3I76A

The crystal structure of the orthorhombic form of the putative had-hydrolase yfnb from bacillus subtilis bound to magnesium reveals interdomain movement
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
228
structure length
223
Chain Sequence
KRYRTLLFDVDDTILDFQAAEALALRLLFEDQNIPLTNDMKAQYKTINQGLWRAFEEGKMTRDEVVNTRFSALLKEYGYEADGALLEQKYRRFLEEGHQLIDGAFDLISNLQQQFDLYIVTNGVSHTQYKRLRDSGLFPFFKDIFVSEDTGFQKPMKEYFNYVFERIPQFSAEHTLIIGDSLTADIKGGQLAGLDTCWMNPDMKIIPTYEIRKLEELYHILNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the orthorhombic form of the putative HAD-hydrolase YfnB from Bacillus subtilis bound to magnesium reveals interdomain movement
rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Putative HAD-hydrolase yfnB
total genus 87
structure length 223
sequence length 228
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3i76A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3i76A01
3N5KA 1Q91A 3E58A 5AKLA 2Q4TA 2B30A 1Z5GA 3QU5A 4AP9A 5ALKA 1TE2A 4BNDB 5A3QA 4KN8A 2VKQA 2IYEA 4BNDA 3ZWDA 5ALXA 4GXTA 3W5BA 2YY6A 2NO5A 3WK8A 4BEVA 2I34A 2R8EA 3IB6A 4L6CA 4CF5A 5AM2A 2FI1A 1RMYA 5AKEA 4OFZA 4KNVA 5AI0A 3ZX5A 5AW7A 3I1YA 5AIAA 2C8LA 3A3YA 2P69A 2IA5A 1RRCA 4I9FA 4Y2PA 4Y2JA 1O08A 5ALLA 1VJRA 3E81A 4UM5A 3NRJA 3N1UA 4UAVA 4EENA 2YJ6A 3I76A 1KYTA 2YFYA 3NASA 5AI6A 2G0AA 3ZX4A 2HO4A 3L5KA 4C4RA 3KC2A 1T9ZA 1XP5A 3OCZA 1SWWA 3U13A 5AVQA 3FVVA 5ALJA 3AR9A 5ALOA 4RETA 4OD0A 4C4TA 3FZQA 4KNWA 4XE5A 2Q4RA 2HX1A 2B8JA 2JGAA 4E88A 3L8EA 4UARA 4F72A 2EATA 2GFHA 4EZEA 1Q92A 5ALVA 4UMDA 2EARA 1U2SA 3DNPA 4C4SA 2FPRA 4IFTA 5AKYA 2GMWA 2ZBEA 2JAOA 1Z4LA 2ZOSA 4BX3A 5AW6A 3KD3A 2CFSA 5ALNA 2CFTA 3ET4A 3ZVMA 3KOOA 1YJ5A 5AW9A 2ZBGA 2FUEA 2GHTA 4YH1A 4H1WA 5AVTA 4DWOA 3WK7A 2FUCA 2YJ5A 1WZCA 1L7OA 2G06A 5AM1A 5ALWA 3HLTA 2FEAA 2MU2A 3FGOA 3J7TA 2P9JA 1Y8AA 3CZ4A 2EAUA 3WK5A 2R8XA 3DAOA 5AW3A 3RFUA 2PR7A 3NIWA 3NAMA 3W5CA 5AVVA 4L6AA 2CFRA 5ALSA 3W5DA 4KYTA 3S6JA 1YDFA 4CF4A 3EPRA 2MU1A 1ZD3A 2X4DA 2FPSA 1ZD5A 5IS2A 2B8EA 4YGYA 3W5AA 2G09A 2P11A 3P96A 4DFDA 2C9MA 1L7PA 3EWIA 4Y2UA 3QUTA 3KDPA 3FPBA 4O8CA 2JAUA 3L0CA 1EK2A 1L7MA 2RBKA 1K1EA 4YIKA 2YMPA 2O9JA 3SKYA 3OCVA 4ZEXA 2I55A 5AW8A 3U19A 1L7NA 1ZOLA 3M1YA 3WKDA 3R4CA 3GYGA 5AK4A 5AK6A 1S8OA 2GHQA 2CN1A 4BKMA 2WF8A 4IG4A 1L8LA 1QYIA 3U7FB 4JB3A 4NAVA 2FDRA 3PCTA 2FPUA 4Y2QA 3A1DA 1N8NA 4FYPA 5A3RA 5AIBA 2B1QA 5AVUA 3B9BA 1FEZA 3MMZA 5AI9A 2YN4A 3ZTWA 3UMBA 1O03A 4EEKA 3WKEA 4FFDA 5AM3A 2DQSA 5AM5A 3OCWA 2FPWA 5AKIA 4DW8A 3OCYA 5AVWA 1Z4IA 5AI5A 3BA6A 4HGNA 2W43A 1RQNA 4DCCA 4UMEA 5ALMA 1Z4OA 3OTQA 4QJBA 3QU9A 1S2OA 2JARA 1YS9A 2PQ0A 3A1CA 5E0OA 2ZXEA 5AESA 4UU1A 2G08A 3NALA 1RLMA 2P27A 3AR8A 4F71A 1Z88A 4HYTA 5AVZA 4NFLA 3QXGA 2HDOA 2YMMA 4HGRA 3N28A 3SKXA 5AVSA 2C4NA 5ALIA 1SU4A 2G80A 1YNSA 3B9RA 1T5SA 2I33A 4AS3A 2B1RA 5AK3A 4MWOA 1LTQA 4AS2A 3AR5A 5ALZA 4RESA 2W11A 3ZVNA 3ZW7A 2YBDA 4G63A 3ESQA 4I9GA 3I28A 4UATA 5AKXA 5AKZA 4NABA 3ZVLA 1VJ5A 1AQ6A 3K1ZA 5ALQA 3N8GA 5AK5A 3L8GA 3ZU6A 2MSNA 4J03A 3F9RA 3UMCA 1NF2A 2WF6A 2YJ4A 3SMVA 5AW5A 4HAIA 4UU0A 3PDWA 1U7PA 2C8KA 4Y3UA 4EX7A 3QGMA 5ALYA 5AICA 3L1VA 3ED5A 2WF5A 1IWOA 3FPSA 3VAYA 1RMQA 5AW1A 2WF7A 3DV9A 2IOFK 4CNQA 2RB5A 4KX3A 4Y2RA 3L8HA 1RC8A 2AUTA 2OM6A 4UMFA 2NO4A 1RMTA 3BWVA 3QX7A 1U2TA 5AKGA 1X42A 4UW9A 2OA0A 1RKQA 2W4MA 4MUMA 3AR4A 5ALHA 4OHFA 1L8OA 3SLRA 2GO7A 3TLMA 2B82A 1J97A 4NV0A 4UM7A 2IOFA 5AM4A 3WGVA 3EF0A 2WFAA 4EX6A 4Y2XA 1PW5A 4KX5A 5ALRA 1RKVA 1NNLA 3DDHA 5T41A 5AKKA 3I6BA 4BYGA 1RKUA 4BX0A 1XVIA 2HOQA 3EF1A 1Z4JA 1VFPA 3IJ5A 3WKBA 5AVRA 3U7HB 1TJ3A 4HGOA 3AR7A 3MN1A 4UMVA 3ZWKA 5IT4A 4XOUA 3E84A 1LVHA 3HYCA 3WGUA 1U7OA 2RARA 4QQFA 3CNHA 4XPZA 4CE6A 3RF6A 4G9BA 4FE3A 2WF9A 5AI4A 3FM9A 2ZBFA 3QUQA 3WKCA 1T5TA 3ESRA 2AGVA 4BEWA 2NYVA 2I7DA 3QU7A 3R9KA 5ALDA 4HGPA 4OCZA 3KZXA 3QLEA 4UASA 2OYCA 2WHEA 1EK1A 1F5SA 3U7GA 4Y2VA 1TA0A 4GIBA 2G07A 2HF2A 5FP0A 3L1UA 4XQ0A 3IRUA 2R8YA 3AR2A 3PGLA 2I6XA 2RAVA 2G1AA 1Z4MA 2HHLA 3L0YA 1RLTA 3L0BA 3OPXA 3UMGA 1CR6A 1ZJJA 3E8MA 2Q5EA 2HSZA 1Z5UA 3U26A 5ALPA 5ALEA 4YCNA 3L8FA 1TJ4A 3KBBA 2BDUA 2WM8A 2I54A 3D6JA 1QH9A 2BY4A 5JJBA 4EELA 2QYHA 4BX2A 3B8EA 2HI0A 3WKAA 3N07A 1WR8A 3AR3A 2AH5A 5A3SA 3QUBA 2D2VA 5AVXA 5AW4A 3QYPA 1ZS9A 2B0CA 1WVIA 1RDFA 4YIHA 1SWVA 1U02A 1MH9A 3WK6A 2O2XA 2FPXA 2YMQA 1QQ6A 4YCLA 3AR6A 4HGQA 1ZRNA 1QQ5A 1YV9A 4J2TA 3SHQA 1TJ5A 2JAWA 3L7YA 3U7EB 3A1EA 4YCMA 1ZD2P 2YJ3A 1Z4PX 5ALFA 3NUQA 3SF0A 3ZTYA 1Z4QA 2AMYA 5AI8A 2PKEA 2QLTA 1L6RA 3OCUA 4JDPA 3WK9A 3UM9A 1YMQA 3R09A 1ZRMA 1WPGA 4BBJA 3QU4A 2HCFA 5ALTA 2YMLA 1N9KA 3QUCA 5AVYA 3QNMA 2BDEA 3PGVA 4Y2TA 3QU2A 1Z4KA 4Y2YA 2HEGA 3NANA 5ALUA 1J8DA 4UAUA 1XPJA 3SD7A 1RQLA 1NRWA 1JUDA 3WK4A 4Y2SA 5AW2A 3MC1A 1QQ7A 5AKJA 3ZI4A 2ODAA 4B6JA 3M9LA 2IOHA 2R8ZA 2OBBA 4ZEVA 3MPOA 4L57A 4NWIA 4CF3A 5AKHA 5ALGA 1RLOA 5AM0A 1RPZA 4PNHA 2ZG6A 2ZBDA 1ZD4A 5AHXA 3ZUPA 3ET5A 3OCXA 5AW0A 1Z4NA 2HF7A 5IT0A 4ZEWA 1CQZA 3ONNA 2C88A
chains in the Genus database with same CATH superfamily
