3I76A

The crystal structure of the orthorhombic form of the putative had-hydrolase yfnb from bacillus subtilis bound to magnesium reveals interdomain movement
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
228
structure length
223
Chain Sequence
KRYRTLLFDVDDTILDFQAAEALALRLLFEDQNIPLTNDMKAQYKTINQGLWRAFEEGKMTRDEVVNTRFSALLKEYGYEADGALLEQKYRRFLEEGHQLIDGAFDLISNLQQQFDLYIVTNGVSHTQYKRLRDSGLFPFFKDIFVSEDTGFQKPMKEYFNYVFERIPQFSAEHTLIIGDSLTADIKGGQLAGLDTCWMNPDMKIIPTYEIRKLEELYHILNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the orthorhombic form of the putative HAD-hydrolase YfnB from Bacillus subtilis bound to magnesium reveals interdomain movement
rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Putative HAD-hydrolase yfnB
total genus 87
structure length 223
sequence length 228
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3i76A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3i76A01
1ZS9A 1RMTA 2FEAA 1U2SA 3E84A 3KZXA 3OCUA 3NANA 2WF8A 2NO5A 5ALIA 4OHFA 1RKUA 2ZBGA 1WVIA 4KN8A 3WK5A 4L6AA 2FI1A 3I1YA 4YCMA 1ZRMA 5AM5A 4ZEXA 2WF5A 3MC1A 1WPGA 4UMVA 1RLMA 4YCNA 3OCYA 5ALXA 1S8OA 5AVRA 2O2XA 5AKEA 4BX2A 3ONNA 2YJ6A 4XQ0A 3WGUA 3AR4A 4JB3A 4UW9A 2W4MA 2HI0A 2NO4A 4BKMA 3U7FB 3AR7A 2WFAA 4UM7A 2EAUA 2YN4A 3R4CA 2IA5A 4I9GA 2HSZA 4UMEA 4EX6A 1RLTA 3IRUA 1Z4JA 3U13A 3SD7A 4NWIA 4Y2RA 1PW5A 2PKEA 3QU4A 3WKEA 5AW9A 3CZ4A 5AIAA 3A1DA 3OCVA 4Y3UA 4Y2XA 4AP9A 3IJ5A 4NABA 2HF2A 3ESQA 2I54A 3I28A 1Q92A 5AVQA 1T5TA 5AW5A 1RDFA 5AKIA 3WKBA 3FPBA 4CF4A 3ET4A 4EEKA 2GO7A 4C4TA 4DFDA 1XVIA 2G08A 1IWOA 2P27A 2HDOA 1TJ3A 1RPZA 3NALA 5AVXA 3L1UA 4IFTA 3M9LA 5AM1A 3ZVMA 2YMPA 3J7TA 3A1EA 5AKJA 5AVVA 3DDHA 3ZVLA 4DWOA 1YV9A 1LTQA 5AVYA 1U7OA 1Z4IA 1K1EA 5ALWA 2FUCA 3DNPA 5AI0A 3M1YA 2VKQA 3E58A 3EF1A 4UU1A 1QH9A 5AVWA 2GHTA 3QUQA 5AKHA 3DV9A 2O9JA 2IOHA 4HYTA 1ZRNA 5JJBA 5AW2A 2BDEA 5ALEA 1RMQA 3U19A 3OCXA 5ALRA 1TJ4A 1XPJA 2JAWA 3W5AA 1KYTA 5AKLA 2I34A 1Z5UA 3FZQA 2PR7A 4H1WA 2RARA 1L7PA 4Y2QA 2MSNA 3QU7A 2YBDA 1JUDA 2B30A 3PGLA 3MPOA 5AI4A 1J97A 4NV0A 4UMFA 4FFDA 4KX3A 3RFUA 5AK4A 5ALUA 1YJ5A 2HF7A 4BNDA 3QYPA 2WF6A 4EZEA 4BEVA 4UATA 2D2VA 3WKCA 2FPUA 4HGRA 2HCFA 5AM4A 2OM6A 2HX1A 4NAVA 2IYEA 2B8EA 3F9RA 3ZTWA 5AW4A 1NNLA 1QQ6A 3AR6A 2AGVA 2YMLA 1TJ5A 2WM8A 3ZWDA 3WK7A 2R8EA 3MMZA 1QQ5A 3QUTA 2YJ3A 2IOFK 2FDRA 2GFHA 5ALOA 1CQZA 1Z4QA 2G07A 4XOUA 1X42A 4DCCA 1ZD4A 2YY6A 4GXTA 4CNQA 1NRWA 1S2OA 3QU5A 2NYVA 1CR6A 3SHQA 5AW6A 1L7NA 5ALGA 2OBBA 1QYIA 3A3YA 2B82A 3AR9A 3CNHA 1L6RA 2OYCA 3L0BA 1YNSA 2G06A 5T41A 1SWVA 2CFSA 1ZD3A 2YFYA 3SKXA 3U26A 4DW8A 1SU4A 2CN1A 1RLOA 2Q4TA 3BA6A 3UMCA 3U7GA 3NASA 4UARA 2IOFA 3FPSA 1RQNA 3N8GA 1WZCA 3EPRA 2ZG6A 5AESA 1FEZA 1L7OA 4BYGA 5ALLA 2I55A 3OCWA 5A3QA 3ED5A 5IS2A 5IT0A 2R8XA 4QQFA 3NIWA 2B1RA 2JARA 3WK8A 2W43A 4UASA 5ALSA 5AKGA 5FP0A 1QQ7A 1N8NA 2YMQA 2QLTA 3UM9A 2R8ZA 3WK6A 4EENA 3L5KA 3I6BA 4G63A 5ALJA 3R09A 2EARA 1VFPA 5AKKA 4F71A 2HOQA 3P96A 3D6JA 2HHLA 4IG4A 3L0YA 4HGNA 2FPXA 4YH1A 4KNVA 4CF3A 4J03A 2Q5EA 5ALDA 3N07A 5AIBA 4MUMA 5AI6A 4RESA 4AS3A 2QYHA 3N5KA 3B8EA 1ZD5A 5AI8A 4QJBA 3AR3A 4RETA 5ALPA 3KOOA 2PQ0A 1TE2A 1Z4MA 3U7HB 2CFTA 2ZBFA 3QXGA 4KX5A 5AVZA 5AICA 5AK3A 4CE6A 2G80A 1ZD2P 2RBKA 2ZXEA 4EX7A 4O8CA 3E8MA 5E0OA 3FM9A 4F72A 1L8OA 4HGOA 5ALKA 2C88A 2I33A 3MN1A 3NUQA 5AVSA 3SKYA 2AH5A 2C4NA 2JAUA 1VJ5A 3VAYA 3ZW7A 4NFLA 4E88A 3QUCA 5ALHA 3ZU6A 3SMVA 4BEWA 1F5SA 4XE5A 2RB5A 5ALMA 2WF7A 3OCZA 3ZX5A 3ZUPA 2JGAA 3ESRA 