3I76A

The crystal structure of the orthorhombic form of the putative had-hydrolase yfnb from bacillus subtilis bound to magnesium reveals interdomain movement
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
228
structure length
223
Chain Sequence
KRYRTLLFDVDDTILDFQAAEALALRLLFEDQNIPLTNDMKAQYKTINQGLWRAFEEGKMTRDEVVNTRFSALLKEYGYEADGALLEQKYRRFLEEGHQLIDGAFDLISNLQQQFDLYIVTNGVSHTQYKRLRDSGLFPFFKDIFVSEDTGFQKPMKEYFNYVFERIPQFSAEHTLIIGDSLTADIKGGQLAGLDTCWMNPDMKIIPTYEIRKLEELYHILNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the orthorhombic form of the putative HAD-hydrolase YfnB from Bacillus subtilis bound to magnesium reveals interdomain movement
rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Putative HAD-hydrolase yfnB
total genus 87
structure length 223
sequence length 228
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3i76A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3i76A01
3L8EA 1AQ6A 3VAYA 5AI4A 4NABA 2C88A 4DCCA 4AP9A 4UATA 2AUTA 3WK6A 5ALDA 1Y8AA 2AMYA 2ZBFA 4KX5A 2VKQA 3I6BA 4FYPA 3QYPA 1Z4LA 2YMLA 3QXGA 3WK7A 3ZWDA 4J03A 3B9RA 1SWVA 3W5CA 5AM3A 3E84A 1WVIA 3N28A 4BEWA 1WPGA 4UMDA 4NFLA 2RB5A 1NRWA 4DFDA 3ZW7A 3A3YA 3FGOA 5AKGA 4E88A 1Z5UA 3QLEA 4O8CA 3E81A 3U19A 2I34A 3ET5A 1RC8A 4BBJA 3S6JA 1QYIA 3B8EA 3ZVNA 4OHFA 3WGVA 3ONNA 2G0AA 1RMQA 3HLTA 4XE5A 4DWOA 1ZOLA 5ALMA 1ZD3A 3OCYA 3P96A 4KN8A 3ZU6A 3SHQA 3WKCA 2RBKA 5ALRA 3AR4A 4UM5A 5AW9A 5ALZA 1ZD4A 1WZCA 2P9JA 3IB6A 5ALPA 3NUQA 5JJBA 3BA6A 4Y2QA 3UMBA 4OCZA 4KX3A 2G09A 2IOFK 2Q4TA 4HGRA 3U13A 1RRCA 2YMPA 3A1EA 4UW9A 5AKJA 1L8LA 4YCNA 1RKUA 5AW8A 2C9MA 1U2SA 2X4DA 1NNLA 1N8NA 4KNWA 3HYCA 1S2OA 2FPUA 3ED5A 2CFSA 3PGLA 4G63A 2FPRA 2HCFA 1K1EA 1XVIA 2G80A 4BX3A 3F9RA 3DDHA 2FPXA 2WHEA 1U02A 5AW4A 5A3RA 4UAUA 3R9KA 3OTQA 4PNHA 5ALGA 5ALEA 4UMVA 3OCUA 3KC2A 3IRUA 2W11A 2FEAA 1QH9A 1TA0A 4HAIA 4GIBA 1XP5A 3ZTYA 1TJ4A 3AR3A 5AW7A 1Q91A 3N5KA 2OM6A 3M1YA 2W43A 2WF5A 4NAVA 2HI0A 4RETA 2Q5EA 5AI8A 2NO4A 3N1UA 1RPZA 5ALWA 1ZS9A 2O9JA 2HF2A 3NIWA 3OCZA 3FPBA 4HGQA 2AH5A 3KD3A 3I1YA 3L0YA 4BEVA 2QLTA 4QJBA 4EZEA 3QNMA 4Y2JA 3NANA 3SF0A 5AVXA 2WF6A 2FPWA 5AIBA 3D6JA 4CF4A 2BDEA 3QUBA 2O2XA 4BNDB 4Y2RA 3EF0A 4Y2PA 3AR6A 5A3QA 2GMWA 3I76A 1KYTA 2C4NA 1J8DA 4UARA 2MU1A 1JUDA 5AW2A 4Y2TA 4YGYA 3ZVLA 4BX2A 2FUCA 5AKZA 3MMZA 3EWIA 3L5KA 5AVVA 3CZ4A 2OBBA 3ET4A 3SKXA 2HO4A 1L7OA 1CQZA 3QU7A 2B0CA 3PGVA 1EK1A 2WF8A 3ESQA 5E0OA 5IS2A 2GHQA 2P27A 2GFHA 3ZVMA 2FI1A 5IT4A 3DNPA 5AI6A 2JARA 1F5SA 5AKKA 2JGAA 1ZD5A 4F71A 2ODAA 3WKAA 3A1DA 3L1UA 3U7GA 3MPOA 2BY4A 3OPXA 1ZRNA 4EELA 5AK3A 4UMEA 5AI5A 4L6AA 1RMTA 1MH9A 4BX0A 3W5AA 5AW3A 1SWWA 2HDOA 1RMYA 1YJ5A 1YS9A 4BKMA 1LVHA 2HSZA 5ALNA 2ZOSA 2FUEA 3L0CA 3U7HB 2IOFA 3WK5A 4HGOA 5T41A 5AKHA 5AHXA 1Z4IA 3U7EB 1O03A 5ALXA 3MC1A 3RFUA 1QQ7A 2FPSA 2PR7A 4Y2XA 4UU1A 3SLRA 5AM5A 5ALJA 4UMFA 4C4SA 3NAMA 2GO7A 3EF1A 1QQ6A 4H1WA 3NALA 2EARA 5AI0A 3N8GA 5AW6A 1CR6A 3WKBA 4YCLA 3WK9A 3L0BA 2WF7A 1Z5GA 2YMQA 2PQ0A 5AKYA 2CFTA 3I28A 3UMGA 1FEZA 4OD0A 5AM1A 1EK2A 3W5DA 4ZEWA 4ZEXA 2CN1A 3WKDA 3OCXA 3M9LA 4Y2UA 3A1CA 5AVTA 5AK4A 2NO5A 2YN4A 1U2TA 2C8KA 4Y3UA 2PKEA 1U7OA 1RDFA 5AKLA 1U7PA 4UU0A 5AESA 1O08A 3QUCA 5AM2A 2HEGA 5ALKA 1T5SA 5AVYA 1YMQA 5AW5A 2I7DA 2EATA 4BYGA 5ALQA 1IWOA 2ZBDA 1Q92A 2B1QA 2R8ZA 1YDFA 1RLOA 4OFZA 5ALYA 5AK5A 2JAWA 5AM0A 2ZG6A 3L8GA 3AR2A 4HGNA 4AS2A 2QYHA 3SD7A 5AVWA 5IT0A 3ZWKA 1TE2A 3QU9A 4AS3A 5AVSA 4C4RA 2I55A 2G1AA 2FDRA 5AVQA 5AI9A 5ALUA 5A3SA 2MU2A 1RQLA 1ZRMA 5ALHA 2RAVA 3AR7A 2WF9A 5ALVA 2EAUA 5ALFA 2B30A 2P11A 2R8EA 3L7YA 3AR8A 3R4CA 4G9BA 3WKEA 5AVRA 2OA0A 3L8HA 2YMMA 1L7MA 2AGVA 2R8XA 4QQFA 5AKXA 3W5BA 4NV0A 3ESRA 1WR8A 1L7PA 3PCTA 4UAVA 1RQNA 4F72A 3QGMA 4MUMA 2B8JA 3UMCA 4KYTA 4GXTA 5AVZA 3U26A 3OCWA 2WFAA 1Z4QA 3FM9A 4CNQA 2HOQA 4C4TA 1SU4A 2DQSA 3R09A 2D2VA 4EX6A 3ZTWA 3B9BA 3MN1A 2B8EA 2G06A 2ZXEA 3J7TA 3ZX5A 1RKQA 3AR5A 5ALIA 4EEKA 2HF7A 3E58A 2C8LA 4UASA 3KZXA 3ZUPA 1Z4NA 3WGUA 3OCVA 4L57A 1T9ZA 4XQ0A 2W4MA 2G08A 2IYEA 1ZD2P 4ZEVA 2YJ5A 1T5TA 3QUTA 3IJ5A 4KNVA 4FFDA 4FE3A 5AKEA 4YH1A 2BDUA 4HGPA 3E8MA 4EENA 5AICA 4EX7A 2ZBEA 3WK8A 3N07A 3NASA 3PDWA 1ZJJA 4IFTA 3DAOA 3BWVA 4HYTA 1RKVA 4CF5A 3SKYA 2YJ4A 2I54A 1VJRA 4IG4A 3DV9A 5AK6A 3GYGA 2P69A 2JAOA 1XPJA 3L1VA 2NYVA 4YIHA 4YCMA 2YJ6A 4RESA 1Z88A 3SMVA 5ALOA 3CNHA 2I6XA 1N9KA 2ZBGA 1TJ3A 5AW0A 1J97A 2I33A 2YY6A 5FP0A 3FVVA 3TLMA 3KOOA 2MSNA 5AKIA 1VFPA 1VJ5A 3QU5A 4UM7A 1Z4MA 4JDPA 3EPRA 4YIKA 2YBDA 1Z4KA 1YV9A 4I9GA 4CF3A 1S8OA 2GHTA 2YJ3A 4J2TA 4L6CA 1YNSA 5AM4A 1L6RA 3RF6A 4JB3A 1LTQA 2HX1A 2G07A 2WM8A 3WK4A 2R8YA 4I9FA 5ALTA 1Z4OA 3QU4A 2HHLA 4Y2SA 1PW5A 5AW1A 3KBBA 1X42A 3L8FA 4BNDA 1NF2A 5ALLA 1L8OA 3QU2A 2JAUA 1TJ5A 2RARA 3ZX4A 4MWOA 5AVUA 3FZQA 4DW8A 2IOHA 2OYCA 3ZI4A 2B82A 1L7NA 3U7FB 2YFYA 3NRJA 4XPZA 1QQ5A 2IA5A 1RLMA 3UM9A 4Y2YA 3QX7A 5ALSA 4CE6A 3KDPA 4Y2VA 1RLTA 2CFRA 4XOUA 1Z4JA 3K1ZA 3QUQA 1Z4PX 2B1RA 2Q4RA 3AR9A 3FPSA 5AIAA 4B6JA 4NWIA
chains in the Genus database with same CATH superfamily