1SK8A 1HFWA 2JATA 2NPIA 2FZEA 4N4AA 3RCBA 3B38A 3CXUA 4BMNA 4CKEB 4FBMA 4QWAA 2V7PA 3C3WA 2D2XA 2D62A 1C3OB 2BFCA 4K3UA 4L3WA 4RVFA 4UBJA 5LZ7A 3ZIDA 4EPRA 5B1SA 4G5OA 4EOGA 4CEIA 2IZ0A 3DDZX 1UKEA 4L8VA 4URFA 4YAGA 1T1RA 3EC2A 1WMEA 4PC1A 5KB3A 3UT5A 1WW8A 2WK1A 1VMIA 3AYXB 3T3MB 4JI0B 1FUKA 4MGKR 4ZANA 4ZYVA 4Q48A 3K9BA 4IIDA 4KV7A 3ROPA 3N2KA 2FEWB 4CN9A 3DP9A 1NDUA 3OFKA 3SHVA 1DRWA 4V0OA 1HOXA 3F47A 1N7JA 3SR4A 3GLQA 5HTOA 4MR7B 5AKEA 3CEMA 2QB1A 4FZ3A 5KQGA 4GW3A 2ZIZA 3JARB 2C83A 1KE1A 1ENPA 4DKXA 1Y6FA 3JR7A 1OKKD 1BZYA 3H5IA 4KQ9A 2J9ZB 4HMQA 1KRWA 2NAFA 3ICWA 1G7SA 2HLDD 1FTQA 3MM4A 2VA3A 4Y2JA 3PW0A 1KO4A 2OLEA 4CM8B 4CV3A 1ATIA 1HSOA 3BD8A 1KVRA 3IEXA 3D8RA 1EJBA 1Y1PA 3LUJA 3BBLA 3AETA 4IDBA 3BILA 4JFRA 4AURA 2ZAOA 3KC2A 1XP5A 4J0IA 4YP1A 4G2TA 4YJ2B 4KXMA 3PB3A 1YA6A 2WYOA 1TD9A 4EZ6A 4QOEA 4WADA 2PGAA 2KI5A 1NW4A 3F7MA 4TROA 5BSRA 1IXYA 1YB1A 3GJ3A 4ZXPA 1DO2A 4K8RB 5L3SA 1KQOA 1J00A 1JT9A 3K8YA 3EDCA 3LUKA 4RF3A 5FTMA 4LZJA 3NH9A 2DPGA 2D4HA 1E2DA 1MJNA 3V5NA 5B12A 3Q7IA 3N39C 4MQ6A 1QUFA 3K1AB 5K3FB 1F4PA 4C2AA 4CIWA 3MJFA 4QASA 4UZEA 4Q82A 1O6FA 3H4BA 1A8HA 4MW0A 3PHLA 1IIBA 2EARA 1Z45A 4X8OA 1U2SA 3VSBA 1VB5A 1KQ3A 4LXXA 3F2VA 4RJTA 2R1TA 3TTVA 4ZI2A 1Q7EA 3BREA 4R71A 3TW4A 4D8VA 3FYUB 4UBNA 1ZQLA 5E95A 1GTRA 2G1KA 1WZEA 2G5HB 2WIGA 5F77A 4KR3A 3F49S 4BNUA 1ZH8A 4CCYB 2V0NA 3C3KA 2AOVA 2CFTA 1JXOA 2HPHA 2UUPA 3E3NA 4JBIA 1JKFA 4FNGA 2GOLA 4UUOA 4XLTA 5AHOA 4X44A 3FSGD 5K3SA 1IQ0A 5LC1A 5AYVA 1IZ9A 2W37A 3DC2A 2C5AA 1P5JA 1T4BA 2M2IA 3GFRA 4N6GA 3ZZMA 4D9GA 3DHNA 4WZAB 3G2QA 1ZRSA 4J9PA 1N3IA 1ONSA 4B44A 3WK7A 3ZU2A 2JLYA 1S4QA 1UBKS 2IUEA 4KLNA 3LPMA 2W2KB 2ZAGA 3VVBA 3MHTA 3RBVA 2O48X 4PYKA 3GCGA 4LZOA 4FT4A 2NADA 4QWDA 1RXSA 1Z19A 2FX3A 2W9XA 4KQEA 3FW1A 3RWBA 2WTAA 2PGJA 4OHOA 4AZVA 3WLRA 2ZS8A 4FN5A 4N5LA 3UHPA 1TK0A 2ID4A 3J7TA 2JLXA 1TB4A 1ADYA 3ALRA 4F5PA 3PO5A 4JI3B 1NY5A 5DKFA 3RFUA 2ENWA 5JE8A 2BJHA 3E7PA 3OM8A 4JJIA 4FDUA 3REFA 4E21A 4P86A 1DIAA 3ECCA 3PTZA 3PUVA 1T1IA 4IJUA 2JEZA 4CF4A 4TQSA 1M2HA 1N7GA 1LV8A 5LYYA 4M1YA 3DMRA 1T0UA 2EZ9A 4BN5A 1R0CA 3HJEA 1Q3VA 5BOSB 5JZVA 3OEED 5I9TA 2W2LD 3I2YX 1L5KA 1C9NA 1CUEA 4KDCA 4FYVA 1LWNA 3R23A 3BXPA 4GF5A 4YB8A 5TMEA 3R9WA 3JVVA 3GJ8A 2ZT6A 3DE3X 1SR8A 3C1YA 1E2LA 2CK3D 5DP1A 3TUJC 5JMOA 3QUTA 3KDPA 2XCTB 2HYDA 3KJNA 1M5UA 2PWPA 3GJQA 5KHOC 1KHHA 2EP8A 2GBPA 2QRJA 4MDEA 4WDQA 3SENA 2AF4C 1NNI1 3BZWA 1DC3A 3UMSA 4D8YA 1NG9A 1GG2A 2JRCA 4GMKA 3B1VA 4ZO7A 3RRFA 3KG2A 1SBCA 1XJ5A 3GJRA 5EUCA 3ZD7A 2ZDHA 2M6LA 3SKYA 4INAA 4ZEXA 4WZZA 4B2PA 1EHYA 3I09A 4AMZA 3C1AA 3JPSA 1E2MA 3OE5A 3WKDA 1UKAA 1CFZA 1PDWA 2DBRA 2HQOA 3UG6A 2J3MA 3IP3A 3ZBUA 4DG8A 5LUAA 4DIMA 2BCJQ 2P4HX 2KHQA 2Z6QA 1WU7A 1E5VA 1W76A 4LPSA 4B34A 4DLAA 4RTQA 3IV7A 3L01A 4Y9UA 3AF4A 3FXAA 1GDTA 3CN7A 4RU1A 2ZROA 4O5EA 4HNGA 4DCNA 5LKAA 3UFBA 3EBPA 2J32A 2Q45A 2XZTA 4J4HA 3GLUA 4RCZA 4ITVA 2EQ5A 1ISIA 3AOGA 4G8CA 4YR9A 2C7RA 4K6OA 1NK7A 3HWTA 2VP3A 3V4PB 2ALZA 5GY7A 4NYJR 5A03A 5JZOA 4Q8EA 5DCUA 3V7YA 1VLLA 2QYSA 3B9BA 4O3MA 3FD8A 4J16C 4ZVNA 3BSYA 3MWGA 3NYQA 4YRSA 1J70A 1ESNA 1G20A 4UD6A 4IM7A 3JQCA 1H2BA 4Y8VA 4BQEA 3PUHA 1E2IA 1B8OA 3OCWA 2W04A 2R48A 4I8XA 2NACA 1G1MA 5HHTA 3JATB 1HE2A 5G3ZA 2R6R1 2L0XA 3EUFA 3V1MA 4PC7A 4NNJA 1RCTE 2ZI7A 3BA6A 2JIZD 1IHPA 1QV6A 4ZAZA 5GTIU 3WGYA 4PANA 3D0OA 3EE6A 3PJEA 5HDQA 4CTNA 1XB2A 4KW7A 5DNEA 3OPVA 5EY5B 2XADA 1ZNWA 2VKTA 4QEZA 2H1SA 3VU0A 2P27A 2IQ5A 3AR8A 3KOWA 1MPTA 4KMRA 4PCAA 4QJ5A 5KVCA 1VCNA 3A4MA 2P62A 1TVCA 1EFTA 2LMRA 3L6CA 2LP4Y 1YZGA 2OGZA 1MXFA 1NI3A 5EWEA 2HBJA 1R88A 4KN6A 1A69A 3IRVA 4CUJA 1BOOA 2EJTA 2WJWA 2HTEA 2OP0A 4GMXA 4GRAA 5HRAA 5IZ4A 5JXIA 4M7WA 2WINI 1Y5MA 4I55A 4QEDA 2YXLA 1YQWA 3V72A 1NXOA 2RGEA 3ILXA 1CJKC 2H57A 2W71A 5TRTA 1IK6A 3ZW7A 1G21B 2VDRB 1T3HA 4HK4A 4KU4A 1ZH6A 3SSAA 3TX6A 2IXEA 2XT6A 5BWOA 1WPRA 4ID9A 3BK7A 3HRIA 1VJ5A 2BCUA 1WV0A 3BB1A 4FK8A 2I78A 4PRKA 1NVUQ 1AD2A 1U4BA 4HOYA 1I7NA 4UTXA 5D7BA 1HM5A 4LTNA 3FROA 3H04A 4IJ5A 5DLDA 4ZVPA 3WDKA 4RU9A 1R3UA 1J42A 3ZLUA 5HYVA 1V85A 4KLQA 3KUKA 4JV2A 2X8WA 3DPUA 3PSTA 4YRQA 3BL5A 1LS6A 2H11A 5BWMA 4EG4A 5GVSA 4H7EA 3VA7A 1DAHA 3VR4H 4AJ4A 4GLLA 4ZU3A 3RFXA 3W5UA 2PLNA 4LC1A 4BGEA 1AG9A 2ISOA 1VI5A 1AGYA 1X7YA 4ZO4A 4C6TA 5C4MA 3HB9A 2C5FA 2I4OA 4TS9A 3RKSA 3IX7A 3NTOA 1NJ8A 1G5TA 2FMUA 2P75A 3RB4A 3LY5A 5CLQA 2K4HA 3I9V6 4REQA 2C3YA 4WCFC 3I32A 4JCCA 3ZJ4A 4A0HA 5C1DA 4OIFA 4YECA 4O4IF 1BD3A 4MWDA 4Q05A 1HXHA 4UUAA 1EQAA 1FDVA 2F3RA 5H5JA 2Q0ZX 3TTTA 1AUQA 2UXCB 2X9LA 1CJBA 3QLJA 3PWZA 4Q16A 2NV2B 1X42A 2OPBA 2QUBA 2WUWE 3V8PA 2HV9A 4HDMB 4LK3A 2GDJA 4KQMA 2X8AA 4PSUA 3SLRA 3P9IA 5AK0A 4BOYA 5U9CA 2RSLA 4NU8X 3GDWA 4UPVA 3LQKA 2AZDA 4UM7A 4XWAA 3VBEA 4M0KA 2P2SA 5E9WA 1QKJA 5HS4A 1OBFO 2PZBA 1ZCFA 2YV3A 5BW5A 4QWMA 3KHGA 1NWCA 5KU7A 1DTWA 5A6SA 1CZNA 8ICZA 3L02A 3LWMA 1BE8A 3QF4A 2O3UA 3IJ5A 4KTTE 3ESYA 2EZXA 5BNFA 3BQNB 2G7MC 3Q7TA 2W7PA 1TJ3A 3UMVA 2RIPA 3CFYA 4M7PA 3RBAA 2HMYB 1AC5A 4G41A 4CPDA 2P66A 3A6PC 3KPUA 4M0CA 3E7WA 4JP3A 4E4TA 2CV2A 1UK8A 1SC9A 1FDTA 2ZYAA 3AHGA 5C8XA 4KWCA 4KK4A 3EDYA 2G04A 4AKGA 4M8SA 3TSZA 1IM2A 2FN3A 2K4MA 2VJPA 5GM1A 5J0XA 1AA6A 3EZLA 3VX3A 4TYNA 4LGYA 2C03A 