A 5E3LA 2DA4A 4XONA 1KU2A 3B73A 3MEXA 4F52A 5GPAA 2DFFA 1JUMA 3OMYA 2IS1A 3I4MJ 2ZNZA 2VBZA 5A2QK 2R7SA 2RVCA 1KU9A 1LEAA 1X4OA 3GFIA 2I8DA 1VQ4I 4U87A 4BBRJ 3WTVC 5FKMA 2KDZA 1BW5A 2X85A 5BOXA 2OD5A 3E6BA 4UVBA 5C4JJ 1Q1VA 3S3NA 5D6EA 1UG2A 3OYEA 2DJIA 2JWTA 3IAS2 2CW0F 3NARA 1S29A 1B4AA 1CF7B 1XDUA 2JA5J 3CMMA 3JREA 5D5XB 4LB6B 3ZCOA 4HNUA 5E3MA 4I98B 3S3MA 2R92J 3HRSA 4B44A 4Y7NJ 4FCYA 4GFBA 5M5YJ 1UFMA 1IXSB 2ELKA 2VQHA 1RPWA 3MZYA 3QPTA 4KUMA 4M6VA 5B1BH 1YO5C 2HYFA 3K70C 5J8CA 2PJPA 4IQJA 3TQNA 3UR3C 3CDIA 3CUOA 2QWWA 1E2XA 2W00A 5L3DA 2J5PA 3TO7A 1ETYA 1T0FA 4OIRF 3L2WA 4GXOA 3EUKL 2E2IJ 5D4SA 1L0OC 1X1AA 3WODF 2ELJA 4YFKF 2IW5A 2WBMA 2F4MB 4IJAA 3CCYA 1A6IA 1MH3A 2V1XA 3CF5F 1FY7A 1FMWA 2WV1A 1F43A 4IEJA 3I58A 1EKEA 1XGMA 1IJWC 4DGWB 1FBUA 4X0GA 2KIMA 2JUCA 4FE4A 3G4SI 1DPRA 2LSOA 2MH9A 4M9SA 2MC4A 3BG9A 4A6EA 2DXIA 3B02A 4HPQA 1CQTA 1XD7A 5JHUA 1Y56A 4L5JA 3HOVJ 4Y33A 4BL0B 5M3MJ 1X4PA 3I71A 1U5TC 2PJRB 3I0TA 2H8WA 1IRGA 3PIOF 2XPWA 2WV0A 1BN5A 4M3BA 4L9TA 3E0JB 1KU7A 2UXNA 2ZXHA 1OCZH 1JJ6C 1I3QJ 1BC8C 2OBPA 1XMAA 1BBYA 3QYBA 5LRRA 4QIWN 2DMPA 5AIPA 3J81Z 3KEQA 1EA3A 3W6JB 4FE7A 4C3HJ 4OOIA 5F0FA 3ISPA 1B1BA 3KP7A 2H6CA 3PL8A 2M8GX 3V7SA 3X2QH 1H8AC 1R36A 1A36A 3QODA 3R61A 2H8RA 2FUG2 5FD5A 2J5OA 4PFPA 1P6RA 3QP6A 4TV7A 1TZLA 1FWZA 5FLVA 4XMYA 1B6AA 3WGHA 1D5VA 2EFWA 1S8NA 2E1OA 2MGQA 1F1ZA 4D7NA 3EPZA 2XF7A 3O2PE 3ZQFA 3CQZJ 2YSRA 4E7SA 2VJ4A 2ZB9A 4IX7A 1EF4A 2E71A 4Q5SF 1O3TA 1KYZA 4A0XA 3FM5A 2QGUA 2X51A 3FMQA 2R7QA 4RB1A 2MD0A 2EH3A 1R1UA 4F93B 5D6FA 3WGGA 1ETOA 1BIBA 4CCKA 3U2RA 2F5CA 2O9LA 1FPQA 1P4WA 1O57A 3IUOA 1CGPA 3TBIA 5F04A 2X9DA 1PP8F 3J80K 4F55A 3ONQA 5GAGJ 5KAFC 1IG7A 4IHYA 3MZ8A 3G1OA 3L9FA 2HDDA 3F8CA 4EVIA 1MBFA 3HOTA 2NOJB 3J80Z 1G3SA 2BYVE 1S72I 3J7AO 2KP6A 1WGXA 1IN8A 5DCMB 3DLLF 1RKTA 1UG0A 2W48A 1R71A 1JJ8C 2KIFA 1BOAA 2CU7A 3EYIA 4GYGA 5CVUA 1NTCA 1ETVA 3S15J 1YE9A 1R1VA 3PNVA 2F5EA 2JQ7A 1T8IA 3TL4X 1AKHB 1XB4A 3M4OJ 5CQGA 1QZZA 1WI9A 2M4KA 5ILVA 3C2HA 3DLAA 1FIPA 2XAJA 3HOXJ 1HLVA 4FT8A 3MWMA 1TNTA 3TOAA 4CCNA 3ZQGA 2ZJPF 3BQZA 4AIDA 3M9AA 3QWLA 3A0HC 4RAZA 2L54A 2LFBA 1JI8A 3ULQB 2DA5A 1LVAA 1AU7A 3KPHA 4L9NA 5F27A 1QO0D 1Z6TA 3C2BA 2YX4A 3IC7A 2QF7A 2NRAC 2I10A 2YS9A 3ZMDA 4RA2A 2H1KA 5C3EJ 2XC7A 4KFCA 2NXNB 2X6OA 3DKXA 3FXRA 4I01A 3IL2A 3S17J 3M8FA 2B7EA 3TEDA 3W2WA 4AUXA 1HXDA 4LB5A 1T33A 1K79A 4DIQA 3EDPA 1SC7A 2E2HJ 1K4TA 2LY2A 3KLOA 3OV8A 5EG0B 3MVPA 1WKMA 4A69C 1XSDA 5K1YA 2ZJRF 3MKZA 4XKVA 1BR4A 5AONA 1SVOA 4FETA 3QOEA 1EV7A 1I39A 1OYWA 3LMMA 4YRVA 1QVTA 5LD2C 4UUSB 3GLXA 3LA2A 4B48A 1YW8A 4KIFA 2LDUA 1RETA 4A3EJ 2XV4S 3IRQA 3RDIA 4WXHA 3SZPA 3WG7H 5J8FA 1BA5A 1R58A 2Z3YA 2KKOA 2K3FA 2A07F 4N4OB 3AG1H 4G6TB 4IVNA 4IKFA 2P6TA 1FEXA 3Q0WA 1X58A 2RKHA 1V5EA 5JFRA 1IO2A 2V4JC 2TRTA 3H0DA 1IGNA 5HS7A 4BXFA 3BDDA 3DFGA 1LDJA 3IP4B 4M3FA 4A3IJ 5M3FJ 3FIWA 5IT9Z 1FSEA 1LJ9A 2E7WA 4LJZF 5IYBJ 4S04A 3K6GA 3JRCA 3WTUC 2CV2A 5CPRB 3PIPF 4ZJZA 5LBQA 5L3BA 1SFUA 4XLPF 5JR3A 3LSGA 3HKZN 3O3KA 3P5JA 5K5OA 2W82A 4RLFA 3RPUD 4FX4A 2BVLA 4Z2YA 4YIIA 1K78B 3H35A 5F08A 2FNPA 2DAOA 2HOTA 2NS8A 3F6VA 1GV2A 3OS2A 3GO5A 1OCOH 3EUAA 2HR3A 1I50J 2L7ZA 1BJZA 3BROA 1WJFA 1ZGAA 2EZIA 5BPIA 4FQGA 1MMDA 3LFUA 5E3NA 4ESJA 5HDGA 5EG0A 4ESBA 2UWMA 4A93J 4R1HA 1HW5A 1T98A 2ZFUA 3CZ6A 1VQPI 1G2HA 4DZPA 4DZJA 2ETHA 1VQOI 5A2QZ 2DO7A 4BY1J 3BCBA 3HYIA 1GHCA 1RUNA 2MH2A 4HLYA 5JLWA 5F1JA 3CO7C 3GX4X 4HSRA 1IUFA 3V4GA 1XPXA 4UY8I 3FHNA 3RQ4A 3C2GA 1EH6A 5K5QA 4NBQA 5CVVA 3LSKA 2VJ5A 4HYEA 2ZXIA 1DP7P 3S1NJ 1FX7A 2FOWA 4IHTA 4UB6C 1U9OA 1MH4A 3I5UA 3IHUA 1Z9CA 1FMVA 4QTRA 1L3LA 2O03A 3B6AA 1W1WE 2BHYA 2KRHA 4RLQA 1G3YA 1J0RA 2COMA 3BG5A 1GVJA 3IWZA 2M0CA 3HSFA 3B6CA 3GFJA 3CP8A 3K2AA 4ESFA 2K9SA 3I55I 4PZJA 3KYLA 2WADA 1O3SA 4UUTA 3ABMH 2LRDA 2L9RA 2LC2A 3DPLC 2Z9OA 3RKXA 2NVTJ 3CUQA 4DYRA 4AIKA 1H9GA 1I5ZA 2GXBA 2CQNA 3H9GA 2G0EA 2VASA 1Z77A 3VB2A 2QQ8A 1QNTA 4A2UA 2L5QA 2EFPA 2BVMA 4LD5A 5ICCA 3S1QJ 2ACJA 1R22A 1Z91A 4G94A 5GAEJ 4KYWA 2LNBA 2DODA 5HOOA 2RQPA 5J3LA 3I56I 4ON0A 5DCFA 1V54H 4JBAA 2HVSA 4CXFA 4G8XA 1MBEA 5IPAA 2RREA 2HDWA 4CYCB 1OLTA 2STWA 2KIQA 2BW3B 1P2FA 2PMHA 3NRVA 2P4WA 3A01A 2F48A 2K3PA 1IN7A 2V9KA 3Q0UA 3HC7A 1UHMA 1MJAA 5ICGA 4CDGA 1U5TA 1S5LC 1MBGA 3PO3J 2VC1A 5E17F 1QZYA 2ZMEC 4NC6A 4C3JJ 1P92A 3DPTA 1ZHFA 3BC8A 3V42A 3S1MJ 1RIOH 2IBDA 2XROA 4IPAA 5LHIA 4M74A 4ZYDA 4P55A 4CCJA 3ZMZA 1QZEA 2CWEA 4WWCA 2LKPA 2A6TA 2CFXA 4YG2F 2HOEA 3KETA 2RN7A 3W6VA 2O3FA 2OTJI 1TWHJ 4HF0A 4J00A 3J7AY 4RB2C 1Z3XA 2KLOA 4P5OA 3CCMI 2HYJA 2ADUA 5EGOB 2EFNA 3LA3A 1VQ6I 4W1UA 4BBSJ 1UB9A 4MLOA 4EM2A 4EV0A 2Y9ZA 2PI0A 4WF2A 1SFXA 4KMUX 2NS0A 1TW3A 2IVMA 3SZGA 1WJAA 1FYLA 3H5RA 5FFXA 4D1QA 2O7OA 1HW2A 4KA4A 1RR8C 4OU0A 3K7AJ 3KP2A 4J01A 2R7ZJ 2K4JA 1EH7A 3ABTA 1YI2I 3NAUA 2QLZA 2XRLA 2XF5A 1GT0C 4H4KC 4ETSA 4DBRA 5JLXA 3SHFA 2HQNA 2Z2SB 1PUEE 1X1CA 2CQ7A 1Z3YA 3BZ6A 3DU6A 4QSHA 2OPTA 3MN2A 2PMZN 2WWYA 1JT6A 2ZJ2A 3HOZJ 3DP7A 3DBLB 4OIPF 1S7AA 3F8MA 4G9YA 1BJAA 2DFHA 2DPDA 4KN4X 2K27A 3CC7I 3HHHA 1HSTA 1Y8QB 2BOLA 4OAYA 2ME6A 3KYDB 5FKLA 4CYDA 4NHJA 3IWFA 2W57A 1YTYA 1R5ID 3HOSA 1MDMA 4WK8F 3L2QA 2RV8A 3JCUC 4HLXA 1S6LA 2I5UA 4DW6A 5J1YA 2K5CA 3ASNH 4M6YA 5FROA 3LSTA 3HPGA 4AIHA 3TMOA 2QEXI 1Y8RB 3FMSA 2LMDA 2V1UA 3H9QA 3MCZA 3J7YJ 4WXDA 2CS3A 1X3UA 1WFXA 5IOYA 1K4SA 3V8LA 5CVJA 2V9VA 3HBLA 2XB0X 1FYKA 3DU5A 4BE2A 4IHXA 2H1LA 2OUMA 5EEHA 1LKXA 5IT9K 2V1NA 5LHGA 4IL6C 3AAFA 2P7VB 3P7NA 1N78A 1O7LA 5J6XA 3HOYJ 2ISYA 1DU6A 2FD5A 1O3RA 1MBJA 2AQFA 1WJDA 2VOOA 4II2A 4LG0B 2X6XA 2DA1A 3K9TA 4I0BA 3OYGA 4EEFG 4F7ZA 1WZ2A 4OAZA 4UHTA 4NQWA 2O5RA 4PJ0C 3FKJA 2K4BA 1YX3A 1ZYRF 2KMUA 4IZZA 2GAUA 2BEOA 3IV5A 4BQQA 2AO9A 3D5SC 1IXRC 2QSHX 2Q8KA 1BC7C 3ZMVA 4UVAA 3GTLJ 2M30A 2K02A 2X6YA 4I99C 2YPRA 1U5TB 5FO5A 3JRHA 2XGXA 1WJEA 4MFDA 3ZP5A 4E7HA 3QRFF 5E18F 1AA7A 4ASNA 4X6AJ 1ON1A 1SD4A 2XAHA 1IN6A 2DOEA 1Z21A 3H1CA 4W97A 1D8KA 2ID6A 1EJ9A 4ZC3A 2R3SA 5ED4A 3M7GA 1NHAA 3F8FA 1O7FA 2FE3A 1IAWA 1STZA 2HQAA 5IY5H 1JTXA 2IGKA 5F0HA 1BL0A 4I02A 3D5RC 5HLTA 5K5RA 1LE8B 2L7KA 4XRMA 4JX5A 1X1BA 3GEZA 1W5TA 3S3OA 4KT5C 1TL8A 2IA2A 2D1HA 2WAQN 1TQMA 2X4HA 4BACA 1HDDC 5L3FA 1VQ5I 4UXNA 4O6JA 5E79C 5ILSA 5CLSA 1ZR2A 2VJJA 4CZZA 2K86A 3HHGA 4L9VA 4HOBA 3K4JA 1K6OA 1FOXA 2R5ZB 4B3AA 3DPUA 1XS9A 3OSFA 2JA8J 3SFIA 1HCRA 1U6GA 2V6CA 4PJJA 1WCMJ 2UZKA 4BDYA 2W4SA 3ABUA 2CRGA 1YRNB 2PEXA 3C7JA 4XR6A 2CUEA 2IA0A 1QHGA 1DGWY 2NVYJ 4ENMA 1REPC 2CFOA 2X1CA 5LGNA 4N9HA 4XLHA 1XN7A 1RUOA 4U7DA 3PJRA 4ENJA 3JRBA 3RIRA 4G7HF 3TKYA 4ZDLA 3W2AA 3S93A 3ROUA 1T08B 5K7FA 2W85A 4XL9A 3ZQIA 2OF7A 1S9HA 3LA7A 1TWCJ 2HPIA 1U8RA 2QCOA 2LY9A 1JUPA 4P9UA 3JRAA 2XGDA 3D1NI 2L7MP 5LLQA 3F0CA 3LSHA 2CQQA 2GOMA 3QU6A 1WI3A 4XKWA 5EZGA 4MTDA 2A3SA 2WTEA 1FT9A 2H09A 2XB5A 4D5CA 2YX7A 4RGXA 4RB3C 2R93J 4FASD 5E8IA 2QSFX 4KT6A 4M71A 2R4GA 4BEHB 5CVIA 1VQMI 4M3DA 1KZHA 3GCMA 1W7PD 2FNAA 2H27A 3MMYB 5J47A 2DTZA 1XDSA 2EZKA 3A0BC 1TC3C 3HSEA 2DQLA 3ZQLA 3W2VA 3H0GJ 3MKYB 1BI0A 4B09A 1G8XA 4Y4RA 5EEGA 2EIMH 3GZ6A 2JSCA 2BY2A 4LG3A 4L0ZB 1LDDA 3H3UA 1K7AA 3PSFA 4XOPA 3DBRB 2ME0A 3EUHC 1S3JA 2ISZA 5GAHJ 2AXTC 3A01B 4I09A 4BU2A 3IH3A 2XGCA 3ZR8X 2LK2A 2M45A 1VQNI 4C2UA 2OZUA 3R0AA 4NQWB 2JSPA 3BY6A 2OZ6A 3BPVA 4FTHA 4OMYA 3OOUA 4M9XA 1K83J 1JGSA 1TWGJ 3RCOA 2EA4A 2EFQA 4ZTJA 3BTLA 2PJRA 2EV6A 2P6SA 4L0YB 4G12A 3JRIA 1E3OC 3OL4A 4B8XA 1SAUA 1TWFJ 1TW2A 3D0SA 5CJ9A 3JSPA 1W0UA 3E6CC 2LKSA 2Q0OA 2ESHA 1LFUP 4UV8A 2CUZA 1UHWA 1XCBA 2QZ8A 3JRDA 3F8BA 4XLFA 2QKMB 3G1MA 4XM3A 5E8GA 4MQVA 4I6ZA 3BG6A 5DDGA 3RKQA 1OJLA 3PFIA 1HQCA 1D5YA 3RZOJ 1SVLA 3LL7A 2FXAA 1YW9A 2KDOA 1R5HA 2Z16A 3L1PA 3S2HJ 2XDVA 3GVAA 2CUFA 2FBHA 3VFZA 3JTHA 2HTJA 1OISA 1JHHA 1YS7A 5JI6A 2K9QA 3KYCB 1Y39A 3LQQA 1JKOC 3Q9VA 4GCVA 4HX7A 1FOWA 5KHDA 2BE5F 1GXPA 2VBXA 1V5FA 2NVUB 4HW0A 1DPUA 5DD8A 5D4RA 2Y31A 3ZMUA 1VF9A 2K9NA 1PP7U 4BNCA 1MJBA 2D5VA 1LFBA 3KP4A 3U1DA 5DS9A 2HZDA 4ZYHA 2R7WA 4HRIA 1KQ8A 3CUQC 3JRGA 3HXLA 2L01A 4CUGA 4LLNA 2FBIA 4A0YA 1YS6A 2LBFA 3KP3A 3MD2A 1B8IA 2XHKA 3FBNB 5TGTA 3N4MA 1RI7A 2CW7A 2DPUA 1VTNC 1NK2P 2WAFA 2MFZA 2F5VA 3H5NA 2W7NA 4JX4A 3BR0A 3HJEA 1SANA 4LITA 1VQLI 3CJQB 1XGOA 3QYEA 4ENKA 1OR7C 4IOAF 5EF6A 3CCQI 4LOCA 4EMSA 3OOPA 2CGPA 4KITB 2OQRA 2L02A 2V79A 3FXQA 1ZQ3P 1BIAA 2IXSA 2JZYA 2XAGA 2QUFA 3KP6A 2IGOA 4HAMA 5BPDA 2DOFA 1MJ9A 1T0FC 3CCVI 1G59A 3HB9A 1TNSA 2QQBA 5D8KB 5E1ZB 1MMNA 1POGA 3FXKA 4CH7A 3JAMK 3CCRI 2DW4A 1X1PA 2EK5A 2FQ4A 1ZN2A 2ZBKA 4E7ZA 4U0WA 3GZ5A 4PUSA 5JVTA 4EJUA 3DTIA 2WA0A 1YRNA 2DQRA 1AWCA 4A3GJ 2V1DA 2V26A 4QLCU 3PNYA 1OFCX 2QM3A 2HVQA 4QPQA 1FOKA 3CF2A 3OS0A 3CCJI 2A61A 4BEHA 3JW4A 1WQ2A 1DGRM 6PAXA 3HSRA 1A6QA 3I59A 3OL3A 1K78A 3HZJA 4IXAA 5DD4A 1P4AA 1I6XA 4HX4A 4YIFA 2ZSHB 3PQJA 2W25A 4E6KG 3L2UA 2JVHA 3FK7A 2P7CB 1MBKA 3V7CA 5K7HA 1F4KA 1XX5A 1X2MA 3K4NA 3OYBA 1FTTA 2HZTA 4HX8A 2CQXA 2DMTA 3H3VK 4UV9A 3OR1C 2G9WA 3VOEA 4DYCA 5F1RA 4BE1A 4XSZF 1F36A 1U78A 3P9IA 1YQAA 3AG4H 5LEKA 2IS2A 4I2OA 1ODDA 3GZNB 4CCMA 4A3JJ 2HTSA 1ZR4A 2EIKH 4IHSA 4DJAA 3KX2A 3SYTA 4E70A 2TDXA 1IDZA 5DUIA 3PO2J 3DF8A 4JYKA 3V8JA 1E17A 3RI4A 1VQ7I 4B43A 5DYMA 4PJLA 2OJED 3GUDA 3EETA 5JVGF 1GV5A 4C30A 3K4KA 2JK3A 2FA5A 2NAZA 4IOCF 1UZCA 4LG0A 2FMYA 3OYJA 3ERED 4AWXB 2KZGA 3GF2A 2Y0MA 5F64A 3ASOH 2FEZA 2VC0A 4KJZA 4G7OF 4EQQA 1PUFA 2R5YB 3BR5A 1FP1D 5KK1A 1ETQA 2WAEA 5ICEA 1HDPA 3BR2A 4LFUA 1MDMB 1Z1DA 4RAGA 1SMTA 3D5LA 4LMYA 3M1EA 2XIGA 5HNFA 2ELHA 1W5CC 4YIRX 1QU3A 2K40A 4C3IJ 1F9NA 5HDNA 3MQ0A 4A3LJ 1MMSA 4HEA2 2F6CA 2H6BA 1UCRA 2COBA 4BS9A 1SAXA 3ZGKA 1D3YA 5CQEA 