3I76A

The crystal structure of the orthorhombic form of the putative had-hydrolase yfnb from bacillus subtilis bound to magnesium reveals interdomain movement
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
228
structure length
223
Chain Sequence
KRYRTLLFDVDDTILDFQAAEALALRLLFEDQNIPLTNDMKAQYKTINQGLWRAFEEGKMTRDEVVNTRFSALLKEYGYEADGALLEQKYRRFLEEGHQLIDGAFDLISNLQQQFDLYIVTNGVSHTQYKRLRDSGLFPFFKDIFVSEDTGFQKPMKEYFNYVFERIPQFSAEHTLIIGDSLTADIKGGQLAGLDTCWMNPDMKIIPTYEIRKLEELYHILNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the orthorhombic form of the putative HAD-hydrolase YfnB from Bacillus subtilis bound to magnesium reveals interdomain movement
rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Putative HAD-hydrolase yfnB
total genus 87
structure length 223
sequence length 228
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3i76A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3i76A01
1RLTA 3SKXA 4NABA 4Y2SA 1SWWA 5AKLA 1L7MA 4KYTA 4C4TA 5ALYA 2ZBDA 3QX7A 2YJ5A 2FPUA 3DAOA 2QYHA 4QQFA 3I6BA 3CZ4A 2OBBA 5AVSA 3ZVLA 2AMYA 1MH9A 1YMQA 1ZD5A 3N8GA 1S2OA 5AIAA 2B1QA 4GXTA 2YMQA 3QUBA 3OCUA 2IOFA 2HF2A 3E8MA 1EK2A 4DW8A 3EF1A 1TJ5A 3AR7A 4EZEA 4Y2RA 2WF9A 5AW9A 2I54A 3UMCA 4BKMA 4GIBA 3EWIA 2G0AA 2HOQA 2MSNA 3NRJA 5ALKA 3OPXA 2OYCA 2HI0A 3WKAA 2C8LA 4Y2UA 1PW5A 2AGVA 3L8HA 2YJ4A 2W4MA 5ALWA 3E81A 3L0CA 3ZUPA 3UMBA 3U7HB 5AVTA 5AKHA 2FPSA 2B8JA 1RDFA 5ALJA 4YCLA 5ALTA 3U13A 4UMDA 2ZBFA 3IJ5A 4I9GA 2HDOA 4J03A 3B9BA 3OCXA 5IT0A 4UU0A 2IA5A 3A1EA 3KOOA 2DQSA 1TA0A 3EPRA 4QJBA 5AW3A 5IS2A 3SF0A 3QU4A 5AVZA 1Z4OA 2G08A 1KYTA 2G80A 4ZEXA 3L7YA 3AR9A 4KNWA 2RAVA 4CNQA 2FUEA 4HGPA 2CFSA 3WGUA 3WKCA 3DNPA 5ALGA 1CQZA 4ZEWA 2G09A 4MUMA 3N07A 1N8NA 2AH5A 5AI8A 2Q4TA 4YH1A 3A1CA 5ALIA 4HGRA 4EENA 5AK4A 4B6JA 2WF7A 3FVVA 2I34A 1XPJA 2CFTA 2O9JA 4UMEA 3FGOA 1ZD3A 4JDPA 5AM4A 5AW0A 2OA0A 4PNHA 5AKEA 1U2TA 3QUCA 4UASA 2R8EA 4XPZA 5AKIA 5AKYA 2PKEA 5IT4A 3NIWA 2YMPA 4F71A 2HSZA 5AVQA 4UARA 5AM3A 1U7PA 5AW1A 3SD7A 4IFTA 1LVHA 2C8KA 2FPWA 4BNDA 3WKBA 1RKQA 1IWOA 2Q4RA 1RKVA 2YFYA 4YCNA 5AW4A 4FFDA 5AK3A 3WK4A 3NASA 2NO5A 3ONNA 2BDEA 4MWOA 3QNMA 3KC2A 1WPGA 5ALUA 1ZS9A 3A1DA 1RC8A 4EX6A 4Y2PA 5AW7A 1WZCA 3R9KA 4CF4A 2WM8A 2W11A 4KX3A 3QXGA 3CNHA 4BEVA 4UAUA 1Z4IA 2OM6A 3AR4A 2R8YA 5AESA 2FPXA 1ZOLA 2HO4A 2JGAA 3NALA 1WVIA 3KBBA 1F5SA 2WF6A 3WK5A 2HHLA 3KD3A 3F9RA 3W5DA 1Z4LA 4G63A 1Z5GA 3WK9A 2JAWA 3L0BA 4UMVA 2WF8A 3N5KA 1Z4KA 4H1WA 2R8XA 1QYIA 3ZU6A 3ZWKA 3AR8A 3PGVA 1K1EA 2JAOA 2FPRA 1X42A 1TE2A 1SWVA 2ZXEA 3UMGA 2G07A 3M9LA 2I55A 5E0OA 3DDHA 5AI6A 2QLTA 1Z5UA 4Y2VA 4XOUA 2B1RA 3FPSA 1RQLA 3L0YA 4AP9A 2IOHA 3OTQA 4BEWA 2HX1A 2HEGA 3MMZA 5ALOA 1J97A 1U02A 1RLOA 3QLEA 3SHQA 4JB3A 5AIBA 3BWVA 4FYPA 2B82A 1YJ5A 3R4CA 5ALHA 2G06A 4YGYA 1JUDA 4XE5A 1RPZA 5ALLA 2JAUA 5ALNA 5AICA 5AVWA 2HCFA 1Z88A 3ZTWA 2ZBGA 5ALXA 5ALMA 1VFPA 5ALVA 2WF5A 2I7DA 2FDRA 3ZX5A 1Z4QA 1SU4A 4L57A 3NANA 4UM5A 3E84A 3IRUA 5AKKA 4O8CA 1O03A 3EF0A 1L7OA 2X4DA 3M1YA 5AW8A 1ZRNA 4C4SA 2PQ0A 3MN1A 2WHEA 2GMWA 5AI0A 3RFUA 1L7PA 1RMQA 2ZBEA 3AR2A 3I76A 4CF5A 5AK5A 2EATA 3AR5A 2C9MA 4G9BA 2GHTA 3ET4A 4BX2A 5ALFA 4Y2TA 3OCZA 1ZJJA 4UATA 3QUTA 4BYGA 4ZEVA 3L8EA 3N28A 4OCZA 4XQ0A 1QH9A 1TJ3A 4UAVA 2NO4A 2YMLA 3QGMA 2MU1A 1T9ZA 3HYCA 1J8DA 5AM1A 3K1ZA 5AI9A 4L6AA 1AQ6A 2P11A 1T5TA 1VJ5A 3ZVMA 1L8LA 3QYPA 2IYEA 3NUQA 5AVUA 2NYVA 3BA6A 5AKXA 1Z4PX 5FP0A 1XP5A 4C4RA 3L1VA 2G1AA 4BX0A 4Y3UA 5AVXA 5AW6A 3R09A 3NAMA 2W43A 3A3YA 5AI5A 3OCWA 5A3QA 1L8OA 5ALEA 4UW9A 4NFLA 3B9RA 5A3SA 2YN4A 1N9KA 3WK8A 3TLMA 4Y2QA 2VKQA 2CFRA 3IB6A 4YIKA 4BNDB 1QQ5A 4OFZA 4BBJA 4KX5A 3AR6A 2CN1A 3OCVA 2EARA 3AR3A 2YJ6A 4Y2XA 4Y2YA 3DV9A 3PGLA 1VJRA 4CF3A 1YNSA 3B8EA 4EX7A 4HYTA 1YDFA 1ZD2P 5AVVA 1FEZA 2AUTA 3D6JA 3E58A 2JARA 3ZVNA 5AW5A 5AKJA 1LTQA 3FM9A 2B30A 2I33A 4UM7A 1Y8AA 4EEKA 4EELA 3W5CA 3KDPA 3S6JA 3ED5A 4RETA 3N1UA 3J7TA 2RBKA 5AKGA 3SLRA 5AI4A 1RMYA 4BX3A 3QU7A 2YY6A 3ESQA 3VAYA 3FPBA 4NV0A 4I9FA 1RMTA 2FI1A 1T5SA 4UMFA 5T41A 1S8OA 5ALRA 1RKUA 2PR7A 2C4NA 1Z4MA 5AK6A 3QU2A 2GO7A 5AHXA 2FEAA 1NNLA 4HGQA 3W5AA 3WK7A 3OCYA 4YIHA 3U26A 5ALZA 4IG4A 4NAVA 3L1UA 3KZXA 1RQNA 1O08A 4DFDA 1XVIA 4OHFA 2D2VA 3ESRA 3L8GA 5AVYA 1ZD4A 4F72A 2YJ3A 2C88A 3ZTYA 3GYGA 2ZOSA 3P96A 1QQ6A 3I28A 3U19A 3UM9A 4AS3A 1QQ7A 1TJ4A 1U7OA 3WGVA 2ODAA 4UU1A 3U7GA 3PDWA 2RARA 5AM2A 4HGNA 4J2TA 3RF6A 4E88A 2I6XA 1Z4NA 4FE3A 2B0CA 3U7EB 3W5BA 3WKDA 2P27A 1EK1A 1Q92A 5AKZA 1CR6A 3U7FB 3QU5A 2BDUA 2RB5A 3SKYA 2ZG6A 4L6CA 1NRWA 5AVRA 2GHQA 4NWIA 3ET5A 2GFHA 4RESA 5ALDA 4Y2JA 1RLMA 1Q91A 2BY4A 4DWOA 2IOFK 5AM5A 3MPOA 5A3RA 4HAIA 3HLTA 1NF2A 4OD0A 5ALPA 5ALQA 2O2XA 2HF7A 1ZRMA 3ZW7A 2R8ZA 4HGOA 3ZX4A 3PCTA 3L8FA 1YS9A 4DCCA 2EAUA 1YV9A 1WR8A 3ZWDA 3I1YA 2YBDA 2WFAA 3L5KA 1RRCA 3MC1A 5AW2A 2MU2A 2Q5EA 1U2SA 2YMMA 3FZQA 3WKEA 4AS2A 3WK6A 2P69A 4KNVA 5JJBA 1Z4JA 3ZI4A 5ALSA 4CE6A 1L7NA 3QU9A 3QUQA 3SMVA 2FUCA 2P9JA 2B8EA 4YCMA 4KN8A 1L6RA 5AM0A
chains in the Genus database with same CATH superfamily