1R6AA 1FP7A 3R0IA 1PE0A 4L74A 3BJEA 2X4GA 3QHAA 4FXPA 1GCOA 1XTPA 4JVOA 1X80B 4KZKA 5J8YC 2AUTA 4LRTB 1R0KA 2X40A 2J6TA 2AMYA 2AMLA 2FRDA 2ZBFA 1X8LA 3TYXA 4GG1A 3IIIA 5CNJA 1I5RA 1O6CA 5HIIA 1FZQA 2JJ2D 4Z1OA 1NKBA 4GH5A 4EY6A 1NUTA 2JGFA 3QOYA 3OLWA 5IM5A 3E84A 4MQBA 5FBQB 2MYTA 2PR2A 4HN4B 1OW5A 4HV4A 3H87A 3JWGA 2XE8A 4RAQA 5B66U 2P5UA 4RLQA 3VMFA 4DLXA 2R6ZA 1A04A 3SICE 5KYXA 2Q3DA 1JU4A 3ZHCA 1W5AA 2F4VB 4X6XA 3N8IA 4QVGA 1QU3A 3N0WA 3EY4A 3OPYI 1NK9A 1FCJA 1D7AA 1NPYA 2CNWA 2ZYDA 3EA0A 3PQEA 4JMLA 2C3UA 4CFYA 5ADVA 3V7FA 3S7ZA 3HEBA 3H3XA 4OLJA 5UKDA 1R0RE 5FCDA 3ZWWA 1SHKA 2G88A 2HEIA 2QHXA 1OFGA 4MW1A 1GZ5A 1KO4A 4Z6CA 5J0YA 3L49A 1MOPA 4UHHA 3KKLA 3ACCA 1SXIA 4OIMA 1DRUA 1N2GA 3HLTA 1SQ0A 4NICA 5H83A 3U81A 4A0RA 3ELDA 3C6KA 1EZZA 3SXJA 4G5GA 5DB6A 2FF5A 3LIPA 3GPIA 5CHGA 3DCIA 2V7PA 1IXRC 1E4EA 4AXXA 4HDNB 2XWPA 8ICIA 2FWIA 2V6IA 2O1SA 2FZGA 3NNSA 5FPPA 4I2AA 1BE1A 4LZAA 3BA6A 3NHPA 3AL0C 1M34B 2ZE7A 3SJBA 4FYJA 3CGGA 2G09A 4MWGA 4RCZA 1Z82A 5EXTA 4DLNA 2YMPA 2DAPA 2EW2A 3AC0A 3P0IA 2YDXA 1G59A 3PWTA 4L4XA 5BV0A 2CJWA 4NE2A 3VQTA 3VR1A 3OFNA 4ED8A 3LBHA 3URKA 5F9FA 3K9NA 1NVXQ 4RVHA 1XLTA 5A6VA 2OV1A 3L79A 2H4JA 4IY1A 4LZPA 4IKOA 4YACA 1FTNA 4GBGA 4O29A 1NGSA 1RAGA 9ICTA 1T3HA 5EPEA 3RIEA 3HGMA 4OMUA 4IRUB 5D51S 4B8WA 5KKCA 5TPZA 4J07A 4Z49A 4PL1A 1NPDA 1CUGA 1TQ4A 4ZQBA 3L4SO 1XAHA 5CIQA 3DE6X 3TINA 4UTPA 1N5LA 5JJ5A 1F2TA 1T1SA 2CFSA 3CUTA 3MJ4A 3PEVA 1R88A 4ZT7A 2C2MA 4MDHA 2FGKA 1XNSA 4IFIA 4R81A 5BT9A 3WA6A 5B7NA 1SCUA 3L07A 4B4KA 1HFKA 2F1RA 2OR3A 1JXAA 4FFBA 1OLSB 4J0GA 3UF0A 1P3DA 4RPZA 2HRBA 1WTAA 4LG1A 1A88A 1UWVA 1XZJA 1Z6XA 3KK0A 3LBFA 4P3PA 3BE8A 3BRWD 2QTNA 4EFLA 5HQ3B 2D4AA 4A8EA 1VC2A 2HA2A 3JYNA 5LP6C 5C8YF 1S9HA 1O94C 1RACA 1J56A 1FNBA 5KPDA 2N47A 2X0JA 4H6WA 3OCUA 2ZROA 5D7BA 5FI0B 2J0UB 1AD2A 3KC2A 4CKBA 2EW1A 4YUXA 3WGIA 3BJMA 3SLGA 1PZFA 4DKJA 5HF5A 2V5VA 1O1YA 2ESEA 4R1OA 2CUTA 4ZDWA 1TJ4A 5M5BA 2FSSA 3H7AA 3NDPA 3QWBA 3T3PB 1K7XB 4AX8A 4D9CA 5EIEA 3C2KA 4TZ0A 5HR7A 2GD1O 4FFSA 3DTVB 4ZMRA 3O83A 3N5KA 2CXPA 1W46A 4IDQA 1QO7A 3RRZA 5IBQA 1H94A 2M9NA 4QNMA 3ROPA 3UHFA 2WUFA 4LRWA 3QVUA 5ICFA 4NAVA 5KFNA 3RWOA 1Y5LA 4AKIA 5KT3A 1G55A 2P65A 5IVPA 5A5EA 3OLVA 1SZCA 2GQ0A 4P7KA 2NPOA 4QASA 5EJ6A 4MW9A 1LGYA 4EA7A 3RVDA 4F8YA 3AM1A 1ECBA 2QUBA 3ON5A 5A6SB 4BB5A 3HI6A 3IH5A 3LX5A 5LP6A 1D2HA 3QNMA 1VZ2A 1ZD9A 4MB0A 3SS8A 1OXXK 2W9BB 4W82A 2C4KA 3A6LA 2SNIE 3FHOA 1YQGA 2EJBA 3L0DA 4N54A 3Q5DA 3HXKA 3THYB 1RJ9B 4M9GA 4PZOA 1R4AA 2HLHA 3DYBA 4O5AA 3ABOB 1QK4A 1YAJA 1ZSYA 2VSYA 1PTKA 2TMGA 4KMOB 1EVZA 3T38A 4WINA 3BQ1A 2DTEA 1C30B 4YJGA 4UHEA 3Q5EA 5KQSA 3BKXA 4FQ8A 3A1NA 4M8LA 3F98A 4GRDA 4LJKA 3KL2A 2GLUA 3HU1A 4FQ7A 3SKXA 6PFKA 1Q20A 1LSJA 4B0OA 9ICPA 2GETA 3M6IA 3N7SC 1CFZA 2QW0X 3WOHA 1CVLA 1I4EB 3BE4A 4E2FA 5BQ3A 1E4VA 1QBKC 2BL4A 3O84A 2I03A 3IMEA 3S70A 2JH8A 3AEQA 1DC7A 1EX1A 4HOYA 5L7WA 1U31A 2IXTA 5JCOC 5ES4B 2AJCA 4EBDA 1XWIA 1BFDA 3C3KA 3FJYA 3GIDA 3NQ41 5K3AA 4RNOA 5CA1A 4DEVA 3JQBA 4BC0A 4R2JA 4YXJA 4B43A 2RC5A 2DFKB 3M7IA 2OCKA 3OP4A 4CGYA 1V11B 4KBFA 2G1JA 3SF8B 1Y5IA 4UQLA 3NC1C 2QR2A 3WNDA 3JZFA 5B57C 1UPTA 1ZH8A 3HNRA 2P4SA 4RE6A 3RRXA 4UHDA 3M81A 3OQ6A 3GARA 5AR1A 2GZ2A 3UB3A 5AI5A 1MVNA 1Z3CA 2VZEA 4YJGB 4QZFA 4YVFA 2YNMA 5IEBA 4DUZB 3W5HA 2D7DA 3HEMA 3QXJA 5H1YA 1DV2A 1PFYA 2IYUA 3RCBA 4D02A 1SD1A 4OJKA 1QE3A 3IG8A 2BISA 3EN0A 4RACA 5B1IA 3H8SA 1SG0A 4E07A 2C0QA 5T6BA 5ALNA 2HYDA 4NSNA 3R9WA 1RHMA 3SNHA 1OV4A 3RD5A 4J3JA 3RVRA 1L7DA 3KKAC 1BHSA 3W04A 3W3ZB 5BQFA 4YY3B 2R1TB 5H80A 4XVRA 3BF7A 4JK1A 4DAOA 1GRNA 1HTBA 2A3RA 2WIKA 1L5MA 3ENVA 3VZSA 3RU3A 4EG6A 4N40A 3SE7A 4MX8A 4RPJA 1U0HC 1YI8A 3T3NA 1FW6A 1IQPA 2FZCA 3UAWA 2J3KA 1XEXA 1K8ZB 4RLHA 1N5MA 2BW0A 4ROTA 4WY2A 3U3OA 2DY0A 3W3AH 2Z6QA 1O6GA 5C53B 1GRRA 2QRNA 4N12A 4XSVA 5EQJB 1HTWA 5TGTA 1DX9A 2FNAA 2CXQA 3QELB 1PDWA 4JYMA 1ZJMA 3GLTA 3SYTA 1Y80A 4K03A 5LNK1 3EF1A 1QQ6A 3LT4A 1Z36A 4PC7A 2GEKA 1SURA 4UU7A 4HSEA 1DUVG 7ICSA 1Y9JA 4RZUA 4DA8A 5AW6A 2NYAA 3B60A 3O2QB 2EBFX 3LDFA 1B43A 1OWMA 3DV0A 5T57A 3JPSA 4ED7A 2ZIZA 4M0CA 3LKDA 4OFXA 5A3JA 1ZQYA 2GNAA 2LDBA 1P1IA 4XYMA 1YT3A 2WTAA 4QRDA 3KL4A 3DAHA 5AKYA 4I36A 4NFHA 2L5YA 3R8CA 1C1HA 3ZXUB 4C06A 1AOXA 4I1VA 1AS0A 1EWYA 1TKRA 2ZCVA 5BOVA 2PJUA 3RJTA 4DL7A 1PTJA 4IZIA 1PT6A 2QMYA 1FFHA 2K5UA 2GAOA 3X1XA 1EG2A 2R86A 3EOZA 5F1YA 1QFSA 1RI5A 2BFDB 3S3TA 3QF4B 4DSFA 4UB4A 1A1SA 3PR1A 4QQRA 2DB3A 5U9CA 2VH5R 2OXCA 3TZBA 2QGZA 1RDFA 5AKLA 1FFEA 2BGKA 1J06A 4LA4A 5FNVA 2VUHB 3TLZA 4BATA 5FH9A 3HVRA 2EZUA 1PJQA 9ICXA 3PQ2A 4CV0A 4AYTA 4Z3KA 3S8MA 2OPBA 2WKSA 2HEGA 4TT3A 2Z1NA 3Q9UA 4MA5A 3OJUA 4JXKA 1RM4A 2FP4B 4PR0A 4EH1A 1GQOA 3AVWA 3VKHA 3WJ2A 1X7XB 1O94D 4DQIA 2WUGA 3H2ZA 5IYZA 2YV2A 4N8DA 3VPFA 4X65B 1HKUA 2BFMA 2VDLB 2P67A 1BS2A 5JCJA 1MAAA 1T4MA 1SIUA 9LDTA 1MEOA 2FPLA 5HQTA 2A5DA 1TUGA 2FH5B 2NVBA 3CZCA 3FF4A 4REQA 4X91A 4ALKA 3HRKA 4WFIA 1MJFA 1RZ3A 4S2EA 4ZA2A 3TZHA 3AXTA 1FP4A 2BOVA 3GT0A 5ICGA 3UCXA 1AN0A 5L3QA 4LEIA 4BE9A 3RJHA 4K9KA 4EB6B 2PMDA 4ETMA 2XUAA 1ZOPA 1TC1A 3ILSA 1BX1A 2Y8EA 4QO7A 4WNYA 5FQOA 1UODA 4NU5A 3AGPA 4C0XA 1K0UA 2CMKA 4PC2A 5ALUA 3C4QA 4NRDA 2YWHA 4IIYA 1VLHA 5MN5A 2R8IA 4UC0A 