5AW1A 5AI5A 4I9FA 5ALFA 2W11A 3ZI4A 4FYPA 1VJRA 4G9BA 1Z4NA 4BX3A 2FPSA 1RRCA 1LVHA 1YS9A 3KDPA 5ALZA 3AR5A 5AVTA 2BY4A 3IB6A 2I6XA 5ALQA 4UMDA 2G0AA 3DAOA 2G1AA 2MU2A 1ZJJA 3WKAA 2YMMA 3WK9A 2Q4RA 4BNDB 2B1QA 3KC2A 3BWVA 2P9JA 1YMQA 1TA0A 3QLEA 4OCZA 1Z4OA 3SF0A 3S6JA 1WR8A 2FUEA 5AVUA 2C8LA 4UM5A 1O08A 5AM2A 4OD0A 1Z4LA 4HGQA 3PCTA 2AUTA 2G09A 2YJ4A 3B9BA 1Z4KA 3GYGA 4YIHA 3FVVA 3OPXA 2MU1A 5AW7A 4Y2SA 2RAVA 4PNHA 3L8HA 3QGMA 4ZEVA 4Y2TA 2JAOA 1Z5GA 2C9MA 1U02A 4Y2PA 3U7EB 3ZX4A 3W5BA 1L8LA 5AW8A 2X4DA 2ODAA 4L6CA 2HO4A 2FPRA 1N9KA 1O03A 3QUBA 2ZOSA 3ET5A 1RKQA 3RF6A 3QNMA 5IT4A 3EWIA 3L7YA 5ALTA 2FPWA 3E81A 2R8YA 4JDPA 3WGVA 4BBJA 4UAUA 5AM0A 2B8JA 5AKZA 3N1UA 1Z88A 4ZEWA 2HEGA 4XPZA 4CF5A 3HYCA 2GHQA 3UMBA 3R9KA 1T9ZA 2C8KA 3W5DA 1YDFA 3QU2A 3HLTA 3L1VA 5AHXA 2WHEA 5AK5A 2AMYA 5AW0A 1Y8AA 4HAIA 5AM3A 2P11A 3ZTYA 3A1CA 3KD3A 3N28A 4Y2VA 3PDWA 4HGPA 1RKVA 1SWWA 2ZBEA 3L0CA 4Y2UA 3L8EA 4BX0A 5A3RA 1Z4PX 3W5CA 4UAVA 4L57A 4B6JA 2P69A 5AW3A 4YGYA 4J2TA 5AKYA 2I7DA 4MWOA 4KNWA 2OA0A 4OFZA 2BDUA 3KBBA 4YIKA 1AQ6A 3FGOA 4KYTA 3OTQA 4Y2JA 3NAMA 2WF9A 1XP5A 1RMYA 1RC8A 3ZWKA 1EK1A 1ZOLA 3EF0A 1U7PA 5AKXA 1NF2A 4AS2A 3L8FA 2EATA 3SLRA 5AI9A 3QU9A 2GMWA 4C4RA 1J8DA 3AR8A 4C4SA 2CFRA 1Q91A 3QX7A 3K1ZA 4FE3A 3WKDA 3L8GA 4EELA 1MH9A 5AK6A 5ALYA 4YCLA 2ZBDA 1U2TA 3NRJA 3PGVA 4Y2YA 2DQSA 3AR2A 2YJ5A 2B0CA 5ALNA 3TLMA 1EK2A 5A3SA 4GIBA 3WK4A 5ALVA 1RQLA 3UMGA 3B9RA 1L7MA 3I76A 1T5SA 3ZVNA 4UU0A
chains in the Genus database with same CATH superfamily
2A86A 4AF8A 1CUKA 3F47A 2F4NA 1ECWA 1MOZA 5GAJA 1SV4A 2M6RA 3DLAA 1BE8A 2XEDA 5J2FA 4QARA 3R3WA 3G6YA 1S3SA 1Y98A 4MICA 3UXHA 1RCTE 1B8NA 3N2GB 1KQ3A 3FSGA 1ETHA 1NQXA 3TQ1A 2R7KA 2ATIA 4QUAA 4WRRA 3HY3A 1I1HA 4UULA 2B3DA 3F5QA 3D1JA 4UMVA 8ICOA 3QF7A 4IQ0A 4PHCA 5KCMA 5EGNA 3I0ZA 2CSUA 1KFSA 2H5LA 5LNK1 2XZOA 3QPVA 5A71A 4EWLA 5CITA 3DC2A 1N5JA 2QOEA 4F5EA 4LQCA 1JBKA 2CXTA 3C3BA 3CZCA 1CY1A 3KQWA 4HXEB 5CW1A 2OBNA 5L4LA 2Y8EA 3V42A 2V45A 1OREA 1WLSA 1YUBA 3EZGA 1E69A 1JI3A 3OE7D 2JEJA 4J0QA 4BATA 3KPYA 4X94A 3G6WA 2BTEA 4EF4A 5T6BA 2P0EA 2VAVA 2EWVA 4IIBA 3DV0A 4OQEA 1TK8A 1JFSA 3AEUA 1XZFA 1MB3A 3ENZA 1VPWA 4IV5A 4UM7A 3I9KA 2L82A 3E0XA 3RYHA 1FFXA 3NBAA 3OKFA 1KVSA 3A3PA 4FC6A 4QX6A 1QIJA 4ZXPA 4D96A 4IC9A 1Z4JA 3PEFA 3BJZA 3NDRA 4IQVA 2G4CA 5B57C 5LZ4A 2DWPA 1K8YB 4RQ8A 3GT3A 1BIFA 5LZ7A 1CEYA 8ICSA 1W93A 4ONEA 5L9XA 1V7PC 1DXOA 1AG9A 1ZUNB 1SC9A 1E3WA 2ZR7A 4Q7LA 1MEJA 3ESQA 3BJIC 1A97A 4GMXA 4S24A 4RU1A 1T5TA 1EDBA 1V5GA 2QMOA 2HAEA 2WJJA 3QWIA 3WWZA 4DL9A 1N7JA 2FN3A 2C83A 3LPMA 4AUEA 1FMFA 3U4IA 4XR4A 3DSRA 3IAXA 3AVTA 3ICCA 1A4RA 3WHLA 1SIUA 1B4DA 3PR1A 4IICA 2P8JA 4W5JA 2E55A 4D80A 4DIFA 3VSEA 1BJTA 3CA8A 5JDCA 3VKHA 2JGJA 3PHBE 5KU1A 3H8WA 4NX2A 2BFEA 2QE7D 1GEEA 2QT9A 3AQIA 3MABA 5C0YA 2UVVA 2XUDA 2P9FA 5HKKD 1GZ6A 2W37A 4LJLA 1Y8ZA 4G5HA 3UANA 1X66A 2FWNA 4LOAA 4RIFA 4UHKA 1ADCA 2YW9A 4AFNA 4DDWA 4ZCLA 3CH7A 4TSFD 4J4HA 4ZKEA 4G5QA 3EFEA 1PNTA 2O8EB 4BNNA 1YV9A 2B0JA 5LQMA 5JCOC 3TR5A 5F7XA 3R5JA 3P9QA 5AVYA 2IELA 4GG1A 3B9JA 3IEKA 3LCCA 5HRCA 4NRDA 1LSJA 4PZZA 3IMKA 4X8OA 3X1ZA 3L46A 1R1DA 3V34A 3CGWA 1KN5A 3L01A 5DF1A 3WG9A 1DGSA 4O2AA 4LV6A 4PHAA 1Z6PA 1DHRA 3L0ZA 3BQ0A 4IR7A 4PBTA 3GJQA 1N1GA 3MTJA 5I9MA 4C7JA 3KSAC 3WIEA 4EY7A 2H5EA 3IPYA 3PVXA 3R75A 2POQX 3STYA 5BYJA 2VJDA 4ALKA 2HZ7A 3NAGA 4RYDA 1DAEA 5ALRA 2J0VA 1ZM7A 1IOLA 3L79A 5KFTA 3B1JA 2QPOA 2IXFA 3HZOA 1Q12A 3FZQA 3RYIB 3TXXA 1WCNA 1K75A 2PR7A 1BJRE 3GUHA 