2VDJA 5EE9A 1N9GB 7ICNA 3H11B 1A9ZA 4R1UA 3RJGA 3OQOA 1DC4A 4GXKA 4WGGA 1CBUA 3TJZA 1DELA 4RL4A 2R2GA 3R75A 2V97A 5E1BA 4C4TA 4JMUA 1Z8NA 1KSFX 2YRFA 5J59A 2JGRA 2Q5QA 2FPUA 2PEYA 4BFZA 5EJ7A 3QKSB 3R7WA 1QCDA 1T8RA 1IOZA 4QQFA 5HHHA 2B8TA 1POWA 1TXGA 5BNZA 4MUFA 1L6IA 5K0LA 5IAKA 4TZ6A 2O2ZA 3FLEA 2HFKA 4NJMA 4RYDA 4QT0A 5DM4A 5TVKA 5HMLA 3K35A 1N1DA 1NW3A 3T5MA 1E6LA 1I2BA 5DLGA 1D2GA 3HC7A 2HRBA 2ISPA 4HFJA 2CB9A 4KEAA 5LDHA 1SOUA 3WMFA 5KT7A 3OZVA 1Y9JA 2HADA 2WVJA 8ICTA 4IDPA 1R6XA 1QUEA 4I2BA 3BK7A 3U0BA 1EM8A 5KFDA 1DLJA 1RYEA 3OLVA 4EO7A 4CFZA 4HZUA 4Z6EA 2CLKB 2QWXA 1DOQA 2H63A 4GSLA 3A4YA 5LKRA 1TJ5A 4JBYA 4WBNB 4YHHB 1H4QA 3F9CA 4EITA 3EXIB 3L93A 5FWAA 2JIOA 2H4JA 5DBHX 4FZ5A 1ZOSA 4CIBA 2W9AA 2HJHA 1E2GA 4OKSA 1O97D 1QZTA 3DKKA 3S2FA 1S10A 4U63A 2KIWA 4BKOA 5DLEA 3ZUPA 1W7AA 4L8VA 4RD3A 1CIVA 5J8YA 4RVHA 3HP1A 5LA6A 5TMEA 4F85A 4BBAA 4ZZ0A 1W9MA 2NZWA 1DAFA 3RREA 2AC2A 4PZZA 3UAWA 4YMLA 3U7HB 3HRIA 5KT2A 3I30X 1Q7GA 3KHUA 1QXSA 3DYBA 3P9ZA 4FFRA 5TQ2A 1L5RA 2WTFA 2BFDB 2VHWA 3EH2A 4TSFA 5BYAA 1R6TA 4EZIA 2O8DA 3RC7A 4A0RA 2NG1A 3ZJ5A 5HIKA 1V25A 2B83A 3RD5A 2YTUA 1JBQA 1JSZA 1N7IA 5K1ZA 3V7JA 2GJKA 4TTTS 2IELA 4V38A 4JWNA 1ZA1A 3AL2A 2GCEA 1I3OA 1TIPA 2X5KO 4QWMA 4FKBA 1AGNA 1UADA 3I53A 1AQUA 4JWKA 4MV7A 5DB7A 1SOWA 3R6GA 1MVLA 1OREA 4G09A 4F2HA 1PJSA 4TMYA 4P7FA 3HP7A 3MNFA 4LOKA 3V8EA 5HGXA 1QIGA 1DZIA 4EB6B 1RT9A 4LDJA 3SIWA 1C0KA 4D8TA 4U7JA 4XAQA 3ZNPA 3QEKA 4RIIA 1KNQA 1O5IA 2RAVA 3P9QA 3AUTA 5A9TA 3L0OA 4FB5A 3NAGA 3SSNA 3DTVA 1QNFA 4A26A 3OMXA 1N34B 1ULAA 2ZRKA 2VDWB 3QPCA 1CQZA 3TVTA 2WRZA 3KOMA 4P4SB 1YZVA 4R9VA 3TD9A 2EKPA 2OY0A 3B6ZA 5BWCA 2VAVA 3LYHA 3EZXA 3QA9A 3AUAA 4LFCB 4EKDA 3JZDA 2O1EA 5D4BA 3TAQA 4I1SA 1G8SA 1QR6A 4PANA 4YH1A 3ZDYB 4WZZA 4DQVA 2PUJA 1XX6A 3G0IA 3G8BA 4K9LA 4EYIB 2KI5A 5KNCD 2XY6A 3NETA 4GOND 2ZB7A 3DDWA 4G0PA 4FIDA 5JSZA 1NDHA 4B4VA 1O95A 1AXEA 3H5LA 3OF5A 4PNHA 1RLIA 3HW8A 1LVUA 3AXTA 4WKBA 2ZUBA 1DIBA 2F6RA 2HGSA 2WK1A 4G0OA 4ZQIA 4LOIA 1HG1A 2QZSA 4JL6A 2R1TB 5HK8A 3AVUA 5IT4A 1ZX1A 4FCTA 4QZAA 2P1ZA 3D0QA 4XYEA 4KZKA 4F5PA 4CLRA 2QBYA 1F8FA 1UEJA 4CG1A 2O6LA 2X13A 3ZGNA 5L3SB 2A9RA 1BC5A 1ZQRA 3HKCA 4QZ8A 1P1HA 4EKNB 5LQJA 2XZOA 4ZTZB 1E1MA 1MW8X 3LGXA 1OH5A 1SZJG 4KTQA 5J2IA 1KJWA 2Z8YM 3PKZA 2NXJA 2YXNA 3AHGA 3G2KA 2VPTA 4YCNA 5DBIA 4OJOA 4U7DA 1AA6A 3MBKA 1X70A 1Q2XA 1UWVA 3IPYA 3KPJA 5LBTA 4M8LA 2GLUA 3IT2A 3A1UA 2C7PA 2Y9UA 1Z9BA 5J0TA 1ZS9A 2ZTLA 2KMLA 1AN9A 5B3JC 2IU3A 1Z2NX 1A9XA 1ZQFA 2XJ9A 2X0RA 2PGOA 4F04A 4HNVA 2Q3CA 1DJQA 1FYVA 1WZCA 4AMYA 1DIOB 5BSFA 2H3QA 1DG9A 4I99A 1N8SA 3TACB 2O2YA 3QHPA 2Z8YA 1UKZA 4TUQA 1YQXA 1Z62A 3LYLA 3PHLA 4I6EA 1S0OA 4URWR 5EVCA 5JSUA 2FUKA 4I9NA 1T10A 3IESA 1J0AA 4XQ8A 5AHKA 4ERNA 2DR2A 1LBSA 3B3GA 2WLTA 3FCYA 5CA1F 1XSNA 3IAFA 3M0EA 3BVPA 1ZMXA 2J6IA 3IILA 3HU1A 5FB3A 5FTMA 4JI1B 4C7VA 4HMPA 1WMFA 4D0RA 2Z6UA 1LU9A 3MGCA 1X7GA 1WNFA 1P2TA 1XRMA 3PSFA 1Z0SA 3E9MA 3QH4A 1O57A 1XZBA 3CZPA 1RC1A 2QS9A 4FKZA 2J0VA 1GPH1 2NZXA 1QFSA 3DLCA 2CNKA 4GWKA 1S8NA 3CEMA 4NM1A 3KWLA 1NI4B 3WBFA 2IS2A 1QMGA 3FCXA 1CUKA 5M3BA 4MIKA 4OEHA 2WHXA 3BZWA 2B5WA 3BCUA 2JRLA 4L0CA 2WF8A 1GLNA 1K92A 1T2AA 1GQOA 1L8XA 4HXFB 1A27A 1A82A 2B2XA 2J31A 3ESZA 2C3YA 3DOUA 1E99A 2WUGA 1E0KA 2DF8A 2ZB2A 4D4IA 1ZESA 3AF1A 1C8LA 1SOMA 3EA0A 3HGTA 1R0YA 3FNBA 4L22A 4C0BA 3T5PA 4K4GA 2XPCA 3LW8A 3OQIB 4FGSA 4NBVA 3H4DA 2R8JA 1X66A 1JHDA 1XMJA 4TL8A 3WDSA 4BCCA 5E1MA 4E21A 5ISMA 1O9BA 2FQYA 2OCXA 3RU2A 3TQIA 3TZHA 3F49S 3HR4A 5CGQB 3H5VA 4OMCA 5A0VA 4FYKA 1XZMA 4RMNA 3X1MA 1HQCA 4JH0A 5ED0A 4X85A 2C95A 2IZ6A 4RM3A 2Q9AA 4HI0E 3M9WA 1CQIB 4UUBA 2DG2A 4ARUA 4NLBA 3MJRA 4BTEA 5CB4B 1LZKA 4H4CA 3DDZX 4G84A 2FX5A 1A77A 1TTQB 2R6DA 4LBYA 3DHVA 2QZ9A 1X74A 3ZE2B 2CFOA 3AEUB 2AX4A 3D4LA 4QXPA 1NVDA 1RWVA 2RG1A 4XGRA 5ALOA 3VVLA 3IP4B 1YB2A 2MJLA 2MCFA 5A02A 2DPIA 2GPWA 4BE4A 1JU4A 5B55A 3GV8B 1F7UA 3H3FA 1RQXA 2H7YA 1MJGA 2XOEA 4YGYA 3RVOA 3ZXYA 2IZ7A 1DE0A 3PKJA 3EGVA 3V4VB 4CV2A 3KKQA 1UC4B 1CWUA 2I3BA 4HEHA 5B53A 1YIOA 1D0VA 1TD1A 1U2QA 3LT0A 1XQWA 4F56A 4HNTA 2BCRA 3W9UA 4II3A 1P39A 2HAEA 4BMDA 1RM5A 2PUHA 3DEHA 4U7WA 1SUPA 3VR5A 1BS1A 1XVTA 3FIJA 3MJDA 4H3KB 4JC8A 4NS1A 3ETGA 4NZPA 4DCVA 2WKPA 4LRYA 4J49A 4ZYLA 3IRUA 4WN3A 5AKKA 1O03A 4G0MA 4FBTA 1N6OA 5BVHB 4WAUA 1ZRNA 3MN1A 4EKYA 2ZS7A 1E9DA 1N77A 3Q8PB 2YIDA 4JY7A 3K2QA 4MFCA 1A4XA 4YN3A 3UHJA 4Z51A 4CBVA 5D49A 1Q83A 4KLMA 1XKLA 1E2EA 3DEFA 4KQEA 1HEYA 2CY0A 4XKJA 3WRYC 2GEVA 2ZDGA 2Q4OA 2RMKA 4Q12A 2QD5A 3BFKA 4XX1A 3L6RA 2UVDA 3TLGB 3H11A 1Z28A 3G7UA 1QDUA 4ZEVA 3V8MA 3F8TA 3BGVA 3EXFB 2DX7A 5COBA 1KBQA 4UTZA 4CLOB 5AXDA 1Z00A 2HPZA 5AT1A 1W8IA 3EIXA 4INOA 3CH4B 3RU3A 4ZYVA 2YMLA 5D5QA 4K6GA 1OXTA 4PZYA 3K70B 1QJ4A 5KFFA 3WGKA 5LQAA 2PUBA 2MU1A 3PMNA 2X0KA 3BMQB 3VUEA 3WIVA 3CVWA 3D6TB 3GD5A 3KAKA 1E5VA 4BO6A 4U6SA 3IMKA 3LIIA 4MPRA 3W9SA 4A9AA 3G2JA 4CMKA 2YY5A 3TPCA 3G8CA 5BOLA 5LB4A 1R6BX 2FMHA 3K0KA 3ESBA 4OQQA 1V45E 4Q44A 2OB1A 2GBCA 1Q19A 3IAAA 4L72A 2O8BA 2P0EA 1H2FA 3RYHB 5IUJC 1NBEA 3OO1A 1JLHA 1AMUA 4XM1A 3K20A 4PWZA 2AN1A 4Y6QA 1DRVA 1O94C 2PT6A 4S0XA 1Q16A 3L9XA 4F6LA 2NYRA 2DTEA 3QBVA 4EA6A 2A0WA 3M1IA 3UGKA 3VC3A 4TLMB 4E5PA 2BGWA 