5KOYA 3H5OA 2UYCA 2GJKA 4KQ6A 2HU8A 5J2TB 1ULUA 2XNCA 4FOSA 3DMTA 4LOKA 4PHCA 2A58A 5DB8A 2WJAA 4D4IA 3MYYA 1KEUA 4P4UA 1JHDA 1XUOA 5CX1B 2ORED 4C5CA 4LCBA 4DMFA 2VHWA 1JFTA 3T3OA 3OHMA 2OA0A 2C5AA 2PGOA 1T3LA 1WB5A 2ASDA 5TQJA 1GY8A 4B7AA 3RIMA 4EHNA 5TMPA 4Z2YA 4IV5A 1ZNWA 1J8VA 2ODWA 4HUQA 3ZDAA 2JFUA 2C9BA 2VP9A 1Z73A 3ISCA 3I62A 4F4WA 1ZQDA 1I3NA 1AROP 2BGRA 1GGVA 2R79A 3H2HA 4GM4A 4KYTA 4P0PA 3Q98A 2EDCA 1UXGA 1SUSA 4JJZA 4MLPA 2I7VA 2W00A 2XMQA 1MIOB 1I1NA 3M49A 1QHHA 3ZIDA 1WMFA 2GM5A 3NETA 1PX2A 1E3WB 4PVCA 1X94A 2B6GA 2V7UA 1M3SA 4DDVA 4QHYA 9ICMA 3FDZB 1PGNA 2WTMA 2YUIA 4DIFA 4GP9A 4ARBA 2VQSA 4MKHA 4ZDKA 5B6IA 2K4EA 4CCYA 3ZTWA 3NBXX 1T0UA 2OEPA 1BW9B 3L6BA 4MULA 3FSEA 8ABPA 3IJRA 3JQ9C 4FYMA 1XNQB 4RVSA 4J9LA 1RRVA 4G0VA 3GJQA 3FOEC 1E94E 3NWPA 4I1OA 3H19A 1DPFA 1ECCA 3ECCA 1Q3VA 3OD1A 1KDOA 1QCDA 2DFDA 2OWOA 4JA2A 4MQMA 1DJOA 1HLGA 2A0WA 3O8QA 4R7ZA 1DKOA 1PVRA 5EHZA 3B9PA 3P97A 4YDQA 5EIXA 4XOIA 5K2OA 1IBRA 2ISCA 3HA2A 4HPXB 4DCUA 3U9SA 2PI5A 3VRHA 3WIVA 1VHDA 2A3NA 1MRZA 1UZLA 2R4QA 4OYHA 1EFTA 2B9EA 2VSNA 4MQLA 3S2ZA 2ZIWA 1HK7A 2HADA 3WQBA 4BJHB 3EJ6A 5J2IA 3HEAA 4R1TA 3WIOA 4ZEVA 1KZ6A 1Z3IX 2F77X 1T7PA 1JMYA 2YVUA 4L5AA 3IURA 3KJQA 4AVYA 2YJ5A 4PZYA 4RKFA 1GYQA 4DQ0A 2PS3A 3IPXA 3IBGA 2H08A 4NXMB 3UOGA 4R6XA 2ZUTA 2FK7A 2IF2A 4J43A 4RH0A 2KEYA 5AKEA 1Z2OX 2WJWA 5EWMA 4RLFA 4GKJB 4UDYX 4JUAA 2PRIA 1XL0A 3GW8A 1W34A 4NY8A 2R8JA 1LTHR 4ZKEA 1H6BA 4ITUA 3KB8A 3DCJA 3IV9A 1LJ8A 3EPPA 2OO7A 3K3PA 2JMGA 2JH3A 4CYMA 2EZYA 3EQ2A 1EWVA 3U17A 4EJFA 5A02A 3B82A 3PQ8A 1F2UB 4B74A 5IFKA 1ADJA 3DAOA 3EQ6A 3OQPA 1YL6A 4EPWA 2BONA 3GEMA 2IZ0A 1MX5A 2QSZA 2PUTA 5FLKA 3U09A 1H2WA 2V6JA 2GD2A 2QVBA 3GFKB 1XC9A 6Q21A 4I6JA 2ZTCA 2O2ZA 1RYNA 3CB2A 2P75A 3O3CA 5ECYA 3UWPA 1W19A 1GA1A 2JW5A 1H2ZA 4MFFA 2VKTA 3FTNA 5KNBD 2V7VA 3AEUA 4P2GA 1MABA 1V4NA 4MEBA 2CDCA 4DV4B 2IS6A 4MGKR 3TKLA 2BHNA 1GYPA 1GZ6A 2OO3A 1RTTA 3BWMA 4AQDA 2PJRA 3VZRA 2NSYA 5AJUA 1Q5PA 3EZNA 4DF8A 4S35A 5GV7A 3O82A 2POQX 3F3SA 2Y0DA 3PICA 5JRJA 3JPPA 2HJGA 1LD3A 3EEFA 2O3UA 3MLEA 4D92A 2JRZA 1D2AA 2RD2A 5KFUA 1Y3IA 2FMXA 5DM60 1QM5A 3Q7TA 1N8TA 1TB4A 5AVJA 3EVZA 2GX6A 3W2TA 2YJ3A 1RXSA 3IP4B 2BPFA 2I1WA 3QA3E 4ETIA 4NYIQ 3EVGA 1DWQA 1AGXA 2BFNA 2DR2A 1PK1B 3UG6A 3CVOA 3L7BA 4ENSA 1JE1A 5ERGB 3V4ZA 2R5WA 1DAHA 4AJ9A 3C4JA 5EJMA 4Y2SA 2HC9A 2BFEA 4S1VA 2CXYA 3OPYA 2P90A 5KWIA 4BNDA 1N56A 2ZXFA 3UHPA 1W0JD 4N3NA 4WV3A 2P40A 5KINB 3ZK7A 2NPFA 5ALLA 1QYXA 4MPRA 4OJMX 1XN1A 2XRFA 4W1SA 5DGDA 1YR1A 5ICEA 3V34A 2O14A 5TQVA 3ROQA 4PAQA 4RA9B 4J3NA 4ED9A 4IOJA 2PUGA 2M9MA 5FXMA 1TPYA 1Q0PA 3WO0A 1T4GA 3OF5A 3D3WA 4QWEA 1UK8A 4J16A 3LBAA 4K46A 4ROSA 3ZH9B 4ZIRA 1YF3A 2YS7A 2BIFA 3HXOA 1J0AA 1YDWA 2L0XA 3LL7A 3SN6A 1SXJB 5T3UA 4XQGA 1MX9A 1P2BA 4YJHA 1CG6A 2ONJA 4F93B 1TD1A 2DEUA 5ESRA 2QL9A 5E4YA 4K3UA 3WAGA 4MUNA 1CEYA 1BWQA 2X0EA 3T34A 1FSGA 9ICHA 4IQ8A 4I3GA 3I58A 1G8KA 2JHAA 2QROA 4DQQA 3RS5A 1FQJA 1X13A 1ZIYA 2OD2A 3GDWA 4YDSA 3N86A 5IAKA 2HR1A 3G2LA 3GCGA 1ISIA 4GI3A 1LLFA 1I3MA 3IUEA 2IS2A 4XUEA 4QWWA 2BM9A 4G1BA 4IHJB 3OJOA 1B15A 4IF6A 4R2KA 5DYNA 4A4DA 3UXMA 9ICEA 1U98A 3IDAA 4YFVA 5IIMA 4JEUA 1D2CA 3AJDA 3CR8A 1LQTA 3D7MA 4FSHA 1A9XA 1GT91 3W2EA 5LYJA 2LM1A 1JL3A 4KDEA 4TV8F 4DARA 1Z4LA 1II8A 2EJCA 1GG2A 1O7JA 3L7CA 1ZK1A 2VPIA 4RBNA 1S9DA 3KQWA 3MCUA 4AC9A 4BQOA 4DSTA 1BXZA 1KBQA 1QIMA 3D3WB 3FIJA 1SHLA 3S2GA 1RQGA 4YRNA 1CR4A 1WBDA 1M8KA 1HGXA 1D7OA 4WBNA 2NAFA 1KJNA 5K0FA 3DTYA 2W9CB 2EFCB 4IR1A 1RC0A 3TSYA 4OAPA 4RKQA 2RHGB 1F1JA 1QO0A 5K3DA 2R8HA 4YHHB 5JISA 2IXEA 4RXMA 3T4UA 2IDZA 4U7PB 2H2FA 1EJ6A 3N7UA 2BKAA 2QUIA 4IJQA 1QYIA 4QJ4A 5EIAA 3WIEA 4CCSA 4HDKA 4KLGA 5KAIU 1WAMA 3EFEA 3QXCA 1WF3A 2JA2A 3BXHA 1GXSB 1I33A 5IK2D 1MNQA 2CHUA 1IIPA 2QTGA 3OQHA 5EXSA 1TEZA 2XB8A 3S1LA 2DTXA 4ZU3A 4RT3A 2DFNA 1GITA 1E5LA 2Z04A 4IVRA 1LPBB 4BLWA 3RRBA 5ALZA 1OHHD 3D3QA 1KWKA 1HE5A 1QRDA 3GIIA 1VRCA 4XUCA 5E6RB 1L7BA 2W37A 2NTEA 5BWBA 1U1GA 3LP8A 3OIDA 4R6WA 3ZCVA 2ZU0C 4L27A 1F4PA 3BB4A 3IODA 1WA5A 5FADA 1RYMA 1DFHA 3VHXB 1N75A 4A5OA 3F67A 4JP5A 1NQTA 4C7MA 3GBVA 3NIBA 4QTXA 4ZJYA 1O5IA 3C3XA 4EA9A 2BFOA 3TXXA 3KTAB 1PV4A 2CEAA 2PGAA 1OGJA 3OUUA 3LQQA 1DINA 2AT1A 1PQUA 2R00C 3O4GA 3Q1LA 1YONA 3S7TA 2IYZA 2RGYA 3IEPA 1P7YA 3BDVA 5SYMA 3OC0A 2P9TA 1QWSA 5KFWA 1BN7A 4O3NA 1KSHA 2Q3MA 3QMMA 1E3DA 5CM9C 2OV3A 2I3DA 4N7BA 2QS9A 3DOUA 5KIAA 4JROA 1XZEA 2OUKA 2XRZA 4X1YA 1S8AA 3OI7A 2A78A 4BUCA 1UM9B 2H63A 3TMYA 1EFCA 3G9TA 1KY3A 1XZIA 2G5CA 1V4VA 1WPRA 4JK3A 4ZVQA 4CMEA 4FKBA 4UFNA 3LCRA 1YGYA 3PF8A 2L42A 1HV8A 3EDQA 4QOIA 2HSWA 4NCIA 3TDMA 5MDHA 1VJCA 2W3SA 4M1KA 2XCRB 1DKUA 4R83A 1U6IA 3MTIA 4TMVA 1DMRA 3LUDA 1GNQA 3O8QB 3KO8A 2R4UA 1OA1A 4I5DA 1CJCA 3G9ZA 4KIUA 4MJ3A 4PNHA 4RHYA 3HCWA 5CH3A 5A5FA 2C5EA 4E94A 4JI5B 4GKKB 2Z4RA 2G7MC 4CM4B 1W96A 2HBJA 2FPOA 2SBTA 3ZZUA 4Q01A 3LXUX 2R18A 1TA0A 2NNLD 2YV4A 1GQYA 3RT7A 3PX3A 2H59A 3WU2U 2XF8A 4RVDA 4GIBA 2QDKA 1KDZA 5DBHX 4N01A 3G59A 3OE1A 1Y8QA 3LECA 3ISJA 1PL6A 2B2CA 3RUAA 1FA9A 5FV7A 2NTJA 3RHZA 3RUHA 1Q1AA 4DANA 2R8RA 3HZRA 4HKTA 1GR1A 4U5QA 1KQGA 3GC6A 4WLVA 4D0NA 1ZQRA 