3OIPA 4ZTFA 1FNNA 1BI3A 1UHSA 4AVPA 3LSMA 2ZNYA 4RAYA 2UXXA 1MBHA 4ZYAA 3F72A 2Y48A 2NVQJ 1IN4A 1R4MB 2F2EA 3DEEA 5LGUA 3CO6C 3WE2A 2AQEA 3CLQA 3EQLF 4KN7X 5IOZA 1U0JA 5CKTA 3S2DJ 2PG4A 3CTAA 1FP2A 4JX6A 2VBWA 4AVZA 3L7WA 2EWNA 2Z33A 1YFHA 1U2WA 2MC3A 2F5FA 4QPOA 3DCFA 4IHWA 3ZN0A 3I4PA 5FD6A 3H92A 1Y0UA 4EM0B 2HEOA 2IGNA 1QA6A 5DCMA 4MGRA 1RR7A 4PGGA 4MIMA 2HPMA 1OYIA 2CQKA 2ZC2A 4HBLA 2BY3A 1MNEA 1GLNA 2KZVA 1IUYA 1NG6A 4CCOA 2FOKA 3A2KA 2PX9A 4XN3A 1YIJI 1G3WA 2BBYA 3BOQA 4BJ5C 1VQKI 2LH9A 1ZAOA 3HTSB 4L9JA 3HOUJ 5FRNA 4BHPA 2LBFB 1J5YA 4GGGA 4HF2A 2BY0A 1GVDA 3WU1B 2BV6A 3E7LA 2LP0A 4RDUA 1Z7UA 2EV5A 2Y0SN 4BHBA 3H9JA 1ETKA 4OINF 4Y15A 2EPFA 4M72A 2TCTA 1MW7A 5FKOA 4A3CJ 5BS6A 4EGZA 3TDUC 2VONA 1DDNA 1D1AA 1MIJA 4BY7J 4GRIA 2Y2ZA 4BKXA 4RGSA 2E5NA 2LY1A 5J40A 1WHUA 3OYKA 2CV0A 1UMQA 3BR3A 3DTEA 1Q1HA 2LVSA 1X2NA 2X6WA 3IH2A 3SXYA 1FJLA 2YUSA 3TP0A 2EZHA 1DU0A 2M2EA 2KHMA 5KVRA 2O8KA 2R7VA 4XNFA 5BNGA 1NK3P 2IT0A 2XPUA 1XSXA 4YEJA 1CF7A 1LDKB 1TQPA 1MMAA 3MAJA 3QPLA 4II3A 4UUSA 3BJAA 4XRFA 2D45A 2FF4A 4MFEA 4LK1F 5FGMA 1AOYA 1I27A 2V6EA 3DEWA 3AG3H 1Z67A 2M1BA 1JKQC 2MW8A 2X48A 3WTWC 2C6YA 3JR9A 1HKSA 4AYBA 3WTTC 2DMQA 2EINH 3CUQB 1R5GA 1ENHA 2LOOA 3T8RA 1R4NB 5B3SH 1W7PA 2VI6A 3R0JA 1T2KA 2DDAA 1LE8A 2A5YB 3C18A 4F91B 4XBFA 2XKOA 2JN6A 2KISA 4PSWA 4PDKA 4A5NA 2MLGA 4AC0A 4G7ZF 2NNYA 5E20A 2XAUA 4IHVA 1KQ9A 4HG2A 4N9IA 4KISA 1SVMA 3GTGJ 1ACIA 3SDGA 3SEZA 4M73A 5IT3A 3G73A 4RM2A 4XLCA 3WHCA 1T6SA 3O6BB 4E4HA 5GPCA 2NOGA 1LUJB 5BQTA 4CO8A 4XLAA 2R0QC 1YW7A 4D5FA 4EJOA 2HXOA 1H88C 4UB8C 3ZN1A 4ZYEA 4A3BJ 4ITVA 4BJTA 1XGSA 1SMYF 1KONA 1FSHA 2FSWA 1TT0A 2HKOA 3A02A 3KZZA 2JT1A 1EH8A 2VBYA 5GADJ 2LR8A 4EJVA 5GTIC 2KFDA 1UELB 1W36C 1IV6A 1FOYA 4AYBN 4WX9A 1NH3A 4L18B 1N75A 3ML6A 1I6HJ 4CYCA 2OAZA 2JTVA 1XG1A 3KCCA 1RNLA 2ZXJA 3BWGA 3FWEA 4BE0A 2GZWA 2EJRA 1WVRA 1OQYA 3HM5A 2FRHA 5EJCA 2DT7B 1HOMA 4CGZA 2LG4A 3K1NA 3QP5A 3I64A 1RRJA 1P7JA 3BLYA 3RTRA 1KA8A 4F3QA 1YX5A 3ZQHA 1T38A 4NNJA 1KU3A 2XGEA 4XSXF 2E5ZA 4AD9A 3HDDA 3CLOA 2UUZA 3RPQA 1T95A 5DEQA 2DA6A 2IPQX 4M3EA 1F5TA 2XSJC 2N8GA 3OSGA 3BTCA 2M0MA 2NS7A 3A1YA 4BYYA 2K85A 1HBXG 3FXLA 2IGMA 4HQMA 3K70D 3A03A 2E1CA 2QA4I 2X0LA 3U1KA 1HC8A 3ESWB 5EZHA 3T5XA 5J4VA 3E5QA 3SDBA 2Y0SA 4LK0F 5LHHA 1IZ1A 2QBYA 3K4MA 2L4MA 2DFEA 4LIVA 4S0HB 4J19A 4H0EA 1WWXA 3K4BA 3OWTA 5J1UA 2DMUA 1SFKA 2ZMEA 2VQCA 4P1WA 3DEUA 2IEKA 2KT0A 2VKHA 4BHCA 5H2FC 2B63J 5B66C 2OV7A 2O8XA 3NQOA 2HS5A 2LD5A 1MKMA 2CO5A 2EA2A 3FHZA 1BM9A 1ETWA 4HDVA 3K4LA 2F4IA 2BGCA 2QBYB 2BW3A 3KE2A 3VYRB 2GM4A 3RSNA 1IDYA 3S32A 2XAQA 2MD5A 4CSWA 5HNHA 1BR1A 1VI0A 2B0LA 2ECCA 2RNGA 4NUBA 3L2RA 2R5YA 5FB2A 3GXOA 1OR7A 2FX0A 4L5EA 1U3EM
chains in the Genus database with same CATH topology
1JXSA 5L3GA 2A69F 1ZLKA 2WC2A 3P9KA 4AIJA 2ZFWA 3L2CA 4BXUA 2A6EF 2ESNA 5ICFA 1I1GA 1QPMA 1MD0A 1SD6A 1W7PB 1A04A 5TRDA 4JK1X 4G6DA 2XKPA 3SFZA 3WTZA 3S2WA 5FLXZ 2VE9A 4U0VA 3K2ZA 2D1VA 2F5DA 1FYMA 3F21A 3FZVA 4OMZA 4BH9A 2FMLA 1ZARA 3K69A 3LFKA 2EFOA 4LGWA 4EGYA 2H94A 4GO1A 4KMFA 3GWZA 1B9MA 4GYIA 2ZKZA 3P9CA 4A6DA 2VE8A 2GXGA 2HFHA 4RGUA 2QQ9A 3E5UA 5DUKA 2M8EA 3M8EA 2RNJA 3WTXC 4HV5A 4KIGA 4I7HA 1MZBA 2FU4A 3F23A 2IJLA 3EYYA 1ZG3A 3DQVC 1ZRFA 4N0BA 3BP8A 2A68F 1WRJA 2Y75A 5LEJA 2Z5UA 2GIVA 5D5VB 2JPCA 2JPBA 5TJJA 4Y13A 2PFBA 4OIOF 2R7FA 5HLGA 3WU0A 2IA1A 2L3DA 2GQQA 3K1PA 2DTRA 2PMUA 3ZMSA 3C1DA 3HUGA 5D5UB 1YLFA 1IF1A 4BAYA 5CYVA 2ZMEB 1G6NA 5HLIA 1H9TA 2DU9A 1J9IA 3E6MA 4FX0A 3N97A 1FC3A 2P5LC 5HLHA 1ZRCA 5CVRA 5D5WB 1G3TA 4RGRA 4LLGF 3DXJF 3E97A 1ZRDA 3HIFA 3F6OA 4WCGA 5F6FA 3KFWX 1MGTA 2A6HF 1YIOA 2W84A 4UNOA 1GXQA 3E6DA 2RDPA 4BQAA 2JRTA 2DFIA 2QENA 5DV5A 5H6RA 1ULYA 2KRFA 3RKWA 2AXLA 1USSA 1FBQA 2G7HA 2FQ3A 1KQ0A 5E1XA 4U7BA 1XMKA 2CSOA 1R00A 1KGSA 3JSOA 1BI2A 2STTA 4CICA 2EV0A 1I1SA 2DK8A 1XGNA 2DK5A 4DNCA 4R79A 4WXCA 3V7RA 1YYVA 1J75A 2DT5A 2QVOA 5L3EA 4HA8A 1T39A 3T8TA 3JTGA 4HF1A 4D0PA 2MLKA 3EUHA 3HRUA 1V3FA 3KP5A 4LLLA 3LAJA 1LEBA 3RYRA 1TTYA 3L09A 1Z6RA 3C3WA 1IW7F 5H6QA 3IKTA 2O6GE 1ZGJA 1W4MA 1OKRA 3LQRA 4M6XA 3I53A 1R1TA 3WG9A 1HKQA 4MNUA 2YU3A 1TQIA 2PBIA 4U0YA 5HVQC 2XAFA 4ZYGA 1IN5A 1OPCA 4MQ9F 1QBJA 4I0AA 1USTA 1Z05A 3REOA 1W5SA 2AS5F 3BJOA 3ZPLA 3BPXA 3TOBA 3TO9A 3WTSC 2OA4A 2MA3A 3TO6A 3W6KB 4K2EA 4NB5A 1R23A 1OYYA 4O3MA 2O0YA 5FLXK 3VEPA 2HKXA 2HQRA 2NNNA 1TLHB 1LNWA 4EJTA 2KJCA 3FM3A 2L4AA 1SD5A 4MEYF 3ECOA 3R60A 2PQ8A 4PGHA 2VT3A 2VN2A 4RB0A 4P96A 2VOPA 4IRGA 2VT2A 3NEUA 3SZTA 3IKVA 4KIBA 4A0ZA 4PCQA 3GW2A 2XVCA 3KEOA 1HSJA 3CDHA 1DUXC 2PLYA 1YG2A 2P5KA 4HDUA 2XASA 2KIUA 5HDKA 1ZLJA 3DV8A 5H20A 1RZ4A 1FLIA 3GFLA 4U88A 1V4RA 3H3ZA 3WE3A 3ZQ7A 3R4KA 3F3XA 3TGNA 2XUBA 3QAHA 3COAC 2NYXA 2ZO4A 3E3VA 2CYYA 3KZYA 3K1MA 3QOPA 2MBFA 1ZREA 1ZH5A 3U9GA 5ILUA 1J59A 5HS9A 2VXZA 1PDNC 3TDZC 4KNYA 3ECHA 1XCVA 3ELKA 4MHGA 4G6QA 1LQ1A 3HRTA 3L00A 2ZCWA 4ZZDA 1FBSA 3GFMA 4UUVA 4OIQF 2GA1A 3R6SA 3FF5A 1H0MA 2IRFG 4QWQA 2CG4A 3CJNA 5E1WA 5BMZA 4EJWA 4UVCA 3LAPA 1IXCA 3SQNA 5L3CA 2EB7A 1OMIA 3LWFA 3WGIA 2DBBA 2Q2EA 3F22A 2Z99A 1ZG5A 2DLLA 4FHTA 1TBXA 1SFEA 5LGTA 2FBKA 4EM1A 3BJ6A 4HZFA 3ZMTA 2O61A 1IRFA 4Y17A 4ZZLA 2G7UA 2M87A 1ONVA 1QQIA 3VODA 2E1NA 1S7OA 2GA2A 4Q4ZF 2OU2A 4YFXF 3HTUA 2XRNA 2E7XA 3FX3A 3T0YA 2HDCA 3F8NA 1WSUA 1J7KA 1SD7A 5HS8A 3J81K 1G4DA 2IP2A 3V8KA 2PN6A 1R7JA 2OQGA 3JAMZ 2P8TA 3IRRA 2DI3A 2RGVA 4YFNF 3RJPA 1HKTA 3Q5FA 1P4XA 1ON2A 2LF7A 1KYWA 1ZG1A 5LRSA 3PQKA 3G3ZA 4CHUA 2LF8A 3Q9SA 2HGCA 3GYHX 3QPHA 1C0WA 4L5IA 2GWRA 4DQ2A 1QGPA 1J2XA 2D2WA 4R8HA 3E5XA 4JQFA 1B9NA 1JE8A 2P5VA 2KJBA 2R7DA 4Q48A 3T1BA 3RYPA 2HWVA 4HQEA 4IF4A 5FFZA 3DKWA 2M5WA 3RPUA 4MEXF 1BI1A 2VODA 1B59A 1FZPB 1D8JA 4S05A 4A5MA 3I59B 4ENNA 4KICA 3I54A 3FMRA 1LB2A 5ERIA 4XLNF 2HYGD 2W24A 2QQAA 4HV6A 2QYOA 4RS8A 4O5VA 2K7LA 4Q47A 3MZHA 3HRMA 4IRIA 5AIQA 3RKYA 3FXUA 4P9FA 1XSVA 1O3QA 4IRHA 3KLNA 3K0LA 2YR2A 5D8LB 2RC4A 3WTYC 4MTEA 3QU3A 3MFKA 1JHFA 4M9ZA 1HW1A 4KDPA 4ZH4F 4A12A 1KU2A 3B73A 3MEXA 2ZNZA 2VBZA 5A2QK 2RVCA 1KU9A 1LEAA 3GFIA 3WTVC 5BOXA 2OD5A 3E6BA 4UVBA 5D6EA 2CW0F 1S29A 1B4AA 1CF7B 1XDUA 5D5XB 4LB6B 4I98B 3HRSA 1UFMA 1IXSB 3MZYA 3QPTA 4KUMA 1YO5C 2HYFA 5J8CA 2PJPA 3TQNA 3CUOA 2QWWA 1E2XA 5L3DA 3TO7A 2J5PA 1T0FA 4OIRF 4GXOA 5D4SA 1L0OC 3WODF 4YFKF 2IW5A 4IJAA 2V1XA 1FY7A 3I58A 1XGMA 1FBUA 2KIMA 1DPRA 2LSOA 2MH9A 4M9SA 4A6EA 3B02A 1XD7A 5JHUA 4L5JA 3I71A 1U5TC 3I0TA 1IRGA 2WV0A 1BN5A 4L9TA 1KU7A 2UXNA 1BC8C 2OBPA 1XMAA 1BBYA 5LRRA 5AIPA 3J81Z 3KEQA 3W6JB 4OOIA 3ISPA 1B1BA 3KP7A 2H6CA 3V7SA 1R36A 3R61A 5FD5A 2J5OA 1P6RA 3QP6A 4TV7A 1FWZA 1B6AA 3WGHA 1D5VA 2EFWA 1S8NA 1F1ZA 3O2PE 2YSRA 4Q5SF 1O3TA 1KYZA 4A0XA 3FM5A 3FMQA 4RB1A 1R1UA 5D6FA 3WGGA 1BIBA 3U2RA 2F5CA 1FPQA 1P4WA 1O57A 1CGPA 1PP8F 3J80K 3L9FA 3F8CA 4EVIA 3HOTA 3J80Z 1G3SA 2BYVE 3J7AO 1IN8A 5DCMB 2KIFA 1BOAA 3EYIA 4GYGA 5CVUA 1R1VA 2F5EA 1XB4A 1QZZA 1WI9A 5ILVA 2XAJA 4FT8A 3MWMA 1TNTA 3TOAA 3M9AA 4RAZA 2L54A 3ULQB 1LVAA 4L9NA 1QO0D 1Z6TA 2YX4A 3IC7A 2NRAC 3ZMDA 4KFCA 3FXRA 4I01A 3IL2A 3M8FA 1HXDA 4LB5A 1K79A 3EDPA 3KLOA 3OV8A 1WKMA 1XSDA 5K1YA 5AONA 1EV7A 1OYWA 3GLXA 3LA2A 1YW8A 4KIFA 2LDUA 2XV4S 3IRQA 3RDIA 4WXHA 3SZPA 5J8FA 1R58A 2Z3YA 2KKOA 2A07F 4IVNA 2P6TA 2RKHA 5JFRA 5HS7A 3BDDA 3DFGA 1LDJA 5IT9Z 1FSEA 1LJ9A 2E7WA 4LJZF 4S04A 3WTUC 5LBQA 5L3BA 1SFUA 4XLPF 5JR3A 3O3KA 5K5OA 4FX4A 4Z2YA 4YIIA 1K78B 2FNPA 2DAOA 3F6VA 3GO5A 2HR3A 3BROA 1ZGAA 5BPIA 4ESJA 5HDGA 4ESBA 2UWMA 4R1HA 1HW5A 1T98A 2ETHA 5A2QZ 2DO7A 3HYIA 1GHCA 1RUNA 2MH2A 4HLYA 3CO7C 3GX4X 3V4GA 1EH6A 5K5QA 5CVVA 4HYEA 1DP7P 1FX7A 4IHTA 3I5UA 3IHUA 1Z9CA 1L3LA 2O03A 1G3YA 1J0RA 2COMA 1GVJA 3IWZA 3HSFA 3GFJA 4ESFA 4PZJA 1O3SA 3DPLC 2Z9OA 3RKXA 3CUQA 4AIKA 1H9GA 1I5ZA 2GXBA 3VB2A 1QNTA 4A2UA 2EFPA 4LD5A 5ICCA 2ACJA 1R22A 1Z91A 4G94A 4KYWA 2LNBA 5HOOA 2RQPA 4ON0A 5DCFA 4JBAA 4CXFA 4G8XA 2STWA 1P2FA 2PMHA 3NRVA 2P4WA 1IN7A 1UHMA 1MJAA 5ICGA 4CDGA 1U5TA 5E17F 2VC1A 1QZYA 1P92A 3DPTA 1ZHFA 1RIOH 2XROA 4IPAA 5LHIA 4M74A 4ZYDA 4P55A 3ZMZA 2CWEA 4WWCA 2LKPA 2CFXA 4YG2F 2HOEA 3KETA 2RN7A 2O3FA 4HF0A 4RB2C 4P5OA 2ADUA 2EFNA 3LA3A 1UB9A 4EM2A 4EV0A 2PI0A 4WF2A 1SFXA 4KMUX 2NS0A 1TW3A 2IVMA 1FYLA 5FFXA 1HW2A 4KA4A 4OU0A 3KP2A 2K4JA 1EH7A 3ABTA 2QLZA 4ETSA 3SHFA 2HQNA 1PUEE 3BZ6A 2WWYA 2ZJ2A 3DP7A 4OIPF 1S7AA 3F8MA 4G9YA 1BJAA 2DPDA 4KN4X 2K27A 3HHHA 1HSTA 4CYDA 4NHJA 3IWFA 2W57A 1YTYA 3HOSA 1MDMA 4WK8F 2RV8A 4HLXA 1S6LA 4M6YA 4AIHA 3LSTA 3FMSA 2V1UA 3MCZA 4WXDA 1X3UA 3V8LA 5CVJA 2V9VA 1FYKA 5IT9K 5EEHA 5LHGA 3AAFA 2P7VB 3P7NA 1O7LA 5J6XA 2ISYA 1O3RA 2VOOA 4LG0B 3K9TA 4I0BA 4F7ZA 4UHTA 4NQWA 2K4BA 1ZYRF 2GAUA 2BEOA 1IXRC 2Q8KA 1BC7C 3ZMVA 4UVAA 2M30A 2K02A 2YPRA 1U5TB 5FO5A 2XGXA 3ZP5A 3QRFF 5E18F 4ASNA 1ON1A 1SD4A 2XAHA 1IN6A 1D8KA 2R3SA 5ED4A 3M7GA 1NHAA 3F8FA 1IAWA 1O7FA 2FE3A 1STZA 4I02A 5K5RA 3GEZA 1W5TA 4KT5C 2IA2A 2D1HA 1TQMA 2X4HA 5L3FA 4UXNA 4O6JA 5ILSA 5CLSA 4CZZA 2K86A 3HHGA 4L9VA 4HOBA 1K6OA 1U6GA 2V6CA 2UZKA 3ABUA 2PEXA 3C7JA 2IA0A 4ENMA 1REPC 5LGNA 4N9HA 1XN7A 1RUOA 4U7DA 4ENJA 3RIRA 4G7HF 3TKYA 3ROUA 2W85A 3LA7A 1U8RA 4P9UA 5LLQA 3QU6A 4MTDA 2A3SA 2WTEA 1FT9A 2H09A 2YX7A 4RGXA 4RB3C 5E8IA 4M71A 5CVIA 1W7PD 2FNAA 2H27A 1XDSA 3HSEA 2DQLA 1BI0A 4B09A 5EEGA 3GZ6A 2JSCA 4L0ZB 1LDDA 3H3UA 1K7AA 1S3JA 2ISZA 4I09A 2M45A 2OZUA 3R0AA 3BY6A 2OZ6A 3BPVA 4OMYA 4M9XA 1JGSA 2EA4A 2EFQA 2EV6A 2P6SA 4L0YB 4B8XA 1TW2A 3D0SA 5CJ9A 3JSPA 3E6CC 2Q0OA 2ESHA 4UV8A 1UHWA 1XCBA 2QZ8A 3F8BA 5E8GA 4MQVA 5DDGA 3PFIA 1HQCA 2FXAA 1YW9A 1R5HA 3GVAA 2FBHA 3VFZA 3JTHA 2HTJA 1YS7A 1JHHA 5JI6A 3LQQA 3Q9VA 4GCVA 4HX7A 1GXPA 2BE5F 