4TRRA 4X3OA 1N1MA 2I6FA 4ZREA 5JSFA 1RCFA 5HX7A 3KHLA 1YJAA 2BFFA 1JUDA 4A15A 3VPGA 3KXKA 3WYNA 5DNVA 2I66A 4I50F 2EAOA 3UKDA 1IVNA 1GPAA 2BR4A 2GUGA 2ZJAA 3AZOA 4KLAA 4M86A 4IOJA 4G1BA 4YJDA 1RAEA 3MZ0A 2ZAOA 4E1BA 1MRSA 4AY3A 3VVLA 1MMFB 3MDCA 2DF8A 2OFXA 4XLLA 3CRNA 3EZXA 4LYHA 3VZQA 3MYYA 1C7FA 1PTJA 2CLCX 8ICBA 3HM2A 3O5AA 4FZVA 3OFVA 3SZOA 5JFGA 4NZOA 4FVTA 3ZG6A 3I2KA 1FLNA 3N0WA 2I3BA 3LWLA 5E6SB 3P20A 5JIBA 3WICA 2KPOA 3UQYS 1P61B 2A8YA 4HWKA 4BU1A 1CR0A 4KB5A 3AP2A 4J94A 1LA2A 3TQQA 3ZIAD 4E14A 4Z51A 2OZLB 4H6XA 2KEYA 2NVOA 2YMLA 2TRSB 4H15A 4G9GA 5LOVF 3T5TA 3WK7A 2J41A 2GXUA 2LIVA 1DJMA 3A6EA 3R9IA 1J9GA 1RKBA 1C8VB 3IPXA 4QNNA 1YGPA 3CC8A 3RROA 4DIEA 4EG5A 4G26A 3FTEA 3GRRA 2GFHA 3LFUA 4JFAA 4CIDA 3TBKA 2CF5A 2BJHA 3SF8A 3NETA 3U7JA 1ONOA 1QZXA 1MW8X 5FQNA 4MV4A 1PDVA 5C1OA 4R3WA 4WUTA 1CUCA 1S2OA 2HCJB 4C87A 1RYZA 2F67A 3CEAA 4HRXA 4BMZA 4KBYA 5L7WA 2G04A 2IHUA 3NTQA 3ETEA 4XXHA 5KG3A 4IW3B 5DTRA 3KOZA 5ALGA 3OKCA 5BWMA 1PJ3A 5E38A 1M6WA 1OI3A 1MDBA 3VPDA 3HJFA 2BGNA 1XCOA 2CVQA 4TLLB 5JYDA 2G9UA 5EKSA 1V1JA 4JJ6A 3HYSA 1B23P 5KB3A 1TJNA 3Q3CA 5CIQA 4G4JA 2GKSA 1G2OA 3GRZA 4G3IA 4F5DA 1I2BA 2ACKA 3F6EX 5E6RB 4A8PA 2Q5FA 5ISMA 4AURA 1T13A 3HBMA 1U7DA 5E4YA 2IOFA 3ZV5A 2CLLB 5GTDA 1IG6A 3LDFA 2RHRA 2V7BA 4MEAA 4O25A 1GRCA 4RVDA 1L5QA 4TWRA 4PSAA 4GT1A 2QRNA 2ZGVA 1WVGA 1PZHA 3CVJA 4IHAA 4IX1A 5EWFA 4G97A 2VP0A 3AGPA 4JBNA 2NVWA 3LWZA 5FAXA 2A9OA 3ZDYB 2PJDA 1OJ7A 4C0WA 1K6JA 1QP8A 3UC5A 1XDGA 1FX0A 4R64A 2I55A 2UVUA 2XVYA 1R5BA 5DX1A 2JGDA 3KE8A 4PYMA 2DCUA 1KTVA 1LU9A 2AQKA 1OB2A 4M1KA 3MFIA 2FMUA 3NIWA 2Y66A 4MVJF 3WK8A 4H4EA 1UXOA 3FBTA 2WYVA 4CLXA 4NMXB 4IJ5A 4X3CA 3M4ZA 2XUKA 5KNCA 1XZNA 1QHXA 1ATIA 1K8XB 4Q9JA 5DNEA 4LJAA 2H3VA 4M9SA 3ROXA 4ECXA 2CJYA 4CN9A 3MJEA 3NT2A 5EXXA 3VYVA 1ZD8A 4DMKA 2XZDA 5HRAA 7ICJA 2YHSA 1ECFA 2DPJA 1NJ2A 2VDWB 1GPUA 5EIBD 3ZHCA 3RRMA 2HHLA 4IG4A 3Q8KA 2AOUB 1Z00A 2I22A 1RKXA 1JQBA 4FZ5A 3RHZA 1VL6A 1TW3A 1W8IA 1V8BA 4PPXA 2PYZA 3QEOA 3ZWXA 1USGA 4D44A 3K9NA 3CWCA 3O8LA 3T99A 2Z2YA 3U4DA 1Z7GA 2A57A 1M1NA 4MB6A 2B36A 3C45A 1F17A 2QI9C 4DB2A 221PA 1PKEA 3E7WA 3D4NA 2H4JA 1EK6A 1XR3A 3JQCA 1GXSB 3D54D 1X7YB 3T9CA 3PHJA 4TTRA 3GEBA 3NOVA 4YP9A 5LDGA 2Y93A 4DLNA 4CKCB 4ILKA 4AJPA 1JMSA 4QYMA 1JROA 3COZA 4ZQIA 3QXGA 2KZZA 2ZWAA 5F7JA 4H3VA 2YCLA 3J80A 3TH5A 4U0JA 4MF8A 2VDPB 1AQUA 5L95A 4ZZ1A 3N3AC 1RZTA 5HCNA 1N5KA 4X1KB 1OLSA 3VPBA 2ZLBA 5KFWA 1GADO 2K4HA 5A3JA 2HA2A 1LRLA 1ML3A 1RJ9A 2QN6A 3KQYA 4X64B 1MVOA 4YMWA 2GEJA 1SV0C 3U4QB 2E8MA 3MWEA 1TM7E 1WEHA 2YYYA 2B2XA 1T25A 4B9EA 4XASA 1VJ5A 3S70A 1XCBA 1SV0A 2B78A 3ZW7A 1W7AA 5ERYA 4YUVA 5IPFA 1Q0ZA 1Q16A 4COKA 5BQPA 4AZVA 3MRXA 3E2IA 2FP4B 2ZUUA 3JR7A 4BIMA 2ZYDA 4R8LA 2E1PA 2IZ6A 3EEQA 3LVQE 1F5SA 1ZISA 3MWLA 4L08A 1E2GA 3C6ZA 2OFOA 3RU3A 5KNIA 3N58A 1H5NA 4MWTA 1AS0A 1YK0A 1UXKA 4PYLA 1EE2A 3FPKA 1XTUA 1W1WA 1D2HA 2VHQA 2JI9A 1E1LA 4MRPA 4J0DA 1UQTA 5KFZA 5CJ2A 2PUBA 4OMCA 2JZOA 1OGJA 2GI4A 1DT3A 4UXJA 3PKJA 2IP2A 1AGPA 3GN1A 3A58B 3AKCA 1JKIA 3CE9A 4BUGA 1VYTA 2GCPA 3H84A 3M6UA 5F77A 2FPSA 3S5UA 2DSNA 1ECCA 2EKLA 4FNAA 1WWUA 4JLKA 2GEUA 1V97A 3NEPX 2F2AB 5LQUA 3D6NB 3T5LA 1SCAA 4LE1A 4AECA 3QJ5A 1X3SA 2AQ4A 4KRXA 2KK0A 3ZK8A 5M2QA 1K6IA 1T0IA 1JSRA 1J70A 4JP2A 3TZ6A 4B87A 4HAZA 1R9JA 1TU4A 1NJWA 3WR5A 4KR7A 3ADPA 2H08A 2I99A 3ISTA 3UPTA 5JAZA 2G1AA 2HSJA 4PQRA 1NRIA 4CJXA 2Q4RA 3EZYA 4F5YA 1AE1A 2EEPA 1XDUA 1UZUA 4B3BA 1R0SA 1XJ0A 5FV7A 3FZGA 3FRIA 1HBJA 3K09A 1Q3UA 