2H3EA 3IJPA 4GYKA 3IE1A 2GA8A 1OX4A 3MSXA 3E7FA 1XZAA 4RVOA 2JASA 5EESA 3IB3A 1RXWA 1YR2A 2ZRPA 2PBRA 1S0UA 2ZB2A 3MTEA 5KFTA 3RB6A 3FWPA 4L9SA 4DMRA 1EMDA 3KJIA 1BPBA 3I1YA 3V9PA 5I6DA 4BFTA 3ZD9A 1E9FA 2WTXA 5AJVB 3U3RA 4C7OA 2V65A 2COKA 4S3MA 3EHDA 4QJBA 3JAKA 1Z7BA 4IIJF 3VPSA 5JYEA 3ESBA 1ILEA 1NF3A 4MUAA 3GJ3A 1FX0A 4B7XA 2VBFA 4HEHA 4J4TA 5I4KA 1EUDB 1T8UA 1SUIA 3KXKA 3VDNB 3UKDA 3AQFA 3AR6A 5B3JC 1VKOA 2C4UA 3D5QA 3G7SA 4KCGA 1ED1A 3KAQA 4XVQA 3TIFA 4E5SA 5DEIA 1HNZB 4TYYA 8ADHA 4XVUA 2QPOA 1NHWA 2ZJ3A 4G8CA 1A9SA 5CVTA 5HR6A 3QELA 1GG8A 4OATA 8ICKA 2QRMA 2NUBA 2Q49A 2WJVA 3PNSA 1IL0A 2P6UA 1CUVA 4J7AA 3VNVA 1UK7A 4YONB 5TIIA 4YT2A 3UJ8A 2WJ4A 3WNCA 1V95A 4JGIA 1Z0AA 4K9OA 5WRFA 1Q7BA 5KWSA 3DMRA 4YGYA 3ZU4A 3OLCX 4AF7A 4ACAA 5G0UA 4PR3A 4D8VA 5J4VA 1H1DA 3RLFA 3C85A 4DR5B 2G9ZA 1OREA 2ZE6A 5KHAA 4F7WA 3KEMA 3PKZA 2W9MA 4CTMA 1LC0A 1C9MA 3G5AA 3V46A 1Z8HA 2VDOB 4DF4A 2KN7A 1S96A 5KJ1A 1YVPA 2LZ0A 2VHCA 2GFHA 3KPYA 1SUDA 4FMPA 1LY1A 2HA6A 4Q24A 1YA8A 3C70A 1MPTA 4B9NA 4JLUA 4N5LA 3ZWXA 2R0QC 1S10A 1K68A 1YIOA 3WMGA 4TYMA 4C08A 1ADYA 1SQSA 3I9V6 1DJQA 4BE4A 2VAMA 3M6FA 5AJWA 5BQXA 4B5KA 1L4FA 2W6JD 1FJXA 4ITRC 2BGGA 2XE4A 4ZO7A 1OXKB 1VGQA 4WACA 4AYWA 4JV1A 2JEOA 1UR5A 2NU6A 1DT5A 1JHXA 3W3AD 2EYUA 9ICIA 5AK3A 5CVCA 5FJJA 5TC4A 5ITZA 4YJ3A 4BTLA 4KAJA 1SCNE 2Z3VA 4ONEA 5HQ3A 4F6LA 1C7FA 3QBTA 3R6GA 4N41A 2I9GA 4QDUA 4BX0A 3BGDA 3KYJB 2C57A 1USVA 2P9FA 3QTBA 1XTBA 1BCRB 5F4BA 4F5YA 1S0MA 4XEUA 2HSZA 1OB2A 2ID8A 2ZOSA 5FBKA 3HSKA 4P93A 4EPTA 3QW4B 3WLIA 4E03A 5KG2A 3R0JA 2BR0A 2W7PA 5HW0A 2Q5LA 4HGOA 1ZQXA 2ZSKA 4Q1CA 4XGQA 2EHDA 4XIYA 4MROA 4Y8VA 4M1SA 3ZY5A 2G1PA 4US1R 1ANKA 1X39A 5LQNA 3ZGZA 2AR7A 2RFLA 3U0BA 2HCJB 3OLZA 4D43A 2ZIAA 2FHSA 2Z5LA 1G4UR 4XIFA 2PR7A 3T5LA 1W47A 2EBUA 4MIKA 4R8MA 4TMTA 2PNJA 4DCNA 4ZGWA 4Q9DA 2HU2A 4ZOCA 3RGWS 1HYEA 3N2KA 3GJZA 3NTUA 3NB0A 4BQFA 4CG3A 1D6SA 4IO1A 5JD6A 4MICA 1JAYA 1NVVR 3BZKA 1R10A 3GVXA 5IDQA 1VLLA 1XZGA 2GCGA 1EQ2A 3C8HA 4TV8B 2GAIA 2B35A 2PV7A 2DF8A 4I8IA 2JCYA 4J94A 4CR7A 3WLOA 4G41A 3IUSA 3WNZA 2ZB8A 2B98A 2O52A 2OQ2A 3AF0A 2C5LA 2IXGA 3QE3A 3OQBA 3PNVA 3ZZ1A 5A6SA 4MINA 2G4VA 3A4LA 1YFZA 5EJFA 1R6VA 3T3HA 3VJMA 3UMGA 2XPCA 5T4EA 4WK4B 3KQHA 1P7WA 3W3AA 3KYCA 3MAGA 4NLCA 2WJHA 5LZ2A 3PX0A 2IEAA 1ZIDA 4K9NA 3A9UA 3GD7A 3V6LA 4NBKA 2WTFA 2CCGA 5AK4A 2CNWD 3CTPA 4KMRA 2A1JA 4Y3UA 2XHZA 1VMKA 4CU5A 4DY6A 2AWOA 2VF4X 3J81k 1H5QA 4IWNA 1P1BA 4IGFA 3X1JA 4F12A 4DR6B 3UK0A 5L51A 1MPXA 4NNJA 1BE6A 4X41A 4BJ3A 3BDAA 3N2KB 3P4UA 4I2NA 2IQIA 1QR6A 2QZPA 4HF7A 1RPNA 1W29A 4EQZA 1X2EA 3KDAA 3ZPXA 1ODJA 2PSJA 2R2GA 3LKVA 3AEQB 4HQNA 3P45A 4BFYA 2Y1EA 2Y05A 1S97A 3PVCA 4K6CA 3RYFB 3M4YA 1LU9A 1F12A 1WKCA 2QMUA 3ISTA 1G6KA 4MOWA 5J2TF 1W9MA 3GQVA 1MEEA 1DFIA 2WSYB 4MTCA 5LXTA 2B4KA 4HH3C 4W1QA 3GPDG 1QXSA 4IJ5A 1EBFA 5KG3A 3F6YA 1H0HA 1SC3A 3WNBA 1SQFA 8GPBA 1L3BA 3QVMA 3MAJA 1SCKA 5LBUA 5CJJA 4I9HA 1SUPA 1XEFA 2VPQA 3MRTA 4P84A 2WIBA 1Z25A 2EJVA 4ZI7B 2WZDA 1AQNA 1QHXA 3HPRA 3OE7D 1TKDA 3HA3A 5DHSA 2XCPA 2WD7B 5CA7A 3AR7A 1JDUA 2EQ5A 3FPAA 4P5DA 3RFCA 3CVVA 2FF7A 1N9GB 5COAA 1QMPA 2QD4A 4AUNA 2B30A 1XHEA 1Z7GA 4EHLA 4A0SA 3AR8A 2KG5A 2KIWA 4F3NA 2V8BA 3U3KA 2PUFA 4JEHA 1ZQKA 4DMLA 4KXUA 4B33A 4YMUA 5F23A 1EM8A 2I2CA 3AW8A 4R0VA 2IBTA 3AUJB 1TCAA 4FE7A 1Y89A 2R60A 4GVPA 2GWHA 1WR8A 3CH7A 1RJDA 3CUEF 4CQLB 5BMVB 1H6DA 3I6IA 2K4HA 1XMQB 1YI0A 3JQAA 4MI3A 5KX5A 2BCJQ 3LA8A 3DKRA 2X7HA 2VSQA 4KVAA 3RABA 3UA4A 3Q41A 3E0QA 1CLEA 2BFPA 2JHCA 3D6UA 4HP8A 4RQ8A 3O3MB 1KJZA 4ECSA 2ZSHA 4I50A 4LWPA 4EFDA 4CCHA 1XCOA 4QECA 1E6CA 3ZCRA 4IQUA 4QXAA 2AOXA 4M3NA 4OHBA 4U3JA 2HIAA 2Q2QA 5KWVA 1QLJA 3IGFA 2WV7A 4M76B 1DIGA 1XALA 5EXDA 3QVTA 2ISPA 1RBMA 1MENA 5KFAA 1N6NA 3LCMA 1CE8A 3Q6MA 4V1CB 2KFNA 4QKQA 4RNMA 4DMMA 4WXRA 3CLHA 2D7JA 2H1SA 3I64A 5I3ZA 1NKSA 5FAXA 2RHDA 4AZ0A 4YRIA 5JPDA 2UUOA 3CUUA 4O3RA 4EZ6A 1IK4A 1WUTA 5E2IA 1ZJWA 2UXDB 1VE3A 1U3DA 3SPXA 2TS1A 1J9EA 3EA4A 1ZXXA 4JLAA 2KHQA 1ZGJA 4BVAA 2W4IA 5HUHA 4B6SA 1KRPA 1NX6A 1ZRSA 2G08A 1CZLA 2PMCA 2W4MA 2XQVA 3E9EA 3I37X 4LHSA 3SXUA 3DKVA 3NYWA 5DF1A 2CYBA 3WGHA 1DBSA 3WLQA 4WKBA 4AG6A 4NECA 1CVRA 1XQ1A 4K2HA 2IUYA 4X7BA 3SSMA 5LIPA 3KVNA 3K70B 2ZB3A 2QZSA 2XGMA 2IP1A 3L1KA 4EO9A 1HUQA 3PF9A 4GM1A 1NJFA 4MV9A 3T4EA 4I50B 4BTVA 3M5WA 3QK7A 1JFLA 1R74A 2GK4A 2VHQA 1KL7A 5DV9A 6NULA 3WYEA 1Q1QA 1HDEA 2ZVQX 3DGFC 5EWJA 3ZYZA 3I2KA 4Y18A 1V5GA 2JH9A 1SCUB 2R11A 4ATNA 4M7WA 3X1MA 3H40A 3N07A 5E9JA 2HHTA 4RK1A 3ZQUA 1GLGA 1Z6YA 4TV9A 3QVKA 5DB4A 5CT5A 4M9CA 2WMOB 4D7AA 2DKFA 1GV0A 3HBFA 4KHZA 4FFBB 1LK5A 3NH9A 1RC1A 2Q5OA 2CL5A 1JX4A 1V7PC 2LKCA 4XB2A 4HLUC 5ISMA 1YVRA 2AGPA 3IE0A 3GN2A 4KGZA 4CT4B 4YCMA 3PX7A 3TLGA 5I9NA 2Z8ZA 2LV8A 4Q00A 1SHJA 3V2GA 2BGNA 3LX4A 1LX6A 4IH1A 4V02A 2AJLI 2HK7A 3IEKA 4HDRA 2ZRMA 3ZHOA 1ISHA 5LLSA 2YN0A 1E5QA 4H1UA 3KYDA 1Z00B 1OTYA 1VL1A 2FN3A 1J1IA 1C7RA 2FQWA 1TVKB 4QICA 1RNLA 4ZJUA 4FQ5A 3A2KA 4KIJA 4CKCA 4ZYUA 1F8FA 4ZCQA 5T4HA 3TX2A 2OCXA 3EIFA 3IALA 1QTNA 2HY7A 4HATA 2A86A 2P0AA 4IHKA 1U45A 2FGJA 1QNLA 2OHIA 4H2DA 4MFAA 4P92A 1L6RA 1BXRA 2CB9A 3ASYA 4PAWA 