2O6HA 1NNEA 2FRXA 4J0KA 3VMFA 2WTUA 1P7VA 1F14A 4R1NA 4XWYA 3C6QA 3GROA 3OLQA 3U56A 1ZQ9A 4FBMA 3RHFA 4UW9A 5FLEX 3EZ2A 3WLHA 2ARKA 3R5FA 5EKXA 2WWXA 8ICGA 4GXRA 2CNDA 2CVFA 5JD3A 4C3UA 1JXQA 2CDRA 3G68A 2GLXA 3NOQA 2AEFA 1JXLA 2JCYA 4Q7EA 4BGIA 4D44A 3U6BA 4HLNA 2O2IA 3AN1A 2IS4A 5ICGA 3WHPA 1I2MA 1HM5A 1OZ0A 3ISTA 3LMKA 3MYYA 4JNKA 4F84A 4B44A 1JQJC 3IOMA 4NOMA 3L77A 4KLGA 1U3CA 1RAHA 2HQSA 8ICIA 3EAFA 1C7YA 5AVOA 2J1LA 5KT5A 2QL9A 1LI7A 1NDUA 2MOKA 1LQUA 3AGQA 2P6NA 3AM4A 3GLKA 4YCBA 3UKDA 1W5BA 2IHTA 2UYGA 1I6KA 1UBOS 3A9RA 4EGFA 2JGLA 2XB9A 4FINA 2M6KA 2ZM6B 3KVYA 5LA6B 1QTNA 3I2YX 4PM4A 2PMBA 3Q41A 2NT3A 5D3KA 2WKWA 3T4UA 3TZBA 3TUJC 3WDLA 5C1OA 1CUDA 1XELA 5LDGA 3KQWA 5EP3A 3TPFA 2I6QA 3QWAA 1JSXA 4V0KA 1J8FA 3F90A 3LSYA 5GP1A 3TE7A 1QRTA 3TOSA 3KTAB 2BE7A 3FGPA 2RRDA 3G1TA 3EUB2 3V4FA 2VA3A 2B36A 4OA5A 1Q11A 3VHXB 3ZCQA 3D6HA 3EDQA 4RY0A 4ED6A 2HHVA 1IMOA 1NFRA 1XSEA 2H4FA 3M6UA 1DO8A 1SH7A 3HJGA 1XTIA 4UUPA 1KY3A 5BT9A 3SU8A 3FHOA 1N0HA 2PXHA 3S2EA 3A2KA 1SURA 3VNBA 2R1UA 2FFBA 2WYVA 2VI5A 3VSAA 3GJTA 4ETWA 1G20E 1CX9B 3A25A 2AL7A 4WDRA 4Z0TA 2YS7A 4EBBA 4G0UA 3HCAA 2E49A 3MFHA 1HI9A 2ZE6A 3LVBA 1IBKB 3BK1A 1C7FA 1KTQA 2JLZA 1T36B 5ULLA 1O08A 1IIPA 3EG5A 3KEGA 1GAWA 4W7SA 4YRFA 3TLXA 1FVOA 3ZE8A 1GZ5A 4G89A 1IUOA 1N48A 3E35A 4YB8A 2I0FA 3TSZA 4GVLA 4DHEA 3BWXA 1JECA 3EIFA 3ORHA 1COZA 4IIDA 4O4JF 5CB8A 2MR6A 2PA3A 3WYGA 4ZVNA 1TAGA 1CLEA 3AF3A 4LSGA 1UJMA 4M1KA 3HA5A 4MWDA 1H6CA 1K9SA 1FDVA 1R6DA 3UV6A 5L1JA 5T67A 3ROXA 3B51X 4H60A 1SCNE 2BFEA 2ZBVA 3ZJUA 3I83A 3HHEA 4S1OA 5TPWA 1V3QE 2HBLA 5I5GA 1UXIA 1ST2A 1V7PC 2AC4A 3QU5A 2RH5A 2RB5A 2ZIGA 3ACDA 4TMFA 3X43A 3BWMA 2WM3A 4GOXA 1PK3A 3U13A 4OJNA 2ZJ0A 1XLUA 1N6KA 3KXPA 3TEFA 4NWIA 4EUFA 1G9TA 3LDHA 4JZYA 4RSHA 3NEYA 4YCDA 1SXDA 3PW0A 1RFGE 1WQ1R 1TU4A 3KDAA 4BNWA 2FDXA 3D02A 1DTWA 2M0NA 1RAFA 1B76A 5IT9A 3MUNA 5I7FA 1U0EA 1VIMA 1KMQA 3G9XA 4DG9A 2EFCB 2WJ4A 3JYLA 4ETIA 1A9XB 1E61A 1ZH6A 4V0OA 1NN5A 4Y7CA 1KDOA 2PQ6A 3L92A 4ARBA 4YLGA 5EVJA 2K8BB 3IE1A 1UK8A 2NACA 3VSDA 4WW0A 5KSZA 1RZRA 1PT5A 4S2UA 1X7XA 2CL5A 4X54A 3M2TA 2FE1A 1CY2A 4GYJA 4BWGA 1VP3A 2G1PA 1AKEA 1PZFA 2R7NA 1DKUA 2W71A 5CAEA 2W8LA 2O0LA 3UCEA 1XVUA 4BVBA 1I30A 4JENA 4XARA 3FY4A 4B71A 5AW2A 1Y3AA 1ZN2A 2AJBA 4LHWA 4TSFD 1IUKA 2W55A 1WX1A 2SKCA 3P9PA 4P3PA 4WE3A 1U5AA 1Y1SA 2Q2NA 3QKRA 1ETUA 4GZLA 1DG3A 5C3MA 3A1SA 4O25A 2HNKA 3B6IA 1JYSA 1ZD1A 2ZB4A 3RIEA 2FG5A 1U2GA 1UZUA 1ZUHA 3CTPA 3DPUA 4TPKA 3H19A 4M49A 1ZD8A 4ZO9A 1EXMA 4G41A 5CFPA 2PUCA 2ZYUX 4OLAA 3EZ7A 3VSCA 4UQGA 5F9FA 1JT9A 1YJAA 2YV3A 4MVJA 3J80A 4Y0VA 2IXDA 2Q5LA 2YJZA 2W2KB 1E6EA 2A8YA 3C16C 2NV2B 3FXAA 4MVCA 1VRWA 2QMQA 2VXBA 4XWAA 1HQDA 3ORSA 1VYUA 5EQFA 5LOVF 4DA4A 4IRKA 1QHNA 2VCEA 1PW7A 3RGGA 3OJCA 1LI4A 4D46A 5AKLA 4YJ2B 3QFCA 1OIVA 3N6VA 2IGTA 2B92A 1H4TA 4KITB 3HKEA 4N3CA 5EC8A 2QDKA 1NT2A 4KK4A 2O3JA 2R79A 3GB9A 3N6RA 5JE8A 2HHHB 1MPTA 4L1KA 2JVKA 1USWA 4IMRA 4OAOA 5KNBH 5CH3A 3EY9A 4A0GA 5KOIA 5DI3B 2Q4DA 4UAZA 1VIAA 3UXOA 2HREA 4F3RA 2PVPA 3JU3A 3JR7A 4UEOA 4ZT5A 4GEKA 2CLFB 1E2PA 2JFOA 4TV8B 2ZXUA 1I7NA 2G4VA 2RHWA 1ULSA 3CSSA 1PJTA 3Q98A 4LI0A 1TK3A 2ZUEA 1RZUA 3C87A 4HLCA 1AS0A 1YI1A 2BBSA 1M10A 3JWPA 3WMXA 4E0DA 4O29A 5JDIA 3AF6A 3T0GA 1S2NA 4FJ1A 5KJ6A 2VDQB 2QZ4A 5I48A 1GTVA 1G8JA 5B6PA 3RBVA 5E4YA 5C4MA 4G5YA 1HMYA 2FMSA 3RAQA 1RM4A 1YQ9A 2DZDA 2RHOA 3EF1A 3F6YA 3IDZA 3T7JA 2ZPAA 4CMAA 1N1EA 3KKMA 5HS6A 3H87A 3KYBA 4IOMA 1KAOA 5ABPA 1EGAA 1ADCA 3ABRB 1PWEA 2V7QA 4DYDA 4RQ7A 2H9AA 2HOQA 3C8DA 4RENA 2CXSA 2HI0A 1G5TA 4AJ1A 4CM8B 4DE5A 4JI0B 5IIIA 1GEEA 3DT8A 3L8HA 3WGHA 4KZPA 2IE8A 2YV4A 4QATA 1E4OA 4UE3S 2OBLA 1XEXB 2EF1A 3O47A 3UMBA 1T0HB 4UHKA 3I52A 4S0ZA 4EHIA 4JLJA 4RS3A 2IY7A 1QO0D 2ACWA 5CG1A 5K6RA 2JCVA 1N0UA 3R23A 4GYKA 3RAFC 2XUAA 4D5EA 2ZROA 1CR1A 5KYVA 3G8AA 2FWJA 2Z2KA 3Q8WA 3DFIA 5EZ5A 2A35A 3OU2A 3DMYA 5KNCH 4WCFA 3VNRA 5CBPB 3JPNA 3GJ3A 3UB4A 1BSVA 4YJ2F 3ZE7A 4J03A 4JD5A 1ZJNA 3ROZA 2CLHB 3OY7A 4I4TB 3JYHA 3Q15C 4E2WA 3B7PA 5M04A 4I2NA 4RPXA 2PO7A 5CA0F 1QR2A 2Q5OA 5JD4A 3HSKA 1CI4A 1VKRA 2RHTA 5AW3A 1GTSA 1B0PA 1QHGA 3A7DA 2BHNA 2AMLA 3L40A 3HA7A 4YEDA 4DPMA 5TV2A 4R8UB 5BUQA 5GY7A 3U48A 2OKCA 4B6GA 1JI3A 1Y5NA 5JAPA 3IUSA 3QSYA 2EAPA 4PYQA 2EC5A 1QCCA 3IHKA 1NK7A 1NJYA 4M37A 4H35A 1DAPA 4RDXA 1T0IA 3KJHA 1OLSB 3G89A 4YA6A 4Z4QA 4C43A 3WKCA 2QM0A 4NLZA 4YV0A 2G72A 1AKMA 1G5PA 1Y6JA 2IF2A 3I6QA 1HX7A 3LX4A 2P1RA 2ZPUA 5EIBC 2NMVA 1OFGA 3KHHA 1DPFA 1T36A 2ZRGA 3H86A 4DMGA 5IJZA 3OIUA 3P9RA 4KLFA 1N8NA 2WG2A 3DMGA 3L0DA 4TKUA 1BA2A 1DB3A 1PT8A 1YR2A 2ZYVX 4PHCA 2BM0A 4RF5A 1VI6A 4P4TA 3LSTA 4D8VA 3OM1A 4DJ5X 4GR9A 2NUAA 4RPGA 4JQOA 2BCSA 3KVVA 5CFNA 5AOVA 6PFKA 1X0XA 1AB5A 1EGQA 3SAHA 1E2UA 3IP7A 5EOZA 1VPLA 1P5HA 4KU4A 4RVUA 2CVQA 3FGOA 5IN5A 3VA7A 1EVEA 5TJHA 1XZHA 1IFXA 2VJMB 3EIHA 1K4MA 1JLLA 3FBTA 4BKRA 9ICNA 1LEHA 3VVCA 4XPZA 2JFZA 4ZCIA 2MSKA 5KFPA 1X1QA 4IUYA 5EHZA 4UUMA 4JU9A 1O6BA 4JBHA 5JRZA 1G38A 1RXUA 5G0UA 5KG6A 3EW9A 4QRHA 3ADPA 4RNCA 4UUNA 3NUGA 3P20A 3RTEA 2WE7A 3GEEA 2FFRA 3F5SA 3WMGA 5AVQA 3SR6A 4ER3A 4LRSB 3N87A 2DBYA 4PQEA 4F9EA 1BD4A 