3LDAA 3SI8A 3GGJA 4DKXA 4BQPA 1WXWA 1PLKA 4UM5A 3OEWA 2ZP1A 1QHHB 1DTSA 3AIOA 3ZQ6A 1IRIA 4JP1A 4E5VA 4GWKA 5K51A 3W2EA 5DX0A 2V9WA 3U4AA 2JIOA 4DMHA 1T94A 5J2DA 4A9AA 1YRLA 2C57A 3AGQA 2IA6A 4X7RA 1Z63A 1BGXT 1IMOA 2W6JD 1O1YA 2Z08A 4B80A 5F7ZA 5ER6A 1SKUA 1ZQ9A 2J7PD 2WFLB 4KBGA 3W7AA 3ZWPA 4Y2TA 4CKWB 4XGRA 4ZEVA 4DTIA 1ZIXA 1EWRA 2O20A 2HXSA 3C1OA 4ZV7A 2PX3A 2C7RA 3SZRA 2VT6A 4N01A 1WP4A 4D7AA 2XODA 4DNPA 2IHVA 2C5BA 4MRRA 4L5JA 3HCFA 2KJ5A 1Z2CA 2ZBRA 2QTMA 2J9GA 2P77A 4KLFA 2GNOA 2Q3BA 4M8SA 3O4HA 1TQ4A 1SKMA 3RS4A 4F5WA 5JVDF 1Y3DE 3OT1B 3HUDA 3EW9A 5J2AA 4NONA 1Z8NA 2PGJA 2H3FA 4AKHA 3I9JA 2BTQB 4EPVA 4GQAA 4CKXA 1OTHA 2XUAA 3E15A 3NIDB 1T5IA 3IFSA 1Z7EA 4V0LA 4IRXA 1KP3A 2TSYB 2A9VA 2FR1A 2GZAA 1EB9A 2MYPA 4NLKA 4UAUA 1F48A 4OQFA 1RXWA 3NGLA 4M76B 2RGWA 2ZE7A 1Z88A 1I8TA 2AZMA 2MT9A 3G79A 3G9QA 3IBFA 4DSEA 2CXUA 5JJKA 1NUHA 3H4BA 4DL3A 2RH8A 4MLCA 5IDWA 2FMFA 2YXBA 4MIOA 2A84A 1MRZA 5LCXA 3QQ5A 2SECE 3W6UA 4CMJA 2HHJA 2W2MA 3TEMA 3QSGA 4NZMA 4S0ZA 4PZ9A 3TLCA 1JSZA 2AYZA 4PVDA 1N61A 1Z7YA 3H83A 4CZ2A 4B7ZA 1U28C 4LYJA 2FJ0A 3LLVA 2WJGA 2X15A 2XYRA 5JCJA 1LPOA 4X20A 4XQEA 4GOLD 3FHOA 3X0DA 4A03A 1GUAA 1CI4A 1A2KC 3MOSA 1L7BA 4OHCA 5A02A 1NF3A 4I8IA 3VKWA 2VTBB 1YL6A 3I2GA 1RKVA 4NYMQ 4EZ6A 1XAJA 4ND8A 3HXPA 4KVAA 3VISA 1G1MA 1O95D 3HFSA 3ZZ1A 2C7QA 3PXEA 4MVJI 3LO8A 4O3FA 1TQ6A 2B4AA 4HDMB 2NUAA 2X13A 4MUYA 1W75A 4YMHA 5EE1A 2ZYWX 4ZT5A 8MHTA 2JCYA 1L3CA 4X6LA 1AV6A 2JI4A 1E20A 1G291 1AXRA 1E5DA 1XMIA 2ANBA 1ZI9A 4QZFA 2QTNA 4L57A 2P6RA 1QM5A 1WM1A 7GPBA 2I3AA 5LU9A 5H2FU 4PGFA 4BKUA 2ZR8A 1RP7A 1ZA1A 3RH4A 4Q8FA 2XMPA 1V16B 4QUJA 4YRSA 3UJBA 4BYMA 1PJZA 1XZMA 4YRKA 3W3AA 4EW3A 3IIMA 3WWOA 2M0NA 4O2BF 5E1DA 3J7AC 3LQFA 4MVJG 1I80A 4WEQA 2FQQA 2XUQA 2ZWVA 4YN4A 1WUJS 3PR2B 4LRXA 2WBLC 5ENZA 3LCJA 4KH0A 3VDXA 2FMXA 1LF5A 5CFQA 4LJ8A 4TUQA 1NVDA 3BD9A 5KSWB 1IC6A 2G63A 1CY8A 4OK5A 4V3CA 4Q1VA 3ZWKA 3JYQA 4YUYA 3QA9A 4PNZA 2CZCA 1TYDE 4BO0A 3IS3A 2REQA 1EFPA 3ILHA 1EBUA 3UG7A 2P35A 5HM6A 4B79A 5K0EA 5KNDH 5DNYB 3NWEA 1WZIA 4BFZA 3QU9A 4M1SA 1Y4UA 3L77A 3LIPA 2VDKB 2NZYA 5AJXA 2UYGA 2WPDA 5A5GA 1I10A 5EPEA 5KKCA 1KEKA 5C7YA 2LYAA 2IHMA 2HHCA 2WWWA 1H85A 4QW9A 4X8HA 4J9PA 1Q91A 2H2FA 2WG2A 1M6YA 2GXSA 3ZI7A 1CF2O 4M9JA 3GFQA 3GZNB 1MH9A 4ZVUA 3PI6A 1A9ZA 2ZXHA 1D9DA 2ZETA 5LLTA 2AW5A 4Z6FA 1BH6A 2YJ5A 1V47A 4M1YA 5IAAA 3D4BA 3E9RA 1HEUA 5ALVA 2LPEA 3OE1A 2E4YA 2X7HA 2ET6A 4JXKA 4BLTA 2P91A 2KVCA 1YR2A 2H1WA 2O1WA 2QY6A 4W4TA 4B8YA 5A03A 1WKCA 5TGTA 2RHWA 3UAZA 2WIJA 1YRYE 1Z68A 1SNYA 1YT5A 1AN0A 2W8LA 2ZBQA 3G85A 4J9UE 4JP8A 2J9ZB 3HCEA 4MVJD 4RD0A 2W0SA 3GV8B 4L8YA 3MBYA 4FBTA 2PMZC 2FI1A 5TQVA 1AA9A 3C3MA 4GO1A 5JSUA 3DOFA 2QUBA 1LTHR 4CKYA 4HDKB 4JT4A 4Q3OA 2NYAA 4G1MB 1JIVA 1QS0A 2WMOB 2NO0A 1VG1A 1ZUIA 5IIJA 4YCNA 4I2GA 1KARA 2H1LA 4J16C 4RH3A 4M9LA 3KFLA 5G53C 2ZUDA 4TRNA 2ZRCA 1E9CA 2V7TA 4WHMA 3TNFA 2WP0A 3IE0A 3P4UA 1PR1A 5H83A 4R8UA 1ND5A 3HN6A 4LWQA 4EATA 4C08A 1K4YA 2W2PA 3D6FA 2ISSD 4K8RB 5FR1A 2N1BA 4DRZA 1J90A 5HBRA 4UW9A 3HXKA 3LRTA 1ADYA 3NIBA 4AO7A 3G6KA 4L8FA 4PGAA 1EBBA 5EJ9A 4J4TA 4P7FA 4WXPA 3WLPA 2CMDA 4UZSA 1ADGA 1CUEA 2JCXA 1GGFA 2ABWA 1G5FA 4PL2A 2OPBA 4MAMA 4V24A 1D4AA 1XTRA 3EASA 4TWBA 4YCSA 3AB8A 4I9GA 2IH4A 4EA7A 4X95A 3CGGA 1JDVA 4ED3A 3IRUA 1U3VA 1EDDA 1D8TA 3CEPB 3K9LA 3NV7A 3U13A 4IOMA 4C7YA 2XYPA 2Y1OA 3EPJA 3DJYA 4AKIA 4Q1DA 5ABPA 1YQWA 3LC2O 2FVXA 2VLBA 2VJYA 3TLJA 5BN3B 5CA7A 2PXIA 1DQRA 5KAMA 1ZETA 3TSAA 4WI1A 4JGBA 