3HKDA 2DGZA 1AZWA 1N9ZA 4E4RA 4UZSA 2XGPA 4I9FA 3VISA 3B2EA 1ZYUA 3DOCA 5HX7A 2VRCA 5AW1A 1E3WA 3KQQA 1TKCA 1YR7A 1X42A 4ZZ0A 3K32A 4YJ2A 3LHIA 1GFZA 4RQ4A 5A03A 4G8JA 1Z2NX 1ZR4A 4P0PB 2B4AA 2SHKA 2CCKA 3BXFA 3QU2A 3LK9A 1N5RA 4JJ7A 3MXTA 1U3UA 2DU8A 3MWLA 1T3ZA 5MFZA 2DT5A 4DLAA 3NBAA 1YNOA 2GZSA 2NAPA 2EKBA 4LY9A 2R6CA 5KDLA 4DW8A 1HR0B 2ODBA 1PJLA 1B8UA 1C9DB 1G41A 2Y9UA 1A5ZA 3UPTA 2CHEA 3VBCA 2G70A 3C16C 3LYLA 3TQCA 1C4KA 4LPSA 4YPFA 3PSTA 3A9CA 3B5EA 3RAXA 3QX7A 2N1BA 4H0NA 1EVJA 5FL7A 3SXPA 1Z7YA 3FGZA 4CHGA 5KOHA 1LX7A 2PIAA 3GX1A 4XSGA 4J9MA 3QFRA 2LYAA 2F67A 3BWEA 4WVFA 2ATLA 3JVVA 1U2RA 4LJ5A 5JZVA 3QUQA 3KTAA 4HAYA 4FZNA 4R1UA 1GZ3A 1J70A 1YC5A 2BT4A 1ZITA 2B1RA 2I0FA 4LCJA 3B1ZA 5ECDA 3OIVA 5JD3A 1ONPA 4QDZA 1NW5A 3PRKE 2PMBA 1YUBA 5DTIA 1FW8A 1KDTA 2I99A 2PIDA 2KTQA 4EL5A 1I7NA 4EVSA 5K4GA 4IIGA 2BAGA 4JT4A 3ZJVA 1YO6A 1ZAKA 2VATA 1AGPA 3EZ7A 2MSWA 4GBED 3C7CB 2IUUA 3ZIUA 4DCVA 4F46A 3AU2A 2UDPA 3RJMA 3OUZA 4AJJA 4DZRA 3LDUA 3T41A 5IKEA 5L9AA 2UZ4A 4N6GA 1KAHA 1UXHA 1E77A 2NT3A 1V8OA 1YUMA 2OCIA 3DZBA 3MS7A 3QE0A 4L51A 4S05A 4OEHA 3D4OA 4BEWA 3P9KA 4HGZA 1MVOA 3SZOA 1X7HA 4DXAA 1G5TA 2ZS9A 3S5JA 1QG4A 4ZDJA 5JNUA 2JLCA 3LUPA 3H4BA 4KITB 1J90A 2H2HA 4PZ0A 4Q7JB 5F5LA 5DW0A 2AR9A 2F7SA 2W6ZA 4C3OB 3LNTA 3ZWNA 3HVIA 4MQ6A 4BNHA 2EG5A 1UEJA 3G8BA 3HCFA 4D80A 1CW2B 3H5VA 3NYIA 2CLHB 3UICA 1ZQIA 4R2LA 2QARB 1F9AA 5LMZA 1A96A 1QFJA 4EBFA 3ETNA 1H23A 2WKRA 4B6OA 1V2HE 4ZYVA 5L7YA 1SVWA 4RAOA 3RHTA 4G5QA 2BEUB 3ONNA 2ZYVX 1WXQA 3AEUB 3Q3CA 1N0HA 1I01A 1M67A 1O58A 4GT1A 1T5BA 1QG0A 3CF6R 4ZCPA 5IXJA 1H4QA 3WGTA 1Q6YA 2WV9A 3N3BC 3T0IA 1E1NA 2IMWP 1Q2XA 2KWIA 4JXXA 2A5YB 5EHGA 3A6DA 4ZANA 3PRJA 5K03A 4TPKA 1ZD4A 3HKBA 2J5RA 2LHTA 1TF5A 3FKSD 3MLBA 1WV0A 2XVAA 5ALPA 1JKFA 1M2OB 2OY0A 5BNWA 5IMBA 5I01A 5JH7A 4OCZA 4DIBA 4JYZA 4U9UA 1OH6A 3A9WA 5KFLA 2BCUA 3G8YA 1NUHA 4TMFA 1ZONA 3VTFA 1KHTA 1L8LA 5KFFA 3KHLA 3MFHA 5ED0A 2J6HA 5J2DA 2GEUA 2ZT7A 4LXXA 2OGWA 3DE3X 5C35A 3DFZA 1G21E 4ZHQF 3BSSA 4U1RA 2V4MA 1XLTC 3G0CA 4MWCA 2J6SA 1P5ZB 2NZJA 4IIJA 1ESEA 2H00A 4ISCA 4AJEA 5JPCA 5HUQA 1OAOA 2P3SA 3FUTA 3RWMB 3RF9A 4WEOA 2H5IA 3L4BC 2G4CA 2GT1A 1TF2A 1FP2A 3QI2A 3R5KA 3WBKA 3D8SA 1ISPA 3QOWA 4XPIA 4DIMA 3UTDA 3WLEA 5DLGA 1DJPA 2B20A 4AWAA 3GJXC 7ICQA 3IESA 4AJPA 2DLNA 4QW8A 3TXYA 3PR3A 1SVUA 1CQPA 2C20A 5J2GA 1BCSA 4PYIA 1WQ4A 3NVVA 2J5KA 2RHHA 2H29A 3F9RA 3UWOA 4U0JA 3W78A 5K0EA 2YXBA 3HJCA 2GN4A 1IWBB 1X7ZB 3H6HA 2YWGA 4OXQA 1DARA 4X8MA 3ICWA 3THSA 3EPIA 1GN8A 3MGVA 2IP4A 4QYWA 3CF2A 2A1TS 3EXFB 1SKMA 2WSLA 3QKRB 3RJKA 3E8XA 5CT9A 7ABPA 1I94B 2AN9A 5DGHA 4KZPA 2BBTA 1GSOA 4BKQA 3LOPA 5DWQA 1DK3A 1UXOA 4F5RA 1I0IA 1GFSA 1Z7EA 2E4VA 2H4FA 1OKKD 1K7FB 1Q1GA 3DEJA 1EAMA 1Y1PA 3BTUA 4MQUA 2OXOA 4RKEA 3S27A 4Q34A 1SUAA 1M1YA 3SI7A 4CMAA 3TF5A 3ER8A 4JLWA 4AB1A 1CX9B 1E9SA 4CXMA 4RF5A 1RIFA 4LQ4A 4EUEA 4GGOA 1E2BA 2P1ZA 1NZBA 2ANCA 5KZMB 3TW6A 4MNTA 5CAEA 1V45E 3EZ2A 1P45A 2QD3A 2IYYA 3KYBA 5DBIA 3TTTA 2X42A 8ICGA 3DDZX 2B1GA 4K2AA 5F5XA 4RQ1A 5CW1A 4CLRB 1SL2A 2VO1A 3QKWA 3ZU5A 3D4PA 2AH5A 2OTCA 4TLDA 4X1IB 5TPWB 3WYCA 1QLHA 3GFBA 1TIKA 4RD3A 3ECSA 1P1CA 3DAPA 2YFKA 2AI3A 1Q0LA 2R8BA 1VBKA 2NZ2A 4XQCA 1XZBA 4MRAA 3P2IA 2JD2A 3M4ZA 4LSZA 3NGLA 3CVWA 1EFRA 3P32A 2E87A 4QNLA 2WNSA 3QUBA 2GESA 2HMYB 4GSYA 4NCKA 1NMSA 4US0R 5KJEA 4YT8A 1Z47A 4F5QA 3THYA 2I9KA 2PD4A 1EFPA 4PGYA 1R4NA 4DLYA 2REBA 1OVGA 4MI1A 2R87A 4JEIA 5A04A 1K98A 3IOCA 1L5SA 5CLGA 1D2GA 4WKPA 3SNKA 4CKEB 1L7EA 1XKLA 2D62A 2MU1A 2ZJ6A 2PSFA 2RBEA 2VNIA 3A1UA 3PNYA 4YRZA 5BSGA 1BMQA 1JUDA 4OJ6A 1QCCA 5BMOA 2OB1A 2Y68A 3RTGA 3WL5A 3GDFA 1T9AA 3KR1A 3OX4A 1GZDA 1V3QE 2D3TA 3VUFA 1IPEA 1R4MB 2FUCA 2OAP1 5EINA 1DUSA 4KLSA 1C9NA 3AERB 2OFWA 2O3RA 3FZEA 4AJOA 3LWLA 5FOTA 1L1FA 4ZI5A 3WTCA 9ICGA 1BG6A 3WZMA 3CRQA 3DL4A 3K20A 2HRQA 2JHFA 2J9FA 3TG8A 1IOVA 3NDRA 2M1XA 4NLNA 4HADA 1PEDA 5KYUA 2VYCA 5D3MB 4MWSA 2ZSIA 3BE5A 4HDSA 1AK2A 3Q15C 3NLLA 1PT8A 1BPEA 5DHUA 5L4LA 2HTFA 3CR3C 3CV3A 5H70A 3SBOA 4ZVUA 3J7AC 1WYGA 5FL3A 1S0NA 2I4TA 4MMZB 1CIPA 1IWPB 1J1ZA 1WTCA 1PNQA 2SECE 2WUVA 4MW6A 4P31A 3TH5A 4DXDA 3K8QA 4BVJA 1TK9A 3HWTA 2I4RA 2Z56A 2Z43A 5BW6B 2B4TO 3ZLVA 2R44A 5KJ6A 3PXUA 3OPXA 1A2BA 2ZREA 5TF0A 1XZCA 4PGQA 1H1LA 4WTOA 4EARA 4UEWA 3JR7A 1E8MA 5JALA 4GL2A 2C1EA 4K6OA 1CETA 3H4VA 1J0EA 2I1QA 3LF2A 4KXQA 3JVDA 1NPTO 4P80A 3H5NA 1GAWA 4S1PA 5IARA 4PQYA 5KAPA 1RMTA 3O8BA 1VGRA 1UAAA 3PW0A 3QZ7A 8LDHA 1W4AA 3T1HB 2BFWA 1YJ5A 1YS9A 2TYSB 2J9GA 3C7KA 4MF2A 4MEAA 1NJSA 2FMIA 1X8KA 1GSHA 2ET6A 2P9YA 3CONA 4G09A 4Y9DA 2AE2A 5EVJA 5JR3A 5EY5B 1NX9A 2E18A 2KBFA 2J9FB 2BFBB 1GR0A 3HKCB 3N87A 4X3CA 4JC8A 4NAHA 3ZV4A 1WHSB 3G0HA 1F1BA 2FQYA 3EIEA 4I1PA 1U4BA 1AM4D 1E18A 3STUA 2E5FA 4HPJB 2XX3A 4P4PA 5BRAA 4Q37A 1X1DA 2PKRA 4XLLA 2ZTSA 1GFWA 5JD5A 1TUIA 5B58T 2XMSA 3NYRA 2XYQA 1I7QB 3GCZA 4PZNA 4GX2A 5KYYB 2BFFB 2Q29A 5CFQA 1GNTA 4NNOA 2FG6C 5D5PA 1OYWA 4W9NA 3DNFA 1M34A 2Q4BA 1DRWA 1X9IA 2H4XA 2D1SA 3JRXA 5E0KB 2WG2A 3NPMA 2QP9X 3SC3A 1A4XA 2H7VA 2QU7A 3I9OA 2KICA 3KRTA 1E3IA 4C20A 2GOYA 1A3CA 1Z8FA 3DV0B 2FSIA 1T3NA 2G6TA 1ACJA 3CPEA 1N36B 