4BNGA 4F4FA 4PFQA 2P6OA 2IYPA 4L5CA 3VHQA 2GWHA 3DL0A 3IMFA 3MJ4A 1VIYA 5AW4A 1JH8A 4X3PA 4TSRA 1LS6A 1XJQA 3PX0A 2CSUA 3QNMA 1QC5A 2C1EA 1YZTA 4RAOA 3QITA 4K6FA 3ZE9A 3B52X 3GA0A 3A1DA 4DOCA 2A1AA 4ZQHA 2RIPA 3KOWA 1JDBB 1N3YA 3FIUA 4E4TA 1ZH4A 1FVHA 1H94A 2RB4A 3IIMA 3MD0A 3O91A 5JXGA 3RR7A 5KNLA 2OCIA 3D3NA 3ZV7A 4CF4A 4L3WA 2PX5A 3ZXXA 2XKKA 4X90A 3L02A 4JLAA 1VG8A 4EQZA 1XROA 2HWYA 1GPNA 1RR6A 5EE5B 1OX4A 1HE1C 2OGZA 2HBKA 2P68A 3K09C 4RPJA 4HYQA 5FBRB 3UYKA 9MHTA 1KFCB 3UCXA 3O4RA 2FPXA 2E5WA 2HO4A 3BC1A 3RHTA 3G5UA 3MS2A 4PZNA 4WVLA 4A92A 3L04A 3SSAA 2WJWA 3SJZA 1OFUX 3F6CA 3SJAA 3SF8B 3AZPA 1D5CA 1ZXBA 2E7ZA 2R48A 3P2KA 5KJEA 3T8YA 1KO8A 4ZJPA 1DOAA 2GN8A 5D00A 4Z4EA 2CYBA 2X22A 2E48A 3ES9A 2OUIA 1KW4A 5KG0A 3SBDA 9ICPA 3H6HA 2VUSA 3LGAA 3KR1A 3WYNA 3GT7A 3GDWA 2PMFA 4IDCA 1UAGA 3ZZ0A 5BXQC 3RBDA 4R2HA 3OQ6A 5CLJA 1K1EA 4NXNB 2OORC 4FHEA 4K1LA 1ECCA 4C2UA 5J9FA 4QUDA 3HWWA 2BEVA 4C05A 4FKMA 4EYQA 5JY1A 4CODB 2R7AA 4C3VA 8AT1A 2DERA 1F0PA 1OYYA 1H0KA 2NXNA 2HEIA 2I2WA 4HDKA 4JZKA 4ZTBA 3WZ2A 5H70A 5B6IA 4XOUA 1PDVA 3V7KA 5FLKA 2GVZC 3M6WA 3VC2A 3UAVA 2O2HA 3BXPA 3COYA 3OD5A 4F06A 4MR7B 2E1EA 4MWGA 4FLEA 2F4NA 2BGGA 4RX1A 2JFFA 4LMBA 1ZIYA 5AP9A 1IJKA 4RFSB 1DJLA 1E5TA 1EK5A 1K63A 1QO0A 3GV7B 1WOYA 1Z56C 2OR3A 2YHIB 3DR3A 4LW8A 3RF7A 1N7GA 1CRXA 2P5YA 2XNDD 3S70A 1ZG3A 2OV1A 1TVEA 3DDOA 4WADA 4D9BA 2AQKA 3Q9SA 3RKSA 3ZGYA 5CCEA 2QPTA 4HXEB 3IA7A 2YS6A 1XCOA 1N4DA 2QLJA 4V02A 1IIBA 4EPTA 1UMKA 3KQPA 4KFSA 1RE1A 2DQZA 4BGVA 3THRA 3GT3A 1KC1A 2D5BA 2EKDA 1C7JA 2GR9A 4WH0A 3IXMA 2CMFA 3QA3E 2PX2A 1XVLA 1RYUA 5DSXA 3ORRA 4J4TA 1VMIA 3V8VA 1C7RA 2XE6A 3AKYA 4L08A 4CM8A 2QX9A 4I46A 1JQLB 5I9BA 1R4NB 5U4XA 3IAS1 3BBLA 5E3HA 5IHXA 2DU8A 1ZK2A 3AJAA 2P6PA 1G8MA 3H6KA 3BG5A 4O5AA 2MDTA 1OPRA 4RPKA 1Z7YA 4WNIA 3RFTA 4B9SA 4PXYA 4BLTA 3U16A 1PL6A 1ZQYA 1QVAA 1SQFA 2OWEA 3J81k 4TYNA 4P08A 4MLZA 1YMVA 1VGQA 3KB1A 4JGBA 1RS0A 2KQUA 3R8XA 4NKRA 3UANA 1L7PA 3UY4A 4COOA 4F0JA 1QP0A 2HV8A 3H5RA 2JGJA 1EFPB 1F20A 1KI1A 3N0VA 5ITZA 2AHOA 1QTRA 1TYBE 1OY1A 2GHTA 3ECCA 1QDEA 2WT9A 3W6ZA 1EFRD 4LC0A 1EUQA 1H5UA 3KZCA 3OFJA 3R41A 4GW3A 1M1NA 1ODTC 2BKEA 3JQ9A 3L8EA 1PFUA 1F6WA 1GWNA 1WUHS 4XQ0A 5DLYA 5IJXA 1R9NA 1L5KA 4BHTA 5BR4A 3H8SA 5J0PA 2V0NA 3BH0A 1AUQA 1AA9A 1T1RA 1JTVA 4TMTA 3CRXA 4EZ9A 3OEED 2QG6A 1UL1X 2YHUA 3PQ7A 5AMXA 3OEWA 5GJCA 3MHTA 1Z34A 1VL8A 2DR3A 4FTWA 2FR0A 3A6KA 1LPNA 1XCJA 3C3AA 1A7KA 3QEMB 4RKWA 4AX4A 4HYKA 1XR3A 2BMEA 2EW8A 1VL6A 3H13A 3O94A 3X1WA 1GSHA 4KW7A 1KKMA 3GLHB 3CUWA 2IUSA 3I0NA 3AJRA 4IQWA 1FTYA 5FOXA 3AERA 4AZWA 3W79A 4B9LA 3GRUA 1B2RA 1SUBA 3G1WA 4JB8A 4O4IB 2IBSA 1Q3HA 2NU9A 4RZ3A 4BLRA 2C1ZA 3EUFA 5HZMA 1T9CA 2ZAMA 3CVXA 4C30A 1GUBA 2WZDA 4FR0A 4NZOA 5LZ5A 2J32A 1GDHA 3O9ZA 4HVAA 1G17A 5JI3E 1D1QA 2SKEA 2VHEA 4JV2A 4XTCS 3PW4A 2J9XB 1FVFA 2VF5X 4K6CA 1PEAA 2EKBA 4WBNA 2NVBA 2W43A 4RKEA 2MSCB 5FI1B 1ZK4A 1AUXA 1FW8A 2KVSA 2NO6A 2VYCA 2TSYB 2ZYIA 3URMA 5A3QA 1FW6A 3EOZA 3BDVA 3JARA 1LK7A 3ROKA 3V7FA 1JAXA 4AJJA 3LUDA 1YULA 1KJJA 3W3AA 3V4ZA 4N8SA 2QXYA 5IUKC 1FMTA 3EVGA 2EW2A 3HCEA 2EHJA 3K2BA 1DK3A 3TRFA 3R3XA 4KVGA 1JJVA 5DM0A 4YIKA 3ABSB 3C5EA 3O21A 3SJCA 1HQYE 1O2DA 4NI5A 4A8EA 3GF4A 1PJQA 2GXSA 3EF3A 4QA9A 2WTBA 3OWOA 5JAZA 1TU3A 3TCNA 2XNKA 5G41A 4XUDA 4M8NE 2W6IA 4UDNA 2XEDA 4YRRA 1K5GA 2NUPB 4Y2XA 4BO4A 2B3TA 4FT4A 4AKGA 1PGPA 2VSQA 1YL7A 4MI3A 3N7SC 4UVDA 1V9CA 1YDFA 4MPPA 3LX5A 4X95A 4RQNA 1T4CB 5K0CA 1HL7A 5FTLA 2GD6A 3LM8A 3PA6A 1QGAA 1Q0QA 3AYZB 3KNZA 4NU0A 2G1UA 1CUJA 3L7OA 2PWZA 2VF4X 3HE3A 1UBLS 4KUGA 4X5OA 3DWGA 1UOPA 3OIVA 1K8RA 4KMOA 1F2TA 2E89A 5DGTA 4US0R 2FPLA 1LQTA 4C0ZA 4QZDA 1Y8AA 2RCNA 2QIOA 1QAQA 3I9NA 5DGDA 3O74A 1QLJA 3S6JA 5UKDA 2ZI6A 3S1AB 4KQWA 5TMBA 4S05A 3B1WA 1VE5A 3FKSA 4Q7JB 4QDTA 5E7IA 2F4VB 3NBMA 4WCFB 1RMYA 3VZQA 2PLRA 2V54A 5G40A 1Q0TA 8LDHA 4TROA 3IP9A 3UJ3X 4BNJA 2WFMA 1RQPA 4LJ6A 5DYYA 1N0WA 1RIIA 2B4KA 4NV0A 2CXOA 4NCJA 4I9FA 5F1YA 4B80A 2AJDA 1A8PA 1PV1A 2AYYA 2JJ1A 2XUZA 3DVQX 2C9YA 4K1XA 3R9XB 1XTSA 3LDAA 1ECFA 2P4HX 7ICEA 3M4YA 2H3IA 2C54A 5DGIA 4YAOA 3I4FA 3D81A 2JLRA 3K6KA 5K0SA 3I64A 4WOCA 3PU6A 2JZCA 1EWTA 4LRWA 1M5RA 4J9QA 4RJTA 2IP2A 1FZQA 4W1SA 3WL8A 1YOBA 3OF3A 4XFJA 1OLUA 2W9XA 3HPQA 2PS9A 1KA9H 5FFFA 4I2JA 4EJ0A 5ICFA 1RQNA 1C0EA 1GPJA 1RYNA 4ZPXA 1BMDA 1ZD4A 4JT4A 2PXIA 3RTGA 1EVLA 2C88A 1FDRA 3RV4A 4U7CA 3DFFA 3DUFB 3NONA 4ACBA 4B9NA 3OIYA 4XCQA 3B20A 4YREA 4C4YA 4FI3C 2NU6B 1QQ7A 2HHWA 2D0OB 2M1XA 3PWSA 4RK0A 3SCZA 4CJXA 1QH1B 3AI1A 1D3AA 1QM5A 5J4VA 2PX6A 1NMEA 1N2EA 3N8KA 2JCSA 4EHKA 5JQGF 2RHHA 1CEZA 3K0EA 2W2PA 3EQZA 5G4KA 2O48X 3U7EB 4YECA 4MVWA 2WWTA 3F7OA 2DP4E 2GRAA 2NWQA 4UUOA 3BS7A 3K4GA 1FRNA 2WVHA 3DOHA 3TQSA 3DZ8A 1Z5ZA 4WLFA 5EINA 5MFZA 3EPJA 3NBAA 2N1RA 1UJ5A 4I2VA 4K86A 1L4YA 1YS2X 5AXBA 4E08A 1KOJA 1A1SA 3SKYA 2WSLA 2QORA 1Y5MA 3KB8A 5H82A 1RBMA 3BJRA 3KKKA 1HG0A 3KS9A 5BN3A 5HHTA 2D3DA 4R6WA 1BQEA 1DTSA 3FF1A 1Q14A 1T34A 1BH2A 4B4KA 3F7NA 5G4LA 4Y98A 1FYFA 3OZSA 4OL0A 1AXGA 1VFNA 1EWKA 5FA6A 4F12A 1XN1A 1U9JA 3SI8A 1ECLA 4QUIA 2GFIA 3E05A 5A06A 4LMRA 2G9RA 3I34X 3TDMA 4EF4A 