2WF9A 1H8HD 1LNZA 1N9GA 1S2GA 4RF5A 2NUTA 3STUA 3VSDA 3WL4A 2IITA 4G8BA 1GSHA 5CFRA 2KD1A 4BEWA 4IOKA 2K2QB 5LXTF 2QN6A 5KG5A 5CJ2A 3EARA 5BWNA 5IUJC 1JIIA 5CIYA 3QFTA 2F8TA 1ES9A 3OT4A 2NXWA 4IDDA 5LCXA 2H2FA 3ZK9A 4C03A 4G1VA 2DULA 2BI4A 1TIKA 4UASA 3N7AA 8GPBA 5KMGA 1N1GA 4QZVA 2Q29A 4HG2A 5IXSA 2UXDB 3LK9A 1SU7A 3OEHD 3QHPA 4QAJA 3G8YA 5JSZB 2F77X 1GQFA 1Z8FA 4TL7A 3PZPA 2L82A 2R4TA 1K7XB 2FE4A 2J87A 3A06A 2QY9A 3GGSA 4KGXA 3W6NA 4A0GA 1OZ0A 3DBLB 1D8BA 1E66A 4RQ7A 1KY3A 1RABA 4HVAA 2OVFA 4I2VA 1IPFA 3BTVA 1XC9A 2ESRA 1ZK3A 3AIOA 3D6NB 8ICLA 5B5EU 3OBBA 3OM1A 1JWBB 5FCDA 4E5UA 5JU5A 2BFMA 2AG8A 2F8LA 4KO3S 5CW1A 4FMDF 2XLCA 3U26A 1NMXA 3TTYA 3M83A 1QHXA 4MJ7A 1JMKC 1J2TA 3CH6A 4E2XA 4GI3A 5LOVB 5BN4B 4XDZA 2XWJI 2L5YA 3HMKA 4Z6KA 2VP6A 4GP6A 1HF3A 1ZUNB 4HNTA 1N4DA 4UDYX 3ZOKA 1JXMA 2IX3A 1Q1QA 5DI9A 3W9YA 1IM5A 1RP7A 1CULC 1D3AA 3GRYA 1QH9A 4TSRA 3P0RA 4MR7A 4ZT2A 4CIXA 4KKVA 2WU0A 5LU9A 3ZDCA 4RQAA 3BYZA 4RZSA 1OFUX 3RT7A 3G7SA 2XIDA 5E6SA 3WA7A 3VJMA 2IXGA 4ZFNA 3VTKA 3BG5A 1PJRA 1K4KA 2J9XB 5B4TA 1YF3A 1EEXB 1V8PA 1SMKA 4L2IA 3SXUB 2FFBA 5K6RA 4JP1A 2TECE 4ZJZA 4GKKB 1T9DA 3HY6A 3RB3A 3H75A 3PVSA 4UUBA 1U5CA 2IZ6A 2W4IA 1QX3A 5KG7A 2KHVA 1QIJA 2DFPA 2IY9A 3EVGA 3KPYA 1FBNA 3CO0S 4ZCSA 5FTLA 5JDIA 4WESB 1ZHFA 5JROA 2QQFA 1X7XA 5DGXA 4AS1A 4DDWA 2A5LA 2WD8A 1N48A 1BKYA 1QFXA 4A8JB 4KXVA 4F92B 1PJAA 4Q4AB 2H63A 3L0SA 3WGLA 4YR2A 1M34A 1OXXK 1U0JA 3I9V1 4KCGA 1U7HA 3FYSA 1JBKA 3LNCA 4HUQB 5G0UA 3SSOA 3FPKA 3CH4B 2GCPA 1BPZA 3ZIAD 2HLHA 1J5XA 1BVYF 2PSJA 3GLFE 1I7SB 1JR3E 2SBTA 3OSZA 4OQNA 3VMMA 4GOJA 2GF0A 3FOBA 3OLXA 3OCUA 4LZWA 4NJMB 4MVJP 5G2OA 4EHIA 4UVDA 4E12A 4EUHA 4EUEA 1KSFX 4YMLA 5COAA 4BCCA 3WMFA 2BEUA 4J0DA 1A5TA 4UZFA 1WBJB 2R1VA 2BL4A 1F60A 5JLJA 1JNYA 3AI3A 3F6RA 3PX3A 4C05A 1QOQB 4UKDA 4D8XA 1ZQBA 3KAQA 2FUKA 4YRKA 1LI7A 3ESDA 4CMIB 4TYWA 3F97A 1CR2A 2P1ZA 2GAAA 1IATA 2GM5A 1OOEA 3H4DA 4NK4A 3VU3A 1XCMA 4MVJD 4KWHA 3R7DA 2RHLA 4F4HA 1CQWA 5FOQA 5BSFA 4D9BA 2WMNB 2AC4A 5JANA 3L3BA 4PONA 3I30X 3SD7A 5KYNA 2CYCA 1GITA 1Q0RA 3DKRA 1S8AA 3SQLA 4BIIA 3P5BA 1AF7A 3FJ1A 4RMIA 1WXIA 5CP8A 3PNPA 4CR6A 2V0GA 5ED0A 2PRIA 3FCXA 4MKRA 3WQHA 4M04A 3PHBE 1SHZA 1U5BB 2ID7A 2OFXA 1LVUA 1Y1LA 4JDUA 3MBIA 4RFLA 3KKNA 3TF5A 1VI2A 3AVQA 2IPLA 2XGGA 4FYJA 4BAGA 4C01A 1JR3A 1YMUA 2CLKB 3AW9A 4HGYA 2DTDA 1U5BA 3UJPA 3O8CA 4GDMA 2XQJA 5PNTA 3VDNB 5AHXA 4UBLA 1TK3A 3OLYA 1X19A 5EWMA 2AZ4A 4A8HA 2RAFA 2P9BA 3RC8A 3IT2A 3WRYC 5BVHB 2FAXA 4XD7A 1I51A 2PGDA 1WIWA 3OIYA 3OU7A 4PJ0U 1SXHA 1YR3A 2FSUA 2OCAA 3UC9A 5JMWA 1UIMA 1Z6TA 3GZNA 3LVBA 3A26A 3QFCA 3VYTB 4Z4EA 4LOIA 3DFKA 1DLIA 2A1TR 2XECA 3JSXA 2YTUA 3K75D 1LRLA 4M0UA 4OMDA 2EF0A 4BFUA 4X62B 3P9YA 2XY5A 1MHTA 3L7AA 4BBZA 5H02A 2TYSB 4YN4A 2C9CA 4KN8A 1GKUB 3CRXA 3ENKA 4RZIA 5F21A 2Y0SF 3KJIA 3O2NA 3RTVA 3W79A 2OXOA 2A3NA 3JQEA 3KR0A 5F1KA 4NENB 2FPLA 1JRPA 1K5HA 2C2RA 3SAGA 3PEUA 1F8UA 1WE2A 4O4JF 5DTRA 3RV3A 4D97A 4DYHA 2NO5A 1QPZA 4EGQA 3VR2A 5CR9A 3CCBA 8ICBA 1GPWB 2HPAA 1RU3A 1E2BA 2II6A 3DMFA 4XW2A 1JE0A 4P7KA 5LL6P 2AL7A 2C4TA 2QD5A 4IG9A 4C4PA 1JFVA 3A9CA 4GQBA 1BWQA 3AXSA 2JXJA 3GPIA 1O6BA 4Z0HO 1PV4A 4LAFA 4EBDA 4L15A 2G6TA 2E4XA 3PBKA 4MV5A 3KO8A 2HHCA 1D2CA 3NHLA 3LYUA 4KJZA 4F21A 3GDGA 1E2JA 4RLQA 1DDGA 3R0ZA 1NK9A 1Y0BA 1URPA 2YJ6A 3ON5A 2JLZA 2C3UA 2PUGA 3F73A 4M9RA 1VHTA 3HCDA 4TS4A 4G81A 2ZPUA 5DMHA 4N76A 1VGVA 1RD4A 3OCZA 3AP3A 2HCTA 2Q6TA 1Y63A 3S1AB 4UBIA 3GL9A 5ALOA 5DKWA 2ZXUA 3CNBA 1ZJZA 2QE7A 2NZYA 2PY6A 4L76A 3ZXYA 1XDWA 2XKKA 4CKZA 4JR0A 3ZD6A 4QYIA 1Z5NA 3TKYA 3WLMA 3PHIA 1C8BA 4QICA 1I7LA 1S9FA 4GDFA 3AUTA 4KUEA 2H4WA 2XGMA 4OJYA 4RZUA 2HMVA 1H1TA 4GC9A 4IIUA 4PFQA 1ZUNA 1V1MB 1A27A 4MW5A 4MICA 1QG0A 2CF6A 2V45A 3R41A 4HQRA 1M1NA 2PLRA 2JLWA 3GVPA 2X9GA 3CNOA 3BJYA 1RXYA 3G8DA 4M0EA 2PKQP 3DNPA 2QLLA 2FPRA 2H1HA 4IFTA 3TLGA 5K0JA 1H0RA 4L4ZA 2FTKE 3PLAE 6ABPA 1OWMA 2PPLA 3TW0A 3CU5A 5FULA 3WYNA 5BN3A 3N97B 1USVA 2VG8A 3I5MA 1Y3CE 3O8QA 2B2NA 2QGFA 1WF3A 2PMZF 4M88A 3MLAA 3JWIA 4PPXA 4CKCA 4YAWA 3H5VA 2YTZA 6YASA 1SM4A 2FUEA 4MI1A 5L4LA 4IR9A 2D2EA 2XX3A 5BNZA 3NP9A 1N2GA 1PZMA 4PNZA 5LKRA 3AL3A 4PR0A 1A96A 1YC5A 1EVIA 3H05A 3HJCA 3TBKA 4DR4B 4TMZA 3GLTA 1D1SA 2H65A 1Z00A 4QUIA 5MFPA 1SXIA 3Q3CA 1AUOA 1E62A 5ALWA 5IBPA 2O8VA 1JEJA 4GUAA 1KARA 3T7KA 3WIVA 1JRLA 4V2UA 2AN5A 1HLGA 3MR2A 2FEAA 2ZATA 4HJRA 4RK6A 4ND5A 4WE3A 3ZXUB 5AW3A 3CZ4A 1G64A 4NLNA 1Z0IA 4GGPA 4RHXA 3TFSA 4XYMA 1GPMA 1KEPA 2XCAA 1ORDA 2JIOA 3ZGOA 4OO1J 4LNUA 1LK7A 1MAHA 3AKDA 3TIGA 3NAQA 3TQHA 2MT9A 2HWYA 3CO5A 4G4SO 3BSWA 5HHHA 3G9XA 3WADA 1QZXA 2CDRA 1MQSA 1BN6A 1D4FA 3JQ8A 4PVDA 5KQMA 5JAIA 5KAIU 4O4HB 3UKDA 1QLJA 4F5ZA 3A1NA 4TL8A 2XI9A 2ZSIA 4B73A 2IYOA 4E14A 1V4NA 4LDPA 4O5AA 2NRTA 4E5DA 3SYLA 3UXEA 4YYEA 1E3MA 1CD5A 1TJYA 5JADA 4J9NA 4LWPA 5I01A 5KTRA 2BGGA 4C14A 2UVPA 3ZHYA 1VMAA 3HKEB 1PSWA 1NZPA 2G5GX 3QWAA 1RWWA 4TL9A 5AWFC 4ENWA 5K8TA 4Y2UA 1BFDA 3T35A 2AI1A 5CT4A 1DV1A 3VC1A 5IAGA 3CPHA 4TRMA 1WXXA 1EK2A 4X6XA 4CR7A 1GTL1 1X70A 2PH3A 3KLMX 5E8RA 3AQ4A 1BCRA 1F06A 1P77A 1PWXA 1T29A 3DMTC 3EFOA 3OMXA 3QXHA 4GKBA 4LOAA 3PFHA 3CWCA 