2XZDA 3HDTA 3LY7A 1CUXA 4HHEA 1JROA 3O0DA 5C4MA 2AJQA 4YREA 1A2KC 5J43A 1U9ZA 2PU7A 2VJMB 3AUFA 3TL6A 3JPRA 4AZVA 4ZEWA 2VLIA 1GZSA 1YB1A 3K2EA 3GXOA 3OJ0A 4JBIA 2XNKA 1FBNA 4YLYA 1F2TB 1NK4A 1KI6A 1RHJA 2VT7A 3CURA 3WRYC 4F9EA 4GXIA 3AL2A 3RBVA 1QZ3A 1W93A 1PFKA 1AQIA 1POWA 4Q48A 3BHJA 2C2KA 3TI0A 1ABFA 1IG3A 1U7PA 2AI1A 3GMSA 4ARSA 3O8NA 3MWDB 3BL5A 4Q4AB 2Q0SA 3TE6A 2IXFA 1QPBA 2UYQA 2ZRBA 3ICVA 3FETA 3PV0A 5BSHA 2VZ9A 1QGZA 5AW5A 1A71A 1IMJA 1G6HA 1MO2A 4TKUA 4ZO6A 1XVLA 1IWOA 5F7JA 4XCVA 3C1OA 3RKSA 4A82A 4CM9D 2AFIB 5DXFA 4LF6B 2F59A 1B22A 1L5UA 1BZYA 1YZTA 4JBWA 3GDXA 5C18A 4Q05A 5LMUB 3V4RA 1VKJA 1QIJA 2YVKA 1U3WA 2GPBA 5DM4A 2UYOA 2NVOA 2FSUA 1NR7A 1YQ9A 3ZVKA 1M76A 1M6NA 4MKZA 1XI2A 3ZNQA 4AS2A 5AVWA 2JLZA 4ND8A 2R7LA 6ABPA 5B5SA 1FYVA 2QRGA 2Z6UA 1P1FA 2BCVA 1EWTA 2N9UA 2UZ1B 4FCTA 4I9NA 2AOWA 1N2IA 4Q3KA 2CUZA 2I55A 1EWKA 1RJEA 1SB9A 8ICWA 2FVXA 1ZJZA 4KVFA 3LS2A 1V35A 4M98A 5AI9A 4DG9A 3H5WA 3E82A 3KFLA 3H86A 3JR3A 1W48A 4G8DA 5DWDA 4B44A 4GMXA 3OU2A 3HCNA 2K4PA 2V3VA 1KIFA 5EWJB 4C2AA 1HMPA 2Y0SC 3NDJA 5KYWB 4OL0A 2EAUA 1UFOA 2IYPA 2O2JA 1YIDA 1A9QA 2PX8A 4RVUA 4S1WA 2A67A 4H17A 4JHXA 1WV1A 4JT8A 2Z2XA 3TARA 5HP4A 3IULA 3WL7A 5JVDA 1XL1A 4QBIA 3IVGA 5D4BA 4LUCA 3NVKI 1WF6A 4F86A 1J21A 1URPA 1SOMA 1E96A 3FSGD 2W2XA 4TKUB 4DYVA 1AT1A 5AKXA 4CGZA 1G66A 1N57A 1RKXA 3FRHA 3IC5A 4YEDA 3W5BA 4I81A 1OZGA 4RSMA 1BJRE 4PLVA 2WYIA 1T1JA 1RZRD 4MKGA 1SL0A 1J7KA 4FNAA 4GU5A 5FTKA 4GXTA 1W25A 1OX6A 1JWBB 2W9CA 3CPHA 3I5UA 1TYEB 2QX7A 2WFAA 3KHTA 3NVDA 3BXEA 4KRYA 4EBBA 2VQFB 2H52A 3AFIA 1ULAA 4M47A 2P9BA 3H2GA 3LP5A 1PEKE 4JJAA 4F4IA 3K5WA 3K0CC 4OQEA 1TEXA 1N3LA 2VT2A 4PIVA 1WXEA 2QXTA 4BO1A 3A6PC 3W90A 1EDDA 3WWZA 3UT5B 4Q3BA 1XSPA 3FCOA 1T8PA 3N8DA 2JG3A 1U3VA 3FFXA 1GXSA 4RZIA 4E4TA 4QULA 2A1TR 2BH9A 1R9NA 3AFNA 2PU5A 1QYDA 3L1JA 4NHOA 5HEKA 4NLLA 3U1VA 1M5UA 2PKQP 2IYFA 4DDMA 5JASA 3W4KA 2I2DA 1NWHA 2OGTA 4KFSA 2OZVA 1UOPA 3VDQA 1FVHA 2XBLA 1JPVA 2JHGA 4FS8A 1BROA 4GP6A 4PX5A 4R2HA 4ZVNA 3UGQA 2VCYA 1T4CB 3JALB 4J0IA 3GRKA 1ZWKA 3LZCA 3MB8A 4GC9A 4FI3C 3AY7A 5A9RA 4IFEA 1Y1RA 1IQRA 1S3SA 3GRCA 3UY4A 5LL6P 1RYDA 4GXRA 4AKTA 4YYZA 2JFNA 2ASVA 3LDAA 2O0HA 3MF4A 4MVJG 3ORSA 5JI3E 4MRRA 5F78A 4QPNA 1Q57A 4QHTA 5LKAA 4UAWA 3HUFA 3DOJA 4KYUA 3QEBZ 4KR7A 1KZ7B 3P5BA 2RH9B 3NM6B 1JFSA 5T14A 1WUJS 1GTZA 1C3LA 1WW3A 2OG2A 2ZBEA 2X2FA 2HW3A 1K6EA 3EUWA 4NMLA 2MSKA 4Q7EA 5IUKC 4FR2A 1OH8A 4GWKA 4D42A 4HVLA 4IFTA 3HGQA 4J0FA 2YVAA 4MKXA 1RQ7A 3OO0A 1GGKA 4E70A 2VSFA 2YJ4A 1XWFA 4V0MA 4BAGA 5IC4A 4C04A 4MUKA 4MW7A 4M8SA 2DTDA 1LFAA 4IHAA 5HOQA 4QGHA 4FDAA 2ERCA 4PHGA 3S2SA 1ZQTA 4CBVA 3VJKA 2P0EA 4AK9A 1M5TA 3N58A 3V4LA 5GVSA 1P1HA 4YRAA 3IJEB 1Z88A 2BPGA 2ZSDA 3KJXA 2KP7A 3GZTB 3MWEA 4FW8A 4R2IA 4JC5A 1X15A 2PI4A 2RH8A 4UQOA 2WU4A 2XOKD 1F6DA 5CR9A 3TR6A 4BP8A 4UOEA 2LXNA 3OAAD 3H8MA 3WLTA 3CJQA 4Q1VA 3FVVA 1EIWA 3I5YA 1GT6A 2OSVA 3IQGX 3KR0A 1VP3A 4F2PA 1OI4A 1ZJYA 2KS6A 1F60A 4FD3A 1GKIA 3GOQA 1YSCA 5M3BA 2WD7A 2OBLA 1NP6A 2B0JA 2VAPA 3EGVA 3IT2A 1A97A 2JJYA 4JUDX 3P9QA 1UEXC 2JFGA 5HS6A 4BV9A 3HMKA 2NO7A 3NRCA 5JANA 4POAA 4D8XA 4AKEA 3EPLA 5BYJA 4JI7B 1QHEA 3CSDA 1R4ZA 4GMGA 2BEVA 4QODA 3P0JA 2ZUEA 1FRVA 2J07A 4IS2A 3HDVA 5CFMA 3LJKA 1K27A 4HRAA 3OPYB 4JR1A 2P1DA 3F5AA 1WXHA 2IEZA 5KYNA 2PPLA 2H85A 4AMGA 1Q3HA 1QKJA 1W7AA 2CRXA 3L8FA 4FGZA 3HK2A 1P2DA 3AQIA 3TUJC 4X66B 1U47A 2P6OA 5DJ5A 3JD4A 4BO6A 3I5AA 2D00A 1VP9A 3BHMA 4F96A 1F5NA 1UQTA 4URWR 3HU3A 1UQVA 2FRDC 5G5HA 3CUVA 4GPD1 2EJUA 5TEVA 1W52X 4BLVA 1H8EA 4BZZA 3DZGA 1S5PA 3ETCA 1CUSA 4N8EA 3PSPA 2VC2B 3D7SA 3H8JA 3KZ1E 1VM6A 3D1VA 3Q3JB 2PLRA 4JJKA 4HLNA 1IHPA 2AEJA 3WRYA 4LJAA 2AIRA 2BGWA 2IYOA 2OOKA 3A2LA 3A28A 3I3OA 3AM9A 4UM8B 4C1BA 3GLKA 4D9IA 1H2YA 1XWLA 3T5HA 4Y2YA 4CE6A 1JBEA 3MR5A 1YZHA 3BCRA 3PJEA 5BN4A 3RRMA 3FTQA 3MD0A 4HDCA 4RZSA 2QN8A 4RF4A 1JHRA 1CP2A 1WDTA 3FCCA 4R1QA 1UZNA 3JAWA 5DXJA 3ZGYA 4DIEA 1T8SA 1DKPA 1Z4JA 3FYUC 5HIAA 5BR4A 2PFOA 3ZHXA 5IFLA 3VUEA 4RY9A 1UK9A 1EFDN 3M1LA 2BEWB 1T5HX 2G9RA 2G04A 2ZYUX 3RBEA 1BRMA 1W4LA 3GDOA 3HCPA 4QRHA 5IF3A 5LLTA 1M2HA 1V4BA 1V1MB 3BMOB 3IXLA 2VAXA 4GSKA 4KGXA 1WDLA 4TTVA 3U5ZB 3T99A 4X5OA 2C88A 3AZPA 3H05A 4FIZA 1QWOA 4MDYA 3ZJUA 1VPLA 1ULBA 3T3EA 5K8TA 4O4HB 5KMGB 2NV3A 2ZYHA 4JLKA 5EE9A 2J08A 1Z74A 3ACBA 3QXGA 3WK7A 2XNDA 2W6NA 3QY0A 1IY2A 5LYYA 4BNIA 5C9ZA 5AM3A 4J9RA 4OXYA 4LY0A 5CHEA 1QRTA 1YXMA 4OQXA 2SCUA 5F52A 3ADOA 4TMKA 4Y6LA 4O0LA 1I32A 1SVSA 2JLSA 4WXYB 4Z9BA 4YMVA 2HIHA 3A0HU 5K3FB 4AUKA 3OJXA 4PXAA 3IFSA 1NVTA 3HP7A 4AULA 2Z98A 4P08A 1PZHA 1XKQA 2G8NA 2HWYA 1ORDA 3SVLA 1PG2A 1OXUA 1ZDMA 2GRAA 4WOBA 5FTWA 3OIUA 1SCDA 3EC2A 4UEJA 1NDUA 1YE8A 4JBLA 1LI4A 2NQ8A 3A1SA 4PLZA 1KOLA 4BBJA 8ICEA 1AHIA 1PP4A 3B8EA 5TMBA 4ZC8A 3RYHB 3DTTA 1EI9A 4IEFB 3W4JA 1GKYA 2I1LA 4QUGA 3BZWA 4D4GA 2PBLA 4N7MA 2HCTA 2JA1A 2ZKIA 4Y67A 1TQDA 4NE7A 1RJ9A 2WAMA 4LE1A 3V8BA 1B2LA 421PA 1J20A 3CZ5A 3GP5A 4IMRA 4ZV9A 7REQB 5JU6A 1G60A 4O4HA 3BOSA 3GRPA 1OXTA 2OZPA 3PE4A 4ECWA 3QBDA 5BSUA 3ABRB 4CPDA 3NUQA 3VU1A 1QANA 4HRVA 1U6JA 2FKNA 3BXZA 3WQHA 4EBEA 4MJ7A 2O8FB 1DJMA 4KX3A 