2JZBA 4QZAA 2V65A 4ZOBA 4C3ZA 1I0ZA 5AIAA 1JVSA 1SBCA 3ZD7A 4NJMB 1JEQA 1BMFA 1ZX1A 3R0XA 2FEWB 3DO8A 3OIDA 4ZDIA 1TFUA 1P2SA 2CMKA 2VS1A 3MTEA 4PZEA 4XYMA 4FUQA 5D86A 1PK3A 1G8HA 1BHSA 4V39A 5G5HA 4JI0B 4ZCSA 1GKYA 2WTBA 4EHAA 5IIOA 1N78A 4M8NE 3HMKA 4QFCA 4DFDA 3T61A 2UUAB 4C0XA 4YJ2B 1QHYA 1AB5A 5HUHA 3SYLA 4GDFA 2VPZA 5FUBA 2XLCA 2HDOA 4GD3Q 1Z07A 4BRWA 3MR2A 1NW8A 3BD8A 5F9NA 4KW7A 2PA0A 4M53A 1K0FA 1NVVQ 1MTZA 1ORTA 2D4HA 2X7XA 3G0GA 4IFTA 1FW8A 2B21A 1V4BA 3VKVA 1MCZA 1E2MA 4EJSC 4MIKA 4Y6PA 5BUSA 2QDKA 3EOAI 4IM7A 5EWMB 3O90A 1UBKS 3IVXA 1ESCA 1GJRA 4Q3LA 5EG5A 2R7NA 3RO7A 5K8VA 2RHMA 3N7SC 1EFHA 1GGNA 2FF5A 4QYTA 4DY6A 3CLTD 1QYDA 2C2ZA 2XWBF 3L93A 3C5FA 1JT2A 1WPRA 2ZU0C 4G41A 3VJLA 1E0DA 1JDBC 5KTRA 2PYDA 4JSTA 1K9SA 4EL0A 1GRRA 5F76A 4OIFA 1WXHA 2O5VA 3ULKA 2FMKA 1CUWA 1A9QA 1OXJA 2AJ8A 3B5EA 1SVOA 3IBTA 3TRJA 3UHAA 5LXTF 3CYMA 1YC5A 1JVNA 1M1NB 3OOHA 1YKFA 5EJGA 4CM6A 5HZKA 1E99A 1SUSA 3SK0A 1ESNA 3EIUA 3CZRA 2VHYA 3DGEC 3OCXA 4HADA 1SUBA 1K8QA 4NCHA 4OKNA 4P08A 2E8NA 1T3ZA 2GPJA 1Y3AA 3L7KA 4FB5A 3AESA 3NBQA 2QARB 2GZ2A 2VSYA 1E2KA 3JQ8B 1FSGA 2FX2A 4IGKA 5DM1A 5KAPA 3SR3A 5CB4F 1EFAA 2IEBA 4YMGA 1IG3A 2UYHA 3LY9A 4MW2A 2ZYVX 2QRQA 1XQYA 5EXDA 1ZXBA 4RQBA 1AQNA 1VCHA 1RZRA 4JV0A 3R5TA 4R8KA 5IHXA 1MORA 2B94A 5F52A 2Q0HA 3HYTA 2BEUB 2OG1A 4A1FA 3SG0A 3G0HA 3BMQA 1KJNA 8ICYA 4X1KA 3KT6A 4CL3A 5M5BA 4BU0A 1J42A 2FDXA 1VA5A 4IDHA 2ODNA 3GG2A 3VSCA 4AW9A 3L43A 3WLKX 4UATA 3TMKA 4DRYA 1H6AA 1YC2A 1TZMA 3G5AA 3UAWA 2EFCB 2AMLA 3U4QA 5DHFA 1QIDA 3MVEA 1FW6A 4XJSA 4EMSA 4E4YA 3A1NA 1I3CA 2XYHA 2KZ3A 3W2TA 4LF4B 3SXPA 2FH5B 3W3AH 1JLLB 3GCXA 3DYIA 3AF6A 4KBFA 2AEFA 5KX5F 1W9MA 2WSIA 3MGCA 4PAQA 1VJDA 3KR2A 4RTJA 2YXLA 2ZT8A 2IKQA 2WM8A 5GIOE 1AT1A 3KHHA 4HFNA 4DOAA 4LPKA 2YHUA 1QZUA 2ALJA 4CKCA 1N1EA 5KQLA 1SIJA 3H04A 1DV2A 1LSUA 4K8OA 1QQ5A 4RK7A 2YTUA 1BGWA 2E4VA 4HLCA 4YJFB 3WDSA 4CPDA 1NW5A 1L5VA 3AERB 5BRAA 3GCWA 4FEAA 4XOUA 3EOBI 1T10A 4G4SP 1A5SB 1N3LA 2QI9F 5EMKA 3RRBA 5J0TA 1EAYA 5IJAA 1FFYA 5DQGA 1NP7A 1JA9A 2WV9A 4I9NA 2NSYA 4RPIA 2WZDA 4FT4A 2GPAA 2ZRAA 4B2LA 4DCPA 3ZYZA 1WMSA 4AU1A 3D64A 5ECGC 1TF5A 4H0NA 1Z2DA 5HMMA 3PQ8A 3D8RA 3WGGA 3EYAA 2OFFA 4EJ6A 1SIWA 4D3ZA 2B82A 4Z0NA 5KSYA 1JXAA 3IKMB 4KG7A 3NC0C 4WXRA 1BS2A 3C7AA 1Z00B 3L0BA 3TLEA 1OHHA 1XZGA 4UHEA 4CCYA 5DHQA 1TUIA 5FCDA 2YZ7A 2QAGA 4F4FA 2CN1A 1QH1B 5LC1A 3PQ2A 5AD1A 5BN4A 5LVAA 2IS2A 1INLA 1KFCB 1DOAA 4J0KA 3W7VA 4DADA 4RLHA 3FPSA 4KREA 2FG5A 1RQNA 3UWPA 2XC9A 4QA9A 2J0EA 1U8CB 1SA0A 2FW8A 2ZRLA 3PIDA 4INZA 3UEOA 4YRMA 4YT4A 1TQDA 3BZKA 1UEIA 1LC3A 4AP5A 4CT5A 4RCYA 1JDZA 1UC8A 3NYWA 7ICPA 5L4SA 2G8LA 1NKEA 2HUPA 5ESDA 4NFYA 2JLUA 3PD1A 2YS6A 1A8HA 1IZ8A 4YRBA 3FDJA 2H11A 3K96A 4W9RA 5FUWA 1Y6GA 3NR2A 4QUGA 3RS5A 1XRJA 2KSOB 1TQHA 2PZKA 4PU0A 4DDHA 1YXMA 5AJUA 5LB4A 1N6PA 4MB2A 5C32A 3WK6A 3AUUA 3I83A 3K73O 2I8AA 3II6X 1ZMTA 1S7CA 3OX4A 3PQDA 1MJ5A 3H9JA 3IBSA 4G63A 4R31A 2F3SA 5FBZA 2GM4A 1F8UA 4MWSA 1XMJA 4JBIA 1X6JA 1GGHA 1KQPA 1NTRA 2J6CA 4P0TA 1L4EA 4BLSA 5LDHA 5ELMA 3P71T 4CCAA 5FPKA 4KQWA 5IKEA 1GNPA 2GRUA 1PWXA 1QANA 2FPXA 3FHJA 3TIVA 1QHHA 1KVRA 4JSRA 4QU9A 4KPFC 5ITVA 2C4UA 5CCBA 1HGXA 4HQRA 1KPGA 1Y9ZA 3C70A 3DFIA 5HK9A 4C8LA 2KIWA 5FO1A 5IVDA 3PTAA 5DB8A 1JG6A 2GF2A 2Z2XA 2GB4A 1JR2A 4DPLA 2QNBA 1MC1A 1KZ4A 4DV2B 2HMYB 1KTIA 1M34A 2NZXA 2FFRA 2VA3A 2EYUA 4DFPA 3DE7X 2WUFA 2V9PA 5GV8A 1ZKDA 5A4DA 3L4KA 4GKVA 1HFWA 1UWLA 4LJ9A 2XVXA 3VNRA 4EHLA 2ZXUA 2C4HA 2RGGA 1V71A 1P9OA 