2VBXA 4HW0A 1DPUA 5DD8A 5D4RA 3ZMUA 1PP7U 4BNCA 1MJBA 3KP4A 3U1DA 4ZYHA 1KQ8A 3CUQC 2L01A 4LLNA 2FBIA 4A0YA 1YS6A 3KP3A 2XHKA 3N4MA 1RI7A 2DPUA 1VTNC 1XGOA 4ENKA 4EMSA 3OOPA 2CGPA 2OQRA 2L02A 2V79A 3FXQA 1BIAA 2JZYA 2XAGA 2QUFA 3KP6A 4HAMA 5BPDA 1MJ9A 1TNSA 2QQBA 5D8KB 5E1ZB 3JAMK 2DW4A 2EK5A 2ZBKA 1ZN2A 4U0WA 3GZ5A 5JVTA 4EJUA 2DQRA 1AWCA 2V1DA 4QLCU 2QM3A 1FOKA 2A61A 3JW4A 1WQ2A 6PAXA 3HSRA 3I59A 1K78A 4IXAA 5DD4A 1P4AA 1I6XA 4HX4A 4YIFA 3PQJA 2W25A 2P7CB 3V7CA 1F4KA 2HZTA 4HX8A 4UV9A 2G9WA 3VOEA 5F1RA 4XSZF 1U78A 3P9IA 1YQAA 5LEKA 4I2OA 1ODDA 2HTSA 4IHSA 4E70A 2TDXA 5DUIA 3DF8A 3V8JA 1E17A 3RI4A 5DYMA 3GUDA 3EETA 2FA5A 2NAZA 4LG0A 2FMYA 3ERED 4AWXB 3GF2A 2Y0MA 5F64A 2FEZA 2VC0A 4G7OF 4EQQA 1FP1D 5KK1A 5ICEA 4LFUA 1MDMB 1Z1DA 1SMTA 3D5LA 4LMYA 3M1EA 2XIGA 2ELHA 1F9NA 5HDNA 3MQ0A 2H6BA 1UCRA 1SAXA 1D3YA 1FNNA 1BI3A 4AVPA 2ZNYA 4RAYA 2UXXA 3F72A 2Y48A 1IN4A 2F2EA 5LGUA 3CO6C 3WE2A 3EQLF 4KN7X 2PG4A 3CTAA 1FP2A 2VBWA 3L7WA 2EWNA 2Z33A 1YFHA 1U2WA 2MC3A 2F5FA 3ZN0A 3I4PA 5FD6A 3H92A 1Y0UA 4EM0B 2HEOA 5DCMA 4MGRA 4PGGA 1OYIA 2CQKA 4HBLA 1IUYA 2FOKA 1G3WA 2BBYA 3BOQA 1ZAOA 3HTSB 4L9JA 4BHPA 1J5YA 4GGGA 4HF2A 3WU1B 2BV6A 1Z7UA 2EV5A 4BHBA 4OINF 4Y15A 4M72A 5BS6A 4EGZA 3TDUC 2VONA 1DDNA 4RGSA 1Q1HA 3SXYA 5KVRA 2IT0A 1XSXA 1CF7A 1LDKB 1TQPA 3MAJA 3BJAA 4XRFA 2D45A 2FF4A 5FGMA 4LK1F 1AOYA 1I27A 2M1BA 3WTWC 2C6YA 1HKSA 3WTTC 3CUQB 1R5GA 3T8RA 1W7PA 3R0JA 1T2KA 2A5YB 3C18A 4XBFA 2XKOA 4PDKA 4A5NA 2MLGA 4G7ZF 2NNYA 5E20A 1KQ9A 4N9IA 5IT3A 4M73A 3G73A 1T6SA 3O6BB 5BQTA 4CO8A 1YW7A 4EJOA 3ZN1A 4ZYEA 1XGSA 1SMYF 1FSHA 2FSWA 2HKOA 3KZZA 2JT1A 1EH8A 2VBYA 4EJVA 4WX9A 4L18B 3ML6A 2OAZA 2JTVA 3KCCA 1RNLA 2ZXJA 3BWGA 3FWEA 2GZWA 2EJRA 2FRHA 4CGZA 3K1NA 3QP5A 3I64A 3RTRA 1KA8A 1T38A 1KU3A 4XSXF 4AD9A 3CLOA 3RPQA 5DEQA 1F5TA 2IPQX 4BYYA 1HBXG 4HQMA 2E1CA 2X0LA 3T5XA 3E5QA 5LHHA 4LK0F 1IZ1A 2QBYA 2L4MA 4H0EA 1WWXA 2ZMEA 3DEUA 4BHCA 2O8XA 3NQOA 2HS5A 1MKMA 2CO5A 2EA2A 3FHZA 1BM9A 4HDVA 2BGCA 2QBYB 3KE2A 2XAQA 2MD5A 2B0LA 5FB2A 3GXOA 1OR7A 1U3EM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JXS A;  5L3G A;  2A69 F;  1ZLK A;  2WC2 A;  3P9K A;  4AIJ A;  2ZFW A;  3L2C A;  4BXU A;  2A6E F;  2ESN A;  5ICF A;  1I1G A;  1QPM A;  1MD0 A;  1SD6 A;  1W7P B;  1A04 A;  5TRD A;  4JK1 X;  4G6D A;  2XKP A;  3SFZ A;  3WTZ A;  3S2W A;  5FLX Z;  2VE9 A;  4U0V A;  3K2Z A;  2D1V A;  2F5D A;  1FYM A;  3F21 A;  3FZV A;  4OMZ A;  4BH9 A;  2FML A;  1ZAR A;  3K69 A;  3LFK A;  2EFO A;  4LGW A;  4EGY A;  2H94 A;  4GO1 A;  4KMF A;  3GWZ A;  1B9M A;  4GYI A;  2ZKZ A;  3P9C A;  4A6D A;  2VE8 A;  2GXG A;  2HFH A;  4RGU A;  2QQ9 A;  3E5U A;  5DUK A;  2M8E A;  3M8E A;  2RNJ A;  3WTX C;  4HV5 A;  4KIG A;  4I7H A;  1MZB A;  2FU4 A;  3F23 A;  2IJL A;  3EYY A;  1ZG3 A;  3DQV C;  1ZRF A;  4N0B A;  3BP8 A;  2A68 F;  1WRJ A;  2Y75 A;  5LEJ A;  2Z5U A;  2GIV A;  5D5V B;  2JPC A;  2JPB A;  5TJJ A;  4Y13 A;  2PFB A;  4OIO F;  2R7F A;  5HLG A;  3WU0 A;  2IA1 A;  2L3D A;  2GQQ A;  3K1P A;  2DTR A;  2PMU A;  3ZMS A;  3C1D A;  3HUG A;  5D5U B;  1YLF A;  1IF1 A;  4BAY A;  5CYV A;  2ZME B;  1G6N A;  5HLI A;  1H9T A;  2DU9 A;  1J9I A;  3E6M A;  4FX0 A;  3N97 A;  1FC3 A;  2P5L C;  5HLH A;  1ZRC A;  5CVR A;  5D5W B;  1G3T A;  4RGR A;  4LLG F;  3DXJ F;  3E97 A;  1ZRD A;  3HIF A;  3F6O A;  4WCG A;  5F6F A;  3KFW X;  1MGT A;  2A6H F;  1YIO A;  2W84 A;  4UNO A;  1GXQ A;  3E6D A;  2RDP A;  4BQA A;  2JRT A;  2DFI A;  2QEN A;  5DV5 A;  5H6R A;  1ULY A;  2KRF A;  3RKW A;  2AXL A;  1USS A;  1FBQ A;  2G7H A;  2FQ3 A;  1KQ0 A;  5E1X A;  4U7B A;  1XMK A;  2CSO A;  1R00 A;  1KGS A;  3JSO A;  1BI2 A;  2STT A;  4CIC A;  2EV0 A;  1I1S A;  2DK8 A;  1XGN A;  2DK5 A;  4DNC A;  4R79 A;  4WXC A;  3V7R A;  1YYV A;  1J75 A;  2DT5 A;  2QVO A;  5L3E A;  4HA8 A;  1T39 A;  3T8T A;  3JTG A;  4HF1 A;  4D0P A;  2MLK A;  3EUH A;  3HRU A;  1V3F A;  3KP5 A;  4LLL A;  3LAJ A;  1LEB A;  3RYR A;  1TTY A;  3L09 A;  1Z6R A;  3C3W A;  1IW7 F;  5H6Q A;  3IKT A;  2O6G E;  1ZGJ A;  1W4M A;  1OKR A;  3LQR A;  4M6X A;  3I53 A;  1R1T A;  3WG9 A;  1HKQ A;  4MNU A;  2YU3 A;  1TQI A;  2PBI A;  4U0Y A;  5HVQ C;  2XAF A;  4ZYG A;  1IN5 A;  1OPC A;  4MQ9 F;  1QBJ A;  4I0A A;  1UST A;  1Z05 A;  3REO A;  1W5S A;  2AS5 F;  3BJO A;  3ZPL A;  3BPX A;  3TOB A;  3TO9 A;  3WTS C;  2OA4 A;  2MA3 A;  3TO6 A;  3W6K B;  4K2E A;  4NB5 A;  1R23 A;  1OYY A;  4O3M A;  2O0Y A;  5FLX K;  3VEP A;  2HKX A;  2HQR A;  2NNN A;  1TLH B;  1LNW A;  4EJT A;  2KJC A;  3FM3 A;  2L4A A;  1SD5 A;  4MEY F;  3ECO A;  3R60 A;  2PQ8 A;  4PGH A;  2VT3 A;  2VN2 A;  4RB0 A;  4P96 A;  2VOP A;  4IRG A;  2VT2 A;  3NEU A;  3SZT A;  3IKV A;  4KIB A;  4A0Z A;  4PCQ A;  3GW2 A;  2XVC A;  3KEO A;  1HSJ A;  3CDH A;  1DUX C;  2PLY A;  1YG2 A;  2P5K A;  4HDU A;  2XAS A;  2KIU A;  5HDK A;  1ZLJ A;  3DV8 A;  5H20 A;  1RZ4 A;  1FLI A;  3GFL A;  4U88 A;  1V4R A;  3H3Z A;  3WE3 A;  3ZQ7 A;  3R4K A;  3F3X A;  3TGN A;  2XUB A;  3QAH A;  3COA C;  2NYX A;  2ZO4 A;  3E3V A;  2CYY A;  3KZY A;  3K1M A;  3QOP A;  2MBF A;  1ZRE A;  1ZH5 A;  3U9G A;  5ILU A;  1J59 A;  5HS9 A;  2VXZ A;  1PDN C;  3TDZ C;  4KNY A;  3ECH A;  1XCV A;  3ELK A;  4MHG A;  4G6Q A;  1LQ1 A;  3HRT A;  3L00 A;  2ZCW A;  4ZZD A;  1FBS A;  3GFM A;  4UUV A;  4OIQ F;  2GA1 A;  3R6S A;  3FF5 A;  1H0M A;  2IRF G;  4QWQ A;  2CG4 A;  3CJN A;  5E1W A;  5BMZ A;  4EJW A;  4UVC A;  3LAP A;  1IXC A;  3SQN A;  5L3C A;  2EB7 A;  1OMI A;  3LWF A;  3WGI A;  2DBB A;  2Q2E A;  3F22 A;  2Z99 A;  1ZG5 A;  2DLL A;  4FHT A;  1TBX A;  1SFE A;  5LGT A;  2FBK A;  4EM1 A;  3BJ6 A;  4HZF A;  3ZMT A;  2O61 A;  1IRF A;  4Y17 A;  4ZZL A;  2G7U A;  2M87 A;  1ONV A;  1QQI A;  3VOD A;  2E1N A;  1S7O A;  2GA2 A;  4Q4Z F;  2OU2 A;  4YFX F;  3HTU A;  2XRN A;  2E7X A;  3FX3 A;  3T0Y A;  2HDC A;  3F8N A;  1WSU A;  1J7K A;  1SD7 A;  5HS8 A;  3J81 K;  1G4D A;  2IP2 A;  3V8K A;  2PN6 A;  1R7J A;  2OQG A;  3JAM Z;  2P8T A;  3IRR A;  2DI3 A;  2RGV A;  4YFN F;  3RJP A;  1HKT A;  3Q5F A;  1P4X A;  1ON2 A;  2LF7 A;  1KYW A;  1ZG1 A;  5LRS A;  3PQK A;  3G3Z A;  4CHU A;  2LF8 A;  3Q9S A;  2HGC A;  3GYH X;  3QPH A;  1C0W A;  4L5I A;  2GWR A;  4DQ2 A;  1QGP A;  1J2X A;  2D2W A;  4R8H A;  3E5X A;  4JQF A;  1B9N A;  1JE8 A;  2P5V A;  2KJB A;  2R7D A;  4Q48 A;  3T1B A;  3RYP A;  2HWV A;  4HQE A;  4IF4 A;  5FFZ A;  3DKW A;  2M5W A;  3RPU A;  4MEX F;  1BI1 A;  2VOD A;  1B59 A;  1FZP B;  1D8J A;  4S05 A;  4A5M A;  3I59 B;  4ENN A;  4KIC A;  3I54 A;  3FMR A;  1LB2 A;  5ERI A;  4XLN F;  2HYG D;  2W24 A;  2QQA A;  4HV6 A;  2QYO A;  4RS8 A;  4O5V A;  2K7L A;  4Q47 A;  3MZH A;  3HRM A;  4IRI A;  5AIQ A;  3RKY A;  3FXU A;  4P9F A;  1XSV A;  1O3Q A;  4IRH A;  3KLN A;  3K0L A;  2YR2 A;  5D8L B;  2RC4 A;  3WTY C;  4MTE A;  3QU3 A;  3MFK A;  1JHF A;  4M9Z A;  1HW1 A;  4KDP A;  4ZH4 F;  4A12 A;  1KU2 A;  3B73 A;  3MEX A;  2ZNZ A;  2VBZ A;  5A2Q K;  2RVC A;  1KU9 A;  1LEA A;  3GFI A;  3WTV C;  5BOX A;  2OD5 A;  3E6B A;  4UVB A;  5D6E A;  2CW0 F;  1S29 A;  1B4A A;  1CF7 B;  1XDU A;  5D5X B;  4LB6 B;  4I98 B;  3HRS A;  1UFM A;  1IXS B;  3MZY A;  3QPT A;  4KUM A;  1YO5 C;  2HYF A;  5J8C A;  2PJP A;  3TQN A;  3CUO A;  2QWW A;  1E2X A;  5L3D A;  3TO7 A;  2J5P A;  1T0F A;  4OIR F;  4GXO A;  5D4S A;  1L0O C;  3WOD F;  4YFK F;  2IW5 A;  4IJA A;  2V1X A;  1FY7 A;  3I58 A;  1XGM A;  1FBU A;  2KIM A;  1DPR A;  2LSO A;  2MH9 A;  4M9S A;  4A6E A;  3B02 A;  1XD7 A;  5JHU A;  4L5J A;  3I71 A;  1U5T C;  3I0T A;  1IRG A;  2WV0 A;  1BN5 A;  4L9T A;  1KU7 A;  2UXN A;  1BC8 C;  2OBP A;  1XMA A;  1BBY A;  5LRR A;  5AIP A;  3J81 Z;  3KEQ A;  3W6J B;  4OOI A;  3ISP A;  1B1B A;  3KP7 A;  2H6C A;  3V7S A;  1R36 A;  3R61 A;  5FD5 A;  2J5O A;  1P6R A;  3QP6 A;  4TV7 A;  1FWZ A;  1B6A A;  3WGH A;  1D5V A;  2EFW A;  1S8N A;  1F1Z A;  3O2P E;  2YSR A;  4Q5S F;  1O3T A;  1KYZ A;  4A0X A;  3FM5 A;  3FMQ A;  4RB1 A;  1R1U A;  5D6F A;  3WGG A;  1BIB A;  3U2R A;  2F5C A;  1FPQ A;  1P4W A;  1O57 A;  1CGP A;  1PP8 F;  3J80 K;  3L9F A;  3F8C A;  4EVI A;  3HOT A;  3J80 Z;  1G3S A;  2BYV E;  3J7A O;  1IN8 A;  5DCM B;  2KIF A;  1BOA A;  3EYI A;  4GYG A;  5CVU A;  1R1V A;  2F5E A;  1XB4 A;  1QZZ A;  1WI9 A;  5ILV A;  2XAJ A;  4FT8 A;  3MWM A;  1TNT A;  3TOA A;  3M9A A;  4RAZ A;  2L54 A;  3ULQ B;  1LVA A;  4L9N A;  1QO0 D;  1Z6T A;  2YX4 A;  3IC7 A;  2NRA C;  3ZMD A;  4KFC A;  3FXR A;  4I01 A;  3IL2 A;  3M8F A;  1HXD A;  4LB5 A;  1K79 A;  3EDP A;  3KLO A;  3OV8 A;  1WKM A;  1XSD A;  5K1Y A;  5AON A;  1EV7 A;  1OYW A;  3GLX A;  3LA2 A;  1YW8 A;  4KIF A;  2LDU A;  2XV4 S;  3IRQ A;  3RDI A;  4WXH A;  3SZP A;  5J8F A;  1R58 A;  2Z3Y A;  2KKO A;  2A07 F;  4IVN A;  2P6T A;  2RKH A;  5JFR A;  5HS7 A;  3BDD A;  3DFG A;  1LDJ A;  5IT9 Z;  1FSE A;  1LJ9 A;  2E7W A;  4LJZ F;  4S04 A;  3WTU C;  5LBQ A;  5L3B A;  1SFU A;  4XLP F;  5JR3 A;  3O3K A;  5K5O A;  4FX4 A;  4Z2Y A;  4YII A;  1K78 B;  2FNP A;  2DAO A;  3F6V A;  3GO5 A;  2HR3 A;  3BRO A;  1ZGA A;  5BPI A;  4ESJ A;  5HDG A;  4ESB A;  2UWM A;  4R1H A;  1HW5 A;  1T98 A;  2ETH A;  5A2Q Z;  2DO7 A;  3HYI A;  1GHC A;  1RUN A;  2MH2 A;  4HLY A;  3CO7 C;  3GX4 X;  3V4G A;  1EH6 A;  5K5Q A;  5CVV A;  4HYE A;  1DP7 P;  1FX7 A;  4IHT A;  3I5U A;  3IHU A;  1Z9C A;  1L3L A;  2O03 A;  1G3Y A;  1J0R A;  2COM A;  1GVJ A;  3IWZ A;  3HSF A;  3GFJ A;  4ESF A;  4PZJ A;  1O3S A;  3DPL C;  2Z9O A;  3RKX A;  3CUQ A;  4AIK A;  1H9G A;  1I5Z A;  2GXB A;  3VB2 A;  1QNT A;  4A2U A;  2EFP A;  4LD5 A;  