1SXJD 1U4OA 4OQQA 2EKPA 5HSGA 4XGKA 1T8RA 3BZUA 1EFVB 1X7WA 4RY8A 3PNKA 2X3UA 4WK2B 5CVDA 5DCWA 3UEOA 2LCIA 4K87A 1FBTA 3ZHXA 2QTCA 1P33A 1HE1C 2VQ3A 1FDUA 1NI4A 4FOTA 2E1PA 4FZRA 3LX4A 2YOFA 1XNGA 3I3OA 5J0RA 4K9KA 3KXKA 5BSGA 1QYXA 4DUZB 2ZYIA 1K3TA 4UNNA 3A4LA 3MJSA 4IYRA 4ZMBA 5HE9A 1K0UA 1E94E 2JFPA 2XE8A 4OXIA 2BMDA 1EP3B 4U7HA 5C31A 4CEIB 4YQEA 2F8KA 4TV9F 4EIWA 2Q1YA 3N0TA 1H8EA 2C7BA 3I9LA 3EZ5A 3WYCA 1N2OA 1LB1B 5DI3B 1CEYA 4B9VA 5FV7A 3KUDA 5T4EA 2Z43A 1IB6A 5TMBA 3ZTWA 3W8FA 4OKIA 1IIRA 5C80A 4QZ8A 4JLJA 1E5LA 5JQGF 1XHLA 4LQLA 4AW9A 2J5KA 5FOTA 1E64A 3GNQA 3OOEA 5CFPA 2OE2A 3V7NA 1BDIA 1GKYA 2B8NA 3PC8C 2ZJ6A 4MZDA 1KI7A 5C8YB 3R5SA 1ZN7A 3O0TA 4FBUA 3H8SA 5FFFA 5I7SA 4XSVA 1YCGA 4UCWA 3KVOA 3BFJA 4DIUA 5FWNA 3O9MA 5ISMA 1S2OA 1V2GA 2FOXA 3QYFA 5AESA 1VDZA 2C59A 5KWSA 4DR5B 2VPZA 4B80A 5J4VA 4NM1A 2B2CA 3GJYA 2FMXA 5JFOA 3F2CA 2X19A 3AVPA 5AXAA 1QDLB 1Z88A 1Y9EA 5J0WA 1WP4A 1N6PA 3K5HA 3OPYA 3OCJA 4C7BA 2QRNA 1UMDA 2VF8A 1NSYA 1T4CA 1P3JA 1T6NA 4FPXA 2YINC 3EH1A 2B37A 3ZZUA 4Y6QA 3BERA 1C9YA 4LMAA 4BQIA 2B1RA 4QZ9A 3C3BA 4P08A 1S9HA 1I7PA 5HFAA 3EIQA 4ADSG 1GPUA 2IXTA 2DERA 2GZRA 1O5TA 2JD1A 2TMKA 4JBWA 2P90A 1KAMA 3R5FA 1XMSA 5KFOA 2IHKA 4LXGA 4MARA 4M83A 5EL0A 2QZ9A 1ZL2A 3CS3A 5I4IA 1DPFA 2I1QA 1O4WA 3HCFA 4NMMA 1GILA 1QRUA 1XZNA 4KXLA 4JI7B 4HLCA 3EPGA 2I91A 5L45A 2COEA 3KQHA 9ICPA 2CUTA 4LISA 4BO4A 3ZCVA 1PJSA 1N7HA 1Z7BA 3G68A 1U47A 3IP5A 3P4UA 2CNWA 5CEFA 2PTHA 3PQ6A 1S6YA 1Y48E 2Z2XA 4W1PA 4CMEC 1LUAA 4W5TA 1W93A 3DZHA 4MV3A 4PRZA 4PYIA 2CBZA 5EWJA 3ZU6A 2VQEB 3PFWO 3JYNA 2IHBA 3VZSA 3UOWA 4K4GA 1RWQA 1YB7A 2H16A 2YIVX 5CH3A 2OXIA 1E2EA 1HDGO 2I2XB 2YJ4A 3AB8A 4FQ5A 4L9SA 3V4ZA 1R27A 4NI5A 4PX2A 1R8QA 2FLLA 3F96A 1QLNA 3IYLW 1RVDA 5ALYA 1J23A 4NDAA 4DEYA 3FTNA 4I2EA 2JEGA 3KKKA 2REBA 4R9UC 2E3TA 1EESA 4WZBE 3RJ5A 4KKXB 3FB4A 1UZNA 2WZBA 2AIRA 5BMOA 3TLBA 1RKXA 2R3SA 3DZIA 3OOYA 3TSYA 1A50B 2J4DA 4WK6A 1JEYA 4R5MA 1Y4SA 5KSPA 3EODA 3T5PA 5FL7A 4IDPA 1XC7A 1VTKA 4U9HS 3OQOA 4JOCA 2AUTA 1L9XA 1CEXA 3OQ1A 3SVZA 5CH5A 1U3DA 4R1LA 2XBLA 3C3MA 1UMBB 1BGWA 1XCBA 2KSOB 1R12A 2CNWD 1TQ2A 1WB5A 1IHOA 1TUGA 3JS5A 4YLGA 4Y0AA 4YJ2F 1JU3A 1HZZA 2HB6A 4RE6A 2DG2A 1QCCA 3FZEA 1ZSVA 5MDHA 2GX6A 2C4UA 5HFNA 2GWHA 3R3XA 5FOVA 4ARUA 1LDEA 2C3OA 3RJMA 1TAUA 4AN1A 3NEPX 3WGVA 2K2WA 3DGEC 3VC2A 4S1WA 5DH9A 2PD3A 3NHUA 2M9MA 4ZAWA 1XN4A 2Q5JA 4K9SA 4BMSA 3RIMA 1IUNA 2HBRA 4EUFA 1N0VC 5EMMA 4WUTA 1PEDA 2BUBA 2HMWA 4E33A 5HP4A 5DGIA 4G0YA 2VK8A 2AYYA 4CCAA 2MUTA 2XVZA 5KL8B 2YS7A 1NBMD 5AVJA 3OZEA 2CCJA 2YNMD 3AHCA 4JYCA 4ER0A 2EZUA 4KTVE 5EJEA 2YWEA 1MRSA 2A1JB 1L4LA 1HYBA 2IV3A 2AOUB 4EEXA 3FE2A 4OJMX 4XOUA 4UEJA 3D8UA 1DB3A 2BELA 1JJIA 1QIKA 3IIEA 4NZNA 4EHFA 1Z38A 2IBKA 3A05A 5EA2A 3H65A 4MVJM 4RPCA 4HWTA 2ZQZA 2FMPA 4RHFA 4M54A 1NUSA 3I64A 1PQUA 2AEMA 4BLPA 4YY3B 4G0WA 1I4OA 1L1QA 1LJLA 5J0YA 3BQMB 3NAGA 1XNQB 4EGFA 1IY1A 1IAVA 4YP7A 4EJSA 3MGAA 5DCLA 1SK9A 4G1EB 2AFRA 2R8GA 3U3KA 4OJOA 4B7CA 3BJEA 2DPJA 1FFDA 1PTJA 2FWIA 4FYHA 1CZKA 1GWNA 1TRHA 1WXGA 1XZAA 2IZ7A 4F8RA 1Z8HA 3KVVA 3PKZA 4GU5A 4UNPA 5K3AA 4DSFA 4EQ6B 4YUXA 5K5EA 3H1PA 3PG5A 2P5SA 3DAYA 4DC9A 2H0AA 1WUDA 3IQDB 3PXAA 2C98A 5C34B 5CA1F 1U0NA 4LXIA 2ZFUA 4GPD1 5TGZA 2ZWOA 4Q8FA 3ZLTA 3MMXA 4LGVA 3ZI0A 2ZI4A 1EP9A 1BDJA 1XF1A 1WXWA 2QL9A 3C3CA 2GD1O 1JV2B 3M3HA 4Y2VA 3R3YA 4H6VA 4N0DA 4QXRA 1QOPB 2WTEA 2CNLA 4BP9A 1IV8A 1SXDA 1S9DA 3R44A 4RQ0A 3GLGA 3PGLA 1ZN8A 4DB2A 1P1RA 3ZDYB 5JAOA 2EW2A 3Q6IA 2ISPA 1JA9A 1WXEA 2QTBA 5E4FA 1RLTA 2O6KA 2WICA 5EQFA 1WDLA 2GZDA 3FUTA 5LP6C 2Q7DA 3OGUA 1U2ZA 2R00A 1TKCA 5D4BA 4FO6A 1CR1A 2GAJA 3L05A 1QP7A 4RZHA 4ZA2A 3ZWBA 3MUNA 1Z5UA 2FEXA 1W88B 4WFKA 3UWPA 3VMFA 2NRVA 2Q8QA 1GCOA 2PI5A 4BJQA 1DIBA 1HC7A 3LDUA 3WGIA 4AWXA 1TCVA 2P4QA 5BVHA 4WECA 3KBBA 3AGPA 3ETEA 3COWA 2PO5A 1VG9B 3HR4A 5ITZA 1JFSA 2VT7A 4L0MA 2OT3B 4C20A 1M74A 2I3ZA 2P4UA 5DRTA 5SY4A 1SA0B 3NHFA 5LZ9A 1PL8A 4E03A 3KTDA 4HZIA 4LBVA 5FNVA 1AMOA 1PUZA 4XPIB 4TKZA 3NM5A 4CL0A 4E22A 4UAZA 2QM7A 2H5XA 3ABZA 3DFIA 3H3FA 3N74A 4DJDC 3QFFA 3G9QA 1ZS9A 3FTDA 2WJ3A 2D5LA 2HUNA 3BMCA 3GLKA 3VPCA 2XHEA 2G9RA 3AUKA 4HP8A 4X1YA 5JAZA 3ZDZB 4BLVA 4RTPA 2XMBA 4NMXB 2F1OA 5DM4A 1NXSA 2NU8A 1CUKA 4R63A 4HGQA 3CPSA 5JG7A 1ZRNA 2VC2B 3RVKA 2YXPX 3B70A 3MGHA 3KFXA 4CKWB 5CXUA 3RIGA 4EFNA 1QG6A 5LDDC 3GP8A 1WDWB 5GZ3A 4TXMA 1Y3IA 3D8BA 4TX1A 4WZBA 1K6IA 2YHUA 1I2ZA 1HKUA 2GD0A 4UNQA 3ZR4B 4CYMA 4FBTA 1UAAA 4ACBA 3OF5A 4NZPA 5DTJA 3VI3B 3W9UA 2WRZA 4WJKB 3ZTYA 1ONOA 3BXXA 5SV2A 2Z8YM 5INTA 2XNHA 3SBXA 2QLTA 3CNNA 4PTLA 1KRPA 2IVFA 1SRRA 2V7UA 2VH1A 3DT9A 3FGPA 5IAOA 1OU0A 5HIJA 2QTMA 4N5MA 2QLFA 3LYHA 3IBSA 1XHEA 2YFKA 1K2WA 4NE2A 4WERA 4IDHA 1CKEA 9ICCA 1E3WA 3KM0A 1IBMB 1WZ2A 3L8MA 1Z0UA 3BJIC 3HKCB 4YAJA 2G9QA 5ES3A 3TUZC 3F5AA 4AYBC 3HJAA 8AT1A 5IBQA 5I3CA 5K0ZA 5KTKA 1QU3A 5EXXA 2CUNA 1IBCA 3L6UA 5GONB 2A4KA 4BS9A 5HGXA 1JAZA 3LDGA 4GM1A 4DN6A 3NDRA 3IE0A 3U6KA 1DBQA 1DC5A 1TMGE 4YXMA 1KFSA 1NJ1A 3AY7A 4PS1A 2CLIB 3NYRA 2PMEA 3UXMA 1VL1A 5KFWA 1E63A 1OROA 1IVNA 3ZIUA 4A4DA 2Q5CA 5I7AA 5TXGA 4OHYA 3LA6A 5LWQA 3MC1A 3NT2A 4JEUA 