1QV6A 1RYYA 2ZWPA 5EXTA 1Q3TA 2ZJZA 3SLKA 4AUKA 1VGVA 5AK3A 3FGNA 1SXJC 2VDQB 1S5LU 3RUCA 3PQ3A 5U4XA 3E8MA 5JEDA 4YMTA 3T4XA 4V2UA 1EVKA 1IE3A 3HNOA 2O54A 2JLCA 1PR4A 2C9CA 1GPJA 3PP8A 3DYBA 1LDBA 4OQQA 2P4UA 4YAIA 3IMFA 4IIHA 3SBXA 3TZQA 2H1CA 3CKKA 3U7QB 6GPBA 3WGLA 3DL7A 3PW2A 1S3IA 2GNAA 5E6UB 2W9MA 1N2ZA 1O54A 2F3TA 4CL2A 2RDIA 1R9GA 4WV3A 2GVDC 5KAFU 3LOUA 1QCZA 5EHZA 1HQYE 4H7IA 4YRFA 2WWGA 3R3XA 4Q9KA 2Y9PB 4FS8A 4H27A 2PUJA 2HMAA 4MI1A 4G4SO 4B85A 2C5AA 4HRAA 1IL0A 1FTYA 1QOQB 1BWSA 3B13B 3C6BA 4MO2A 1RWXA 2CLOB 2HWWA 3E05A 4JVSB 3CV3A 1J00A 3NNNA 4DDMA 5K9ZA 1NZBA 4EUFA 1Q0QA 4YRGA 4QZ8A 1N2IA 4M1OA 1QTRA 2V6GA 4MEJA 1GQQA 2YIVX 3CZPA 2VHTA 2BM1A 5D49A 3LUPA 3GIMA 4UHDA 4WOKA 2GBFA 4XYGA 4YACA 5F2OA 3K9CA 2WVJA 3IUYA 3LD9A 4QOEA 5JQGA 4FILA 3DCIA 2YIDA 3PFFA 1SVWA 3VVBA 4EVIA 5IM5A 4G2NA 4XPIB 4QTXA 1E9RA 1M74A 5FI1B 4BCDA 5J4LA 1W96A 1E60A 5B12A 3K71B 2DF4B 1OSNA 3DTTA 2D0DA 3DV0B 4FK8A 4CDGA 4NOLA 2V3WA 3IB6A 4MS4B 1TMKA 4ZI5A 3AYZB 4NBNA 1UKCA 3ITDA 2H2DA 4JJ4A 2O3JA 4CQNA 1PVPA 3PJRA 5DNCA 5JYCA 5KOHA 4TLDA 3Q12A 5BMOA 4F8JA 3W9YA 3S8YA 2BTQA 3BREA 5I7FA 1OFIA 1DEXA 3F49S 2YMMA 5LOVA 2W2NA 4EKIA 3R8XA 2Z8YM 3C7CB 3NYIA 3E9EA 4MVYA 1G2IA 4QRHA 3UNXA 4BLPA 5C52B 1Z4OA 4QWMA 2OPHA 3CW2A 1N9ZA 2P6PA 5D6OA 3KWJA 1WXXA 4Z0PA 1EB8A 1K92A 3DOOA 2NUPA 1YIAA 1ZOSA 2I62A 1R3DA 4AJ9A 1T8WA 4M98A 4N8EA 1AVTA 4OPMA 4YJHA 5IVKA 4G5XA 2FJUA 4NP6A 4AKTA 1SH7A 4QE3A 1V7QA 1YZQA 4G1VA 1D04A 2VPWA 3SIXA 1CS4C 2QVLA 3W0LB 3HBFA 2D3DA 1AD2A 1HDZA 1UP6A 5JOQA 1WSBA 3AJEA 4N3BA 2OXCA 4AS1A 1AHHA 2A78A 1FNDA 1W76A 2IYYA 2Q6LA 3ESBA 4HYYA 4K40A 4WD3A 4AQDA 2OK7A 3ZX4A 5B3LA 2A1IA 3HGTA 3EZ2A 1DBVO 3BWBA 2CXRA 3R23A 3GMTA 4NJOA 5F21A 3UAGA 5CRXA 5K3FB 3BWDD 4BLUA 2CDRA 5C3UA 1H4VB 1I6WA 4B17A 2HBYA 1LQ2A 1PZFA 3E8XA 3GRCA 3ST7A 3VH4A 4D9JA 9LDTA 5IILA 3N0VA 4R8VA 1QZTA 5DBOA 4O5KA 4GZ6A 4OJYA 2IXBA 5JNTA 2O50A 1G20A 3LLUA 3PQ6A 2N9UA 1EG2A 1U0OC 3OAAD 5ALTA 2VHWA 3O9VA 1BCSB 2PMWB 3FTDA 1FXSA 4OQXA 4U8GA 4BMDA 5HIKA 2MMCA 3KQPA 3A28A 2AI1A 3AFHA 2A9KA 3AG5A 4F96A 3QXSA 2FEOA 4O0MA 3H4MA 5CT6A 3SS7X 2NUPB 3DKVA 5MGNA 4CRXA 2RHGB 3WGIA 2ZAGA 3LX5A 5BN3A 3EN0A 3JAWA 4FYVA 4N0QA 3L02A 4MZXA 5M3BA 2WB2A 2C4WA 4FX2A 4KMSA 4RTRA 4HUJA 1P60A 2XOXA 4EJFA 2YZNA 2CYAA 2PT7A 1WNFA 1HFJA 3HLTA 4US1R 3UBTA 2HMWA 1QFXA 3CH4B 4TL9A 3B3JA 1RRVA 4URFA 1SG0A 3F97A 1EQUA 4TWZA 4A6DA 3PR3A 3NVKI 3E4DA 3C16C 3NBKA 4QGAA 1YD7A 2J5KA 2P11A 1WCXA 3MHTA 1P29A 3PSAA 3V1UA 1BPBA 1T8RA 2F3PA 5EI5A 4O3SA 2FETA 1N5XA 1H05A 2PRKA 2IC5A 2AUMA 3BAFA 1AUPA 3D3EA 3OZXA 5CHYA 2ZE6A 5CGZA 2O3RA 1PTKA 3EQ2A 1WNTA 3ORFA 4A82A 4EO4A 2AS0A 2JIQA 1DU4A 1SN7A 3LL4A 3QXXA 4CQMB 3VKGA 3VJKA 1YQ9A 4KMUA 2Q45A 1Q21A 1RE0A 2QJTA 2ZTMA 3IUQA 4LY3A 1OIXA 1TGYA 2MMGA 4PG5A 4UAVA 1BVRA 4PLCA 1TMGE 1OBHA 3WLSA 5JAPA 1SUAA 3BBPA 4GECA 4YGYA 3HEMA 1DAMA 2QD5A 2R7AA 2NW6A 2I7DA 4HVTA 1EFDN 2DUMA 4DE5A 4XGKA 4IS7A 2ORED 4P80A 4IDAA 3VPCA 3U4MA 4WNIA 1HORA 3DYVA 2DVMA 3C6XA 3MS2A 4QXPA 3PSIA 1OR8A 3R40A 2BCRA 1NW7A 3FLAA 5FHQA 2DL0A 5B4TA 1JR3D 3SZMA 1UQVA 4DWJA 4DO9A 1LDGA 2YYSA 5F33A 4AYTA 1DJQA 3N0TA 1LCIA 2HJHA 3K5HA 2WDPA 5EHNA 1FSSA 3NYQA 1ZOLA 7ICFA 1HG0A 2DOKA 4W9NC 8LDHA 4Z0TA 3MGVA 3CNOA 4OMUA 1IOZA 4OQMA 3UJNA 4LN1A 1H5QA 1WV1A 1KIAA 2BR0A 3RVDA 2ALZA 3W78A 1MAAA 1K63A 4AQ7A 3QEKA 2DY1A 4NKRA 4QDKA 1V8ZA 4L5IA 3V3TA 4UFPA 4PRKA 3QSYA 2WU8A 1JGTA 3BZWA 3DT6A 1G5RA 3GROA 4C4SA 4OG2A 4US0R 4UUBA 2BAGA 4YCCA 1SB3C 5DGDA 3LXRA 