5ICC A;  2ACJ A;  1R22 A;  1Z91 A;  4G94 A;  4KYW A;  2LNB A;  5HOO A;  2RQP A;  4ON0 A;  5DCF A;  4JBA A;  4CXF A;  4G8X A;  2STW A;  1P2F A;  2PMH A;  3NRV A;  2P4W A;  1IN7 A;  1UHM A;  1MJA A;  5ICG A;  4CDG A;  1U5T A;  5E17 F;  2VC1 A;  1QZY A;  1P92 A;  3DPT A;  1ZHF A;  1RIO H;  2XRO A;  4IPA A;  5LHI A;  4M74 A;  4ZYD A;  4P55 A;  3ZMZ A;  2CWE A;  4WWC A;  2LKP A;  2CFX A;  4YG2 F;  2HOE A;  3KET A;  2RN7 A;  2O3F A;  4HF0 A;  4RB2 C;  4P5O A;  2ADU A;  2EFN A;  3LA3 A;  1UB9 A;  4EM2 A;  4EV0 A;  2PI0 A;  4WF2 A;  1SFX A;  4KMU X;  2NS0 A;  1TW3 A;  2IVM A;  1FYL A;  5FFX A;  1HW2 A;  4KA4 A;  4OU0 A;  3KP2 A;  2K4J A;  1EH7 A;  3ABT A;  2QLZ A;  4ETS A;  3SHF A;  2HQN A;  1PUE E;  3BZ6 A;  2WWY A;  2ZJ2 A;  3DP7 A;  4OIP F;  1S7A A;  3F8M A;  4G9Y A;  1BJA A;  2DPD A;  4KN4 X;  2K27 A;  3HHH A;  1HST A;  4CYD A;  4NHJ A;  3IWF A;  2W57 A;  1YTY A;  3HOS A;  1MDM A;  4WK8 F;  2RV8 A;  4HLX A;  1S6L A;  4M6Y A;  4AIH A;  3LST A;  3FMS A;  2V1U A;  3MCZ A;  4WXD A;  1X3U A;  3V8L A;  5CVJ A;  2V9V A;  1FYK A;  5IT9 K;  5EEH A;  5LHG A;  3AAF A;  2P7V B;  3P7N A;  1O7L A;  5J6X A;  2ISY A;  1O3R A;  2VOO A;  4LG0 B;  3K9T A;  4I0B A;  4F7Z A;  4UHT A;  4NQW A;  2K4B A;  1ZYR F;  2GAU A;  2BEO A;  1IXR C;  2Q8K A;  1BC7 C;  3ZMV A;  4UVA A;  2M30 A;  2K02 A;  2YPR A;  1U5T B;  5FO5 A;  2XGX A;  3ZP5 A;  3QRF F;  5E18 F;  4ASN A;  1ON1 A;  1SD4 A;  2XAH A;  1IN6 A;  1D8K A;  2R3S A;  5ED4 A;  3M7G A;  1NHA A;  3F8F A;  1IAW A;  1O7F A;  2FE3 A;  1STZ A;  4I02 A;  5K5R A;  3GEZ A;  1W5T A;  4KT5 C;  2IA2 A;  2D1H A;  1TQM A;  2X4H A;  5L3F A;  4UXN A;  4O6J A;  5ILS A;  5CLS A;  4CZZ A;  2K86 A;  3HHG A;  4L9V A;  4HOB A;  1K6O A;  1U6G A;  2V6C A;  2UZK A;  3ABU A;  2PEX A;  3C7J A;  2IA0 A;  4ENM A;  1REP C;  5LGN A;  4N9H A;  1XN7 A;  1RUO A;  4U7D A;  4ENJ A;  3RIR A;  4G7H F;  3TKY A;  3ROU A;  2W85 A;  3LA7 A;  1U8R A;  4P9U A;  5LLQ A;  3QU6 A;  4MTD A;  2A3S A;  2WTE A;  1FT9 A;  2H09 A;  2YX7 A;  4RGX A;  4RB3 C;  5E8I A;  4M71 A;  5CVI A;  1W7P D;  2FNA A;  2H27 A;  1XDS A;  3HSE A;  2DQL A;  1BI0 A;  4B09 A;  5EEG A;  3GZ6 A;  2JSC A;  4L0Z B;  1LDD A;  3H3U A;  1K7A A;  1S3J A;  2ISZ A;  4I09 A;  2M45 A;  2OZU A;  3R0A A;  3BY6 A;  2OZ6 A;  3BPV A;  4OMY A;  4M9X A;  1JGS A;  2EA4 A;  2EFQ A;  2EV6 A;  2P6S A;  4L0Y B;  4B8X A;  1TW2 A;  3D0S A;  5CJ9 A;  3JSP A;  3E6C C;  2Q0O A;  2ESH A;  4UV8 A;  1UHW A;  1XCB A;  2QZ8 A;  3F8B A;  5E8G A;  4MQV A;  5DDG A;  3PFI A;  1HQC A;  2FXA A;  1YW9 A;  1R5H A;  3GVA A;  2FBH A;  3VFZ A;  3JTH A;  2HTJ A;  1YS7 A;  1JHH A;  5JI6 A;  3LQQ A;  3Q9V A;  4GCV A;  4HX7 A;  1GXP A;  2BE5 F;  2VBX A;  4HW0 A;  1DPU A;  5DD8 A;  5D4R A;  3ZMU A;  1PP7 U;  4BNC A;  1MJB A;  3KP4 A;  3U1D A;  4ZYH A;  1KQ8 A;  3CUQ C;  2L01 A;  4LLN A;  2FBI A;  4A0Y A;  1YS6 A;  3KP3 A;  2XHK A;  3N4M A;  1RI7 A;  2DPU A;  1VTN C;  1XGO A;  4ENK A;  4EMS A;  3OOP A;  2CGP A;  2OQR A;  2L02 A;  2V79 A;  3FXQ A;  1BIA A;  2JZY A;  2XAG A;  2QUF A;  3KP6 A;  4HAM A;  5BPD A;  1MJ9 A;  1TNS A;  2QQB A;  5D8K B;  5E1Z B;  3JAM K;  2DW4 A;  2EK5 A;  2ZBK A;  1ZN2 A;  4U0W A;  3GZ5 A;  5JVT A;  4EJU A;  2DQR A;  1AWC A;  2V1D A;  4QLC U;  2QM3 A;  1FOK A;  2A61 A;  3JW4 A;  1WQ2 A;  6PAX A;  3HSR A;  3I59 A;  1K78 A;  4IXA A;  5DD4 A;  1P4A A;  1I6X A;  4HX4 A;  4YIF A;  3PQJ A;  2W25 A;  2P7C B;  3V7C A;  1F4K A;  2HZT A;  4HX8 A;  4UV9 A;  2G9W A;  3VOE A;  5F1R A;  4XSZ F;  1U78 A;  3P9I A;  1YQA A;  5LEK A;  4I2O A;  1ODD A;  2HTS A;  4IHS A;  4E70 A;  2TDX A;  5DUI A;  3DF8 A;  3V8J A;  1E17 A;  3RI4 A;  5DYM A;  3GUD A;  3EET A;  2FA5 A;  2NAZ A;  4LG0 A;  2FMY A;  3ERE D;  4AWX B;  3GF2 A;  2Y0M A;  5F64 A;  2FEZ A;  2VC0 A;  4G7O F;  4EQQ A;  1FP1 D;  5KK1 A;  5ICE A;  4LFU A;  1MDM B;  1Z1D A;  1SMT A;  3D5L A;  4LMY A;  3M1E A;  2XIG A;  2ELH A;  1F9N A;  5HDN A;  3MQ0 A;  2H6B A;  1UCR A;  1SAX A;  1D3Y A;  1FNN A;  1BI3 A;  4AVP A;  2ZNY A;  4RAY A;  2UXX A;  3F72 A;  2Y48 A;  1IN4 A;  2F2E A;  5LGU A;  3CO6 C;  3WE2 A;  3EQL F;  4KN7 X;  2PG4 A;  3CTA A;  1FP2 A;  2VBW A;  3L7W A;  2EWN A;  2Z33 A;  1YFH A;  1U2W A;  2MC3 A;  2F5F A;  3ZN0 A;  3I4P A;  5FD6 A;  3H92 A;  1Y0U A;  4EM0 B;  2HEO A;  5DCM A;  4MGR A;  4PGG A;  1OYI A;  2CQK A;  4HBL A;  1IUY A;  2FOK A;  1G3W A;  2BBY A;  3BOQ A;  1ZAO A;  3HTS B;  4L9J A;  4BHP A;  1J5Y A;  4GGG A;  4HF2 A;  3WU1 B;  2BV6 A;  1Z7U A;  2EV5 A;  4BHB A;  4OIN F;  4Y15 A;  4M72 A;  5BS6 A;  4EGZ A;  3TDU C;  2VON A;  1DDN A;  4RGS A;  1Q1H A;  3SXY A;  5KVR A;  2IT0 A;  1XSX A;  1CF7 A;  1LDK B;  1TQP A;  3MAJ A;  3BJA A;  4XRF A;  2D45 A;  2FF4 A;  5FGM A;  4LK1 F;  1AOY A;  1I27 A;  2M1B A;  3WTW C;  2C6Y A;  1HKS A;  3WTT C;  3CUQ B;  1R5G A;  3T8R A;  1W7P A;  3R0J A;  1T2K A;  2A5Y B;  3C18 A;  4XBF A;  2XKO A;  4PDK A;  4A5N A;  2MLG A;  4G7Z F;  2NNY A;  5E20 A;  1KQ9 A;  4N9I A;  5IT3 A;  4M73 A;  3G73 A;  1T6S A;  3O6B B;  5BQT A;  4CO8 A;  1YW7 A;  4EJO A;  3ZN1 A;  4ZYE A;  1XGS A;  1SMY F;  1FSH A;  2FSW A;  2HKO A;  3KZZ A;  2JT1 A;  1EH8 A;  2VBY A;  4EJV A;  4WX9 A;  4L18 B;  3ML6 A;  2OAZ A;  2JTV A;  3KCC A;  1RNL A;  2ZXJ A;  3BWG A;  3FWE A;  2GZW A;  2EJR A;  2FRH A;  4CGZ A;  3K1N A;  3QP5 A;  3I64 A;  3RTR A;  1KA8 A;  1T38 A;  1KU3 A;  4XSX F;  4AD9 A;  3CLO A;  3RPQ A;  5DEQ A;  1F5T A;  2IPQ X;  4BYY A;  1HBX G;  4HQM A;  2E1C A;  2X0L A;  3T5X A;  3E5Q A;  5LHH A;  4LK0 F;  1IZ1 A;  2QBY A;  2L4M A;  4H0E A;  1WWX A;  2ZME A;  3DEU A;  4BHC A;  2O8X A;  3NQO A;  2HS5 A;  1MKM A;  2CO5 A;  2EA2 A;  3FHZ A;  1BM9 A;  4HDV A;  2BGC A;  2QBY B;  3KE2 A;  2XAQ A;  2MD5 A;  2B0L A;  5FB2 A;  3GXO A;  1OR7 A;  1U3E M; 
#chains in the Genus database with same CATH topology
 2AHQ A;  2F4O B;  2V9P A;  3BCA A;  1JXS A;  5L3G A;  5C44 J;  3CME I;  2A69 F;  2CJJ A;  1ZLK A;  1FIA A;  2WC2 A;  3P9K A;  1JUS A;  4AIJ A;  2ZFW A;  2KQR A;  2EBI A;  3G1L A;  3L2C A;  4BXU A;  2Q1Z B;  1P7I A;  4ANJ A;  1Y1W J;  2HOA A;  2A6E F;  2ESN A;  2LLK A;  2E60 A;  3G2B A;  5ICF A;  1I1G A;  1QPM A;  2VKV A;  4E7J A;  1MD0 A;  1ZTR A;  2X1D A;  2R7T A;  1SD6 A;  1W7P B;  4E7I A;  1A04 A;  5TRD A;  1YJN I;  4B3X A;  4JK1 X;  5EDN A;  4G6D A;  4BQN A;  1VQ9 I;  1TT5 B;  2MG4 A;  2R7U A;  1XMX A;  2XKP A;  3SFZ A;  3WTZ A;  1LFP A;  1D1C A;  5DM7 F;  2JVG A;  4B4C A;  5M5X J;  3S2W A;  5FLX Z;  2VE9 A;  4U0V A;  1RC9 A;  3K2Z A;  4C2M J;  2D1V A;  3MKW B;  2F5D A;  1FYM A;  2BXZ A;  1D0Z A;  3F21 A;  3FZV A;  1W36 D;  2DDB A;  3VYU B;  1OCT C;  4OMZ A;  4BH9 A;  2FML A;  1QVU A;  1ZAR A;  3K69 A;  3LFK A;  2EFO A;  4LGW A;  4EGY A;  3DBH B;  2H94 A;  4GO1 A;  5J4Y A;  4KMF A;  2HNH A;  3GWZ A;  1B9M A;  4V2F A;  2DYR H;  4GYI A;  3K4C A;  1A31 A;  1AKH A;  2OTL I;  2V7F A;  3LOC A;  1HF0 A;  2DJN A;  2ZKZ A;  3P9C A;  1JKR C;  4GDF A;  1QHH D;  4CA0 A;  4BJ6 C;  4A6D A;  1MMG A;  2VE8 A;  3M1C A;  1LPQ A;  2GXG A;  2HFH A;  4RGU A;  1U9N A;  2QQ9 A;  3H36 A;  3E5U A;  3VSK A;  5DUK A;  2M8E A;  5LFA A;  3M8E A;  1QPI A;  4RBO A;  2RNJ A;  1DQU A;  3WTX C;  4HV5 A;  1VFC A;  2DOA A;  4KIG A;  3FXO A;  2KL4 A;  1MSE C;  4I7H A;  1MZB A;  2FU4 A;  3CMY A;  1ERD A;  2E36 A;  3F23 A;  2IJL A;  3EYY A;  1K61 A;  1ZG3 A;  2K9L A;  3DQV C;  1ZRF A;  2VKD A;  1J09 A;  5EEA A;  1W0T A;  4N0B A;  5B1A H;  3OIO A;  3NWT A;  3LSP A;  3BP8 A;  2DCE A;  2A68 F;  2RQQ A;  4XRS A;  1WRJ A;  2Y75 A;  5LEJ A;  2L7F P;  2Z5U A;  2QKL B;  2GIV A;  5D5V B;  2JPC A;  2M34 A;  1IV8 A;  2JPB A;  2KRC A;  5TJJ A;  4Y13 A;  2PFB A;  4OIO F;  3GTO J;  5EYR A;  2R7F A;  5HLG A;  2OCE A;  3WU0 A;  5J1R A;  2IA1 A;  2WY8 Q;  3AKZ A;  3LNQ A;  2VPL A;  2L3D A;  2GQQ A;  1BW6 A;  1PVE A;  3K1P A;  2VQL A;  2BZT A;  2DTR A;  1TWA J;  2PMU A;  3ZMS A;  3C1D A;  1Y0N A;  5JHF A;  5GP9 A;  3HUG A;  5D5U B;  3VDX A;  4NDL A;  3CC2 I;  1YLF A;  1T56 A;  1IF1 A;  4BAY A;  5CYV A;  2ZME B;  1G6N A;  5HLI A;  1H9T A;  2DU9 A;  3BR6 A;  2VIX A;  1J9I A;  3E6M A;  3IAM 2;  4FX0 A;  3N97 A;  1FC3 A;  2P5L C;  5HLH A;  1ZRC A;  5CVR A;  2BY1 A;  3BZC A;  3K10 A;  5D5W B;  1G3T A;  4RGR A;  4LLG F;  3I4N J;  1YIT I;  3HOW J;  3RZD J;  4C2T A;  3DXJ F;  2WAQ A;  3E97 A;  3FKI J;  3OYA A;  1ZRD A;  3CD6 I;  3HIF A;  3F6O A;  2RAE A;  3KZI C;  4WCG A;  3FBI B;  2DA3 A;  5F6F A;  3N05 A;  3KFW X;  1MGT A;  2A6H F;  2VL8 A;  1YIO A;  2W84 A;  4A3F J;  4UNO A;  3S1R J;  1GXQ A;  3E6D A;  3FXJ A;  4JOM A;  3IH4 A;  2R7O A;  3LSJ A;  2RDP A;  3OYL A;  5B5E C;  1E3P A;  4BQA A;  5IYD J;  2JRT A;  2M7B A;  2DFI A;  3G6E I;  4AU7 A;  2QEN A;  5DV5 A;  4ZDP A;  5IYC J;  2M3A A;  1WJC A;  5H6R A;  3SEQ A;  1ULY A;  2KRF A;  2IS6 A;  3RKW A;  5IP9 J;  2AXL A;  2HVR A;  1USS A;  1FBQ A;  2G7H A;  1A5J A;  2FQ3 A;  2ZXW H;  3OY9 A;  3HPH A;  1MSF C;  1KQ0 A;  4I76 A;  1R6R A;  5E1X A;  4U7B A;  1XMK A;  2CSO A;  2BHZ A;  1WPK A;  2HU9 A;  1R00 A;  4XLE A;  3OR2 C;  3HGY A;  1YOV B;  3BR1 A;  2GBY A;  3E1S A;  1FTZ A;  1KGS A;  4E7L A;  3S16 J;  3JSO A;  1JTY A;  4XIC A;  1IC8 A;  1BI2 A;  2STT A;  4CIC A;  1SEU A;  2EV0 A;  1I1S A;  2GLO A;  1ZKG A;  4XKB A;  3W3C A;  2DK8 A;  2GXA A;  1XGN A;  2NVX J;  2JUG A;  2DK5 A;  4DNC A;  4R79 A;  5E3O A;  4WXC A;  2CMP A;  2HI3 A;  3V7R A;  1YYV A;  1J75 A;  2DT5 A;  2QVO A;  4NC8 A;  5L3E A;  3GBG A;  4ABZ A;  4HA8 A;  1T39 A;  3T8T A;  