2K87A 4O2BB 3M1AA 3O9VA 1P5HA 3QJ5A 4DVJA 1HWYA 1M2OB 4XGNA 3L7KA 2IYYA 4KI0A 1PFUA 1QG2A 4M9HA 2OBBA 4N6NA 3M81A 3T7CA 3PEFA 4RKRA 1LLQA 1ND5A 2FSVA 2O05A 2IQIA 5AKHA 3C6ZA 4I1UA 4MYCA 4KOEC 3W9BA 1UEXC 2B4RO 2UZ1B 4XAQA 4V3CA 3BIWA 4CG1A 3JPQA 2WWIA 3EZGA 3QBJA 4G0ZA 2E1RA 3KVRA 2WAQF 4RQUA 1L2TA 2FPGA 4B8WA 4NICA 3GGJA 4HB3A 2YNMC 3H6KA 4J9QA 3WL5A 5KFZA 1DFIA 3H40A 3WMEA 8ATCA 1FP7A 2GFIA 4OHRA 4PGMA 3R4VA 2JKVA 1KH3A 3T7EA 3RJKA 1FRZA 1GZVA 2PH5A 4EPXA 2QT9A 1BRMA 3ROQA 3ONNA 4E11A 5GPBA 1L5OA 3LM8A 1E6EA 3DW1X 3OFNA 1TZCA 1I2MA 3E58A 3M4NA 1RIIA 1OH7A 2AHRA 2FSHA 3I9MA 4LFCB 3VDQA 5DLFA 4C1NA 4QM7A 1XO1A 3ESCA 3OFSA 2NSLA 2PDAA 2AQKA 1IPHA 3R24A 4YROA 3A6HA 5EHIA 5BUCA 1XTZA 1BD4A 1TE2A 2C5GA 5KOHA 3PL5A 1PK8A 1Z1BA 2XUZA 2CV0A 3P4YA 3CCCA 1HJPA 1NV9A 4TUPA 3EVBA 5KJ1A 3E9DA 2QTAA 1IXRC 3TANA 2ZIUB 1Q2UA 1T6YA 2FMSA 4GMHA 3X44A 4B79A 5ALXA 4GXTA 5FKJA 2YY6A 1I1QB 4K2AA 3NRWA 4WBSA 3X1YA 3QBDA 5BMVA 2ORYA 1RAFA 5B58T 3PLNA 1I9GA 4XFKA 1KAEA 1GQYA 2MMCA 1J5EB 3NBKA 8ICKA 2FOLA 3UA3A 1XEWX 3JAKA 3AUOA 2RK6A 3WWYA 3GHYA 3M70A 5FRDA 1G7TA 2ZE8A 3AKYA 1MAWA 2YCLA 3C43A 1KI6B 5F4BA 1E99A 3KR9A 2J0UA 2O2CA 4DC0A 4EF5A 9LDBA 1Q1NA 1KY4A 2RHOA 4LHVA 3E81A 2F7SA 1U9IA 2R4QA 3TD6A 1Y81A 1G8SA 2WIJA 3N1UA 2A0XA 3PUKA 4K9LA 4ARZA 4EH1A 1U0EA 3EIXA 2Q1XA 3I04M 4PLTA 4YMHA 4MV6A 1UDXA 2IVZA 3L5KA 4AUEA 1SXGA 4D81A 4ZMRA 5E38A 4ECAA 3BJRA 4S1PA 2ZVQX 5FD8A 5J23A 5AVQA 3KOMA 2IDZA 4BNKA 3B8HA 3EVFA 5HBRA 1KPGA 3F3MA 2PCJA 5T4HA 1IN6A 2XXAA 4TXNA 1BWRA 1U98A 3G3EA 4MHSA 4RD3A 4XE5A 1G16A 3RBZA 5LQRA 3E48A 1N36B 3NWOA 4LYEA 1WW2A 2F62A 3D4NA 2AEEA 3HGTA 3X1JA 4WWHA 3K7EA 3TE7A 5C37A 1KDPA 4E08A 2FG7C 1ISHA 2CEAA 2IU3A 3RABA 4YV2A 5LPNA 3HFRA 1SHTX 3RTEA 1KJQA 4W5NA 2JGNA 3RBXA 1PG5A 1EFUA 1NVMB 2VSXA 3N8NA 3PQEA 4RPKA 3H1FA 3EPKA 3AINA 3GROA 5I4CA 3OD5A 4FEYA 4F3OA 2XGJA 5T64A 1B0ZA 2O3RA 1GM5A 1UPUA 2PWYA 1HE8B 4HH4A 3V7JA 2ZCUA 4U2KA 5AKYA 3B5IA 2ZBEA 5DBFA 1SOWA 1DJLA 1JHYA 3CV3A 3K0AA 5DI3A 3SE0A 1P0QA 3VM6A 1K7SN 3MR6A 5LXTB 2C2YA 3ZJVA 2C2ZA 2X1VA 3ICQB 4P4MA 1U80A 4XSHA 1A8SA 2VF4X 3GUVA 4KIWA 2LKYA 3TAUA 4B5LA 4D02A 2JFNA 1WXHA 2EKZA 3G1TA 4KGDA 3RAXA 4J2HA 4KLAA 5D00A 5F2OA 1U2EA 3VU8A 2VA9A 3ILHA 2ZVDA 5BUZA 3CJTA 2H4YA 1T6BY 5LQAA 4FDTA 4QAQA 3SYZA 4XKJA 4P38A 4J1TC 2VT6A 1B1AA 3BUSA 1CY2A 4P84A 3AF5A 3TOCA 1G5FA 1LFDB 2W6PA 2ZAIA 5JRZA 4E7PA 1E3TA 4G0UA 2Z1DA 1UDRA 1XTVA 2GM9A 3DLPX 4L73A 1YZFA 5FWXB 3HL4A 4AMGA 1R37A 1B23P 1OZGA 4PZEA 4Q01A 4K8OA 4BEJA 4QTYA 1MMFB 1MDBA 2ECFA 3QZ8A 1QHEA 3E2IA 3P9RA 3HBNA 4M87A 5C5EA 3M8RA 4CM3A 4GECA 2EDCA 2H92A 3GD7A 3O8LA 5KMGB 2A9OA 3RTBA 4P4OA 1YUNA 3MWEA 1ZJ4A 4LDRA 1YHNA 1TT7A 4F12A 3R3UA 4I6EA 3TMKA 1PS0A 2CFRA 4ZCLA 2HRBA 5DZSA 1VHLA 3WLOA 4IX1A 4PGXA 1IHXA 3I0ZA 3BWEA 4ZXFA 4INPA 5BSUA 2GKGA 4Q3CA 1HK7A 2HNBA 5AJYA 4IWNA 2AJ8A 3MBOA 4DJTA 1NLUA 1RYRA 1PSDA 1ORIA 1EX9A 4B3HA 1JBEA 5JD3A 4NMLA 2E48A 4GOLD 3DEAA 4E2ZA 5LP1A 4XUEA 5ESWA 3NV9A 4JBLA 1LY1A 3BHNA 1N6RA 4NLLA 3SX0A 4LYDA 3LBFA 4HNUA 1CZUA 2Y77A 2C7VA 3FUCA 3EUB2 2W9CB 2B94A 5A06A 2YMPA 2QRVB 2UZIR 1RQGA 4HX2A 3SK0A 1EDDA 1TA4A 1J09A 1MGPA 1ZOLA 4KMSA 5CM2Z 5GTHU 1BHSA 4YALA 1ZM9A 2VP5A 2BT4A 2C78A 2PNFA 2WDZA 1E7QA 5L3VA 1T3GA 4K9OA 1QSYA 3X1XA 2FZKA 1WMFA 2VANA 4UU7A 1BHO1 3C4VA 3PTAA 1T34A 1SUSA 4JUCA 4Q03A 4IC9A 2X7HA 3MRXA 4QFBA 4Y9DA 4CR8A 1XG5A 3ELDA 4RJ2A 3NEYA 3G02A 4JKYA 1UXOA 2F43A 2OWEA 2Z09A 3F7TA 2K7FA 3NKLA 1O57A 1XXHE 4W1SA 2WVJA 1BXRA 2HA4A 3OZVA 5G1OA 1UC5B 1ODKA 3HDGA 3QVXA 3LBHA 2H7XA 2VDLB 3K8ZA 3L5OA 2CXXA 3QNWA 5ECDA 1D1TA 3F98A 5IAJA 3WIBA 3KETA 2ODGA 2NU6B 5K3OA 2Y27A 3R3VA 4M1ZA 2GVDC 2DQZA 4O6VA 5IJ0A 4MLZA 1W2WB 5J8YA 3TZHA 3V4LA 3LUAA 3GLSA 3ND8A 5HBGA 3GO4A 2KZMA 1OIWA 3K53A 2GI4A 1DSSG 4C0WA 4W5RA 4Q93A 2YJNA 2D3TA 3OPYB 4Q4AA 1FW8A 1S01A 2WWFA 2ZTLA 3NTVA 5DHPA 3KCNA 4CF7A 2LM1A 4HGNA 4BLSA 5D51S 1X92A 5T14A 1G98A 2YH2A 4DCCA 3DL7A 3QX9A 3VKFA 5GWXA 4OU4A 5A9SA 5C7OO 5I9BA 3H8VA 1B0XA 3H11A 3P5SA 4M53A 1QE0A 2PQ0A 1WSDA 2N1BA 4X84A 1Q2XA 4MI3A 3CRVA 1WCWA 3HYTA 4F4XA 1G19A 4WBXC 2OHHA 4WINA 5DM2A 3WL7A 4B3CA 1J0CA 1R0KA 3EGWA 4EYEA 5AVZA 3NKVA 1WRBA 3DZGA 4JN6B 4RM2A 4WCFA 3IEUA 4GR9A 3VO1A 2DFKB 2OVBA 1EFPA 3ND6A 3A11A 3PFNA 4W5WA 4XEHA 4BO2A 2G80A 1QU2A 4K5QA 1ADCA 1O2DA 1K6XA 3SJBA 2C77A 3DDUA 2BCEA 3KXIA 1JAIA 4D0NA 5HQ3A 2W6MA 2BHRA 4TM7A 5BSHA 8LDHA 2JJ2D 1FMLA 1WLYA 2PA3A 2QQ5A 4OGGA 4R40A 6NULA 2V9CA 2C31A 1V96A 4LVUA 3VR3D 1LDNA 4L51A 3AR5A 4CRWB 3LV8A 1MIOA 2M9NA 4FFMA 2YYYA 4XIYA 2WTUA 2V7TA 5EYPA 2VQFB 5J5AA 5JY1A 1WD7A 2X5XA 4MJXA 5DM0A 3FDIA 4D8UA 1SCAA 3K70C 1CJSA 4L7QA 5F5NA 4DQDA 1ILEA 2W48A 3HM9A 4F93B 4DQUA 1N61A 4J16A 3N7SC 1XD8A 4H6WA 4A1OA 3PUXA 3PSHA 1JDBB 3B1ZA 2QOEA 1DKMA 1GLVA 1SC3A 3L2OB 1W87A 2P41A 4E5VA 3FBTA 1EP2B 1MX1A 3PIIA 5CVJA 5CLFA 3K1TA 4MWSA 4Z7JA 2H2HA 2DGZA 4QJIA 1JYSA 8ICOA 3VSEA 2OORA 1ZBDA 3FRJA 4YK7A 1ZQ1C 1TYCA 1ZO8A 5DYGA 5FA6A 3N2YA 4RDIA 5KAMA 3VNQA 2DPYA 3BTOA 4D9EA 3TIFA 3IHTA 4B1FA 4JI4B 3PDWA 1S0OA 2B1JA 4WUVA 2XICA 4P5DA 1XCLA 2R7MA 4Q7QA 3N0RA 1V6AA 1WOYA 3L06A 4Q4LA 4S12A 4DV5B 1SEVA 2PYIA 