3DHYA 3EHDA 1J90A 1FMJA 3FDFA 3RV3A 3SIRA 3DCJA 2P6UA 1T3LA 4MS4A 2AJCA 1E64A 3BJEA 2BMJA 1Z68A 1P18A 2VLBA 3GWZA 3PCTA 3PMLA 4KLUA 1MAAA 3FKSD 4JNCA 4D8UA 2AVNA 2XRYA 3MINB 3CLUC 1K5PA 1VHLA 4IRDA 4EJ6A 5JO0A 2PSJA 3MWJA 4EI9A 5K0BA 5JS7A 2FW1A 4OATA 4P0QA 2JPDA 4KWTA 2WD9A 2MU2A 4KV7A 4N03A 1Z2PX 4PTZA 5IDWA 1SCDA 1Y4AE 3G3EA 4U39A 5H3HA 2BUCA 5JNWA 3FGNA 4QUEA 2ZM5A 1WXFA 4AL4A 1PK1B 1SZHA 2Y66A 1Z2CA 3OOYA 4E0BA 5I4KA 4JI2B 1KP3A 3LUGA 4H7PA 1YB4A 2GPAA 4P82A 9ICRA 2TMDA 4S1TA 3W34A 2BUAA 2DFVA 5J2HA 3BFJA 3ZHZA 2NO9A 4DZZA 1P44A 3REQA 4TYYA 3T7KA 3WB9A 3GFBA 4FS8A 3W77A 1F6DA 4EJSB 3GYBA 2A4MA 1Z33A 2AX3A 3IQGX 5TC4A 4BQSA 3A6ZA 3PEFA 1USGA 1MP0A 4IBOA 4H7JA 2XB2A 2IXEA 3OLWA 3T4XA 3AEYA 3IUMA 1SXPA 1QFJA 2K4HA 4FYVA 5PGMA 4EI2A 4F38A 1QSLA 4RGBA 2DH5A 2X4IA 4JLUA 1T24A 2KSQA 1N60A 3DQZA 3ZQ4A 4ZVQA 2W58A 1MN8A 1EP1B 5ALYA 1FBTA 2XUDA 2GESA 3NHAA 4N47A 1GPLA 4MUNA 3ZV6A 5C37A 2F2AB 1DKNA 3NBYC 2Q9CA 1ZMTA 1X40A 5C8YA 2RHLA 3G5TA 1IXKA 3TVDA 2IHYA 3H5TA 3IFSA 1T6ZA 2AN4A 3CX3A 3OM8A 3OY2A 1VL1A 3CJTA 8GPBA 1YVPA 3VO9A 1S8FA 2W7PA 2QNBA 4WDQA 2WY2D 5A5FA 3LZCA 5CXSA 2E55A 1YR9A 2G88A 2ZVPX 4KE8A 4GLLA 4M98A 4O2AF 4Z9AA 5K8JB 4KDEA 4WXRA 5TF4A 1X7DA 2BAGA 1XAIA 4WHMA 5CCDA 3RAJA 3WWYA 4DRXA 2YV5A 3F2IA 3B3AA 2I5HA 1KKXA 3AUFA 4ZJYA 2B94A 1YFLA 1M2KA 1RKBA 1N8KA 1F3LA 2EL7A 2WTEA 3O8NA 3QOXA 4MKFA 3D7KA 1KE2A 3S2YA 1BXGA 3B85A 4ZI3A 4ZYTA 2FWPA 1EB9A 3FUXA 4KVFA 2BP7B 4IEEA 2IYQA 2JD1A 2FEXA 2W7TA 2Z43A 8ICQA 4PQYA 1E2KA 4S35A 1J8QA 1NAIA 4ML3A 4ZHSA 2WWRA 2H3ZA 4CKCA 4MYUA 3WLRA 4FS1A 4LRQA 4AF8A 2HK8A 4IVNA 4URFA 2C28A 1Y3DE 4YT5A 2R6ZA 5FTWA 4AN0A 1UXJA 2HIGA 4YMUA 1PVPA 3EDOA 1N56A 3AB8A 4NAUA 3LUJA 4RCYA 2KPOA 2EKZA 4XGKA 3RS2A 3L0CA 3O8CA 2W3SA 2CHFA 4G4GA 7ICMA 3WXBA 4S3MA 4K87A 1NW9B 1ZW1A 3JVVA 4JIMA 1DC7A 1E58A 1GZDA 4OMUA 3UJ6A 3ZHOA 3BMQA 5KVQA 2JBHA 1MO6A 1J2RA 2A6PA 4IGIA 2OYRA 1PHRA 2QN1A 1E1KA 5IANA 4ENWA 1J0EA 1YRBA 4KBFA 2BFCB 2HBZA 3A4NA 3LLVA 3QEOA 4O59O 4UE2A 3NWBA 4MDFA 1IOWA 3QVOA 1EP9A 5ADHA 2GUWA 2JIRA 1E9CA 4FIZA 5H9VA 1QCKA 4BNIA 3CUTA 1G66A 1A6SA 1KHTA 4D9IA 1PX2A 2DPMA 2IA5A 4LFAB 3BQ1A 5CNIA 4ZK2A 1U7UA 5BV0A 3U1VA 3HPRA 1WHSA 4OV6B 3X2EA 5E38A 2WU3A 3P0JA 1ES9A 5FBWB 2HL6A 3VYRB 1KYTA 1RPTA 2XW6A 3ZCXA 5K9ZA 4WKPA 2F76X 1JAYA 3F5EA 1KJIA 3AW8A 4O4HA 3SI7A 3TVYA 2KOBA 4KNWA 3KYDB 5H8WA 2XQKA 2VBFA 1KS2A 3IE2A 3GLFE 5C32A 2J9FA 3R5JA 4JSYA 3VR1A 4QGSA 3GP8A 4N40A 2I67A 4AAYA 2XT6A 3H7IA 3FMVA 3EEBA 3IBCA 3BDIA 4TZTA 1WDMA 2EQAA 1QTIA 2H5LA 2VSYA 3DUWA 3EVTA 5TQVA 3DF7A 3IDSA 3KTAA 3V97A 1L4GA 4LF8B 3QXHA 4FHFA 2Q4TA 4OXKA 2E5FA 1HYHA 5K7SA 2OD7A 3BB3A 3CO0S 3CN7A 3TIFA 3U3XA 2PK3A 1P4RA 3QUAA 1HFWA 3O9MA 2IU6A 2ACKA 1VYHA 3LKBA 3UW1A 5CCXA 1D7OA 1SPXA 1DHTA 3F96A 2GN6A 3HDHA 4QFCA 1CUVA 3EG9B 3GA7A 2ORWA 1R6VA 4OOFA 1U2TA 2HBMA 3THXA 1XJ0A 2R8EA 4WN9B 4RL6A 3RG2A 1LBIA 4V1CI 2XZTA 1X38A 3QJYA 2R84A 1NUUA 3G79A 1UFOA 4QX6A 1HDGO 3EA4A 3EGOA 3AJ9A 1MIHA 4LGCA 3OSPA 5BNFA 1P91A 1Z39A 2DBVO 2EZTA 2APJA 5MFPA 2JVIA 3HDQA 5EMMA 2IHMA 1G8YA 5H4GA 1LRJA 1R5OA 3DGFC 1NJ8A 1ZHHA 4RVNA 3FWKA 3RANA 1DZ3A 1M5UA 5K0EA 2W8KA 1RKVA 4K46A 1CRZA 2UVPA 3GOQA 3PD1A 4PCAA 4NK4A 5CT5A 3U4AA 2YRWA 4FEEA 5K8IA 1B6SA 1D7AA 3DTTA 3LKVA 4BDTA 4WY8A 3L6CA 4J16C 1GTMA 1M73E 4JUCA 3AU6A 5BSVA 3JVIA 2C2DA 2IGBA 1ZNWA 4J9MA 2VH1A 3GDFA 3ZE1B 1V5EA 3IV9A 4Q93A 1RC8A 2AE2A 1O6CA 1YRLA 3DBOB 5HCNA 1E3WB 3R5HA 4FNGA 4QO8A 3ZC3A 4E2XA 3CWQA 1VPTA 4PEVA 2XWJI 3CZCA 1C9DB 2QG9A 3MGKA 4YQFA 1A5TA 3FH0A 4YRPA 1EX6A 4HDRA 4HG2A 5FYDA 1NRXA 2BE9A 4RK6A 1IQRA 3BIXA 3L8ZA 1ZAKA 1TKDA 4F5EA 5GVRA 1Q3TA 3PHBE 2HTFA 2VJOA 3AVPA 1Z4IA 3I42A 3KEMA 3D6VA 2NOAA 1HYGA 4NJMB 1PBNA 5A4KA 4P5DA 2NO1A 2O5CA 3DLPX 5FFNA 3D54D 3N2KA 3IAUA 3QLVA 1H2BA 3R6LA 5DRTA 4HNHA 3ZLJA 2VL7A 3UJHA 4N65A 1GR0A 1OKKD 1PNRA 4LQCA 2BC9A 4KQIA 3DXFA 1ONSA 1Z5GA 3QFHA 3UPDA 4G1VA 2VQEB 1HGXA 4IJKA 1QX4A 3LLCA 2BTEA 2EJCA 1IB6A 5IZ4A 2UUBB 2ENUA 1WXXA 3QTTA 2PS1A 2WAAA 1G4HA 1UPXA 4LI3X 1RJGA 4QW9A 4EG3A 3B13B 4WJLA 3LFTA 4J7AA 4CG0A 3T5AA 2JAXA 4AF6A 3ESAA 1GFSA 1G21B 1MG0A 4KL8S 5KMGB 1W46A 2GETA 1T13A 2W8ZA 3BD9A 1PYDA 2P3LA 4EFNA 3ESXA 4NEGA 2WUWE 5HKOA 4KFUA 3IJRA 2CDCA 3IMCA 5E0OA 5L3SA 2HRQA 5C1IA 4H18A 5A0FA 2NVWA 2RJ3A 4R9RA 2RKBA 2PBFA 4OGKA 4PIVA 3W04A 4KHZA 1ZK1A 4N5DA 8ICOA 4IJUA 4ZT3A 2IUEA 5FOUA 3ZCPA 3N3BC 3QENA 2Q6VA 3Q6IA 4YP3A 3Q8QB 4MEAA 4FMDB 5BW5A 5C7IO 4CM6A 1NKBA 2X5XA 1NYRA 2FMTA 3Q2IA 4YMIA 3M1LA 4R16A 1JXMA 4GRDA 5BSTA 2LIPA 3TLYA 5CBPA 1FSPA 1M6WA 2F64A 5DQHA 1LKYB 1T1IA 3ENQA 1VHQA 1FP2A 5E6RA 4II7A 3WRYA 4HDMA 5JDCC 1MRZA 1UZMA 3QLEA 3PFIA 1QQBA 3C5VA 2V4UA 4CEHB 5DG9A 1PWYE 2XO7A 1DADA 2VHJA 2O0HA 4ND7A 3C3JA 1KK2A 1RPZA 3NHRA 1VDVA 1QF6A 1KU6A 3OAAA 2CUKA 2PBZA 4N1AA 2RGDA 4Z2AA 5COAA 4M1OA 2WFZA 2ZATA 3FUTA 1SAYA 4FX2A 2ON6A 4NXMB 3JPSA 4GHWA 1FP4A 1ZVJA 5HZHA 1PEYA 4WV3A 3F74A 2KZZA 4D3ZA 5FNZA 1WBJB 2O0JA 4NVRA 4KGXA 1C7ZA 4MCHA 1SVIA 4DLZA 4EFLA 5CB1A 3CB4A 3TR5A 1MRSA 1HLFA 5A1TA 1S0UA 3MJVA 3WNBA 1RXSA 3FNGA 3GZNB 1UBHS 4RLSA 1ZQBA 1U7DA 3ASYA 3HUEA 1ZZEA 2JLAA 2FQXA 2Y4OA 2HBYA 4Z8XA 