2CH0 A;  1S7E A;  2BXY A;  3JTG A;  4HF1 A;  4XOT A;  4D0P A;  3CCE I;  2MLK A;  5GTH C;  3EUH A;  3HRU A;  1V3F A;  3KP5 A;  4LLL A;  3OYI A;  3LAJ A;  1LEB A;  3RYR A;  1TTY A;  3L09 A;  1Z6R A;  2HOS A;  3DKY A;  2E35 A;  3C3W A;  1IW7 F;  5H6Q A;  3IKT A;  2O6G E;  1YJW I;  4XID A;  3WHB A;  3CDL A;  2IS4 A;  3TP3 A;  1ZGJ A;  1W4M A;  2PMZ A;  2JA7 J;  1ORK A;  4V2G A;  1OKR A;  4IO9 F;  3LQR A;  4M6X A;  5KNL A;  3OS1 A;  3PUF A;  3I53 A;  3PM1 A;  1R1T A;  3VSL A;  3WG9 A;  3DWL E;  4EAT A;  1Z7L A;  2MYS A;  4DYQ A;  1HKQ A;  4MNU A;  3M3Y J;  2Q2E B;  2YU3 A;  1TQI A;  2ZJQ F;  2PBI A;  4U0Y A;  2ICW G;  1X19 A;  5HVQ C;  3OYN A;  2XAF A;  1JGG A;  4BUP A;  3PFY A;  4ZYG A;  5DTD A;  4M3G A;  1ZEL A;  1IN5 A;  1OPC A;  1OCC H;  3FIS A;  4PK4 A;  4MQ9 F;  2DT6 A;  2A5W A;  1R9T J;  4PSX A;  1QBJ A;  4I0A A;  1UST A;  1Z05 A;  3REO A;  2MSY A;  3F9K A;  1W5S A;  1K6Y A;  3HL2 A;  2AS5 F;  3BJO A;  3ZPL A;  4AM3 A;  2KPM A;  3BPX A;  3KIO A;  1RKW A;  3TOB A;  3TO9 A;  3WTS C;  3BZK A;  1APL C;  3TW7 A;  2M4G A;  2OA4 A;  1DP3 A;  2MA3 A;  3ERM A;  3TO6 A;  1PYV A;  3W6K B;  4K2E A;  4NB5 A;  2L0K A;  1WH7 A;  2E19 A;  1R23 A;  2CW8 A;  1OYY A;  3CJR B;  2LTP A;  4O3M A;  2O0Y A;  3CES A;  5FLX K;  2XF6 A;  3VEP A;  4F92 B;  2HKX A;  2HQR A;  3OIQ A;  2JRM A;  2NNN A;  1TLH B;  1LNW A;  2VPR A;  4EJT A;  1D0X A;  3WU2 C;  4PJM A;  1N25 A;  3ABL H;  3LSR A;  2KJC A;  3VWB A;  4BDZ A;  1V55 H;  3FM3 A;  2B9S A;  3GTJ J;  2L4A A;  1SD5 A;  2K9M A;  2Y30 A;  3Q0V A;  4MEY F;  3ECO A;  3R60 A;  4XK4 A;  1ZGW A;  2PQ8 A;  4PGH A;  2VT3 A;  2VN2 A;  4RB0 A;  4P96 A;  3L2V A;  5TIS C;  2VOP A;  4PJN A;  4IRG A;  3BTJ A;  1P9Q C;  2DA2 A;  2VT2 A;  4BGD A;  3NEU A;  1Y1V J;  3OYC A;  3SZT A;  3IKV A;  4KIB A;  3SJM A;  4A0Z A;  4PCQ A;  1ETX A;  3GW2 A;  2XVC A;  3KEO A;  3ZOB A;  1HSJ A;  3ZQQ A;  4NC7 A;  3CDH A;  1I3A A;  3A4C A;  1DUX C;  2PLY A;  2CUJ A;  1YG2 A;  3BG7 A;  1X3Z B;  2A05 A;  4C9Y A;  5FKK A;  2P5K A;  4XN0 A;  4HDU A;  2XAS A;  2KIU A;  5HDK A;  2HXI A;  1OCR H;  1ZLJ A;  2W1O A;  2Y9Y A;  3DV8 A;  5H20 A;  2VLA A;  1RZ4 A;  1FLI A;  3TW6 A;  1OCP A;  3GFL A;  4U88 A;  1V4R A;  3PUB A;  2L2O A;  3H3Z A;  3OYM A;  3Q3S A;  3OYD A;  3ABK H;  3WE3 A;  3ZQ7 A;  3R4K A;  2ID3 A;  3F3X A;  3TGN A;  2XUB A;  3QAH A;  2NYX A;  2ZO4 A;  3E3V A;  3COA C;  2CYY A;  3KZY A;  3QYF A;  3K1M A;  3QOP A;  3GTM J;  1WJB A;  2EIJ H;  4Z6Y A;  2MBF A;  5IP6 A;  1ZRE A;  9ANT A;  3LSI A;  1ZH5 A;  3U9G A;  4E7K A;  1VZ0 A;  2LYC A;  2X1E A;  5ILU A;  1J59 A;  3VYT B;  5HS9 A;  2FJ1 A;  2VXZ A;  2QSG X;  4XQF A;  3S8P A;  1XTA A;  2VXD A;  1A35 A;  4N4N B;  1PDN C;  3TDZ C;  5F0C A;  4KNY A;  2YU9 J;  4BQO A;  3GME A;  3MKL A;  3ECH A;  1XCV A;  4IQ4 A;  3ELK A;  5FKN A;  3NWS A;  2L9V A;  4MHG A;  4G6Q A;  1QRY A;  1LQ1 A;  3FK6 A;  1M1E B;  3HRT A;  1WH5 A;  4CZC A;  4V19 K;  3L00 A;  2JA6 J;  3PSI A;  1U8B A;  1R49 A;  2ZCW A;  2GIZ A;  1RES A;  4ZZD A;  1FBS A;  3GFM A;  2EIL H;  4RM3 A;  5DM6 F;  3J7Z I;  3CMA I;  2XSD C;  2VB6 A;  4UUV A;  4OIQ F;  2GA1 A;  3R6S A;  4HNT A;  3BQY A;  1V5G A;  3HG9 A;  3FF5 A;  2VUM J;  2GOX B;  2P0W A;  1H0M A;  3BTI A;  2IRF G;  3FXM A;  3S14 J;  4QWQ A;  4XKC A;  4PFO A;  2CG4 A;  3CJN A;  5E1W A;  1VND A;  4MO7 A;  4DBQ A;  5BMZ A;  1B72 A;  2Y69 H;  4EJW A;  4CCL A;  3HUG B;  4UVC A;  1IXC A;  3LAP A;  5C4X J;  2OCC H;  3SQN A;  1MND A;  3QQA A;  1BR2 A;  5L3C A;  2DYS H;  2EB7 A;  1H89 C;  1OMI A;  1JKP C;  5FLM J;  1GUU A;  3LWF A;  4HST A;  3WGI A;  2DBB A;  2Q2E A;  3F22 A;  3JRF A;  2Z99 A;  1ZG5 A;  2DLL A;  4FHT A;  3CC4 I;  1TBX A;  1SFE A;  5LGT A;  2FBK A;  2DA7 A;  3KEY A;  3OYH A;  1JT0 A;  4EM1 A;  3I3L A;  4XOR A;  2DMN A;  1E3H A;  3BJ6 A;  4HZF A;  1PUF B;  3ZMT A;  4D9J A;  2O61 A;  1IRF A;  1YJ9 I;  4Y17 A;  4ZZL A;  5FRM A;  5EGO A;  2G7U A;  3G71 I;  3GLL A;  2M87 A;  3U21 A;  2E1M C;  1ONV A;  1QQI A;  4Y52 J;  3AFH A;  2L9N A;  3VOD A;  2E1N A;  3ZXS A;  1S7O A;  3O8H A;  1B8I B;  2R7R A;  2GA2 A;  2JA2 A;  3M07 A;  3QPS A;  3GTK J;  4Q4Z F;  2OU2 A;  4YFX F;  5KAI C;  4DOZ A;  2OC6 A;  3HTU A;  4YEL A;  2ECB A;  2XRN A;  2E7X A;  3FX3 A;  3T0Y A;  2HDC A;  3UNG C;  4RAF A;  3CP2 A;  3CCU I;  3F8N A;  1X1D A;  1WSU A;  1J7K A;  2Z1D A;  3H5A A;  2UV1 A;  1SD7 A;  2CV1 A;  3ZQC A;  1AHD P;  5HS8 A;  5M5W J;  4LIU A;  3J81 K;  1G4D A;  3CJT B;  2IP2 A;  3V8K A;  3GTQ J;  1Z0X A;  2PN6 A;  2LKX A;  1R7J A;  2JMW A;  2OQG A;  3JAM Z;  2L9S A;  4Y3O A;  2E1M B;  2P8T A;  3IRR A;  2DI3 A;  2RGV A;  2HQ5 A;  1GDT A;  5FJ8 J;  4YFN F;  3RJP A;  3VYS B;  1HKT A;  1D1B A;  3Q5F A;  1P4X A;  3O8G A;  1IRX A;  1ON2 A;  2LF7 A;  1KYW A;  1ITY A;  5K7Z A;  1ZG1 A;  3AL0 B;  5LRS A;  3PQK A;  4D7M A;  3FDY A;  3G3Z A;  4CHU A;  3PNT A;  2LF8 A;  4BXX J;  3Q9S A;  1NG7 A;  4A3M J;  2HGC A;  2WB1 A;  3BT9 A;  3GYH X;  3OYF A;  3QPH A;  1C0W A;  4L5I A;  2GWR A;  2ZSI B;  2LRE A;  4DQ2 A;  1QGP A;  3AG2 H;  1J2X A;  2IAI A;  4JP0 A;  2WY7 Q;  2VJI A;  1UAA A;  2D2W A;  4R8H A;  5KCM A;  3E5X A;  3I9V 2;  4JQF A;  1B9N A;  1JE8 A;  2P5V A;  2KJB A;  2R7D A;  4Q48 A;  1ZK8 A;  3T1B A;  3RYP A;  2HWV A;  4HQE A;  1TP4 A;  4IF4 A;  3VPR A;  4HNV A;  2M7A A;  5FFZ A;  3DKW A;  2M5W A;  3UKG A;  4A3K J;  3RPU A;  2VKE A;  4FIS A;  2MAB A;  2EZL A;  5HOD A;  1N77 A;  4MEX F;  2E2J J;  2JJ7 A;  1E0E A;  3HGG A;  2EQR A;  1BI1 A;  1MNM C;  1B59 A;  2VOD A;  1FZP B;  4XRS G;  4XLN F;  1LVK A;  1VQ8 I;  1D8J A;  4B47 A;  4S05 A;  3ZRG A;  3M8J A;  4A5M A;  3I59 B;  4ENN A;  4ZDO A;  4KIC A;  3I54 A;  2WB1 N;  3FMR A;  2VQG A;  1WJ5 A;  5ERI A;  4RMN A;  1LB2 A;  3HKZ A;  2W24 A;  2HYG D;  2P81 A;  2QQA A;  4HV6 A;  1UJ8 A;  1X3W B;  2QYO A;  4O5V A;  4RS8 A;  2R5Z A;  2XPV A;  2K7L A;  1O4X A;  3CCL I;  4Q47 A;  3MZH A;  3HRM A;  2DN0 A;  3CCS I;  4IRI A;  5AIQ A;  4A3D J;  3RKY A;  4OWR B;  3FXU A;  3RQI A;  1SFO J;  3BG3 A;  4P9F A;  1YHQ I;  1XSV A;  4X1E A;  1O3Q A;  4IRH A;  2R7X A;  3KLN A;  1D0Y A;  3K0L A;  1B72 B;  5IP7 J;  1IRZ A;  3GTP J;  3HEF A;  2M9H A;  1Y6I A;  2YR2 A;  5D8L B;  2RC4 A;  3WTY C;  4MTE A;  3DTK A;  3QU3 A;  3MFK A;  1JHF A;  1HA8 A;  1XC5 A;  4M9Z A;  1BOB A;  1HW1 A;  2E34 A;  4ZH4 F;  4KDP A;  1PJR A;  3AL0 C;  4B1R A;  4A12 A;  5E3L A;  2DA4 A;  4XON A;  1KU2 A;  3B73 A;  3MEX A;  4F52 A;  5GPA A;  2DFF A;  1JUM A;  3OMY A;  2IS1 A;  3I4M J;  2ZNZ A;  2VBZ A;  5A2Q K;  2R7S A;  2RVC A;  1KU9 A;  1LEA A;  1X4O A;  3GFI A;  2I8D A;  1VQ4 I;  4U87 A;  4BBR J;  3WTV C;  5FKM A;  2KDZ A;  1BW5 A;  2X85 A;  5BOX A;  2OD5 A;  3E6B A;  4UVB A;  5C4J J;  1Q1V A;  3S3N A;  5D6E A;  1UG2 A;  3OYE A;  2DJI A;  2JWT A;  3IAS 2;  2CW0 F;  3NAR A;  1S29 A;  1B4A A;  1CF7 B;  1XDU A;  2JA5 J;  3CMM A;  3JRE A;  5D5X B;  4LB6 B;  3ZCO A;  4HNU A;  5E3M A;  4I98 B;  3S3M A;  2R92 J;  3HRS A;  4B44 A;  4Y7N J;  4FCY A;  4GFB A;  5M5Y J;  1UFM A;  1IXS B;  2ELK A;  2VQH A;  1RPW A;  3MZY A;  3QPT A;  4KUM A;  4M6V A;  5B1B H;  1YO5 C;  2HYF A;  3K70 C;  5J8C A;  2PJP A;  4IQJ A;  3TQN A;  3UR3 C;  3CDI A;  3CUO A;  2QWW A;  1E2X A;  2W00 A;  5L3D A;  2J5P A;  3TO7 A;  1ETY A;  1T0F A;  4OIR F;  3L2W A;  4GXO A;  3EUK L;  2E2I J;  5D4S A;  1L0O C;  1X1A A;  3WOD F;  2ELJ A;  4YFK F;  2IW5 A;  2WBM A;  2F4M B;  4IJA A;  3CCY A;  1A6I A;  1MH3 A;  2V1X A;  3CF5 F;  1FY7 A;  1FMW A;  2WV1 A;  1F43 A;  4IEJ A;  3I58 A;  1EKE A;  1XGM A;  1IJW C;  4DGW B;  1FBU A;  4X0G A;  2KIM A;  2JUC A;  4FE4 A;  3G4S I;  1DPR A;  2LSO A;  2MH9 A;  4M9S A;  2MC4 A;  3BG9 A;  4A6E A;  2DXI A;  3B02 A;  4HPQ A;  1CQT A;  1XD7 A;  5JHU A;  1Y56 A;  4L5J A;  3HOV J;  4Y33 A;  4BL0 B;  5M3M J;  1X4P A;  3I71 A;  1U5T C;  2PJR B;  3I0T A;  2H8W A;  1IRG A;  3PIO F;  2XPW A;  2WV0 A;  1BN5 A;  4M3B A;  4L9T A;  3E0J B;  1KU7 A;  2UXN A;  2ZXH A;  1OCZ H;  1JJ6 C;  1I3Q J;  1BC8 C;  2OBP A;  1XMA A;  1BBY A;  3QYB A;  5LRR A;  4QIW N;  2DMP A;  5AIP A;  3J81 Z;  3KEQ A;  1EA3 A;  3W6J B;  4FE7 A;  4C3H J;  4OOI A;  5F0F A;  3ISP A;  1B1B A;  3KP7 A;  2H6C A;  3PL8 A;  2M8G X;  3V7S A;  3X2Q H;  1H8A C;  1R36 A;  1A36 A;  3QOD A;  3R61 A;  2H8R A;  2FUG 2;  5FD5 A;  2J5O A;  4PFP A;  1P6R A;  3QP6 A;  4TV7 A;  1TZL A;  1FWZ A;  5FLV A;  4XMY A;  1B6A A;  3WGH A;  1D5V A;  2EFW A;  1S8N A;  2E1O A;  2MGQ A;  1F1Z A;  4D7N A;  3EPZ A;  2XF7 A;  3O2P E;  3ZQF A;  3CQZ J;  2YSR A;  4E7S A;  2VJ4 A;  2ZB9 A;  4IX7 A;  1EF4 A;  2E71 A;  4Q5S F;  1O3T A;  1KYZ A;  4A0X A;  3FM5 A;  2QGU A;  2X51 A;  3FMQ A;  2R7Q A;  4RB1 A;  2MD0 A;  2EH3 A;  1R1U A;  4F93 B;  5D6F A;  3WGG A;  1ETO A;  1BIB A;  4CCK A;  3U2R A;  2F5C A;  2O9L A;  1FPQ A;  1P4W A;  1O57 A;  3IUO A;  1CGP A;  3TBI A;  5F04 A;  2X9D A;  1PP8 F;  3J80 K;  4F55 A;  3ONQ A;  5GAG J;  5KAF C;  1IG7 A;  4IHY A;  3MZ8 A;  3G1O A;  3L9F A;  2HDD A;  3F8C A;  4EVI A;  1MBF A;  3HOT A;  2NOJ B;  3J80 Z;  1G3S A;  2BYV E;  1S72 I;  3J7A O;  2KP6 A;  1WGX A;  1IN8 A;  5DCM B;  3DLL F;  1RKT A;  1UG0 A;  2W48 A;  1R71 A;  1JJ8 C;  2KIF A;  1BOA A;  2CU7 A;  3EYI A;  4GYG A;  5CVU A;  1NTC A;  1ETV A;  3S15 J;  1YE9 A;  1R1V A;  3PNV A;  2F5E A;  2JQ7 A;  1T8I A;  3TL4 X;  1AKH B;  1XB4 A;  3M4O J;  5CQG A;  1QZZ A;  1WI9 A;  2M4K A;  5ILV A;  3C2H A;  3DLA A;  1FIP A;  2XAJ A;  3HOX J;  1HLV A;  4FT8 A;  3MWM A;  1TNT A;  3TOA A;  