1SCNE 3AIMA 3LC2O 2FW9A 4QHSA 4FOPA 2W7TA 1IHUA 3L6RA 5BY2A 3UWOA 1F9AA 2WPNA 1NC3A 1U04A 3O0DA 5FHRA 4NBLA 4QLAA 2IOFK 5TQ2A 4BB0A 1FP6A 2DY0A 3EMDA 3I61A 1T0BA 2H52A 2BPOA 4KWIA 5GONF 4R2KA 4HVLA 5JZ9A 4JBGA 4XLLA 4OG2A 1MFPA 2Q50A 3GGCA 1YZTA 1A8IA 2OM6A 3RJGA 1HG0A 2VLIA 3BWVA 1F1JA 5HM8A 1SOVA 5DM70 1RI1A 2FQWA 4YNBA 4BQPA 4KNYA 1FE8A 3R6TA 3JPYA 2RH5A 2BN4A 5KQSA 4JLKA 2UUOA 3IOBA 3VVCA 1HFJA 4FLFA 2HHSA 1C2YA 2RCNA 2MR6A 3JYLA 1M73E 3MMPA 4RKQA 5CT6A 4ZHQB 1ZHOA 1IUOA 1IFXA 4GEGA 2Q8NA 2B5VA 4TN5A 5DBBA 2IW3A 4DZTA 1FMTA 3DMYA 4JA0A 4YCXA 4A2WA 1P2UA 2E5WA 3L7DA 2PFSA 5KFLA 4XVRA 4AJJA 4URVR 1IN5A 3M49A 4ZQFA 4EX6A 1NBOA 2LYAA 3DDHA 2C57A 4E1AA 2NO9A 2AJBA 1UAGA 1Z3IX 4ALNA 4AMBA 3EVDA 1PD1A 4LE0A 3MFIA 4NNOA 1UJBA 2BFDA 2AW5A 4QUHA 4F6RB 2RQ5A 3EF1A 5BQXA 4DSKA 1O87A 1XD2B 4LGCA 2AGQA 4Q7JB 4QDXA 4YAFA 2Z83A 4EARA 5L3QA 3FWYA 1ZAKA 4PIVA 3HEBA 4CTOA 1H4QA 2EQAA 3OSPA 1RRFA 3GJZA 3B7WA 3N2EA 2WNIA 3NVDA 1GCUA 1HA3A 4HNSA 3JQBC 4BVHA 3TQOA 3LRTA 3K09A 2QEQA 4OJQA 5J58A 2C7OA 1ZCJA 2W8BA 2X13A 3CRRA 3E7FA 3OOJA 2O3TA 3BHJA 4QQFA 1NVWQ 3CNHA 4HB2A 1U99A 4NYJQ 1F1BA 4QPZA 3KQMA 4DA8A 2W03A 3KQQA 4D74A 2OHGA 5FF9A 4TKVA 4BO3A 2LDBA 1W581 1PQWA 2G25A 3DVLA 4RDHA 1K5OA 4R83A 3SEFA 2FLVA 2ZBFA 1QTIA 2CUZA 2D13A 2UZ3A 1Q0QA 2R8JA 2JGDA 2R25B 4NBWA 4ZOAA 2ZYSA 4WPGA 2LCQA 1XL1A 2W0MA 4FEGA 4MWBA 4CFYA 4PSVA 4TV8B 4UTZA 3BCUA 2ZPAA 1XZQA 2O4CA 3AHHA 2EFYA 2X7XA 3FGNA 2QK4A 4M86A 1FVXA 4KN5A 4MGZR 4TTQA 1P0MA 3T6KA 2J9FA 1XQXA 1P72A 4OYLA 2CXTA 4F1JA 5J2DA 1XL0A 1XLTC 2VHUA 3NBFA 4B7AA 4R0MA 3TLZA 4MDYA 3OUUA 4BYMA 2KZ3A 2DHEA 3E0XA 3IIMA 2Q2OA 2H0QA 4U4AA 3IKLA 3L1UA 3AVOA 2F1JA 3MAJA 3DV0B 3BJZA 1NQXA 4HDQB 5TZVA 5I7HA 2NU6A 4DTCA 3TEFA 3TEMA 4CG0A 5K8UA 1VBKA 3CIOA 3LZCA 3I9NA 4R8LA 1UMKA 1E0KA 4PLGA 2VZLA 3K9NA 4N3CA 2HHLA 3L0YA 2W70A 1KP3A 3SEIA 3C4QA 3S27A 3W5SA 4EECA 2WB1C 3N2IA 2ZJOA 4NOLA 1Y1KE 3G8CA 1ZWKA 3IKTA 3EB9A 4O4IA 1RXWA 3Q9NA 1LD3A 1NUAA 4YP9A 1N6LA 4S35A 3WMXA 4MRAA 4ROTA 1G21A 3VPDA 1LWOA 2P8JA 4ZI7F 2WJAA 3R0QA 1N6OA 3ETLA 3ZOZA 3ZWNA 4JKIA 4F86A 3I5XA 1EQUA 1SVOA 4J9UE 2AN1A 1XAIA 4F4DA 1P2DA 4KFCA 4GVXA 3UAYA 1D09A 3B5EA 4IUDS 4HX5A 3WGMA 1UHUA 3ADOA 1J4AA 2XOXA 2PKQO 3P9NA 4BJ1A 5IMBA 2NZJA 1FDWA 3B9QA 3B52X 2QYHA 3GJXC 3RS2A 1CF9A 3AR3A 2L2QA 5FUWA 4WZBB 4L5CA 3GB9A 4QA9A 5DGCA 5AVXA 4OHCA 3FETA 5AW4A 5DJ5A 3AU9A 5CVCA 5LQMA 1VKOA 2GT1A 3H3JA 4XWGA 1F9EA 1PUXA 3GLVA 3H4MA 3WK6A 4LXUA 1DX6A 1W36D 4DSAA 2EYQA 4OJPA 4DMUB 4MHOA 1PQYA 1GU0A 1QQ6A 2R751 2NWQA 1CUWA 1U2QA 5EIOA 7ABPA 4WEQA 4LRSB 2A1TS 1YV9A 4YG2A 1COKA 1P6UA 5J4HA 2XNSA 4PTYA 5IP5A 1RM4A 3L7YA 3M4ZA 2HM7A 2CNDA 5IIIA 1EDZA 2A92A 1XSLA 3H1EA 4BKQA 4ZYTA 1DXOA 2QI9F 1G20B 1EDBA 2DH6A 3KU1A 4X93A 4F3KA 4LXYA 2AMYA 3EG9B 3IAEA 3KZKA 3PNBA 4CLEA 3E7XA 1YMQA 4OY3A 3N59A 3PNCA 1WDKA 3ID6C 1H1LB 1YZKA 1Q3KA 4WZ6A 3QU4A 1X1EA 1ZOOA 3EG9A 4ZVKA 3HLYA 5ALTA 4BN0A 2Y1XA 1SXJC 3CB4A 3OCCA 1BQ4A 4K88A 4KRFA 1MORA 3V6HA 3A4NA 3C98A 6LDHA 4YRFA 5K3EA 2C3PA 2NSHA 2QAGA 1COZA 4D4MA 2XBUA 2ON6A 3D0KA 4DCTA 2EX4A 3L7NA 4TVSA 1Z82A 3HY4A 4B33A 4ARIA 4JYZA 1B1CA 3K2IA 1QMGA 1KVQA 1K8RA 4I50A 4RTRA 4HY3A 3V4RA 1Q1BA 4PHAA 1M10A 2ZWIA 1N6IA 5GM2A 4AO8A 1I2CA 4EVSA 5BRJA 1QRAA 1OUMA 1Z0DA 1RQLA 3UWDA 4Q00A 5AW2A 3I52A 4W5JA 1W85A 2PKXA 4F4YA 4I1IA 1U90A 3LCMA 4ALLA 5C8VA 8ICEA 4OATA 1N62A 2JAPA 2FSVC 1VZ3A 1A9QA 4ZEVA 2B0JA 3QI7A 5BPHA 3RFAA 3AVYA 3QWFA 3KHUA 1PKXA 5HQTA 1D0IA 5AM0A 2Z95A 2PLWA 3RR2A 4O0IA 1FFXA 3FCAA 3W7VA 4F2WA 3I62A 3C5HA 2CXYA 4HUQA 5HF6A 4BFXA 4K6FA 4KVZA 3T12A 3Q3GE 1LX6A 3UTCA 3H16A 1R5OA 4MKHA 4BNVA 4WLFA 1CY0A 2A1JA 3AFHA 1OBVA 3R0IA 4YASA 5I9IA 2B21A 4B9MA 1L5YA 1W5BA 2HSEA 2NXNA 4EVRA 1U28C 3ELWA 3QUAA 2ACEA 4LY3A 5E1DA 1KDRA 1CQZA 3T3DA 5IDQA 3HRKA 4DL6A 4FFBB 4TLDA 2MWMA 2QMHA 5LMCA 1P4SA 1V11B 4KLLA 4KQJA 1E1YA 4RLFA 2QR5A 2EFJA 3EDMA 2H2AA 3DB2A 1MV8A 5T8KA 2C8JA 1WXDA 2VJMB 5LA6A 1T13A 4IIVA 5LDGA 2GD2A 4PH5A 1EG7A 4IVNA 4HYQA 4CLDA 4XUSA 3HCBA 3K8QA 4RGYA 3BS7A 4YD2A 3C3AA 3KHSA 4Q6WA 4R3NA 4X1IB 1Y7LA 1ONPA 4TVKA 5BOMA 4ETNA 4HB4A 2GOYA 1XV5A 1RRKA 1JHRA 1RWVA 5BR7A 1LB2B 3AJ9A 1JJVA 4ECTA 1CRXA 1FDRA 1N0HA 3B3AA 3W2TA 2E89A 5KVQA 4BWYA 1VIVA 1SB9A 4LHYA 4ZV4A 2IC5A 3ER9A 2PVSA 1QH1A 2Q07A 1AGNA 3B5JA 3D3EA 3P0IA 4L7VA 4OO3A 4UEKA 4C3VA 1UZLA 2O2HA 4H59A 5BOLA 4J91A 2AVDA 4DUPA 2ZSEA 5AW7A 1C7ZA 4B9NA 4TTIA 1LBIA 2AR7A 5BSTA 1R64A 2H06A 4TMXA 6ADHA 5AXDA 2KVSA 2GBIA 4NH4A 3COPA 3JASA 2ENUA 2KW5A 3B1KA 3LY7A 3PR1A 4L8GA 4UB1A 5CA0F 1KMNA 3A2MA 3QKSA 1CDZA 4JBNA 7ICPA 2J3EA 5THXA 3DLBA 2DPHA 3A6LA 5K0CA 2WIBA 1T9AA 1YZ3A 2Y92A 4Y1FA 2D1QA 1QCZA 1QJCA 1T9ZA 1W5FA 1IIPA 1HDCA 3GT4A 4FZVA 1AKQA 3FDZA 5LZ2A 1A7JA 3NOQA 3FZQA 1SUEA 3CEAA 3T1NA 1ODFA 2Q4RA 1C41A 2BMVA 4GYJA 2JLCA 3PMLA 3X0DA 2C4VA 1E7WA 4PGQA 2GB4A 2HRQA 2WC1A 3Q5GA 4FWIB 4IH4A 3QMMA 4N3NA 1JFLA 1XVAA 3ZH9B 3LQYA 5KUTA 2XITA 1KJNA 4A0RA 4RQ1A 3ZCQA 1Q3UA 5CG1A 1KJ8A 3K6RA 2RAUA 4AP6A 2XSZA 2M6RA 2BBWA 4UMDA 4B3TB 1MB9A 4F4ZA 1AS3A 1OCEA 3HDYA 3P2JA 5A2QA 2IV2X 4JA2A 2CXNA 5A4IS 3TLKA 5IYZB 1SC4A 3M4XA 4W99A 3O3NB 3NEAA 