3S5UA 4NYIR 4KSCA 4DLTA 1Y3BE 3V7YA 5C1DA 3PRHA 3L6OO 4YROA 3M1YA 3ENZA 4JXKA 1M83A 2DTDA 4KUEA 2CD9A 2J3QA 2XB8A 3D59A 2NRVA 1D1SA 2OZKA 2WT8A 4WOJA 1RM3A 2EATA 2QHXA 3HCWA 3UO8B 2WU0A 1RNLA 4L0QA 3TLZA 4JJAA 1SKSA 4BNFA 1SBYA 4F60A 2J6UA 4M9LA 3EQ6A 4MUKA 4OYRA 2X8BA 1IDOA 4P7KA 5LYJA 3WTBA 2Y05A 2DKNA 4C1NA 4CKBA 2C5GA 2RBEA 5FPSA 3TW0A 4GSKA 3HBMA 1P7ZA 5EZYB 5EJFA 1QAOA 4B76A 4EVRA 3ISVA 3LQ4A 1H42A 2FPPB 4JEMA 2ZTDA 4KWEA 1LJLA 3KJQA 1DBPA 3VPSA 1GQRA 2WB4A 4E3WA 1APBA 2YQEA 3N05A 2Y3IA 3SOZA 2RLTA 2ASEA 1E0JA 1ORHA 4NDZA 3R8FA 1I32A 4LNUA 3OZ7A 3O6VA 3WAKA 3LPAA 3Q88A 4B82A 2W8BA 1U8EA 5LLDA 2DT5A 1YRAA 3PQEA 4PG7A 4X84A 3EDRA 1V2HE 3NUQA 4QWDA 5AVUA 3ILVA 3K9CA 1GZ3A 3T7DA 4O1MA 2EGHA 4RPHA 5GIPE 3DMNA 4FMBB 4C0KA 1XP5A 2YHSA 5FPYA 1YBFA 3VGJA 1S97A 2R68A 4QHYA 1ZUIA 5AVXA 2MSDB 3C28A 1T8PA 4YO7A 1ZVKA 4WFKA 5CJPA 3NFYA 5TEVA 1T4GA 4LJXA 2JHDA 1PP4A 2FK8A 4HNRA 4DV4B 3QW2A 3UIEA 1RHJA 4BVKA 4W5TA 1SXGA 3CG0A 5JV5A 4NSNA 3PYLA 1XYVA 2C4UA 5BVGB 2JLSA 4RV5A 2J5RA 1ZCJA 3N86A 3VX3A 1CK4A 2ZR8A 2QRHA 3ZKWB 5IABA 4JLWA 4KMRA 1UHUA 3DXXA 4YD1A 2AK2A 3EVAA 1TO6A 1HO3A 1T15A 3FUUA 3MPUA 4BX9A 1WV0A 5CCBA 2W6CX 3EISA 6AT1A 3IQFA 3VDMA 3ER8A 4LS3A 4RABA 4KI7A 1UBRS 3KWFA 4EJ2A 5KTRA 3M5WA 3K3PA 3M4NA 5LU9A 2FJ6A 2GJ9A 4NCAA 1BJKA 4LWPA 1M6HA 2V6FA 2Q4EA 1VJRA 5F1PA 4PZPA 2P91A 4J3JA 4YI5A 2IT1A 5AVVA 1H9AA 3V32A 1E6KA 3DZHA 3GBPA 1V8PA 3QMMA 1Z3EB 2FVYA 4JYZA 6NULA 5G0TA 2JLWA 4Z6KA 1BXKA 4OI0A 4QNNA 4TMKA 3VZCA 1OX6A 2O3TA 3LT4A 4PC2A 2FOIA 2I78A 1JAIA 2WAMA 7ICQA 4EEKA 3JPWA 3UKOA 3MBIA 1P3Y1 4GXIA 4G8DA 1QBKC 5EL0A 3D4BA 2VHZA 1PI3A 1DWQA 4LY0A 4PIPA 2Y1CA 1O58A 2WZBA 1P77A 2CJFA 2Y27A 1H1LB 4NQZA 4FOLA 5FOVA 1QOQB 1W25A 3OSUA 4LJ9A 2RHGB 1R5BA 4DC1A 2JIPA 3PCRB 3T3MB 1N2JA 5I8PA 2H3FA 3H83A 2YINC 1N2GA 5JPIA 3QWFA 1JG3A 4MUIA 2DY1A 3NHKA 4C7XA 1FNBA 2QVZX 3CINA 4UMFA 3V8PA 4BCDA 1S8OA 1R8QA 3B3QA 5F3DA 4ER5A 4UTPA 3UG6A 2PR7A 3TKLA 1HT3A 4JT8A 1S7CA 3DXYA 4LC1A 4D79A 3GARA 4R1MA 5L7WA 4GM0A 5AHXA 2O0KA 2GK7A 2PUWA 3GMDA 4F9FA 1LDMA 4O63O 1SB8A 2QE7A 3ZPXA 2KJQA 4ZHQF 4EF5A 3O1HB 2DUMA 1DSSG 4HGQA 1NVBA 1QLWA 3GW8A 4WQMA 2FR8C 4K9NA 5SYMA 1RHQA 2OWOA 1T0JB 2G3YA 5BNWA 2GCOB 3U9SA 4X6XA 4C22A 1X9MA 1YI8A 4IHJA 3SF8A 5JZMA 4OHFA 1L5GB 1DO2A 4NHOA 3L8GA 2IXFA 3SK0A 2AQHA 2PKQO 2Z4TA 3CKKA 1JIUA 1PTJA 4QRDA 3IS3A 5L8VA 4GMXA 2PG3A 2RGGA 3QX9A 3ACBA 1YA4A 4I5EA 2H5IA 4YMWA 4CFSA 1TJ4A 4UB8U 5J0WA 2R11A 3RJTA 3TSCA 4Q6WA 1QANA 4DCJA 2PSDA 4G23A 1W88B 4MQFB 1GL6A 4A15A 3AUOA 3KL2A 1N5MA 4P2HA 3W2HA 5K3OA 4YY3B 1TQDA 3Q5EA 4RBNA 1OE0A 2Y68A 2F2TA 5IAEA 2OPHA 3B82A 3B6JA 3FFAA 3G6WA 1CZOA 4OQMA 5FWXA 3VYTB 4I50F 5K3EA 1BX0A 2C20A 3E7FA 2MYNA 3AHHA 3P8ZA 4UNPA 3T4EA 2BWJA 5SZKB 1EAYA 1UXOA 3NEPX 4H7FA 5ERXA 2CBXA 2ZSBA 1H0RA 3HPOA 1D9XA 1YR1A 2H0AA 4RANA 1AOXA 4YASA 4F3YA 1JDTA 3OIWA 1BAPA 1HA3A 4L4XA 3KR2A 2BY4A 3OHSX 3NBFA 4NEHB 3V2UA 421PA 1R16A 2NN3C 3PXXA 4BQIA 3ZHUA 5KOYA 5AM5A 4G8CA 4NARA 3EAQA 3FWYA 1ZGBA 2VYVD 5KFUA 1XVAA 2VTDA 4KXQA 3G1UA 4EYKA 5ALQA 2LD4A 5FJJA 1E60A 1ZXXA 4JX9A 4UOEA 2XMQA 1BQ4A 3PFGA 4PPFA 3OTGA 1NIJA 3LUCA 5FTKA 3VOTA 1KVTA 2BEUA 2OP1A 3HR8A 1EUZA 3MGBA 4C01A 2O07A 3UMRA 2V5AA 2Z2ZA 1BVSA 4RUAA 2AHOB 1SL0A 1DMRA 3AO0B 3GLHE 2GAOA 3SDBA 5LD2B 3T1YB 4R2WA 3CUUA 1H8HD 1QRDA 4RCVA 4UM8B 4YG2A 2DUYA 3TARA 3P4YA 3CX4A 5FL7D 2DOKA 2E6KA 5HHIA 4IL5A 3M3DA 1PL7A 3F6BX 2O8CA 4F5DA 4RM2A 4F5YA 4V0QA 5I8ZA 4X65B 1Q7TA 2OZLB 4ZI5A 4N0PA 1OU4A 2YVUA 5BYBA 3OTWA 4FHDA 1ODKA 3ZI4A 1NGSA 5EUQB 3T4PA 2H1VA 3TDNA 1XA3A 5REQA 2OFFA 4YRNA 1Z0DA 5ICEA 4YALA 4C29A 2UDPA 4IXTA 3PFKA 3NDJA 2JGMA 2CXNA 3FZNA 3GPLA 2O1SA 2E5LB 4OM8A 2DHDA 1L6RA 1VRVA 2BVNA 4HD8A 2UYQA 5CB6A 1N61A 1I7SB 3AXSA 1DJPA 5E6RB 1L5ZA 2YL2A 4QQKA 2PZKA 3SC3A 4NABA 1GU1A 2EP5A 2ZCJA 1J07A 4FFBA 2F1IA 3R5XA 4QDJA 1ZJWA 3SZOA 5F7XA 2CDBA 4JROA 4IIJF 4A16A 4C0XA 5EIAA 3OHMA 1BVUA 1BU8A 1V37A 2QYHA 3F1KA 3JASB 4O4LA 1GUDA 3NP7A 5H7XA 1RU3A 3EOAI 2BBOA 3CH6A 5IDXA 2PL1A 4G0NA 1GL7A 2C83A 3SQDA 1CY6A 1N5OX 1O94D 3U7RA 4F1JA 2GI4A 1OVMA 3LK7A 3DM5A 1BG6A 4ARZB 5BWOA 3GOHA 4QQRA 1MH9A 1KVRA 3LDUA 4YDHB 3KLMX 3JXEA 1PL0A 5KYYB 1SRQA 4PS1A 1EEXB 3PF9A 1WSAA 1XZIA 2F3TA 3HEAA 4Q3AA 3U3MA 1B73A 4AK9A 2Q6IA 2ZBPA 2TECE 3ZH9B 4JJ4A 4IRCA 1MO2A 5TS3A 2YXEA 3ZHBA 1DUIA 4MLDA 2CNBA 2GPNA 4P6VF 5HIAA 3MBOA 3Q0IA 3GQBA 4LBZA 2AUNA 4GWLA 2VRBA 4TYQA 1G2OA 1XEAA 9ICBA 3D8RA 3L6DA 3HKBB 2HTEA 2JFBA 2VNSA 4AFNA 2OOKA 4D56A 1E0DA 4OO3A 3VH1A 1NW6A 4URUR 2OYCA 1BCSB 3C3WA 4XUSA 2R4UA 5GWXA 3EXFA 3GJ8A 5FHQA 2DY0A 1AKNA 2OECA 3ABIA 1ZYUA 4O2BB 4OI1A 3THSA 3CX8A 2CLOB 1UWLA 1SUSA 1LFDB 1LX7A 2NGRA 2P9BA 2ZRNA 1ZQPA 1PZMA 2XB4A 1THZA 3HVIA 4O2AB 1SKBA 3O0DA 3N7TA 4HDKB 2P7HA 4M7WA 1Q3KA 2EKLA 4ZT2A 121PA 3E0QA 3ROGA 4BPRA 2XCQA 4FBGA 4TGLA 3VPAA 5A2QA 5JECA 1J2YA 3ICVA 2V8OA 5I47A 2R5WA 2FYTA 2BCVA 3RB8A 5EKTA 2KVCA 2CSXA 4P9NA 3U4HA 3WMEA 5KNDA 4JB2A 1RE0A 1S0VA 5IT0A 3JW8A 2GBLC 5CWRA 4H3HB 3ETLA 4U5QA 3RI3A 4BS9A 2IIPA 2DQSA 3R5KA 4NCBA 2H85A 2OYSA 1T8EA 2GVNA 3SHTA 2G08A 1VHWA 4FZRA 1Z1VA 4NZNA 4B0PA 4OIFA 4N7MA 2CMGA 3L7YA 