4CCN A;  3ZQG A;  2ZJP F;  3BQZ A;  4AID A;  3M9A A;  3QWL A;  3A0H C;  4RAZ A;  2L54 A;  2LFB A;  1JI8 A;  3ULQ B;  2DA5 A;  1LVA A;  1AU7 A;  3KPH A;  4L9N A;  5F27 A;  1QO0 D;  1Z6T A;  3C2B A;  2YX4 A;  3IC7 A;  2QF7 A;  2NRA C;  2I10 A;  2YS9 A;  3ZMD A;  4RA2 A;  2H1K A;  5C3E J;  2XC7 A;  4KFC A;  2NXN B;  2X6O A;  3DKX A;  3FXR A;  4I01 A;  3IL2 A;  3S17 J;  3M8F A;  2B7E A;  3TED A;  3W2W A;  4AUX A;  1HXD A;  4LB5 A;  1T33 A;  1K79 A;  4DIQ A;  3EDP A;  1SC7 A;  2E2H J;  1K4T A;  2LY2 A;  3KLO A;  3OV8 A;  5EG0 B;  3MVP A;  1WKM A;  4A69 C;  1XSD A;  5K1Y A;  2ZJR F;  3MKZ A;  4XKV A;  1BR4 A;  5AON A;  1SVO A;  4FET A;  3QOE A;  1EV7 A;  1I39 A;  1OYW A;  3LMM A;  4YRV A;  1QVT A;  5LD2 C;  4UUS B;  3GLX A;  3LA2 A;  4B48 A;  1YW8 A;  4KIF A;  2LDU A;  1RET A;  4A3E J;  2XV4 S;  3IRQ A;  3RDI A;  4WXH A;  3SZP A;  3WG7 H;  5J8F A;  1BA5 A;  1R58 A;  2Z3Y A;  2KKO A;  2K3F A;  2A07 F;  4N4O B;  3AG1 H;  4G6T B;  4IVN A;  4IKF A;  2P6T A;  1FEX A;  3Q0W A;  1X58 A;  2RKH A;  1V5E A;  5JFR A;  1IO2 A;  2V4J C;  2TRT A;  3H0D A;  1IGN A;  5HS7 A;  4BXF A;  3BDD A;  3DFG A;  1LDJ A;  3IP4 B;  4M3F A;  4A3I J;  5M3F J;  3FIW A;  5IT9 Z;  1FSE A;  1LJ9 A;  2E7W A;  4LJZ F;  5IYB J;  4S04 A;  3K6G A;  3JRC A;  3WTU C;  2CV2 A;  5CPR B;  3PIP F;  4ZJZ A;  5LBQ A;  5L3B A;  1SFU A;  4XLP F;  5JR3 A;  3LSG A;  3HKZ N;  3O3K A;  3P5J A;  5K5O A;  2W82 A;  4RLF A;  3RPU D;  4FX4 A;  2BVL A;  4Z2Y A;  4YII A;  1K78 B;  3H35 A;  5F08 A;  2FNP A;  2DAO A;  2HOT A;  2NS8 A;  3F6V A;  1GV2 A;  3OS2 A;  3GO5 A;  1OCO H;  3EUA A;  2HR3 A;  1I50 J;  2L7Z A;  1BJZ A;  3BRO A;  1WJF A;  1ZGA A;  2EZI A;  5BPI A;  4FQG A;  1MMD A;  3LFU A;  5E3N A;  4ESJ A;  5HDG A;  5EG0 A;  4ESB A;  2UWM A;  4A93 J;  4R1H A;  1HW5 A;  1T98 A;  2ZFU A;  3CZ6 A;  1VQP I;  1G2H A;  4DZP A;  4DZJ A;  2ETH A;  1VQO I;  5A2Q Z;  2DO7 A;  4BY1 J;  3BCB A;  3HYI A;  1GHC A;  1RUN A;  2MH2 A;  4HLY A;  5JLW A;  5F1J A;  3CO7 C;  3GX4 X;  4HSR A;  1IUF A;  3V4G A;  1XPX A;  4UY8 I;  3FHN A;  3RQ4 A;  3C2G A;  1EH6 A;  5K5Q A;  4NBQ A;  5CVV A;  3LSK A;  2VJ5 A;  4HYE A;  2ZXI A;  1DP7 P;  3S1N J;  1FX7 A;  2FOW A;  4IHT A;  4UB6 C;  1U9O A;  1MH4 A;  3I5U A;  3IHU A;  1Z9C A;  1FMV A;  4QTR A;  1L3L A;  2O03 A;  3B6A A;  1W1W E;  2BHY A;  2KRH A;  4RLQ A;  1G3Y A;  1J0R A;  2COM A;  3BG5 A;  1GVJ A;  3IWZ A;  2M0C A;  3HSF A;  3B6C A;  3GFJ A;  3CP8 A;  3K2A A;  4ESF A;  2K9S A;  3I55 I;  4PZJ A;  3KYL A;  2WAD A;  1O3S A;  4UUT A;  3ABM H;  2LRD A;  2L9R A;  2LC2 A;  3DPL C;  2Z9O A;  3RKX A;  2NVT J;  3CUQ A;  4DYR A;  4AIK A;  1H9G A;  1I5Z A;  2GXB A;  2CQN A;  3H9G A;  2G0E A;  2VAS A;  1Z77 A;  3VB2 A;  2QQ8 A;  1QNT A;  4A2U A;  2L5Q A;  2EFP A;  2BVM A;  4LD5 A;  5ICC A;  3S1Q J;  2ACJ A;  1R22 A;  1Z91 A;  4G94 A;  5GAE J;  4KYW A;  2LNB A;  2DOD A;  5HOO A;  2RQP A;  5J3L A;  3I56 I;  4ON0 A;  5DCF A;  1V54 H;  4JBA A;  2HVS A;  4CXF A;  4G8X A;  1MBE A;  5IPA A;  2RRE A;  2HDW A;  4CYC B;  1OLT A;  2STW A;  2KIQ A;  2BW3 B;  1P2F A;  2PMH A;  3NRV A;  2P4W A;  3A01 A;  2F48 A;  2K3P A;  1IN7 A;  2V9K A;  3Q0U A;  3HC7 A;  1UHM A;  1MJA A;  5ICG A;  4CDG A;  1U5T A;  1S5L C;  1MBG A;  3PO3 J;  2VC1 A;  5E17 F;  1QZY A;  2ZME C;  4NC6 A;  4C3J J;  1P92 A;  3DPT A;  1ZHF A;  3BC8 A;  3V42 A;  3S1M J;  1RIO H;  2IBD A;  2XRO A;  4IPA A;  5LHI A;  4M74 A;  4ZYD A;  4P55 A;  4CCJ A;  3ZMZ A;  1QZE A;  2CWE A;  4WWC A;  2LKP A;  2A6T A;  2CFX A;  4YG2 F;  2HOE A;  3KET A;  2RN7 A;  3W6V A;  2O3F A;  2OTJ I;  1TWH J;  4HF0 A;  4J00 A;  3J7A Y;  4RB2 C;  1Z3X A;  2KLO A;  4P5O A;  3CCM I;  2HYJ A;  2ADU A;  5EGO B;  2EFN A;  3LA3 A;  1VQ6 I;  4W1U A;  4BBS J;  1UB9 A;  4MLO A;  4EM2 A;  4EV0 A;  2Y9Z A;  2PI0 A;  4WF2 A;  1SFX A;  4KMU X;  2NS0 A;  1TW3 A;  2IVM A;  3SZG A;  1WJA A;  1FYL A;  3H5R A;  5FFX A;  4D1Q A;  2O7O A;  1HW2 A;  4KA4 A;  1RR8 C;  4OU0 A;  3K7A J;  3KP2 A;  4J01 A;  2R7Z J;  2K4J A;  1EH7 A;  3ABT A;  1YI2 I;  3NAU A;  2QLZ A;  2XRL A;  2XF5 A;  1GT0 C;  4H4K C;  4ETS A;  4DBR A;  5JLX A;  3SHF A;  2HQN A;  2Z2S B;  1PUE E;  1X1C A;  2CQ7 A;  1Z3Y A;  3BZ6 A;  3DU6 A;  4QSH A;  2OPT A;  3MN2 A;  2PMZ N;  2WWY A;  1JT6 A;  2ZJ2 A;  3HOZ J;  3DP7 A;  3DBL B;  4OIP F;  1S7A A;  3F8M A;  4G9Y A;  1BJA A;  2DFH A;  2DPD A;  4KN4 X;  2K27 A;  3CC7 I;  3HHH A;  1HST A;  1Y8Q B;  2BOL A;  4OAY A;  2ME6 A;  3KYD B;  5FKL A;  4CYD A;  4NHJ A;  3IWF A;  2W57 A;  1YTY A;  1R5I D;  3HOS A;  1MDM A;  4WK8 F;  3L2Q A;  2RV8 A;  3JCU C;  4HLX A;  1S6L A;  2I5U A;  4DW6 A;  5J1Y A;  2K5C A;  3ASN H;  4M6Y A;  5FRO A;  3LST A;  3HPG A;  4AIH A;  3TMO A;  2QEX I;  1Y8R B;  3FMS A;  2LMD A;  2V1U A;  3H9Q A;  3MCZ A;  3J7Y J;  4WXD A;  2CS3 A;  1X3U A;  1WFX A;  5IOY A;  1K4S A;  3V8L A;  5CVJ A;  2V9V A;  3HBL A;  2XB0 X;  1FYK A;  3DU5 A;  4BE2 A;  4IHX A;  2H1L A;  2OUM A;  5EEH A;  1LKX A;  5IT9 K;  2V1N A;  5LHG A;  4IL6 C;  3AAF A;  2P7V B;  3P7N A;  1N78 A;  1O7L A;  5J6X A;  3HOY J;  2ISY A;  1DU6 A;  2FD5 A;  1O3R A;  1MBJ A;  2AQF A;  1WJD A;  2VOO A;  4II2 A;  4LG0 B;  2X6X A;  2DA1 A;  3K9T A;  4I0B A;  3OYG A;  4EEF G;  4F7Z A;  1WZ2 A;  4OAZ A;  4UHT A;  4NQW A;  2O5R A;  4PJ0 C;  3FKJ A;  2K4B A;  1YX3 A;  1ZYR F;  2KMU A;  4IZZ A;  2GAU A;  2BEO A;  3IV5 A;  4BQQ A;  2AO9 A;  3D5S C;  1IXR C;  2QSH X;  2Q8K A;  1BC7 C;  3ZMV A;  4UVA A;  3GTL J;  2M30 A;  2K02 A;  2X6Y A;  4I99 C;  2YPR A;  1U5T B;  5FO5 A;  3JRH A;  2XGX A;  1WJE A;  4MFD A;  3ZP5 A;  4E7H A;  3QRF F;  5E18 F;  1AA7 A;  4ASN A;  4X6A J;  1ON1 A;  1SD4 A;  2XAH A;  1IN6 A;  2DOE A;  1Z21 A;  3H1C A;  4W97 A;  1D8K A;  2ID6 A;  1EJ9 A;  4ZC3 A;  2R3S A;  5ED4 A;  3M7G A;  1NHA A;  3F8F A;  1O7F A;  2FE3 A;  1IAW A;  1STZ A;  2HQA A;  5IY5 H;  1JTX A;  2IGK A;  5F0H A;  1BL0 A;  4I02 A;  3D5R C;  5HLT A;  5K5R A;  1LE8 B;  2L7K A;  4XRM A;  4JX5 A;  1X1B A;  3GEZ A;  1W5T A;  3S3O A;  4KT5 C;  1TL8 A;  2IA2 A;  2D1H A;  2WAQ N;  1TQM A;  2X4H A;  4BAC A;  1HDD C;  5L3F A;  1VQ5 I;  4UXN A;  4O6J A;  5E79 C;  5ILS A;  5CLS A;  1ZR2 A;  2VJJ A;  4CZZ A;  2K86 A;  3HHG A;  4L9V A;  4HOB A;  3K4J A;  1K6O A;  1FOX A;  2R5Z B;  4B3A A;  3DPU A;  1XS9 A;  3OSF A;  2JA8 J;  3SFI A;  1HCR A;  1U6G A;  2V6C A;  4PJJ A;  1WCM J;  2UZK A;  4BDY A;  2W4S A;  3ABU A;  2CRG A;  1YRN B;  2PEX A;  3C7J A;  4XR6 A;  2CUE A;  2IA0 A;  1QHG A;  1DGW Y;  2NVY J;  4ENM A;  1REP C;  2CFO A;  2X1C A;  5LGN A;  4N9H A;  4XLH A;  1XN7 A;  1RUO A;  4U7D A;  3PJR A;  4ENJ A;  3JRB A;  3RIR A;  4G7H F;  3TKY A;  4ZDL A;  3W2A A;  3S93 A;  3ROU A;  1T08 B;  5K7F A;  2W85 A;  4XL9 A;  3ZQI A;  2OF7 A;  1S9H A;  3LA7 A;  1TWC J;  2HPI A;  1U8R A;  2QCO A;  2LY9 A;  1JUP A;  4P9U A;  3JRA A;  2XGD A;  3D1N I;  2L7M P;  5LLQ A;  3F0C A;  3LSH A;  2CQQ A;  2GOM A;  3QU6 A;  1WI3 A;  4XKW A;  5EZG A;  4MTD A;  2A3S A;  2WTE A;  1FT9 A;  2H09 A;  2XB5 A;  4D5C A;  2YX7 A;  4RGX A;  4RB3 C;  2R93 J;  4FAS D;  5E8I A;  2QSF X;  4KT6 A;  4M71 A;  2R4G A;  4BEH B;  5CVI A;  1VQM I;  4M3D A;  1KZH A;  3GCM A;  1W7P D;  2FNA A;  2H27 A;  3MMY B;  5J47 A;  2DTZ A;  1XDS A;  2EZK A;  3A0B C;  1TC3 C;  3HSE A;  2DQL A;  3ZQL A;  3W2V A;  3H0G J;  3MKY B;  1BI0 A;  4B09 A;  1G8X A;  4Y4R A;  5EEG A;  2EIM H;  3GZ6 A;  2JSC A;  2BY2 A;  4LG3 A;  4L0Z B;  1LDD A;  3H3U A;  1K7A A;  3PSF A;  4XOP A;  3DBR B;  2ME0 A;  3EUH C;  1S3J A;  2ISZ A;  5GAH J;  2AXT C;  3A01 B;  4I09 A;  4BU2 A;  3IH3 A;  2XGC A;  3ZR8 X;  2LK2 A;  2M45 A;  1VQN I;  4C2U A;  2OZU A;  3R0A A;  4NQW B;  2JSP A;  3BY6 A;  2OZ6 A;  3BPV A;  4FTH A;  4OMY A;  3OOU A;  4M9X A;  1K83 J;  1JGS A;  1TWG J;  3RCO A;  2EA4 A;  2EFQ A;  4ZTJ A;  3BTL A;  2PJR A;  2EV6 A;  2P6S A;  4L0Y B;  4G12 A;  3JRI A;  1E3O C;  3OL4 A;  4B8X A;  1SAU A;  1TWF J;  1TW2 A;  3D0S A;  5CJ9 A;  3JSP A;  1W0U A;  3E6C C;  2LKS A;  2Q0O A;  2ESH A;  1LFU P;  4UV8 A;  2CUZ A;  1UHW A;  1XCB A;  2QZ8 A;  3JRD A;  3F8B A;  4XLF A;  2QKM B;  3G1M A;  4XM3 A;  5E8G A;  4MQV A;  4I6Z A;  3BG6 A;  5DDG A;  3RKQ A;  1OJL A;  3PFI A;  1HQC A;  1D5Y A;  3RZO J;  1SVL A;  3LL7 A;  2FXA A;  1YW9 A;  2KDO A;  1R5H A;  2Z16 A;  3L1P A;  3S2H J;  2XDV A;  3GVA A;  2CUF A;  2FBH A;  3VFZ A;  3JTH A;  2HTJ A;  1OIS A;  1JHH A;  1YS7 A;  5JI6 A;  2K9Q A;  3KYC B;  1Y39 A;  3LQQ A;  1JKO C;  3Q9V A;  4GCV A;  4HX7 A;  1FOW A;  5KHD A;  2BE5 F;  1GXP A;  2VBX A;  1V5F A;  2NVU B;  4HW0 A;  1DPU A;  5DD8 A;  5D4R A;  2Y31 A;  3ZMU A;  1VF9 A;  2K9N A;  1PP7 U;  4BNC A;  1MJB A;  2D5V A;  1LFB A;  3KP4 A;  3U1D A;  5DS9 A;  2HZD A;  4ZYH A;  2R7W A;  4HRI A;  1KQ8 A;  3CUQ C;  3JRG A;  3HXL A;  2L01 A;  4CUG A;  4LLN A;  2FBI A;  4A0Y A;  1YS6 A;  2LBF A;  3KP3 A;  3MD2 A;  1B8I A;  2XHK A;  3FBN B;  5TGT A;  3N4M A;  1RI7 A;  2CW7 A;  2DPU A;  1VTN C;  1NK2 P;  2WAF A;  2MFZ A;  2F5V A;  3H5N A;  2W7N A;  4JX4 A;  3BR0 A;  3HJE A;  1SAN A;  4LIT A;  1VQL I;  3CJQ B;  1XGO A;  3QYE A;  4ENK A;  1OR7 C;  4IOA F;  5EF6 A;  3CCQ I;  4LOC A;  4EMS A;  3OOP A;  2CGP A;  4KIT B;  2OQR A;  2L02 A;  2V79 A;  3FXQ A;  1ZQ3 P;  1BIA A;  2IXS A;  2JZY A;  2XAG A;  2QUF A;  3KP6 A;  2IGO A;  4HAM A;  5BPD A;  2DOF A;  1MJ9 A;  1T0F C;  3CCV I;  1G59 A;  3HB9 A;  1TNS A;  2QQB A;  5D8K B;  5E1Z B;  1MMN A;  1POG A;  3FXK A;  4CH7 A;  3JAM K;  3CCR I;  2DW4 A;  1X1P A;  2EK5 A;  2FQ4 A;  