4LVSA 2WUDA 3C3YA 3R76A 1IQRA 1Z4LA 4F8EA 5EJMA 3TADC 2AA3A 2ZJBA 2CFSA 4MRRA 3E7DA 3NHKA 5KYUB 3BE4A 1GCIA 5EJ5A 4RK4A 2C20A 3OKAA 3UPQA 5EPEA 4AICA 4QE3A 1YJ5A 3CVYA 5G0SA 1EGHA 1ZISA 3RUDA 3AJRA 4TMVA 2GXQA 5AUQA 1O8BA 4DSOA 1CT9A 4M0MA 4NCBA 4PLCA 1O96B 1W46A 3EIEA 3O93A 5JPCA 1PNVA 3CR8A 4RFSA 3L6EA 3ZGYA 4XQ8A 5I7FA 4LF7B 5CBPA 1MHPA 2DWPA 5K01A 2GPSA 5KYTA 4MFAA 3PXCX 3AY0A 1SZPA 3IVRA 3KTFA 3VNSA 2ZK7A 2RHTA 2YOHA 4O3OA 5CYFA 5C46F 4Q66C 1V9CA 3C3PA 1P1CA 3CJQA 3BB3A 1O89A 3KOXA 3S1AA 2P9JA 5CLHA 1PT7A 5ARBA 1N4AA 4KZKA 4R16A 4KPYA 2HEIA 3STXA 5EJ6A 2XGSA 4GOOD 3D6FA 5MN5A 1C7EA 2QP9X 3UAVA 1USUA 1NXQA 1PFGA 1US8B 3MTDA 5EIWA 2M0NA 1WJGA 4ZCQA 1YDFA 4QGAA 4CKYA 3G2MA 3OLWA 2D6FA 3WWEA 2ZUFA 2RMKA 3ICPA 3W5IA 2QXUA 1ZD3A 4XD7D 1Z37A 1PCXA 2PXHA 4RELA 4NNPA 1GAQA 1ML4A 3PVCA 4IVRA 3ZCSA 3CZ9A 4OM8A 4D4KA 4M60A 3LCCA 5EJAA 3IV9A 4NR0A 3UKOA 4F9GA 1R6BX 4G4JA 4HN9A 2VHZA 1B0UA 2IYPA 3RPEA 7ICJA 1QBGA 5CP2A 2B5WA 4FDLA 1N56A 1C9EA 1ZR2A 1M2JA 3ZDRA 1JQ3A 3OSUA 3FF1A 3Q0IA 4YN3A 4EGJA 3QVSA 3NTQA 5G0VA 2RHBA 2BFOA 3T9FA 1L7MA 3VDXA 1BDMA 2QPLA 2WG2A 1MB4A 3QQPA 3ITDA 3TLCA 3VR6A 4LHXA 4RH1A 4JJ6A 2NZWA 5J63A 1ZNZA 1E3SA 3LQQA 2I55A 5L9AA 1SA0A 3K9QO 3OT1B 5JHGB 1L7NA 4O9MA 4FW8A 2VJDA 2DLCX 5KNDH 1JILA 1NURA 1Q84A 4UDXX 4YV7A 4WL0A 4L4YA 4TWZA 1DUVG 2DC1A 2FRXA 3G2NA 4IG4A 1KDVA 5K1ZA 1NK8A 1PL6A 1NJXA 4JI5B 2Q3HA 3LWZA 4G3XA 5DF1A 5E0KB 3PQ2A 5DWDA 2AJQA 2ZBPA 4BNWA 1DFHA 4DUYB 1AU9A 3HXLA 1B3RA 4MIKA 3WJ7A 2NV3A 1TCCA 4UUQA 1GTMA 2OCDA 4DJAA 1PJLA 2D06A 5JALA 4ZOBA 4A1FA 4Y2QA 1QGUA 1RM0A 2CJWB 2GBLC 1QV9A 2IODA 2BR0A 1UBSB 3CUKA 3DSRA 4I1SA 1QJ4A 4FHCA 4AZ3B 4DQLA 4GL2A 3FYHA 4QYTA 4REOA 1NW9B 1GR1A 3G89A 5FLYA 3HADA 4HWPA 1BX0A 2FB9A 2RKOA 5EKDA 1NP3A 4KLCA 5AI9A 1MOSA 1VP3A 3EJ6A 3JQPA 4P3YA 3U7IA 1UADA 2VO1A 3H4VA 4M8LA 1MQ2A 1TEXA 3WZLA 4LMPA 3EBOA 1DC8A 2IXFA 2X0KA 2V55B 3QXJA 3WOVA 4AJOA 4Q7KA 1NZJA 2UVPB 1BHQ1 4YPOA 1EA7A 3CLKA 1D2AA 1RIFA 4A8EA 4ZHSA 1AE1A 2JLUA 2MYPA 2CMHA 1AGXA 2F67A 1VG8A 1LK5A 1Y4UA 3D7RA 1AQUA 4WACA 3HACA 1SHUX 3EQ2A 3F5EA 3ORRA 3L4JA 1XMQB 4NBUA 1QV7A 1Z39A 4BZWA 3FY4A 3NALA 4QZGA 3FMPB 3GNLA 4F71A 3A9UA 5KINB 1UINA 5JJKA 4B9AA 4Q3AA 3EN0A 5CR0A 4IRXA 1J8VA 3TVYA 1QVVA 4MF8A 1AGRA 1ZMOA 1T8TA 3JATA 5IXJA 2IS1A 3OQIB 3WRXC 3U81A 4HEHA 4KE8A 4CQNA 3H9JA 3N87A 1SCUB 2VHJA 3VNVA 4N01A 1SU4A 4GKVA 1KZHA 1YNSA 4EK9A 3GEIA 3AEQA 4TRJA 3IMCA 3THWA 2QZSA 1T5SA 2VDWB 3HH8A 4U3JA 3U44B 3BWCA 1NJFA 3O8OA 4MWOA 4MUNA 4KXUA 2PV7A 3R74A 3T99A 2CJPA 4IXWA 4FUQA 5HNKA 2W55A 3TQ1A 2HUPA 3FPCA 4BAUA 3CKYA 2WA2A 1HDZA 4DMFA 4AQYB 3T5BA 4G63A 3CBGA 2FCRA 3HU3A 3AL2A 2BEWA 1E1CB 2HU7A 2QIPA 2Z4RA 3A8TA 4O5KA 5E6UB 4C0JA 1P81A 4EFLA 5AUOB 3K1ZA 3TKLA 2JHDA 5AK5A 1VJGA 2NTJA 2QW8A 3T3FA 2ISSD 2OZVA 4Q43A 3C6YA 3HYRA 3EGXA 5KYWA 3D3NA 6CHYA 3PJGA 2DF4B 3PW5A 4LF4B 3EZFA 2YVUA 3UQYS 1T8SA 2CHGA 5FI5A 5EUQB 5DNYB 1NVBA 4HTFB 1NNUA 2CCGA 3TJZA 4RIGA 3ISBA 3V2UA 3NGMA 4UHKA 3A28A 1JMYA 1BH6A 2AI2A 2XKAA 3THYA 3L1VA 1JFTA 1U7WA 2Z1MA 4HSGA 4QTXA 4ENQA 1ZP6A 3PO4A 3MERA 4RS4A 4U0KA 3HXQA 5K3CA 4HLQB 1NDHA 1X7ZA 4LWOA 2WSYB 8ICMA 1ZGAA 4M99A 3TVTA 5KNCD 3TFOA 4CNQA 4ZPJA 4KX3A 1W25A 4I3HA 5AR1A 4RVCA 1W9MA 5FTWA 2IMWP 1XPRA 5DTMA 4MUAA 1BHJA 2ZTHA 1WDTA 4I9NA 4D6YA 2FFRA 1D0SA 1M6WA 1S8NA 1YL5A 2C1XA 4N9QA 4PG6A 4X60A 2HH9A 3JD4A 3QPWA 4YQFA 4D3FA 5A9SB 4XX0B 1GDDA 1RKQA 1CDOA 3VKUA 1KZ4A 1EWQA 2WM2A 1KI6A 1BWPA 2PFNA 1OJ7A 2B20A 1I30A 4QSHA 1PN3A 3TGLA 2WE7A 3WL6A 1MF7A 3GOQA 3VSAA 1J97A 3BPSA 1PX0A 4LJSA 2BEJA 2XCSB 3FMVA 2AI3A 3PFBA 1CUAA 1K1SA 2PX0A 4P54A 1B2RA 1XHFA 4DMMA 1VRCA 2P79A 4LXQA 5CBKA 1RQ7A 4QO7A 1ECJA 3HA2A 3OMWA 1X8XA 3PXBA 5D87A 2ZJ5A 3QMVA 4KK3A 5T41A 2BFEA 4BLRA 4F3CA 1GGJA 4PIMA 1T43A 2PKRA 2V5AA 1RKUA 4IGIA 2DQYA 3OLVA 4GLJA 4RD0A 2HOQA 3U17A 5B64A 3WBBA 4YR7A 4ALJA 3IV6A 3S81A 5LP6A 3IUSA 2NXEA 4QOFA 1AN0A 2JVKA 1TEZA 1JIKA 3T4UA 4M0AA 3RVPA 3NWEA 2ATVA 5MGBA 3MN1A 2KP7A 4FR2A 1YBFA 2Q6IA 3Q8PB 2Z4SA 2J9GA 1N34B 2VF5X 5KFHA 5L4NA 1ORVA 2BFNA 2WOOA 3KSRA 3EZYA 1XYVA 1JFRA 2IYRA 5FWYB 5HUHA 5CDFA 2ZSDA 4IMPA 5AJXA 4U7PB 7ICSA 2DBVO 7MDHA 1Y8QB 3WLHA 2D3DA 2EBFX 3OA2A 1TKDA 3HJUA 1SG0A 3PC2A 5DYWA 1E9RA 2IUSA 2X0JA 3ZKAA 1G59A 1DG3A 4ND2A 2FPGB 3QIAA 1V3UA 2AZMA 2Q3JA 4HO1X 3T8YA 4KFTA 5LMNB 2OAP1 3M5CA 4CIDA 4GZMA 2AGVA 2AK2A 3CRW1 1H0SA 2CVHA 1R7RA 2Q46A 1PW7A 3GBVA 3IS3A 2RIRA 2Z9BA 3B6KA 4C7ZA 3HM2A 4JQYA 2X5NA 4QNRA 3B51X 2KKPA 3HZHA 4JQSA 4K6HA 1I13A 2FFHA 3OG9A 5ILOA 4ODIA 1ITZA 1V5EA 4AYBF 3LQRA 3JQ7B 4F5QA 2QYTA 1A0OA 1Z13A 2HFKA 3OOHA 4KBYA 4EG5A 3ZHZA 3BMQB 2HF2A 1P45A 2QN8A 3F5QA 2BM1A 4HX9A 4MP6A 1GRCA 4XQ0A 4DHWA 1A1VA 2OAGA 4BUCA 2R8YA 3ZQKA 1BKSB 4ELTA 1P2FA 2Z5GA 1O1YA 1AUVA 2O1XA 5H3CA 4M49A 4LFAB 4NU6A 5EGSA 5SZKB 3RRZA 4BNYA 4DCUA 4QTZA 1IN8A 5IAAA 4IDQA 1L1EA 3F2BA 5C1IA 2QW0X 4KACA 2VDMB 3HT3A 2KFNA 4NAHA 3LKVA 1P18A 3IPXA 3EQ6A 5DIFA 5EZSA 4QBIA 4KO4S 3ZUGA 4YCNA 5E9JA 5T8KC 3QTBA 1E6LA 2VXCA 1DX9A 5FQNA 1ZGGA 4WVFA 2IGBA 1PVDA 2IHUA 3NBZC 1PHRA 1PNOA 4V0RA 3SZRA 4RGQA 3NS7A 2AN3A 2CHUA 4WEOA 4D79A 4PAOA 1MSWD 1HE3A 4CCSA 