3WOHA 4C06A 4HNSA 2R00C 1JIJA 4XXHA 1YZUA 2CFSA 2WWVD 1RBYA 3C14C 4KLQA 2BSAA 3L8CA 2PJRA 3IVGA 4BGUA 4F46A 5IVDA 2KWIA 4UOQA 3RADC 1IWBB 2JK0A 3PVSA 3PNCA 2GRUA 2O06A 3JVUA 4IV5A 4JWTA 3ZY5A 3L7LA 5LUBA 1TGYA 4RMGA 4B3CA 2GM4A 1FYDA 3M6XA 3MBYA 3O9VA 1AGXA 4DS4A 2BFOA 2E4WA 3E2IA 4MI6A 4HZUB 1FSGA 1V1RA 4ZYXA 3MR3A 3ZU5A 2LXNA 5LQMA 4WFIA 1B14A 3CMMA 3S0JA 1NJWA 3MINA 4ITRC 4MGHA 4BFVA 3DG9A 4CQJA 4FILA 3AUXA 1UBMS 3L46A 1CUUA 1BHSA 4LKRA 2V58A 3TNDA 1T2VA 2WFLB 5ECDA 4UBBA 3H2YA 2IP4A 1V85A 3JWIA 3F2DA 3M7IA 4FE7A 3KUDA 5IAGA 4DIEA 5T3YA 2E3JA 3NIWA 5LN1A 5FWXB 1SCQA 2B4AA 4BFUA 2HSJA 3I1IA 5J4LA 2E4ZA 1IY2A 1KY2A 1MHPA 3UENA 5KFIA 1H8EA 4F5NA 1WRBA 3WGYA 2ZJ7A 2C2RA 1LUAA 2GN1A 1XNSA 1U2RA 4FYJA 2AEEA 3QZ7A 1XDBA 3PDIB 3UICA 3AOEA 1XZ8A 2DFKB 2XXAA 4A23A 3O3MB 3SEZA 2BEJA 1U0GA 3CVYA 2OHHA 2J7PA 3AB3A 4F4UA 1H3NA 4D6PA 4Z54A 1W35A 2VJDA 3CBQA 4IDFA 4BFXA 1QIIA 4PIMA 5BUSA 1WPGA 2VYQA 1NV8A 1Q50A 1YKGA 3PHHA 1V8OA 4MB0A 3RRHA 4XQEA 2E8PA 4AUEA 2NT4A 4QWAA 2X14A 5LIPA 1M8KA 2FWIA 4KR2A 1AQYA 4K3VA 1FC0A 2UUPA 3VR5D 3BFVA 3DKPA 3EFHA 3HL0A 4KFTA 1OHHA 2Q2VA 3G59A 3LK9A 2JFPA 4RQ8A 1NQUA 1Z47A 4Y6RA 2QUBA 2ETVA 3AETB 5FPHA 4BCBA 2WJAA 1D6MA 3AR4A 3P2YA 2PFKA 4D82A 4F4HA 5DYIA 5AESA 1AO3A 2VR1A 2UZ4A 1ABFA 2FEOA 3IVRA 4PBRA 2FPMA 4O3OA 1DTWB 2HOIA 1KQ3A 2FMIA 2ODEA 3GUVA 4U9IS 3IKLA 5EKDA 4QOFA 3ZGVA 1HH4A 2UYCA 2AW5A 5BV7A 3F9RA 1QGED 5BSHA 2QAGC 1Z4LA 4M9CA 3CWCA 3RH0A 3K75D 3O7WA 3WK9A 8ICBA 4DUPA 2WV7A 2YBEA 1ZYQA 3NBZC 2V9PA 1E79D 2IYVA 3AEZA 2X5OA 3TTXA 2BISA 3S3TA 3HB7A 4PHPA 1TM1E 3ICWA 3IAM1 2XMSA 2RCYA 1XNJA 2Q5JA 2COKA 4BMZA 1DCKA 5ADUS 3H9EO 5AK0A 1NQOA 1X42A 4GEGA 2FF5A 4DQRA 4KXVA 1WMBA 2ZIZA 2AQ8A 1CYDA 4PSDA 3LS2A 4INPA 4ROSA 4FR2A 4DSTA 1V7ZA 1T3SA 3AILA 3SE7A 2X19A 1YZLA 1VMDA 3DVAB 1VDMA 4EO9A 5IG2A 3BRQA 5KG3A 3RIYA 4C6TB 4A2PA 2FPPA 3LV8A 3RJEA 2ZSDA 1PUZA 2K4EA 1L4LA 4X5VA 3WB0A 3A28A 3DAGA 2ATVA 3E23A 3LT2A 3QXXA 4ZVPA 4LJ8A 3OICA 4Z9BA 1E3WA 1A98A 1EAMA 1LA2A 2ANBA 2HEGA 1W9HA 2H1WA 3E82A 3EHEA 2ZJ6A 4YJHB 4ZXFA 3V4OA 5JC8A 4KYVA 2DE0X 4NL4H 3EZGA 3K73O 3I2HA 4G5FA 5DTIA 1XQ9A 4BNMA 3BHNA 1P1BA 1GLVA 3PFCA 3FRHA 1BO6A 4S04A 3AP2A 4FYPA 1T94A 3DD1A 3HEMA 3BMXA 5BPCA 4AULA 1EBFA 3DLAA 2Y1IA 2WMOB 4P34A 3NFRA 1BU5A 2PIDA 4UFPA 4JJ7A 4CKXA 2D7DA 1YB1A 2RC6A 2HQBA 1CSEE 1N63A 2WIJA 3A36A 4ZZIA 2R60A 1H2HA 4LHSA 5C5DA 2HMAA 5DM70 1Z5VA 3GEMA 4X94A 3QTLA 2WF5A 2I7DA 1CULC 1N5JA 3ZX5A 3JQDA 4HDSB 1Z19A 1KVSA 1Z4QA 4I1RA 2HHSA 1TO1E 3NTRA 9ICXA 1E8NA 3WLOA 3FNEA 2MSEB 3EF0A 1KMCA 4M47A 1EM8B 4DXAA 3NHYA 1D2AA 3ND7A 4RMIA 2R00A 1N3IA 3BOSA 3KQSA 5WRFA 9ICWA 1EEHA 2DLDA 2OAQ1 2ZBEA 4NPHA 4YJ3B 5GM1A 1N2CA 2Q3BA 1X7XB 3AR5A 1A3CA 1Y6ZA 3DEYX 4QNRA 4XYGA 5DHQA 4R3WA 4DIKA 1I6MA 1E3QA 1MQ8B 1XA4A 4FJ0A 4IH4A 5DWDA 5FNVF 3T5HA 5CM9C 2QGNA 1TK9A 3L4PA 4PZDA 2GBLA 3QFSA 1HE2A 2X9LA 3WL7A 3ZWMA 1D07A 3NUZA 2DLNA 2X58A 3KO8A 3NNSA 2E9SA 1AV7A 1SUWA 2ONZA 3O31A 4OFXA 3IQEA 4I8IA 4KHPB 4RCZA 3IMEA 3U17A 2WABA 4L8FA 4IFEA 1T4BA 4X71A 2IBKA 1NP3A 2A5JA 3LPDA 1FY2A 2AQIA 3BF7A 4MLCA 1ABBA 5FRDA 2WSBA 3JPQA 2FUG1 2AOUB 2Q1TA 4ADSG 1L9KA 5HX7A 1Z35A 3KZKA 5TQJA 4LF5B 2QEQA 1EBBA 3O7MA 2Z04A 4G65A 4RZRA 5BQPA 1FX1A 2VUUA 5NLLA 2ZJ1A 1IIRA 5J2TF 3OSNA 1NKSA 2XQIA 4DL7A 4X7PA 3TDKA 3W7VA 4B6OA 3ELUA 3UXYA 3QUSA 1UFRA 4URZR 1X7ZA 5KI6A 5DRYA 3UH1A 3WIBA 1K1QA 5L40A 2GB4A 1F4LA 3U3RA 3F7TA 2G04A 4R1TA 3W8EA 4F3NA 4MGKR 4Y3UA 4K2AA 4PR3A 1TUGA 4BMOB 4A0HA 1EIWA 1Y88A 3G2NA 4GVPA 4RIEA 5TEWA 1OWLA 3SC2A 5K4HA 1RWOA 1IXSB 1KYQA 3D7SA 2AVDA 2GA9A 3NIFB 2IDJA 4MS3B 4NMLA 1CF2O 1VLVA 2C07A 1QIFA 4C80A 2LCIA 2VK2A 2FZ5A 3B2EA 2B20A 3M4JA 4S1WA 3OM0A 3W2FA 5JRJA 5KSWB 3E15A 3E9ZA 3FROA 2HMVA 4WZBA 5M34A 4G4JA 1KN5A 2DBQA 4RPYA 1GG9A 4GQIA 2VKQA 3FDXA 3INYA 3LC7O 3TZEA 3ZU3A 1VHJA 3LWLA 3CV3A 3MQFA 4MAMA 4MYDA 5CW1A 3FTFA 1BDBA 4IM7A 2VPIA 3AR6A 1II9A 1FBNA 4IHJF 3PV0A 1XRJA 4IXMA 5EP1A 1PNVA 3AR3A 2ZUDA 1GSOA 2WHQA 3PENA 3QEJA 3R5TA 5CYOA 4HQNA 1OIXA 1QRSA 1YHNA 3PGLA 4IS7A 4B5KA 3D8BA 1XZFA 1IPFA 3P5BA 4J4HA 5FFMA 4JL8A 1F8GA 1KGSA 4G5XA 4TOIA 4YS6A 1Q7CA 2R1TA 4AUNA 3FTQA 3H16A 5IRCD 4ZDKA 3LQRA 4HQOA 1Z22A 7ICLA 4CL2A 5IASA 4L6IA 1IATA 5CD1A 4RHCA 5HCIA 4BWYA 3ZVNA 4KG7A 3FTEA 2WWHA 1RRGA 2D7JA 1KMIY 2C0PA 2YVKA 1VZ3A 3BD6A 1KDTA 2Y1EA 2BZGA 4MVJI 5BV1A 2FMXA 4G97A 2WJ6A 4CTOA 1XRSB 2C61A 4GOKA 2F59A 5GGXA 1IBCA 4RMJA 3HMKA 1QZUA 2O8DB 5HF9A 4HNGA 4IIGA 4ND6A 5FADA 4B5LA 1I33A 1ZH0A 1WPRA 4HQFA 1X9IA 4BX3A 2L19A 1JHYA 1MGOA 5I4IA 3IM1A 5J0YA 2XAAA 3A9UA 3Q87B 4M1EA 4RPZA 2G76A 2CXQA 4Z7NB 4HBZA 2FB9A 4M88A 1QG4A 2ENWA 3PJDA 5E7MA 3K6SB 3THWA 1SOVA 4ARAA 3K9NA 3A2LA 2XYPA 2ZJZA 2HA3A 3BJZA 3IKVA 3IVAA 5FOTA 3RUAA 3BE5A 4EB6A 1E7MA 2QW8A 2VZLA 1H38A 4NRDA 1UMDB 2R8IA 3HA3A 3VOAA 2OFXA 1MOZA 2XHEA 3H18A 2ZAIA 1Z13A 2PSSA 2XNJA 1BGVA 4J0HA 1GR1A 3IUBA 1ZITA 3D1VA 3RSFA 2I9KA 3K53A 4P1ZA 1GZ6A 4P0QB 2X8WA 1K86A 4EYHB 1LQ2A 3BKXA 1SL1A 3USZA 4O5EA 2FZCA 2GJAA 5H3CA 3KKZA 2ZIUA 5A7GA 1SQ0A 5EIEA 5KQMA 4Z3OA 2O2CA 4CMIB 4LXTA 2R86A 4WSOA 1Q1GA 4JLNA 4BWVA 1U1EA 3R20A 5L3QB 2WICA 1XZDA 4JIGA 