1MT0A 5H59A 5LLSA 1WPQA 1JWBB 3PNQA 1ZUWA 3ZC3A 2UUCB 1OLSB 2IQIA 3PPXA 4KACA 4HLUA 1IDOA 2BGJA 1W36C 1T2FA 2BI4A 3UXPA 1C29B 1M75A 4LJ4A 1TTQB 3LLCA 3AR2A 2RHFA 2H29A 3AEKB 1IZ9A 3F3MA 4RYLA 4UU8A 2ODWA 3R8CA 5HQJA 1WV0A 4MUIA 3HB7A 2AFHA 2OCIA 4I8DA 4NL4H 3T7AA 2WC1A 2DWQA 1JB1A 4DYHA 1SKSA 4NV1A 2ADFA 3AEZA 4O08A 9ICKA 1Q11A 2LTAA 5AJVB 3KZXA 4RFLA 2NV6A 1BX1A 2QP9X 1ECBA 4OHVA 3Q0IA 3MGBA 4X85A 2X3UA 1BDBA 1C14A 9ICOA 3RFXA 4N3GA 4BN5A 4C0LA 1B14A 1ZW1A 2GKGA 4KN8A 1TTTA 1S0NA 3EMBA 5DTMA 2ZDGA 2OQ2A 4D0GA 3MINB 1Z08A 3QFTA 3IEXA 1N6HA 2PJUA 3JRWA 3BJYA 5C81A 2J08A 1SOAA 2PYIA 1NW9B 1FX0B 2YWJA 4OGWA 3VJMA 1KKXA 3HCWA 2J59A 5D51S 1O97C 4IHJB 4TT3D 3RFAA 1WPXA 4DLZA 1HSOA 1F4VA 2W0MA 4B8ZA 3QVWA 4JQZA 3A3KA 1E4VA 2VRCD 4IOKA 4RENA 1VIMA 3G68A 1SBQA 3W6PA 1EGVB 1ZM2A 3K8OE 1Y3CE 2VNIA 3AINA 3HLKA 3JASA 4I36A 4RO0A 4U3JB 4WCFC 4R83A 4BKMA 3DFMA 1QQBA 1PFGA 1HE2A 3CUWA 2C61A 2ZVJA 2XB6A 4DLRA 3ICEA 4G89A 2J5BA 2GCOA 3FPGA 1CT9A 1CZUA 1FYFA 2CYCA 1MPTA 4G0NA 2JHDA 5KT6A 1XEXB 2YN4A 1U49A 3KWLA 3H97A 3R4CA 5KG2A 1GTL1 1L7DA 1Y9AA 3BJRA 2BPCA 2CZGA 8ICCA 1V3TA 5HGJA 3CO5A 5JD3A 3O4IA 2AB0A 2FP3A 3AU9A 4N0EA 1Z2OX 2OHGA 5EPUA 4OJOA 2C3MA 2ZI5A 4KJXA 4TL7A 5DV9A 2LNDA 6LDHA 5GJVC 2VF7A 2B92A 5ELLA 2FKNA 4XZ3A 1A9TA 4QZ9A 1U8FO 1V39A 4TM7A 3TDMA 2VJOA 3CZ4A 2IMWP 1ECLA 1SFRA 3SDSA 2H1RA 5LZ5A 8ICEA 3PHLA 3OQNA 3BZBA 2KX7A 1IQPA 3WZ2A 2EDAA 1COOA 1R0YA 4UAYA 1KXZA 3PYXA 4FMCB 4LRTB 5TF4A 5HQ3A 1Y1KE 3Q87B 4N9WA 4JMUA 4OM8A 1C9YA 7ICSA 2IW3A 2QTVA 4IWXA 4WXYB 3WLEA 3UOGA 4HK4A 3ZDQA 1HWYA 1LPMA 2CMHA 3QHPA 4FOTA 2QARA 3JQ8A 1W0JD 3GLUA 4GPZA 1RAIA 3TJRA 1HY3A 3R7DA 3TG8A 3A2KA 1L5HB 3FW1A 5IC5A 5CDFE 1BMQA 3WP0A 2SNIE 1E3EA 1E89A 5CXXA 4IEEA 5AM1A 1UBFA 4BMXA 3P0RA 1QLWA 2ZJ5A 5F3XB 3FC4A 2ORYA 4ISBA 4LF9B 2HWKA 4DJEC 5EWGA 5ETJA 3K35A 1CK4A 1C3OA 3GGDA 1ZSVA 2AT1A 3U3RA 1SXJE 4GYYA 3V4FA 4CNBA 5A4IS 1X2IA 3DFZA 4P54A 4Q02A 5KYVA 2HNBA 1DIAA 5EOVA 2QLBA 1SMKA 5EIBC 5ALWA 5BSUA 4RAQA 2G7MC 3WLJA 4QW8A 1YK1A 1K7YA 3PL5A 4M55A 4MWEA 1AROP 2IE0A 3RUDA 4LZDA 2IHJA 3QI7A 1OHHD 5FA6A 1NK7A 4CMEA 2KS6A 1XAIA 2XHZA 1SJ9A 2ZATA 1NI4A 4NESA 4NH4A 2P41A 2AMFA 4TZTA 5EWJA 3E27A 2QZ9A 3VBCA 3VUFA 4DZTA 1SOWA 1J33A 3A0RB 2J45A 1JFLA 3V6JA 3DR5A 3NVVA 2HRCA 4IFBA 1X40A 1EVYA 3K1JA 1VJ1A 4K9NA 2D3WA 3JWPA 2BDEA 3WMRA 4B5KA 1WF6A 5AW2A 3ONWA 3O8OB 5DLQC 2I8CA 2BFBA 2JAWA 3SAGA 3UMRA 5F7OA 5IVIA 1JHRA 3OQOA 1P2BA 2F90A 3B2QA 2VATA 1ORRA 3FUTA 4RBNA 1QIFA 2C8VA 1XA4A 3E0FA 1Q3HA 3AERA 2C96A 3GEGA 1E3DA 1Z2PX 3QU7A 3EWSA 4GP6A 3Q11A 4POOA 4KTQA 2JJ8A 4JB8A 4LRUA 3EXAA 2A59A 1I7PA 4BV8A 1TD9A 3F90A 1XYGA 4PAOA 4O4HB 4YVFA 3SDZA 3LKZA 1UH5A 2J8ZA 2QGFA 1C1XA 2WLSA 9ICGA 5I9BA 7REQB 2SCUB 4KX3A 3A26A 4M1EA 2ZTDA 2XCOA 2Z5VA 4V0QA 5DCYA 4CG1A 5B1YA 3AEUB 4JLWA 1DEAA 5G0UA 5DXFA 4Y6SA 2WF6A 2PUHA 1G64A 1ONSA 3BG5A 1FU4A 3PNVA 3RYHB 2R8GA 1U47A 3JQBA 4HVLA 7YASA 1UK6A 4AKSA 4TT8A 4QDTA 2XMCA 2RMKA 4R51A 2HC9A 4CCYB 1TKBA 4JD5A 2WPDD 3CTMA 3IQFA 2QSZA 4D0NA 1HL7A 3FUCA 3AIKA 1RYHA 1NOIA 3LLSA 3TSCA 3ANTA 4R66A 3KRTA 1I0LA 3PFKA 2Z3ZA 4P4GA 4PX3A 3PFBA 2ZIFA 3GLHA 3U4GA 4NCBA 2Q5QA 1GYRA 2PXCA 4U9UA 1V1MB 1CQIA 3Q4GA 1V11B 5F78A 4Z0HO 3PENA 3N70A 1C3XA 4J1SA 5L1JA 1PT5A 4E2XA 4CIBA 3DCYA 1QRRA 3T3GA 2EKBA 4G0XA 1BFKA 3UB2A 1E8NA 3ZCSA 4W5WA 5H9VA 1Z4QA 3HN2A 1W0KD 1U0GA 1PZXA 1YR6A 4J9LA 5I9SA 1CEQA 1ZD4A 5DJ5A 4BPBA 1ZHOA 4DLGA 3L4JA 4AZWA 4IILA 5KWIA 1XTKA 1MX9A 2WE8A 4GU5A 4KDEA 1U8XX 4UE3S 2LDBA 