1ZN2 A;  2ZBK A;  4E7Z A;  4U0W A;  3GZ5 A;  4PUS A;  5JVT A;  4EJU A;  3DTI A;  2WA0 A;  1YRN A;  2DQR A;  1AWC A;  4A3G J;  2V1D A;  2V26 A;  4QLC U;  3PNY A;  1OFC X;  2QM3 A;  2HVQ A;  4QPQ A;  1FOK A;  3CF2 A;  3OS0 A;  3CCJ I;  2A61 A;  4BEH A;  3JW4 A;  1WQ2 A;  1DGR M;  6PAX A;  3HSR A;  1A6Q A;  3I59 A;  3OL3 A;  1K78 A;  3HZJ A;  4IXA A;  5DD4 A;  1P4A A;  1I6X A;  4HX4 A;  4YIF A;  2ZSH B;  3PQJ A;  2W25 A;  4E6K G;  3L2U A;  2JVH A;  3FK7 A;  2P7C B;  1MBK A;  3V7C A;  5K7H A;  1F4K A;  1XX5 A;  1X2M A;  3K4N A;  3OYB A;  1FTT A;  2HZT A;  4HX8 A;  2CQX A;  2DMT A;  3H3V K;  4UV9 A;  3OR1 C;  2G9W A;  3VOE A;  4DYC A;  5F1R A;  4BE1 A;  4XSZ F;  1F36 A;  1U78 A;  3P9I A;  1YQA A;  3AG4 H;  5LEK A;  2IS2 A;  4I2O A;  1ODD A;  3GZN B;  4CCM A;  4A3J J;  2HTS A;  1ZR4 A;  2EIK H;  4IHS A;  4DJA A;  3KX2 A;  3SYT A;  4E70 A;  2TDX A;  1IDZ A;  5DUI A;  3PO2 J;  3DF8 A;  4JYK A;  3V8J A;  1E17 A;  3RI4 A;  1VQ7 I;  4B43 A;  5DYM A;  4PJL A;  2OJE D;  3GUD A;  3EET A;  5JVG F;  1GV5 A;  4C30 A;  3K4K A;  2JK3 A;  2FA5 A;  2NAZ A;  4IOC F;  1UZC A;  4LG0 A;  2FMY A;  3OYJ A;  3ERE D;  4AWX B;  2KZG A;  3GF2 A;  2Y0M A;  5F64 A;  3ASO H;  2FEZ A;  2VC0 A;  4KJZ A;  4G7O F;  4EQQ A;  1PUF A;  2R5Y B;  3BR5 A;  1FP1 D;  5KK1 A;  1ETQ A;  2WAE A;  5ICE A;  1HDP A;  3BR2 A;  4LFU A;  1MDM B;  1Z1D A;  4RAG A;  1SMT A;  3D5L A;  4LMY A;  3M1E A;  2XIG A;  5HNF A;  2ELH A;  1W5C C;  4YIR X;  1QU3 A;  2K40 A;  4C3I J;  1F9N A;  5HDN A;  3MQ0 A;  4A3L J;  1MMS A;  4HEA 2;  2F6C A;  2H6B A;  1UCR A;  2COB A;  4BS9 A;  1SAX A;  3ZGK A;  1D3Y A;  5CQE A;  3OIP A;  4ZTF A;  1FNN A;  1BI3 A;  1UHS A;  4AVP A;  3LSM A;  2ZNY A;  4RAY A;  2UXX A;  1MBH A;  4ZYA A;  3F72 A;  2Y48 A;  2NVQ J;  1IN4 A;  1R4M B;  2F2E A;  3DEE A;  5LGU A;  3CO6 C;  3WE2 A;  2AQE A;  3CLQ A;  3EQL F;  4KN7 X;  5IOZ A;  1U0J A;  5CKT A;  3S2D J;  2PG4 A;  3CTA A;  1FP2 A;  4JX6 A;  2VBW A;  4AVZ A;  3L7W A;  2EWN A;  2Z33 A;  1YFH A;  1U2W A;  2MC3 A;  2F5F A;  4QPO A;  3DCF A;  4IHW A;  3ZN0 A;  3I4P A;  5FD6 A;  3H92 A;  1Y0U A;  4EM0 B;  2HEO A;  2IGN A;  1QA6 A;  5DCM A;  4MGR A;  1RR7 A;  4PGG A;  4MIM A;  2HPM A;  1OYI A;  2CQK A;  2ZC2 A;  4HBL A;  2BY3 A;  1MNE A;  1GLN A;  2KZV A;  1IUY A;  1NG6 A;  4CCO A;  2FOK A;  3A2K A;  2PX9 A;  4XN3 A;  1YIJ I;  1G3W A;  2BBY A;  3BOQ A;  4BJ5 C;  1VQK I;  2LH9 A;  1ZAO A;  3HTS B;  4L9J A;  3HOU J;  5FRN A;  4BHP A;  2LBF B;  1J5Y A;  4GGG A;  4HF2 A;  2BY0 A;  1GVD A;  3WU1 B;  2BV6 A;  3E7L A;  2LP0 A;  4RDU A;  1Z7U A;  2EV5 A;  2Y0S N;  4BHB A;  3H9J A;  1ETK A;  4OIN F;  4Y15 A;  2EPF A;  4M72 A;  2TCT A;  1MW7 A;  5FKO A;  4A3C J;  5BS6 A;  4EGZ A;  3TDU C;  2VON A;  1DDN A;  1D1A A;  1MIJ A;  4BY7 J;  4GRI A;  2Y2Z A;  4BKX A;  4RGS A;  2E5N A;  2LY1 A;  5J40 A;  1WHU A;  3OYK A;  2CV0 A;  1UMQ A;  3BR3 A;  3DTE A;  1Q1H A;  2LVS A;  1X2N A;  2X6W A;  3IH2 A;  3SXY A;  1FJL A;  2YUS A;  3TP0 A;  2EZH A;  1DU0 A;  2M2E A;  2KHM A;  5KVR A;  2O8K A;  2R7V A;  4XNF A;  5BNG A;  1NK3 P;  2IT0 A;  2XPU A;  1XSX A;  4YEJ A;  1CF7 A;  1LDK B;  1TQP A;  1MMA A;  3MAJ A;  3QPL A;  4II3 A;  4UUS A;  3BJA A;  4XRF A;  2D45 A;  2FF4 A;  4MFE A;  4LK1 F;  5FGM A;  1AOY A;  1I27 A;  2V6E A;  3DEW A;  3AG3 H;  1Z67 A;  2M1B A;  1JKQ C;  2MW8 A;  2X48 A;  3WTW C;  2C6Y A;  3JR9 A;  1HKS A;  4AYB A;  3WTT C;  2DMQ A;  2EIN H;  3CUQ B;  1R5G A;  1ENH A;  2LOO A;  3T8R A;  1R4N B;  5B3S H;  1W7P A;  2VI6 A;  3R0J A;  1T2K A;  2DDA A;  1LE8 A;  2A5Y B;  3C18 A;  4F91 B;  4XBF A;  2XKO A;  2JN6 A;  2KIS A;  4PSW A;  4PDK A;  4A5N A;  2MLG A;  4AC0 A;  4G7Z F;  2NNY A;  5E20 A;  2XAU A;  4IHV A;  1KQ9 A;  4HG2 A;  4N9I A;  4KIS A;  1SVM A;  3GTG J;  1ACI A;  3SDG A;  3SEZ A;  4M73 A;  5IT3 A;  3G73 A;  4RM2 A;  4XLC A;  3WHC A;  1T6S A;  3O6B B;  4E4H A;  5GPC A;  2NOG A;  1LUJ B;  5BQT A;  4CO8 A;  4XLA A;  2R0Q C;  1YW7 A;  4D5F A;  4EJO A;  2HXO A;  1H88 C;  4UB8 C;  3ZN1 A;  4ZYE A;  4A3B J;  4ITV A;  4BJT A;  1XGS A;  1SMY F;  1KON A;  1FSH A;  2FSW A;  1TT0 A;  2HKO A;  3A02 A;  3KZZ A;  2JT1 A;  1EH8 A;  2VBY A;  5GAD J;  2LR8 A;  4EJV A;  5GTI C;  2KFD A;  1UEL B;  1W36 C;  1IV6 A;  1FOY A;  4AYB N;  4WX9 A;  1NH3 A;  4L18 B;  1N75 A;  3ML6 A;  1I6H J;  4CYC A;  2OAZ A;  2JTV A;  1XG1 A;  3KCC A;  1RNL A;  2ZXJ A;  3BWG A;  3FWE A;  4BE0 A;  2GZW A;  2EJR A;  1WVR A;  1OQY A;  3HM5 A;  2FRH A;  5EJC A;  2DT7 B;  1HOM A;  4CGZ A;  2LG4 A;  3K1N A;  3QP5 A;  3I64 A;  1RRJ A;  1P7J A;  3BLY A;  3RTR A;  1KA8 A;  4F3Q A;  1YX5 A;  3ZQH A;  1T38 A;  4NNJ A;  1KU3 A;  2XGE A;  4XSX F;  2E5Z A;  4AD9 A;  3HDD A;  3CLO A;  2UUZ A;  3RPQ A;  1T95 A;  5DEQ A;  2DA6 A;  2IPQ X;  4M3E A;  1F5T A;  2XSJ C;  2N8G A;  3OSG A;  3BTC A;  2M0M A;  2NS7 A;  3A1Y A;  4BYY A;  2K85 A;  1HBX G;  3FXL A;  2IGM A;  4HQM A;  3K70 D;  3A03 A;  2E1C A;  2QA4 I;  2X0L A;  3U1K A;  1HC8 A;  3ESW B;  5EZH A;  3T5X A;  5J4V A;  3E5Q A;  3SDB A;  2Y0S A;  4LK0 F;  5LHH A;  1IZ1 A;  2QBY A;  3K4M A;  2L4M A;  2DFE A;  4LIV A;  4S0H B;  4J19 A;  4H0E A;  1WWX A;  3K4B A;  3OWT A;  5J1U A;  2DMU A;  1SFK A;  2ZME A;  2VQC A;  4P1W A;  3DEU A;  2IEK A;  2KT0 A;  2VKH A;  4BHC A;  5H2F C;  2B63 J;  5B66 C;  2OV7 A;  2O8X A;  3NQO A;  2HS5 A;  2LD5 A;  1MKM A;  2CO5 A;  2EA2 A;  3FHZ A;  1BM9 A;  1ETW A;  4HDV A;  3K4L A;  2F4I A;  2BGC A;  2QBY B;  2BW3 A;  3KE2 A;  3VYR B;  2GM4 A;  3RSN A;  1IDY A;  3S32 A;  2XAQ A;  2MD5 A;  4CSW A;  5HNH A;  1BR1 A;  1VI0 A;  2B0L A;  2ECC A;  2RNG A;  4NUB A;  3L2R A;  2R5Y A;  5FB2 A;  3GXO A;  1OR7 A;  2FX0 A;  4L5E A;  1U3E M; 
#chains in the Genus database with same CATH homology
 1JXS A;  5L3G A;  2A69 F;  1ZLK A;  2WC2 A;  3P9K A;  4AIJ A;  2ZFW A;  3L2C A;  4BXU A;  2A6E F;  2ESN A;  5ICF A;  1I1G A;  1QPM A;  1MD0 A;  1SD6 A;  1W7P B;  1A04 A;  5TRD A;  4JK1 X;  4G6D A;  2XKP A;  3SFZ A;  3WTZ A;  3S2W A;  5FLX Z;  2VE9 A;  4U0V A;  3K2Z A;  2D1V A;  2F5D A;  1FYM A;  3F21 A;  3FZV A;  4OMZ A;  4BH9 A;  2FML A;  1ZAR A;  3K69 A;  3LFK A;  2EFO A;  4LGW A;  4EGY A;  2H94 A;  4GO1 A;  4KMF A;  3GWZ A;  1B9M A;  4GYI A;  2ZKZ A;  3P9C A;  4A6D A;  2VE8 A;  2GXG A;  2HFH A;  4RGU A;  2QQ9 A;  3E5U A;  5DUK A;  2M8E A;  3M8E A;  2RNJ A;  3WTX C;  4HV5 A;  4KIG A;  4I7H A;  1MZB A;  2FU4 A;  3F23 A;  2IJL A;  3EYY A;  1ZG3 A;  3DQV C;  1ZRF A;  4N0B A;  3BP8 A;  2A68 F;  1WRJ A;  2Y75 A;  5LEJ A;  2Z5U A;  2GIV A;  5D5V B;  2JPC A;  2JPB A;  5TJJ A;  4Y13 A;  2PFB A;  4OIO F;  2R7F A;  5HLG A;  3WU0 A;  2IA1 A;  2L3D A;  2GQQ A;  3K1P A;  2DTR A;  2PMU A;  3ZMS A;  3C1D A;  3HUG A;  5D5U B;  1YLF A;  1IF1 A;  4BAY A;  5CYV A;  2ZME B;  1G6N A;  5HLI A;  1H9T A;  2DU9 A;  1J9I A;  3E6M A;  4FX0 A;  3N97 A;  1FC3 A;  2P5L C;  5HLH A;  1ZRC A;  5CVR A;  5D5W B;  1G3T A;  4RGR A;  4LLG F;  3DXJ F;  3E97 A;  1ZRD A;  3HIF A;  3F6O A;  4WCG A;  5F6F A;  3KFW X;  1MGT A;  2A6H F;  1YIO A;  2W84 A;  4UNO A;  1GXQ A;  3E6D A;  2RDP A;  4BQA A;  2JRT A;  2DFI A;  2QEN A;  5DV5 A;  5H6R A;  1ULY A;  2KRF A;  3RKW A;  2AXL A;  1USS A;  1FBQ A;  2G7H A;  2FQ3 A;  1KQ0 A;  5E1X A;  4U7B A;  1XMK A;  2CSO A;  1R00 A;  1KGS A;  3JSO A;  1BI2 A;  2STT A;  4CIC A;  2EV0 A;  1I1S A;  2DK8 A;  1XGN A;  2DK5 A;  4DNC A;  4R79 A;  4WXC A;  3V7R A;  1YYV A;  1J75 A;  2DT5 A;  2QVO A;  5L3E A;  4HA8 A;  1T39 A;  3T8T A;  3JTG A;  4HF1 A;  4D0P A;  2MLK A;  3EUH A;  3HRU A;  1V3F A;  3KP5 A;  4LLL A;  3LAJ A;  1LEB A;  3RYR A;  1TTY A;  3L09 A;  1Z6R A;  3C3W A;  1IW7 F;  5H6Q A;  3IKT A;  2O6G E;  1ZGJ A;  1W4M A;  1OKR A;  3LQR A;  4M6X A;  3I53 A;  1R1T A;  3WG9 A;  1HKQ A;  4MNU A;  2YU3 A;  1TQI A;  2PBI A;  4U0Y A;  5HVQ C;  2XAF A;  4ZYG A;  1IN5 A;  1OPC A;  4MQ9 F;  1QBJ A;  4I0A A;  1UST A;  1Z05 A;  3REO A;  1W5S A;  2AS5 F;  3BJO A;  3ZPL A;  3BPX A;  3TOB A;  3TO9 A;  3WTS C;  2OA4 A;  2MA3 A;  3TO6 A;  3W6K B;  4K2E A;  4NB5 A;  1R23 A;  1OYY A;  4O3M A;  2O0Y A;  5FLX K;  3VEP A;  2HKX A;  2HQR A;  2NNN A;  1TLH B;  1LNW A;  4EJT A;  2KJC A;  3FM3 A;  2L4A A;  1SD5 A;  4MEY F;  3ECO A;  3R60 A;  2PQ8 A;  4PGH A;  2VT3 A;  2VN2 A;  4RB0 A;  4P96 A;  2VOP A;  4IRG A;  2VT2 A;  3NEU A;  3SZT A;  3IKV A;  4KIB A;  4A0Z A;  4PCQ A;  3GW2 A;  2XVC A;  3KEO A;  1HSJ A;  3CDH A;  1DUX C;  2PLY A;  1YG2 A;  2P5K A;  4HDU A;  2XAS A;  2KIU A;  5HDK A;  1ZLJ A;  3DV8 A;  5H20 A;  1RZ4 A;  1FLI A;  3GFL A;  4U88 A;  1V4R A;  3H3Z A;  3WE3 A;  3ZQ7 A;  3R4K A;  3F3X A;  3TGN A;  2XUB A;  3QAH A;  3COA C;  2NYX A;  2ZO4 A;  3E3V A;  2CYY A;  3KZY A;  3K1M A;  3QOP A;  2MBF A;  1ZRE A;  1ZH5 A;  3U9G A;  5ILU A;  1J59 A;  5HS9 A;  2VXZ A;  1PDN C;  3TDZ C;  4KNY A;  3ECH A;  1XCV A;  3ELK A;  4MHG A;  4G6Q A;  1LQ1 A;  3HRT A;  3L00 A;  2ZCW A;  4ZZD A;  1FBS A;  3GFM A;  4UUV A;  4OIQ F;  2GA1 A;  3R6S A;  3FF5 A;  1H0M A;  2IRF G;  4QWQ A;  2CG4 A;  3CJN A;  5E1W A;  5BMZ A;  4EJW A;  4UVC A;  3LAP A;  1IXC A;  3SQN A;  5L3C A;  2EB7 A;  1OMI A;  3LWF A;  3WGI A;  2DBB A;  2Q2E A;  3F22 A;  2Z99 A;  1ZG5 A;  2DLL A;  4FHT A;  1TBX A;  1SFE A;  5LGT A;  2FBK A;  4EM1 A;  3BJ6 A;  4HZF A;  3ZMT A;  2O61 A;  1IRF A;  4Y17 A;  4ZZL A;  2G7U A;  2M87 A;  1ONV A;  1QQI A;  3VOD A;  2E1N A;  1S7O A;  2GA2 A;  4Q4Z F;  2OU2 A;  4YFX F;  3HTU A;  2XRN A;  2E7X A;  3FX3 A;  3T0Y A;  2HDC A;  3F8N A;  1WSU A;  1J7K A;  