2J0VA 4R40A 5CR0A 2AWNA 3T7CA 1HDRA 2CXHA 5BWCA 4BMXA 4KTQA 5B2FA 3ZZNA 2W22A 1W6RA 2BUAA 3VR4H 4G0OA 3RAJA 2WE8A 4PHHA 3AESB 1E2DA 4RPYA 1YULA 1NSTA 2G6BA 2Q27A 4NCNA 4QTUB 3FIUA 1TECE 1FXSA 4RDXA 3HW8A 3JXEA 3VAAA 2HRCA 3OOYA 4UVDA 4HYYA 1L4GA 1M54A 1XSEA 2ICAA 3IDQA 4L22A 4PLWA 1ZGBA 4MA0A 1YL5A 2HDWA 3BJYA 4EHKA 2RB4A 2EFYA 3EXHC 3AFMA 2DFTA 3RIGA 5C1BA 1GL9B 2NTNA 4EG4A 4ZU6X 1TX4B 2H9AA 3N70A 3NMUF 4LC1A 2QPTA 4Q66C 1W0JA 1Y48E 1A5TA 1GPKA 3HYTA 4UHCA 1QGOA 1ABEA 4I4TB 2WIGA 2ZKLA 5KUTA 1LV5A 1VBFA 4DEYA 5GJWC 5CEHA 3LVVA 2H5EA 1PUXA 3OOHA 3LSYA 4MPJA 5ER6A 2HMXA 5TPZD 1LCIA 1ESCA 1U02A 1AXGA 2FPXA 3LDHA 4JL5A 1BEUB 3HB1A 3LPLA 4WZBA 3V3TA 1K6JA 2PTHA 1BD3A 1FE8A 1DC8A 4HDMB 4LGMA 1SOWA 3HM2A 4BRZA 5G4LA 4FBMA 4C03A 5JHHB 4KW7A 4B3TB 3CGWA 1ZOSA 2QAGA 3KKPA 2ZTVA 1E2PA 4H60A 3EDMA 4TLCA 2GM3A 2ID9A 2RJOA 4FDTA 1QUEA 1LH0A 4AJ1A 2KJ5A 5AW7A 3D3EA 4BB0A 1MV5A 2QY9A 1Z18A 1C7EA 2FG5A 3A1TA 3JQGA 3UUWA 3RC3A 1IG6A 2J7KA 4YP3A 4OQNA 4RPIA 1ZLYA 3AHIA 4LRYA 2E8PA 1AKUA 1P2VA 5E6UA 2QQGA 2W6OA 2FFJA 3N1UA 3OU6A 4IQTA 3BFPA 1AE1A 1Q12A 1MDFA 3BB3A 2BDPA 3ZXYA 3SHFA 5ILGA 3WSVA 2I9PA 2O2SA 2ACKA 3BULA 1Q95A 3PHLA 4BEVA 2WHQA 4BS9A 4O1IA 2Y1OA 4JEMA 3G0OA 4LQLA 3SZUA 2OCBA 2TECE 8ICYA 1ECJA 5AVXA 1ZRHA 4IYRA 1USIA 4TUYB 4Z9AA 5F9HA 2D6FA 3GVIA 1MFPA 4C0BA 2DUYA 1UFQA 3LUKA 1O96A 1YZGA 1R5OA 4TT8A 5BWLA 2MUTA 2G40A 4O1MA 3ASZA 5IKOA 4KMUA 4BNDB 5C5CA 2VPXA 5J4KA 4DV2B 4ARCA 2HSEA 4WXHA 1CFJA 4FC7A 1XQWA 2V7TA 3L7LA 3FDJA 1TAMA 4XD2A 2C0CA 2RDJA 1IAQA 2OEHA 1P4GA 2BFFA 2WP8J 1KSJA 1VG1A 3AP1A 2QVYX 4UE2A 2F3RA 4D5EA 2A9JA 5BN3A 3GLGB 1SHUX 3JQ8B 2UVQA 2NMVA 3OT1A 2BQUA 1MHPA 3OIYA 1Y82A 5AW2A 3B70A 10MHA 2E7ZA 3VR2D 5IEJA 1XCBA 1BWPA 5LQKA 3PKJA 1QIFA 5HK9A 2X9NA 4KWHA 4II2A 2FFRA 4UDOA 3ZVLA 2HREA 3PUIA 1WEKA 3KHUA 4Q4HB 2QLJA 3GPLA 2H3QA 2JDIA 3OQNA 1NLZA 3F5MA 4LV8B 5I3CA 1LQUA 5JY1A 5E0OA 4WJLA 4DL2A 3OF2A 1XRPA 2GHQA 3QBEA 2XI9A 1Z6TA 4L07A 1XE3A 1U4SA 4LYHA 5KWEA 4LE0A 3VC2A 4ND6A 3ZVMA 2O3QA 3K5PA 2RGCA 4D99A 4YP7A 1AUOA 2XVZA 1NNI1 4M99A 5IDXA 5C0OE 5K0TA 3KHGA 2ZWAA 1ZD5A 3IIJA 1G64A 4JYCA 5G1NA 1V9PA 3C4VA 2PMEA 1B41A 2R85A 3JTMA 2H31A 3OA2A 2NU6B 3OSUA 3ZXSA 1Q8KA 4CRWB 4J1QA 2NRTA 5CDUA 5DNYB 4IJWA 1X74A 4JSRA 3K8YA 4OB6A 5FO0A 4HFMA 3UCEA 1Q3TA 1V0JA 1IPFA 1BNPA 1UXIA 2I4NA 2VDJA 3V4SA 4DTIA 4QZHA 1I4TD 1HNXB 4NP6A 5IJWA 4N47A 1CNEA 3QSYA 1QO9A 1RAHA 1TAQA 4GOND 3FDXA 3O73A 1Y4DE 4K0RA 1VCNA 5EJ4A 3QE9Y 1ZBDA 3M9XA 1BNOA 3RTDA 3TW8B 1ZM9A 4BNTA 3UAXA 3FGPA 1B1AA 2B8NA 2O48X 1ISRA 3JD2A 4X6LA 1YR3A 2EYQA 1TW3A 4FLFA 4ME6A 4PHTA 4TN5A 5U1PA 1K2VN 3IDSA 2IOFA 1QYCA 3MJTA 1KYIA 3C7AA 4RJKA 4NC9A 8ICXA 4M2YA 5DI3B 1N2ZA 3EZFA 2H3VA 4JS0A 1O03A 2ZWOA 4IJMA 4J1TA 4RZRA 4NLKA 3JQ6A 1PR6A 4ADSG 2AOTB 3FHTA 2E89A 2K8AA 1J33A 1SZDA 1XMXA 2R25B 2VF8A 3ZGXA 1P74A 2EIHA 4G5SA 3UQ0A 2BTQB 2NXEA 3OICA 4JC0A 2ZIUB 1KI3A 4MR7A 4P54A 5CAEB 4PG8A 2QZJA 2W9XA 3V4OA 3DEIA 4X7MA 1Z15A 1ZNZA 4OQMA 5EUBA 4L2IB 1M1YB 4B32A 1DUIA 1E1DA 3KUXA 1H2XA 4YP0A 3N05A 1PJ3A 4U7CA 4FGWA 4KQFA 3GH3A 4TL8A 1QTIA 1C30A 1LDBA 1R6BX 2CY0A 2CXRA 5HJ7A 3T3DA 1DRJA 2AFHE 2F64A 2PWPA 3DOOA 3LHFA 4FVTA 4XQ9A 3DF9A 3K94A 1TO1E 2Z2JA 3RO7A 2WT4A 3IE2A 4B17A 4Z4CA 1U5CA 3G5MA 4U2GA 2WG0A 4ER3A 3DV2A 4PAGA 2G3YA 3F47A 5DBAA 4DS4A 1U8YA 3C97A 3JYOA 4JMPA 4LHYA 5DM1A 3ZHVA 2J6IA 3DW3X 4FHFA 1TCBA 5DISB 3PV8A 3E7PA 2GCNA 1ZW6A 1DBPA 5KNCD 1WD7A 2V7WA 2GBPA 1NOKA 1N1DA 3IKJA 3Q9SA 4Q4JA 3X1YA 2WB1C 3WBBA 3VOSA 5AM1A 1S8NA 4OXKA 5C8YA 5F3XB 1R0SA 1D1SA 3ICQB 3JQ7A 3S55A 2GO1A 3P19A 4IHQA 2VF5X 3JWHA 4KXYA 1YB7A 2Q9AA 1T36A 4K6MA 4EFMA 4DL5A 1IYZA 4D9MA 4NDAA 3Q7RA 4E33A 5J29A 4MYRA 2PKEA 4R16A 2V58A 3B7PA 3IKTA 4XRGA 4LXYA 4UEQA 2UUPA 1LXCA 4L2IA 2IWHA 3UT6A 3F49S 1D0IA 2W8LA 1OZ0A 1HEKA 3NDBB 1UZAA 3M6MD 2LGJA 3PDIA 4KO1S 4F6RB 1OILA 1NYQA 4MQEB 4AKGA 1NJYA 1XGKA 2AF4C 4CM4A 4EF5A 2R8ZA 5EZ5A 5FBHA 3LUGA 1EXNA 2H0AA 3CS3A 2FY8A 3GXBA 3GMTA 4ESVA 4KQKA 2MT9A 3WYBA 1G3IA 2JAWA 4JENA 2R7KA 1I24A 1ZJ4A 3FPGA 3HBJA 3L8GA 3B1XA 4IJKA 3QVOA 3H1PA 5IMSA 3CW2A 5AXCA 1LDMA 3AG6A 4WT7A 3S2YA 3SC4A 1EB9A 2DBVO 4ED3A 4LDPA 4J7UA 3QU9A 1K9SA 3GLHE 4WECA 4AS3A 1ISGA 4Q9HA 1SD2A 1M34E 2V9ZA 3GNTA 3ZKAA 1Q6ZA 2EZXA 2FDRA 3AF1A 4UREA 1MQAA 5TB5A 4C3VA 4DTCA 1RQLA 3BBLA 3DUFB 3OBBA 3U9TA 2GTPA 3V4VB 2BH2A 3JATA 1X66A 5KFCA 2AXNA 2OGZA 2RAVA 4HVTA 2UUCB 1BRTA 4FZLA 5HKLA 3RS0A 4IJVA 2JK0A 3RBAA 2RG7A 4BU0A 4RTRA 3TQQA 1RWMA 4M22A 4BP3A 1E99A 4MV8A 4RPCA 1JG3A 1MC5A 1WETA 3DLBA 4RPLA 5AHKA 3ULKA 5EPUA 3A3KA 3CIFA 1QFXA 3B3QA 5JLJA 2O8CA 4BNGA 1RXIA 1S76D 1EM8B 3I2YX 2HRZA 1NKCA 1D5WA 3QFCA 4FI3F 3GRRA 4C0JA 4E21A 3ESRA 5P8WA 5JQGA 3T61A 4BO3A 2HDNB 4ESHA 2XW6A 1BOOA 2ECQA 2ES6A 5GGYA 4FFOA 2A0FA 3KOZA 4HDMA 4MV7A 1YDMA 8ICRA 3B7GA 4F91B 1VRVA 4HX5A 3BMQB 5AVZA 5KNCH 1QK3A 4LVNA 4YCJA 1OCEA 4JOQA 4WMLA 2EX0A 3C5HA 1E9EA 3MTQA 4BFZA 2P9HA 4G0QA 1Q11A 1OJLA 1W1UA 3MABA 4QUAA 1SU4A 3MG9A 1WZEA 3REOA 1C7ZA 1Z62A 3IQIX 5JZSA 4PS0A 1RKBA 4I6GA 3RHSA 3VC3A 3ZKWB 1VYVA 3HCBA 4KLIA 1ZVQA 2A0XA 1II0A 2V5UA 3EXEA 2F62A 2A0KA 3IIMA 1RWKA 3DDUA 4NJ8A 