5JXIA 1G20A 3EPPA 2C9DA 2EL9A 3TTWA 3CZRA 4PX3A 3U7GA 1SIJA 3MAAC 2X0NA 1T5IA 5HIIA 5EP2A 3I9LA 3OURA 4M87A 3RF6A 3DE5X 3Q3IA 2VZ9A 3GJRA 1LS1A 1RWBA 1CY7A 3SNHA 2I7TA 4CL8A 3I5AA 4XH9B 1MVOA 1Z7BA 2PUTA 3IVMA 3IP6A 3SR0A 3C70A 4DEYA 2EZXA 3PHJA 2BMWA 3W5BA 4TVKA 5TDHA 2P27A 2O7VA 4JR0A 5AKZA 3G0DA 2XX3A 1FX0A 2WOOA 2OLEA 4AO7A 4DG8A 1YDMA 4REMA 5D5PA 2P62A 2ZG6A 1POXA 1NASA 3AETA 3L4BA 5CW2A 2XNSA 2C2ZA 4D4GA 2HMXA 3ICOA 4R3NA 3OZTA 1BE8A 1WE2A 4Y6SA 5JHHB 2D13A 5L95A 3ENVA 4Y2JA 1KYIA 5IARA 3OMWA 3CZMA 4A4DA 4FZLA 3C45A 1H66A 4GC6A 4H6XA 1Z8HA 1V9LA 4GPTA 4I1OA 4MIOA 4MP8A 3VPFA 5KFMA 3GZNA 1BX1A 3W6PA 3X1YA 2IS1A 1NLYA 3LCJA 4IZ6A 1FXWF 1NF2A 2F8TA 4M0LA 3UJ7A 3IP3A 3EFBA 3WMWA 4R8LA 4D9HA 4PICA 3TQCA 5AOAA 2NP7A 1NLZA 3MHPA 2XCUA 4ZOAA 2ZWIA 1DAKA 1XL1A 4IH1A 4PGGA 2VP6A 1IONA 3QVSA 1GPMA 1DG1G 2EAUA 1X94A 4DVGA 1OB2A 2P2ZA 3PLRA 3R4VA 1J21A 1MBZA 1P6UA 3WLPA 3ZBPA 2H06A 2Q6OA 2QXTA 1EWVA 3K15A 4J0FA 1U45A 2J8ZA 2PL5A 4N49A 1HDRA 1TC1A 3RRBA 3SR3A 3VNQA 1DCMA 4ZVOA 3DE6X 4UD6A 4C0LA 5F9LA 1R74A 4LYYA 4BXOA 4KLHA 3VR3A 4JKOA 4C7OB 1RHUA 2P69A 2I3DA 2AF3C 4ZOLA 1P3DA 3PI6A 2CGEA 5ITWA 1WUIS 5ALSA 4IJWA 1MO3A 3L4BC 5J0RA 4P93A 2CXYA 1QH1A 4URHA 2J6CA 3GRFA 3H7AA 1X2IA 7ICUA 1L7QA 1WXDA 3OE1A 3TIVA 3U3OA 4CEIB 1SZDA 3CONA 5KFNA 1ILWA 3KQQA 4E5YA 1HUQA 2FUNB 1GZUA 4FMCB 3M9OB 2WB1C 1U3FA 4BNUA 4HLDA 5HF5A 2Y6UA 2UV8A 3MD9A 3FZEA 3ND6A 1SVSA 1QF7A 2ZI5A 4OG2A 4FGJA 1G5RA 1QFMA 4IDDA 5BYJA 5JOQA 1VXOA 4Q6BA 1F1JA 3ZK9A 2JH1A 1X7WA 1QIDA 2JHAA 4UB2A 3GEHA 4Z1MD 2EJTA 3DA8A 3TNJA 1WHTA 3TBFA 3LI2A 1AKTA 1RWKA 1X1SA 2OBBA 5IILA 3INGA 3OQBA 2I2XB 4C2BA 4M38A 2YZNA 4V0RA 4Y9TA 3BORA 3GLGE 1OA0A 2OHIA 3SAJA 2W9CA 4DQIA 5K2MA 4AROA 3MJSA 7ICGA 3PUYA 1DBVO 5CU7A 1UKEA 2IWHA 5AIAA 2VDWA 4D3DA 3VJKA 1W8DA 2DHEA 1Y37A 1G9SA 1XS9D 1ORTA 1SKUA 2B1QA 1RM6C 2EJVA 2Q6LA 1NJ6A 5D7NA 1MOSA 2AW3A 3O4JA 3WNCA 4LEIA 2X23A 1GZ7A 2LYHA 6GPBA 4JLKA 4J7XA 4BU0A 4DMMA 1VL0A 4CDGA 1NXWA 2G70A 1BPEA 3QVJA 4IDGA 4Q05A 3CW2C 3IGFA 4Q9KA 4RTLA 4IQFA 3AUUA 1TT7A 4AXXA 4FNAA 3U4QB 4URYR 1HT0A 3IJEB 3KQYA 5AW9A 1SXJE 1C7IA 4KAFA 5CVTA 4BKMA 4P4OA 1FE8A 4ND3A 5JAOA 1DXHA 3C5WP 3D4PA 3GDHA 4FC7A 5D86A 1B22A 1E77A 2ZSIA 3ZK7A 4RTJA 3SHVA 1E7QA 1CLUA 3BSYA 1E66A 1P9WA 1VI2A 4OH1A 3TRHA 4E32A 4NONA 1O1YA 3NBKA 3IP8A 3Q3GE 4F92B 5CRXA 5LL6P 3GX1A 1COWD 3RS8A 4O5CA 3KJIA 4P4NA 2H1IA 3T1QA 1JG1A 1K9VF 2DWUA 1CB0A 2OE2A 4LDRA 2Y0CA 2Z4SA 1Z6YA 4DSOA 1SD1A 3B89A 4PHDA 2FEWB 4J2HA 4LK3A 3SBXA 1FP1D 2DKOA 4DJJA 3P2JA 2JXJA 4EF6A 4ESOA 1KWKA 3LHKA 3QTBA 2X8JA 5J29A 2JJ2A 4MWTA 4EWLA 4Y1RA 2C2OA 3SFVA 2HSDA 3EVBA 4BPBA 2O8BB 1K0FA 4Z4GA 3EZLA 1I1NA 2JHPA 2RH9B 4QJBA 2PV7A 2HWXA 3PQ4A 1X15A 1ECJA 3IOEA 3JCZA 1JALA 2DJIA 4REQB 3SZ3A 3HXOA 5JBQA 2ADOA 5CDHA 1A5AB 1KWGA 4JI7B 4MUJA 1M6VB 3WLQA 2OQ2A 3RQSA 3C24A 1T91A 3RC2A 2GD1O 1RLUA 5DN9A 3GJYA 4GECA 5DYGA 3TBKA 5T7BA 4W5RA 1H2ZA 2VSXA 1IG0A 4KXFB 1AKWA 2DPGA 1H6BA 2EZYA 1E3IA 2G40A 1V1MA 3JQAA 4G5HA 3H5AA 3U5TA 1FXUA 2PRIA 4QEDA 2NTJA 5BW6B 3RJZA 1B8NA 4XYBA 4QUAA 3BE8A 3WV5A 1TK5A 4UCWA 2G09A 1QU3A 2H9YA 4JVSB 4B3TB 1HK7A 4UHFA 1O8BA 1X6JA 1SD2A 1UDXA 1HDIA 2G5PA 3AV0B 4KQ1A 5BQOA 4YJGA 1YASA 7ICVA 4R54A 1TVKB 4IMJB 4M8KA 1CEQA 3KQVA 4H7KA 4QDZA 4ZOEA 4AJKA 1CJKC 1QB8A 1W73A 2IYOA 2PTHA 4H59A 1ZI9A 3L4KA 2UXBB 4JXJA 4O4JA 2QTVA 3V9PA 3PL5A 4GBMA 3LLUA 1DUVG 1KC3A 2KBEA 2PO5A 1C8BA 2I1QA 2ZTMA 5AJTA 3ONFA 4MWSA 4WA8A 5AJVB 5IJAA 5AKIA 4Q37A 2LV8A 5A62A 2YMPA 1VHTA 1UKAA 3QNWA 1LXCA 1OZGA 1N2SA 5BMVA 1EE9A 2Q41A 2D1QA 1ZJMA 2JGDB 4UARA 1RC0A 3OZDA 4OHZA 4YHBA 2H29A 4LWZA 4Q21A 3CWZA 1K6IA 1U8TA 3H75A 2H2DA 3WA6A 1UUFA 2Q4RA 2ECPA 4G3XA 3H0MB 1P9LA 1XV5A 4TXMA 4Q3EA 2NU6A 3DT6A 4CT5A 3BXZA 4CV1A 2D1RA 2BCGY 3MR2A 2OVBA 3GFQA 3GVIA 1JEYB 1Z17A 4DEZA 1FDOA 3C98A 4U0JA 1VCHA 2F8KA 3PUJA 4NTZA 1L4MA 3LUKA 3USES 3K9BA 2VANA 1PLJA 1QK3A 3U7IA 4BQPA 1QGUA 3ZZ1A 1QHHB 4V3CA 4C8NA 1BE1A 1URPA 3C43A 3EUWA 3GJ0A 3DE0X 4JJ8A 4P5EA 4AG6A 4O2RA 4QYXA 5IEBA 3BGWA 5GPBA 2FRVA 4IIHA 1M8GA 1XKTA 4BOYA 1OOEA 2C5HA 3V72A 2VWPA 3LWDA 4LPKA 5L9AA 2JAQA 4RWZA 5DHAA 2NUTA 4Q7KA 4EHNA 2DUWA 2DPJA 4BFSA 4P8RA 2AGPA 4ZCQA 2OGSA 5A7FA 2YWEA 4QQNA 5FX2A 4BN5A 2P6RA 2HBJA 1H8HA 2CCJA 2R6JA 3WK5A 1M2HA 4PLWA 5CIQA 2VQSA 3DE2X 3NW9A 3RYFB 2OZLA 4HTFA 3T3DA 3Q7IA 2JGEA 4TWBA 3EMDA 1P7PA 4I5IA 5DBFA 2IPXA 3MGGA 3KTQA 1SN7A 2PYIA 4NU6A 3BMNA 4GKBA 2ZWVA 1Y7HA 5L3QA 1GZSA 3PX4A 3MILA 3WGOA 1JVBA 4BMPB 2VDMB 1BXRB 2R8XA 1M75A 4MVJP 1S0NA 1F2DA 1M2GA 4Z4HA 1BQ3A 4H3VA 5DT2A 3ZE6A 4G4SP 2IL1A 3E6AA 3I9MA 1XXHB 4K03A 4EQ6A 3CF4G 2QUJA 4JODA 3O82A 2E4UA 2GILA 2YX1A 1XO0A 5FDFA 5L1KA 4MJLA 1MN6A 3DDHA 2K2WA 5K6TA 1OFTA 2VRNA 5TPZA 1BMFA 3ZBQA 2IDZA 5A1JA 1XLTA 3EZ9A 3GMSA 3R74A 1D2RA 1YFKA 2V9WA 1HTWA 4P0PA 1IY0A 3I58A 3D6FA 1MAHA 4FHGA 4EAQA 4J7CA 2IY9A 3ZD8A 4DAEA 1TF5A 1DWOA 1RAIA 3ZDCA 4ZV4A 4NX2A 3PKIA 5IVHA 3ZYCA 1C0LA 1NHGA 4N5HX 1RRKA 3BILA 3WGZA 3C41J 1JDNA 2LE0A 2Y0EA 1G7SA 3WDMA 4I8XA 1GKIA 4CCSA 3MMZA 3OPMA 4M55A 1GKYA 3MRTA 3LUHA 3IEXA 1LC3A 5B36A 4GH5A 4MYHA 3SXUA 3FLAA 5CA1B 2RGYA 3QOFA 2FW9A 4KOAA 3S68A