1SD7 A;  5HS8 A;  3J81 K;  1G4D A;  2IP2 A;  3V8K A;  2PN6 A;  1R7J A;  2OQG A;  3JAM Z;  2P8T A;  3IRR A;  2DI3 A;  2RGV A;  4YFN F;  3RJP A;  1HKT A;  3Q5F A;  1P4X A;  1ON2 A;  2LF7 A;  1KYW A;  1ZG1 A;  5LRS A;  3PQK A;  3G3Z A;  4CHU A;  2LF8 A;  3Q9S A;  2HGC A;  3GYH X;  3QPH A;  1C0W A;  4L5I A;  2GWR A;  4DQ2 A;  1QGP A;  1J2X A;  2D2W A;  4R8H A;  3E5X A;  4JQF A;  1B9N A;  1JE8 A;  2P5V A;  2KJB A;  2R7D A;  4Q48 A;  3T1B A;  3RYP A;  2HWV A;  4HQE A;  4IF4 A;  5FFZ A;  3DKW A;  2M5W A;  3RPU A;  4MEX F;  1BI1 A;  2VOD A;  1B59 A;  1FZP B;  1D8J A;  4S05 A;  4A5M A;  3I59 B;  4ENN A;  4KIC A;  3I54 A;  3FMR A;  1LB2 A;  5ERI A;  4XLN F;  2HYG D;  2W24 A;  2QQA A;  4HV6 A;  2QYO A;  4RS8 A;  4O5V A;  2K7L A;  4Q47 A;  3MZH A;  3HRM A;  4IRI A;  5AIQ A;  3RKY A;  3FXU A;  4P9F A;  1XSV A;  1O3Q A;  4IRH A;  3KLN A;  3K0L A;  2YR2 A;  5D8L B;  2RC4 A;  3WTY C;  4MTE A;  3QU3 A;  3MFK A;  1JHF A;  4M9Z A;  1HW1 A;  4KDP A;  4ZH4 F;  4A12 A;  1KU2 A;  3B73 A;  3MEX A;  2ZNZ A;  2VBZ A;  5A2Q K;  2RVC A;  1KU9 A;  1LEA A;  3GFI A;  3WTV C;  5BOX A;  2OD5 A;  3E6B A;  4UVB A;  5D6E A;  2CW0 F;  1S29 A;  1B4A A;  1CF7 B;  1XDU A;  5D5X B;  4LB6 B;  4I98 B;  3HRS A;  1UFM A;  1IXS B;  3MZY A;  3QPT A;  4KUM A;  1YO5 C;  2HYF A;  5J8C A;  2PJP A;  3TQN A;  3CUO A;  2QWW A;  1E2X A;  5L3D A;  3TO7 A;  2J5P A;  1T0F A;  4OIR F;  4GXO A;  5D4S A;  1L0O C;  3WOD F;  4YFK F;  2IW5 A;  4IJA A;  2V1X A;  1FY7 A;  3I58 A;  1XGM A;  1FBU A;  2KIM A;  1DPR A;  2LSO A;  2MH9 A;  4M9S A;  4A6E A;  3B02 A;  1XD7 A;  5JHU A;  4L5J A;  3I71 A;  1U5T C;  3I0T A;  1IRG A;  2WV0 A;  1BN5 A;  4L9T A;  1KU7 A;  2UXN A;  1BC8 C;  2OBP A;  1XMA A;  1BBY A;  5LRR A;  5AIP A;  3J81 Z;  3KEQ A;  3W6J B;  4OOI A;  3ISP A;  1B1B A;  3KP7 A;  2H6C A;  3V7S A;  1R36 A;  3R61 A;  5FD5 A;  2J5O A;  1P6R A;  3QP6 A;  4TV7 A;  1FWZ A;  1B6A A;  3WGH A;  1D5V A;  2EFW A;  1S8N A;  1F1Z A;  3O2P E;  2YSR A;  4Q5S F;  1O3T A;  1KYZ A;  4A0X A;  3FM5 A;  3FMQ A;  4RB1 A;  1R1U A;  5D6F A;  3WGG A;  1BIB A;  3U2R A;  2F5C A;  1FPQ A;  1P4W A;  1O57 A;  1CGP A;  1PP8 F;  3J80 K;  3L9F A;  3F8C A;  4EVI A;  3HOT A;  3J80 Z;  1G3S A;  2BYV E;  3J7A O;  1IN8 A;  5DCM B;  2KIF A;  1BOA A;  3EYI A;  4GYG A;  5CVU A;  1R1V A;  2F5E A;  1XB4 A;  1QZZ A;  1WI9 A;  5ILV A;  2XAJ A;  4FT8 A;  3MWM A;  1TNT A;  3TOA A;  3M9A A;  4RAZ A;  2L54 A;  3ULQ B;  1LVA A;  4L9N A;  1QO0 D;  1Z6T A;  2YX4 A;  3IC7 A;  2NRA C;  3ZMD A;  4KFC A;  3FXR A;  4I01 A;  3IL2 A;  3M8F A;  1HXD A;  4LB5 A;  1K79 A;  3EDP A;  3KLO A;  3OV8 A;  1WKM A;  1XSD A;  5K1Y A;  5AON A;  1EV7 A;  1OYW A;  3GLX A;  3LA2 A;  1YW8 A;  4KIF A;  2LDU A;  2XV4 S;  3IRQ A;  3RDI A;  4WXH A;  3SZP A;  5J8F A;  1R58 A;  2Z3Y A;  2KKO A;  2A07 F;  4IVN A;  2P6T A;  2RKH A;  5JFR A;  5HS7 A;  3BDD A;  3DFG A;  1LDJ A;  5IT9 Z;  1FSE A;  1LJ9 A;  2E7W A;  4LJZ F;  4S04 A;  3WTU C;  5LBQ A;  5L3B A;  1SFU A;  4XLP F;  5JR3 A;  3O3K A;  5K5O A;  4FX4 A;  4Z2Y A;  4YII A;  1K78 B;  2FNP A;  2DAO A;  3F6V A;  3GO5 A;  2HR3 A;  3BRO A;  1ZGA A;  5BPI A;  4ESJ A;  5HDG A;  4ESB A;  2UWM A;  4R1H A;  1HW5 A;  1T98 A;  2ETH A;  5A2Q Z;  2DO7 A;  3HYI A;  1GHC A;  1RUN A;  2MH2 A;  4HLY A;  3CO7 C;  3GX4 X;  3V4G A;  1EH6 A;  5K5Q A;  5CVV A;  4HYE A;  1DP7 P;  1FX7 A;  4IHT A;  3I5U A;  3IHU A;  1Z9C A;  1L3L A;  2O03 A;  1G3Y A;  1J0R A;  2COM A;  1GVJ A;  3IWZ A;  3HSF A;  3GFJ A;  4ESF A;  4PZJ A;  1O3S A;  3DPL C;  2Z9O A;  3RKX A;  3CUQ A;  4AIK A;  1H9G A;  1I5Z A;  2GXB A;  3VB2 A;  1QNT A;  4A2U A;  2EFP A;  4LD5 A;  5ICC A;  2ACJ A;  1R22 A;  1Z91 A;  4G94 A;  4KYW A;  2LNB A;  5HOO A;  2RQP A;  4ON0 A;  5DCF A;  4JBA A;  4CXF A;  4G8X A;  2STW A;  1P2F A;  2PMH A;  3NRV A;  2P4W A;  1IN7 A;  1UHM A;  1MJA A;  5ICG A;  4CDG A;  1U5T A;  5E17 F;  2VC1 A;  1QZY A;  1P92 A;  3DPT A;  1ZHF A;  1RIO H;  2XRO A;  4IPA A;  5LHI A;  4M74 A;  4ZYD A;  4P55 A;  3ZMZ A;  2CWE A;  4WWC A;  2LKP A;  2CFX A;  4YG2 F;  2HOE A;  3KET A;  2RN7 A;  2O3F A;  4HF0 A;  4RB2 C;  4P5O A;  2ADU A;  2EFN A;  3LA3 A;  1UB9 A;  4EM2 A;  4EV0 A;  2PI0 A;  4WF2 A;  1SFX A;  4KMU X;  2NS0 A;  1TW3 A;  2IVM A;  1FYL A;  5FFX A;  1HW2 A;  4KA4 A;  4OU0 A;  3KP2 A;  2K4J A;  1EH7 A;  3ABT A;  2QLZ A;  4ETS A;  3SHF A;  2HQN A;  1PUE E;  3BZ6 A;  2WWY A;  2ZJ2 A;  3DP7 A;  4OIP F;  1S7A A;  3F8M A;  4G9Y A;  1BJA A;  2DPD A;  4KN4 X;  2K27 A;  3HHH A;  1HST A;  4CYD A;  4NHJ A;  3IWF A;  2W57 A;  1YTY A;  3HOS A;  1MDM A;  4WK8 F;  2RV8 A;  4HLX A;  1S6L A;  4M6Y A;  4AIH A;  3LST A;  3FMS A;  2V1U A;  3MCZ A;  4WXD A;  1X3U A;  3V8L A;  5CVJ A;  2V9V A;  1FYK A;  5IT9 K;  5EEH A;  5LHG A;  3AAF A;  2P7V B;  3P7N A;  1O7L A;  5J6X A;  2ISY A;  1O3R A;  2VOO A;  4LG0 B;  3K9T A;  4I0B A;  4F7Z A;  4UHT A;  4NQW A;  2K4B A;  1ZYR F;  2GAU A;  2BEO A;  1IXR C;  2Q8K A;  1BC7 C;  3ZMV A;  4UVA A;  2M30 A;  2K02 A;  2YPR A;  1U5T B;  5FO5 A;  2XGX A;  3ZP5 A;  3QRF F;  5E18 F;  4ASN A;  1ON1 A;  1SD4 A;  2XAH A;  1IN6 A;  1D8K A;  2R3S A;  5ED4 A;  3M7G A;  1NHA A;  3F8F A;  1IAW A;  1O7F A;  2FE3 A;  1STZ A;  4I02 A;  5K5R A;  3GEZ A;  1W5T A;  4KT5 C;  2IA2 A;  2D1H A;  1TQM A;  2X4H A;  5L3F A;  4UXN A;  4O6J A;  5ILS A;  5CLS A;  4CZZ A;  2K86 A;  3HHG A;  4L9V A;  4HOB A;  1K6O A;  1U6G A;  2V6C A;  2UZK A;  3ABU A;  2PEX A;  3C7J A;  2IA0 A;  4ENM A;  1REP C;  5LGN A;  4N9H A;  1XN7 A;  1RUO A;  4U7D A;  4ENJ A;  3RIR A;  4G7H F;  3TKY A;  3ROU A;  2W85 A;  3LA7 A;  1U8R A;  4P9U A;  5LLQ A;  3QU6 A;  4MTD A;  2A3S A;  2WTE A;  1FT9 A;  2H09 A;  2YX7 A;  4RGX A;  4RB3 C;  5E8I A;  4M71 A;  5CVI A;  1W7P D;  2FNA A;  2H27 A;  1XDS A;  3HSE A;  2DQL A;  1BI0 A;  4B09 A;  5EEG A;  3GZ6 A;  2JSC A;  4L0Z B;  1LDD A;  3H3U A;  1K7A A;  1S3J A;  2ISZ A;  4I09 A;  2M45 A;  2OZU A;  3R0A A;  3BY6 A;  2OZ6 A;  3BPV A;  4OMY A;  4M9X A;  1JGS A;  2EA4 A;  2EFQ A;  2EV6 A;  2P6S A;  4L0Y B;  4B8X A;  1TW2 A;  3D0S A;  5CJ9 A;  3JSP A;  3E6C C;  2Q0O A;  2ESH A;  4UV8 A;  1UHW A;  1XCB A;  2QZ8 A;  3F8B A;  5E8G A;  4MQV A;  5DDG A;  3PFI A;  1HQC A;  2FXA A;  1YW9 A;  1R5H A;  3GVA A;  2FBH A;  3VFZ A;  3JTH A;  2HTJ A;  1YS7 A;  1JHH A;  5JI6 A;  3LQQ A;  3Q9V A;  4GCV A;  4HX7 A;  1GXP A;  2BE5 F;  2VBX A;  4HW0 A;  1DPU A;  5DD8 A;  5D4R A;  3ZMU A;  1PP7 U;  4BNC A;  1MJB A;  3KP4 A;  3U1D A;  4ZYH A;  1KQ8 A;  3CUQ C;  2L01 A;  4LLN A;  2FBI A;  4A0Y A;  1YS6 A;  3KP3 A;  2XHK A;  3N4M A;  1RI7 A;  2DPU A;  1VTN C;  1XGO A;  4ENK A;  4EMS A;  3OOP A;  2CGP A;  2OQR A;  2L02 A;  2V79 A;  3FXQ A;  1BIA A;  2JZY A;  2XAG A;  2QUF A;  3KP6 A;  4HAM A;  5BPD A;  1MJ9 A;  1TNS A;  2QQB A;  5D8K B;  5E1Z B;  3JAM K;  2DW4 A;  2EK5 A;  2ZBK A;  1ZN2 A;  4U0W A;  3GZ5 A;  5JVT A;  4EJU A;  2DQR A;  1AWC A;  2V1D A;  4QLC U;  2QM3 A;  1FOK A;  2A61 A;  3JW4 A;  1WQ2 A;  6PAX A;  3HSR A;  3I59 A;  1K78 A;  4IXA A;  5DD4 A;  1P4A A;  1I6X A;  4HX4 A;  4YIF A;  3PQJ A;  2W25 A;  2P7C B;  3V7C A;  1F4K A;  2HZT A;  4HX8 A;  4UV9 A;  2G9W A;  3VOE A;  5F1R A;  4XSZ F;  1U78 A;  3P9I A;  1YQA A;  5LEK A;  4I2O A;  1ODD A;  2HTS A;  4IHS A;  4E70 A;  2TDX A;  5DUI A;  3DF8 A;  3V8J A;  1E17 A;  3RI4 A;  5DYM A;  3GUD A;  3EET A;  2FA5 A;  2NAZ A;  4LG0 A;  2FMY A;  3ERE D;  4AWX B;  3GF2 A;  2Y0M A;  5F64 A;  2FEZ A;  2VC0 A;  4G7O F;  4EQQ A;  1FP1 D;  5KK1 A;  5ICE A;  4LFU A;  1MDM B;  1Z1D A;  1SMT A;  3D5L A;  4LMY A;  3M1E A;  2XIG A;  2ELH A;  1F9N A;  5HDN A;  3MQ0 A;  2H6B A;  1UCR A;  1SAX A;  1D3Y A;  1FNN A;  1BI3 A;  4AVP A;  2ZNY A;  4RAY A;  2UXX A;  3F72 A;  2Y48 A;  1IN4 A;  2F2E A;  5LGU A;  3CO6 C;  3WE2 A;  3EQL F;  4KN7 X;  2PG4 A;  3CTA A;  1FP2 A;  2VBW A;  3L7W A;  2EWN A;  2Z33 A;  1YFH A;  1U2W A;  2MC3 A;  2F5F A;  3ZN0 A;  3I4P A;  5FD6 A;  3H92 A;  1Y0U A;  4EM0 B;  2HEO A;  5DCM A;  4MGR A;  4PGG A;  1OYI A;  2CQK A;  4HBL A;  1IUY A;  2FOK A;  1G3W A;  2BBY A;  3BOQ A;  1ZAO A;  3HTS B;  4L9J A;  4BHP A;  1J5Y A;  4GGG A;  4HF2 A;  3WU1 B;  2BV6 A;  1Z7U A;  2EV5 A;  4BHB A;  4OIN F;  4Y15 A;  4M72 A;  5BS6 A;  4EGZ A;  3TDU C;  2VON A;  1DDN A;  4RGS A;  1Q1H A;  3SXY A;  5KVR A;  2IT0 A;  1XSX A;  1CF7 A;  1LDK B;  1TQP A;  3MAJ A;  3BJA A;  4XRF A;  2D45 A;  2FF4 A;  5FGM A;  4LK1 F;  1AOY A;  1I27 A;  2M1B A;  3WTW C;  2C6Y A;  1HKS A;  3WTT C;  3CUQ B;  1R5G A;  3T8R A;  1W7P A;  3R0J A;  1T2K A;  2A5Y B;  3C18 A;  4XBF A;  2XKO A;  4PDK A;  4A5N A;  2MLG A;  4G7Z F;  2NNY A;  5E20 A;  1KQ9 A;  4N9I A;  5IT3 A;  4M73 A;  3G73 A;  1T6S A;  3O6B B;  5BQT A;  4CO8 A;  1YW7 A;  4EJO A;  3ZN1 A;  4ZYE A;  1XGS A;  1SMY F;  1FSH A;  2FSW A;  2HKO A;  3KZZ A;  2JT1 A;  1EH8 A;  2VBY A;  4EJV A;  4WX9 A;  4L18 B;  3ML6 A;  2OAZ A;  2JTV A;  3KCC A;  1RNL A;  2ZXJ A;  3BWG A;  3FWE A;  2GZW A;  2EJR A;  2FRH A;  4CGZ A;  3K1N A;  3QP5 A;  3I64 A;  3RTR A;  1KA8 A;  1T38 A;  1KU3 A;  4XSX F;  4AD9 A;  3CLO A;  3RPQ A;  5DEQ A;  1F5T A;  2IPQ X;  4BYY A;  1HBX G;  4HQM A;  2E1C A;  2X0L A;  3T5X A;  3E5Q A;  5LHH A;  4LK0 F;  1IZ1 A;  2QBY A;  2L4M A;  4H0E A;  1WWX A;  2ZME A;  3DEU A;  4BHC A;  2O8X A;  3NQO A;  2HS5 A;  1MKM A;  2CO5 A;  2EA2 A;  3FHZ A;  1BM9 A;  4HDV A;  2BGC A;  2QBY B;  3KE2 A;  2XAQ A;  2MD5 A;  2B0L A;  5FB2 A;  3GXO A;  1OR7 A;  1U3E M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...