4KLNA 1E5VA 2H3FA 4KXNA 2I8LA 4MZDA 4EJSA 3HYNA 1OTXA 2EOAA 4K8RB 6REQB 4LX8A 2GJ9A 3E58A 1JHZA 4UASA 2ADFA 4OK6A 1ZQVA 1R12A 3NOOA 4FE4A 3ZUPA 4URXR 1BVYF 3OBIA 5DT9A 5IYZB 3E3LA 2NV2B 4TUYA 1TYBE 1YU6A 1NK6A 1S0OA 3O03A 1PL0A 2Z09A 4FU0A 2XF2A 3U44B 4J4BA 3QY9A 5AHWA 4I1SA 4BNJA 4G0WA 2CXXA 1Q7TA 3BTOA 1VHWA 3KQPA 1UH5A 1RWQA 2Q21A 1QS0B 2ES4A 2Y1GA 3B36A 1RW4A 2ZB7A 4QU9A 1GO3F 5LYJB 1DPGA 1O97C 4TZ6A 4IRKA 4NYMR 5LC1A 1Z6QA 4WNAB 4YH1A 4HGPA 1PD0A 4BAZA 1FXWF 4ZI7A 3SCZA 2NZUG 2RGNA 4PGHA 2FOLA 1Z5PA 1GUYA 2BFAA 1PR2A 2H16A 2I3GA 2C04A 3K9WA 5H0IA 4QM6A 4JU8A 1OU0A 2H1CA 2VDVE 4M86A 4PO1A 4QEDA 3RJZA 5IWCA 4RE5A 3KFUF 4LDRA 1ADCA 2BF4A 2W2MA 4JI1B 3SR0A 3EVTA 2Z2IA 4ECYA 4GS5A 1DQPA 3EC1A 4W9MC 3NP7A 5K4HA 4PZUA 1PHPA 1PGJA 4US8A 2HBRA 2IELA 4XJVA 4ML3A 1R0BA 1VI2A 3KJGA 2PWZA 4F2HA 3G8AA 1GNRA 3G9QA 3UFXA 2BGLA 1F38A 3X43A 1MG5A 3PB3A 2C3YA 2NZXA 1KH1A 3CNHA 1U8AA 1VJDA 3I5MA 1CUWA 3R5HA 4L76A 5DCWA 1Y34E 5FPTA 2WJYA 4A6EA 4OHPA 3VI3B 1NIJA 1I4DD 4G0MA 4REMA 3FZYA 3FI0A 4FINA 5CYPA 3IDOA 3UJ3X 1ONSA 2RH5A 5CLLA 2C03A 1MGPA 1WQ3A 2XA9A 3GUVA 2C9CA 3HL4A 4I50F 2IPNA 3M4JA 4O5OA 5K05A 4YIKA 1MN8A 5E6RA 4F06A 3UAVA 3M3DA 1XZNA 4L8FA 5FNVF 4ZPJA 5HXAA 2GCOB 3PZBA 4J1NA 2IV7A 4BKOA 3CN7A 2AUMA 2BFCB 1M8JA 1E7QA 1K8YB 4L6CA 5HM8A 1XWWA 3M8SA 3LKBA 4FJ2A 1I10A 5FUBA 4IDHA 5E79U 2XVYA 2GZRA 3K92A 3LQRA 2UYGA 3DDWA 4QOHA 2HHLA 1RQPA 5FUVA 4DMHA 1ZOIA 1FBTA 4MRSA 1VZ3A 2WNHA 4XCQA 1T10A 3OE7A 4ZCSA 3ESDA 4M37A 1KBOA 4GMKA 1YCGA 3LQFA 3WL4A 4EJ6A 4N76A 3C1UA 1HEYA 3CYFA 1L8OA 3LT1A 3STTA 2Y0CA 3OHSX 1E64A 4NL9A 2D0PB 1CEXA 5EJ5A 1KJ8A 4JUZA 1LEHA 1JDJA 1KZGB 1CDDA 4HXGA 4R5HA 5CG2A 5IRCD 1QRUA 3UW3A 1IUOA 3TBFA 1G20A 4YV2A 2BR3A 2HPVA 2ECPA 1XX6A 3O9VA 3WBJA 3ICOA 5IUNC 2DSTA 4KPYA 1TMYA 3ZJ4A 1RLMA 4QGSA 4RDHA 2R8PA 2H1WA 2ZYWX 4KLEA 1I2ZA 4MS4B 4BOYA 4KRFA 3BB1A 4ZRMA 1QIGA 3JWEA 1K8RA 1V9SA 1YRAA 3PXCX 4LF5B 4NJMB 4B79A 2K8BB 3LQ1A 3QI7A 3KJZA 3HKZC 3U49A 4KE6A 1KEEA 1V41E 4R7GA 1A5BB 3BREA 3WB9A 1CS0A 3MBKA 4BKUA 3BSWA 4JI4B 3DMPA 4DEZA 4DGSA 4MGZR 2D4HA 3VZBA 4B6JA 4JDUA 2Y1FA 3LX8A 1KOJA 2Z7JA 3K72B 4CMHA 4NABA 4P3OA 1LW6E 1Y9ZA 3MFIA 5JS7A 3BFJA 4DCCA 4OH1A 4BMVA 5C1PA 1CVIA 3ZCSA 1X7DA 1Y8AA 2Q5IA 4R64A 5JNSA 3UPDA 3BA1A 4FYPA 3RKRA 2I67A 1ETUA 1I30A 3WBFA 3N6RA 1UJMA 4P33A 1PZMA 1MOZA 3O2JA 4RS4A 4PICA 5D49A 2XCSB 4U00A 1H3EA 3DDOA 1SVNA 5EWGA 4F8EA 3UMJA 4K4IA 4YO8A 3DSRA 2XJ9A 5JD4A 3K6JA 5C4IA 3EASA 3BPSA 3D7LA 1E79A 3ME5A 1R6UA 3DWFA 4RABA 4QQKA 4MV0A 4EITA 4DSJA 1G8PA 2A3VA 1PGQA 2KBEA 1J2RA 1P91A 1YR6A 2PVPA 3LP6A 4JI6B 3BERA 3T35A 4BO2A 5IJAA 1I5EA 1QRAA 2O2CA 3M4XA 4PZLA 5T4FA 3RFTA 1FFWA 3PNKA 2J33A 1H2EA 2O19A 4JI0B 4G5HA 4PYQA 4OUDA 3DLAA 3INRA 3GAZA 4R9NA 3COWA 2PXIA 3X2EA 1QRRA 1RMQA 4I5GA 4QDXA 4WOPA 3EF3A 2X6RA 5THKA 4E15A 1KFTA 1E7RA 4Q12A 3DZ8A 3FPHA 2WKQA 1XDGA 2FDXA 2BHRA 4NESA 4LMRA 1ZQCA 2H4ZA 4Y6GB 3ZCXA 2HSJA 4J7CA 3O75A 2IE0A 5BYBA 2KIVA 2CXTA 4NATA 3KPVA 1N32B 4FTWA 1QAQA 1AA6A 1RXYA 5A3VA 1QG2A 4WXMA 5DE3A 4YMTA 3EIQA 2MR6A 2WQ7A 3IUMA 1KK3A 1MZVA 1XO0A 4J91A 2JIBA 5HIMA 3ZHSA 1FMJA 1P4RA 1XA0A 2OZEA 1CUJA 1EZ4A 1VI5A 1CRQA 2JK1A 3K9BA 4B4VA 3HDJA 4G9EA 1CI4A 5B58C 2OG1A 3D02A 4N39A 3Q8XB 4AMZA 4MR8B 3T12A 3ZDRA 4EMTA 3SZLA 4PFJA 4HLCA 2AFHA 2BCRA 3L06A 3HCAA 5A4DA 2DLCX 1UJ6A 1F2DA 2D5IA 1A69A 1NNLA 1UBTS 1U9YA 1ZIXA 2XTMA 4M6WA 4D45A 4YG2A 2QI9C 2ISQA 4KNWA 4C14A 4CMJA 1MXHA 3AY0A 3K05A 2ZTDA 2FE1A 5AUOB 5KPJA 1TJPB 2KW5A 1UMBA 3MLAA 4OPMA 4RKYA 4CW7A 3G89A 1QCYA 3PZPA 3GLRA 1YB5A 4EKGA 1IHOA 4NIMA 4GPZA 1NMXA 5EXEA 1AV6A 1COOA 3TLCA 1VG8A 1GSAA 1QH1B 2NYRA 2ZW9A 3KJHA 1GCIA 1ORRA 2DBZA 3N5CA 3DVAB 5EWEA 1JJ7A 3PITA 1UBCA 1ISFA 1Y3AA 3R6DA 3NEJA 2GGSA 1ZH6A 2FAXA 5CTAA 5GJVC 1YDHA 1A6SA 4RCYA 1JAIA 3FPEA 4UPDA 3W6PA 5BPFA 1LBIA 3ZZTA 3KSMA 3KQMA 3Q5GA 4UVGA 3RSCA 4B2LA 3KLPX 3LHSA 3K9QO 2GB4A 1Z12A 4UMVA 4JOCA 3ODGA 1XFAA 4BV3A 5FUWA 1KIAA 3CKLA 1J0CA 1J49A 2W11A 1E1MA 1LPPA 1GUBA 4I46A 3C8MA 4R2WA 2XUJA 3U44A 2NO6A 2O1WA 5EAIA 2OHGA 3T5AA 3LQ2A 4OSEA 1KMNA 3GLIB 1Y33E 3ZTYA 4UUOA 1IQUA 1NAHA 5M34A 5DSXA 1ZM4A 4HNQA 5CGZA 4IWXA 5L7TA 2Y1LA 3DFUA 3PC8C 2WABA 3T1OA 4MB2A 2VI5A 2NP7A 3B89A 3BC1A 2W43A 3ZQ6A 1KY2A 3DQQA 3GA5A 4ALLA 2MA1A 1YKSA 3PXAA 1QK5A 3TNLA 2GCIA 1BGXT 2FEMA 3PA8A 2NO4A 5AW0A 2O0LA 5M04A 3EPJA 1XCMA 4CIVA 4Z1MD 2HF2A 3O38A 4PPFA 3I73A 3FPBA 2W3RA 1L2TA 3OMWA 3B6EA 3D6HA 5J4YA 1RCUA 4KLOA 1PQYA 1TM2A 4YFYA 1MN6A 3DZKA 1WZIA 4CWAA 3VNRA 1AB6A 4L4SA 2XWQA 3ANLA 3D6JA 1EFPB 4ZRNA 3RVPA 2DG2A 3T7RA 1D1TA 1KFDA 4EVQA 2IH5A 2YBEA 4KREA 4G0XA 4EECA 1M5RA 4DIUA 1UINA 4CMEC 4ED0A 4DRZA 2YXNA 7MHTA 1A8PA 4RKRA 3GZNB 4KR2A 1CYDA 1E1QA 1KYTA 3QKSA 5IJ0B 1EXVA 1LNSA 1J9ZA 2AE1A 4QPZA 2HBMA 5B4TA 2O3SA 1QQTA 3OESA 4HRYA 4B40A 4O5CA 4YMNA 3R9IA 3QRWA 1NTOA 4DLBA 3W5IA 2QQ0A 2XWBF 4FIDA 2BDTA 2WAXA 1AQUA 2M6RA 3H17A 1OBFO 1PQ4A 3KM0A 2O05A 1L3UA 2VK8A 4HMOA 1K6XA 1XD2A 5KNLA 3ETRA 4TQSA 4L8WB 1Z8NA 4OK3A 3WI7A 3QBVA 3OHAA 2ZDGA 2OFOA 4QNNA 4V03A 2WIJA 2O1XA 3AOEA 2GXSA 1IBKB 1VPVA 1KFJB 1RWBA 2BLNA 2IITA 3RRGA 1GL7A 3QUSA 3ZE7A 1K6IA 2W70A 3WY9A