4M9JA 1CUIA 1ORTA 2AX3A 2P8SA 4BX2A 2HL6A 2BE7A 2AJLI 3H6HA 2E5SA 2D74A 4FGUA 4L50A 5A1JA 3SVTA 2ZIAA 4NJ8A 4OBWA 4K9QA 1KW4A 1PJ3A 2QM8A 3BC1A 2GEFA 5I9LA 3VRHA 2FZCA 4UJ3A 4DL4A 1UBUS 1G6KA 1B2LA 1WVIA 5FBRB 5TS3A 3VI4B 2W6CX 4LNHA 4ENRA 1N63A 4A6XA 1PU2A 2ODBA 3FNQA 2RCYA 1GQ2A 1QR2A 1U3CA 2F3UA 4QIHA 2A0WA 1KOLA 4AB1A 3CNEA 5IVPA 5JZBA 3IE1A 4F2SA 1VYVA 2GA9A 5E4JA 4KGVA 2JHPA 1YKSA 2WKWA 4EHNA 4D9CA 4UTVA 2AW3A 1EM6A 1NW5A 3FKQA 4G67A 3A0RB 4ZO8A 4UEWA 4E0DA 1L4UA 1THMA 1TLTA 5FAKA 2EOAA 3HI4A 5KTPA 2OBFA 1NPYA 3ANLA 1AX9A 3L0OA 5DN6A 3RSSA 1E58A 3KEGA 3G59A 3CH5A 5ENDA 3O94A 1H2ZA 2IZ5A 3C6MA 3WYAA 1Q46A 3C87A 3SF0A 2Z9CA 3RT1A 3SJAA 4TLAA 1Z4QA 1EIZA 2ERYA 3O8OB 2PQ6A 4JDPA 2PJUA 1H23A 2VOJA 3TOVA 4LJ5A 1GL3A 2PD6A 1PZHA 1WPGA 2VBGA 2Y93A 1S2NA 2B98A 5FUXA 5IUKC 3PPWA 4P81A 4ETWA 5LIPA 4BIMA 2R6HA 5JNTA 1UOPA 5E1BA 3B12A 4MGHA 4DY6A 3DZFA 1C3XA 1YDGA 2IIQA 1GVHA 1DEXA 2XUOA 3C8MA 4PU0A 3U7JA 3WY9A 2M98A 3MCVA 2BDEA 4YDQA 1DKQA 3F4LA 1MUUA 4BWMA 1MJHA 1XR3A 2FJPA 4Y2TA 1JHOA 2VZ9A 3PYMA 4FHEA 5HZMA 3M9MB 1SBYA 3GDFA 2WNHA 1PZGA 3QW4B 4DV2B 2NU8B 5ALUA 1J8DA 1DPGA 3SAJA 3WGGA 1UJNA 5AFSA 5ICGA 2XZOA 3M34A 4D9FA 4C3UA 5B58C 5I7VA 5JUWA 3BIFA 2YXDA 3CLSC 2GJ8A 2GVZC 2H7VA 2ODAA 2VHXA 2W83A 1YR9A 3KKPA 4R2MA 2IL1A 1X7GA 1O4VA 4Q3OA 2A67A 1VHQA 2R8ZA 5H9WA 5SYNA 5K0TA 1KDOA 3EPJA 2OUKA 4EBBA 5TPZD 3ROTA 4XYLA 1TEHA 2GPTA 3A3NA 3DFFA 2DJ5A 3TK1A 3LT0A 3V8QA 1U6JA 3ZJUA 2O8CA 5DULA 1KTIA 6Q21A 4KE7A 4W1QA 4RK0A 4U2FA 2JZBA 2OWOA 1ISRA 3B48A 1RHKA 1W1UA 1XZJA 1XROA 2V1XA 1KU0A 4U7JA 3PD7A 4EJSB 3NO4A 1Z6QA 3PW7A 1EX6A 4EHDA 3CF6R 3OCXA 4R6XA 3JR3A 3PRYA 4QL3A 3MT8A 1S1CA 2H17A 4H6PA 2LBOA 2HF7A 2P7IA 1MO4A 3EYWA 1RAEA 3L4PA 2IHJA 2WU3A 1CUSA 2OQ2A 3T3HA 4LBYA 3THSA 4B2LA 4IUCS 4JGIA 4EQ6A 3FNHA 1M6EX 3TZLA 2ZQYA 3NXKA 3ZWMA 1SUIA 2FN4A 1IM8A 2QWXA 4IBOA 1I32A 4NATA 3TXAA 4CT4B 4JWNA 2XNDA 3O8QB 2GYUA 2G40A 1JTFA 3U48A 3B53X 2HDNB 3SR6A 3LF2A 3U3DA 4V03A 1EIWA 4KSYA 3RH0A 1II8B 1AZTA 4C2UA 4JXZA 1SVNA 1DC7A 4LDQA 4MW9A 2VHVA 3ZHSA 9ICGA 4U7CA 5JUMA 3WA6A 1B15A 5J2JA 3OIWA 4MI6A 2XVTA 4BNDA 2RK4A 1G291 1H2XA 5KWIA 3ZLJA 1UOOA 1PFYA 3W5BA 1OR8A 4J9LA 3IJPA 5FTNA 1H6BA 3A9RA 5G3YA 4YMVA 4O3FA 4C6RA 2ZJ7A 1CZRA 1IBRA 1MG5A 3C3DA 2RP5A 3WI7A 1R8JA 3PZRA 4G65A 4MJLA 3U16A 3ODGA 4D4JA 4G86A 2WM3A 1GNRA 1YFKA 2N75A 4X90A 3U80A 3GJ6A 1XZMA 3ONDA 1DIGA 4PEVA 3EYAA 4RKEA 4RLHA 3I12A 1P1KA 3T34A 1IBLB 3THRA 4DNOA 1Z68A 1PZNA 9ICOA 5GIOE 4LPKA 3DFMA 3IAUA 4L8LA 1EYZA 1KMHA 5ETJA 1Z06A 2X5OA 2BKVA 3MJHA 1JG7A 5GONA 3D6UA 2G63A 3NORA 3QMPA 2HO4A 4JVLA 2OYYA 1NKSA 1QM5A 3PQFA 3DHYA 3K2BA 1SKRA 1YNOA 3WL8A 4H3HB 1CYEA 3OJFA 3PHHA 1L7AA 3HN2A 1L5UA 3H2IA 4RETA 1FDSA 3RWMB 4BFVA 1NAHA 3D7LA 5AJWA 3RJ9A 1R4MB 4MX8A 4DSZA 3H11B 1F2UB 2HX1A 2JCXA 3JTEA 4FKBA 1ESEA 4NLKA 1R10A 4E88A 2XNKA 3DZ8A 3PNLA 3TO5A 3O82A 3N2GB 4EBFA 1WB4A 4YT8A 4H2DA 1RFGE 1KH1A 3GA0A 3HE3A 4AUMA 2VBIA 2KSQA 2W6JD 5LQCA 4EZEA 5ALVA 1I4WA 4ZK2A 1MN8A 4R2LA 2AXNA 4RAQA 3AG5A 621PA 3PC6A 7ICOA 1EFVA 2ZITA 3T7AA 3ABOB 3HR7A 3UN1A 4QBGB 1FU8A 1PJ2A 1WA5A 4E6EA 5JS7A 2IYSA 1OQAA 1CS4C 5FO1A 5K2MA 4CQMB 1V26A 1A2KC 5K51A 1FYFA 1QGYA 8ICPA 4XCXA 5CCDA 3STTA 4ENUA 1PE0A 5AW6A 3VV2A 2IZZA 2AEJA 3GUHA 3NVMB 4GOXA 1EZ1A 3IAM6 3VR5A 4NC9A 4BMOB 4UCQA 3KQUA 3QE2A 4GC5A 2FR1A 4LYGA 4WZAA 3T5CA 1Z8NA 1UJCA 2I4RA 1M6HA 3C1TA 3MBKA 3PNVA 4G4GA 3VFDA 5EHXA 3ACDA 4WJZA 5K3DA 3UICA 3U5ZB 2OEHA 1N2XA 2R47A 4BTLA 2HJWA 10MHA 3HN7A 2FNAA 1OHHA 4YMGA 1TMOA 3GJ0A 4KQHA 1ODLA 4YO8A 4LRTB 4C7XA 1XKTA 4QNNA 5J0SA 3E9CA 3ED1A 4W1RA 5H70A 2ZRNA 4Z1OA 3PC3A 4JBHA 5K45A 2PMKA 3FMOB 3C23A 1CE8B 1SBTA 3O26A 4NQZA 3WK5A 1JXQA 3AEUA 3HG7A 4LY9A 4Q1VA 1JW9B 4DRYA 2RGXA 4JMUA 4IQWA 2IZ1A 2GAOA 5AVVA 1W36B 3B9JA 4MVCA 4AG5A 2OK8A 3D6HA 3JYHA 3R9IA 5F4ZA 3QEOA 4DNQA 4E70A 5EJ7A 4LF6B 2NZ8A 1Z6AA 4AC9A 2J5QA 1OA1A 2NV6A 3OC0A 3P4XA 4YAKA 3U7RA 1K6JA 5J0UA 4MAAA 2VR1A 4UHFA 3DLAA 5AO9A 2VWPA 2BLLA 1PFWA 2FPSA 5DX8A 5C8YA 4YAIA 5LSAA 2ZSJA 4S1VA 1JFFB 5TT1A 2Q0HA 3E4DA 2JAHA 4R66A 1U9CA 1ZMXA 4ZOEA 1UANA 3AZOA 1IWBB 2H1IA 3FHOA 2ZUEA 5G4KA 3OZXA 2E1EA 3F6CA 1JEQA 2CXUA 3EOAI 1PVRA 3BTSA 4PGHA 4RD1A 4TLEA 3TOSA 4DIBA 3II6X 1YQUA 4GUDA 2Z08A 3CVJA 3FWPA 2DRIA 2PFGA 3TADA 1VRVA 2ZE5A 1HUZA 3KDSE 4Z3KA 4B3RB 3RSCA 3ZY2A 1K1EA 4HAYA 5E2IA 1P9OA 4K6KA 1P4RA 4LXTA 4I8IA 2N9UA 1AS2A 1UBEA 3EW9A 5AW8A 3IAAA 4O29A 3GMDA 1RQRA 2ET6A 4MO9A 5K3BA 3MWJA 1KI1A 5I7EA 3I0NA 1D4OA 3LYAA 2RHFA 4FZMA 2A33A 1U8XX 2HCRA 3PWTA 4DT1A 1B6GA 1SHJA 2APJA 2P3QA 4ZU1X 3WAGA 4AKIA 1DBVO 1UC9A 4B75A 1H3FA 4RD2A 2CMKA 2P40A 3PCTA 2WYVA 2I67A 1VCMA 3MIIA 2QKYA 1L4GA 4MV4A 1Y8ZA 4Y6LA 1GKKA 1LBTA 3ZY5A 2ZPTX 1Y6GA 4FYPA 4XUGB 1KNXA 3G13A 3QPAA 1E1RD 1K5GA 2IYZA 4HDSB 5K0EA 4TKMA 4LJLA 1UPTA 2RHMA 1JSLA 3EUAA 2JJ1A 1O03A 1EM8A 2VH2A 2XUPA 4HAVA 3P0FA 1TTHA 2GNOA 3PHCA 5LNK1 2QL7A 4PHHA 3A36A 1P91A 1XSNA 1KSHA 5LYJB 4LF5B 1ZQSA 1IZ7A 1LDYA 2EJVA 2PRJA 3OCYA 5KYXA 3QRWA 1PDVA 2XUQA 4TTVA 1TX4B 1M1YE 2RH9B 3CUEF 2JJQA 4WHMA 5JTTA 2O59A 4AYWA 1LS1A 1PS9A 1SGGA 4ALIA 4FI3F 4HTAA 5EWFA 1NN5A 1EFAA 3CH7A 5E0OA