4PLPA 1MU0A 1CUUA 3OLYA 1FSZA 3P97A 4U2KA 4BN0A 4FDMA 1OKKA 4ZI3A 2JJ1A 4WK2B 2EKQA 4JMPA 1CP3A 1LNSA 3SFTA 1PF7E 4DF8A 2C99A 4RUCA 1L5UA 2AFIA 3C14C 4W1PA 2GERA 3ZLBA 4KQGA 2R18A 1JAIA 4PAMA 5FPTA 3BRSA 4ENQA 5JADA 3CVXA 2GBPA 1GKUB 3C1UA 4P0QA 4GZ5A 2WWIA 3N2KA 5I7HA 1J8VA 4TTIA 4ZAYA 3ZCRA 2C8JA 1N5WA 3VNUA 1QHFA 1D4FA 1WZCA 2QL6A 2PZ8A 4M0DA 2RG7A 1NUTA 1QCCA 3K4HA 1Z12A 4BNXA 4F4JA 2NQ8A 3RB3A 2DPXA 3O8QA 4GYJA 3CPHA 4HDKA 1KZ1A 3KR0A 1UR5A 4N12A 4QU5A 1DS6A 4PYJA 3DFKA 2J9YB 4DQRA 4Q21A 2OBFA 5T6MA 4JJAA 1MO6A 3NRZA 3OQMA 1JB9A 1OV6A 5IS2A 4UXIA 5A4AA 1IBKB 1T6BY 5LNK6 1MJGM 2C07A 3RAQA 2UDPA 3QWFA 4Z1MA 1GL7A 2HM7A 1Y6RA 4N5IX 1OT3A 3U09A 1KI7A 2P9HA 3BTUA 3OWXA 4DBZA 3MQFA 1A8IA 4X7MA 5A6SB 3VV3A 4Z7OB 3HA7A 1CSEE 4OFWA 3MOIA 4PG7A 4D9EA 3PEWA 4TYYA 3O2JA 3I6BA 4FSHA 1B2RA 4KDCA 2P66A 2VT3A 2IXEA 3PUXA 4U6NA 5EMHA 2R6ZA 1P7YA 3E7DA 4M0FA 3W8DA 2FMTA 3RK1A 4TLAA 4D0SA 4DWIA 3WSVA 4ECAA 3F67A 1KIMA 3G6XA 1M2EA 1KO7A 4KEAA 4MUHA 3V46A 4CMBA 4H3SA 3R7NA 3WHPA 1A7AA 1AZSC 1VPLA 2FA9A 3AB7A 3IOBA 4J1TC 2IKSA 3C29A 3B8EA 1B16A 5AI8A 2AVDA 3OJSA 3JPPA 2ATLA 4M9NA 1T9CA 1X80A 3E3LA 1JEDA 3LKVA 3PUYA 5CM8B 5BPFA 4NU5A 3FMVA 3RJHA 5K2MA 4B3XA 4ZK2A 5BV7A 2FE9A 1O94A 3NGXA 4MR9B 4QDXA 5CVEA 3WDKA 4D0RA 5BN5A 3WB9A 1X2BA 2X77A 5EXSA 4OLJA 2VJ4A 1ZMRA 4JA0A 1L7QA 1MG5A 3T95A 1NBMD 1THTA 1TYAE 1ZD2P 2LD4A 2HQRA 3O4JA 2ZTSA 2R87A 3U0VA 4FBUA 1FBTA 3E18A 4FHDA 2R7LA 4AXBA 5E0OA 4RLSA 5C8ZA 3IOEA 1HQKA 4R5MA 1TL7C 3V4SA 2Z57A 2C77A 2GF0A 2QRKA 3SR6A 7ICUA 1E2FA 2YHBA 3EH1A 1QJCA 2YX1A 3I72A 4KPGA 3RJ5A 1YZLA 4B35A 4F7WA 3BZUA 1VHQA 4F2DA 5JNRA 4PNEA 1ZR4A 1XQVA 3BK7A 2ZYHA 3I4LA 4R1PA 3X1YA 5C37A 3GP5A 5CLJA 5AUQA 3LYHA 5DDYA 2ZK7A 1DINA 4LC1A 4WBNA 3ZU6A 1BVYF 1NJSA 1TJPB 2C98A 4R8SA 3UV3A 3WJAA 2VR1A 4EHNA 3EGDB 4C76A 3JSXA 5EERA 2WF7A 5LPNA 1OH5A 3ZX5A 4WLOA 1GRNA 2M6SA 5C2JB 2NPOA 2EQYA 1UMBA 2HA6A 2WTXA 4FN5A 4MYCA 4FSXA 2EV9A 3WRXC 1Z0KA 3HKZF 1SD5A 2IGTA 1JYFA 4GR5A 4QPJC 3VOAA 2XIQA 4ZZ0A 5BUCA 4AKGA 3HJCA 2V7QA 5EPOA 1WB9A 2WTMA 2WAQF 2F3UA 2HJRA 2JGDB 3I1JA 3O91A 2VAPA 4K03A 2CV0A 2RJOA 3T54A 3UQZA 1RPTA 2PMZF 1HRDA 5KMGB 4L8GA 2QXTA 3QF4B 2ZDHA 2Q7OE 3ZZMA 4C2AA 4K6CA 4Q16A 1RYMA 3UO8B 1A77A 3RRFA 4R9UC 4UCXA 5FL7D 1ID1A 1SD2A 1ZJJA 3LVFO 3N76A 3DBOB 5IN5A 5INTA 3QIVA 1S4MA 4IQ4A 1RJGA 1NJ5A 2HGZA 2HJGA 3LGSA 3MGIA 1D6MA 4GMFA 1QONA 1A0OA 4RSHA 2XY6A 4RSRA 5ICFA 4BKRA 4C20A 1I5EA 3E7FA 1F2DA 4AMUA 1SCUB 4QTTB 3DTVA 2BHTA 3FWYA 4X24A 1WR8A 3ZWBA 1FBNA 3W1WA 3WBKA 2ASVA 4F3NA 3EMKA 1U4BA 4B3MB 1AUQA 4JKOA 2QTRA 3T8YA 4R69A 1VB3A 4YIHA 3FVVA 1DUVG 3JALB 3MGKA 4XTRA 1UJ4A 2VJNA 3UXNA 4B32A 2X9VA 3CUYA 4KC0A 4M37A 4RTMA 4NBKA 1TGVA 1HEIA 3O73A 2FPGB 3TW4A 4J6EA 3FF1A 4UOEA 1I1OA 3PWZA 2NUTA 3GGPA 4E5DA 2P79A 1R6AA 1ADFA 3B6MA 4WVLA 2IDZA 2UYYA 3FPJA 3HJTA 1NLFA 1JLKA 2DFDA 2PKYX 2VHEA 1Z62A 1JT9A 3V8MA 2H1OA 3ICQB 1ZNXA 1HFEL 3A6HA 3I0NA 1E6KA 2X40A 1NLMA 2HFJA 5DLEA 5KMGA 1M5RA 4M49A 1T9AA 2EJVA 1NRJB 3LHKA 4KR9A 3VOTA 5FH9A 2F8MA 3ERCA 1QGAA 2A5JA 3RTGA 1WCIA 4H1HA 3ZV7A 3FCXA 5I4IA 4ZO9A 3RKUA 2P65A 2XGGA 2XY4A 3KXIA 1QIMA 1PJBA 1Z82A 2C20A 3KZKA 3OIGA 1BX0A 4Q3DA 4U6QA 4XLTA 4YP6A 1U8TA 3VZBA 5K99A 3JY6A 4BFYA 3PV8A 5A6VA 5E4TA 1P45A 5DHRA 1U45A 2ID8A 2YASA 3L05A 5LBIA 3GFVA 4D8UA 3FYTA 5AKZA 2IFTA 1O5OA 3LPDA 3ZWWA 3E9YA 4YRJA 4BKPA 5LM3A 4CF5A 4YB8A 1T1EA 3AMVA 2BCQA 1V8PA 4IV8A 3QTBA 4PSKA 3OC6A 4A7PA 2R85A 2RE8A 5L1IA 1P8AA 3TIFA 4WLFA 2KNJA 1T2CA 2R7MA 2I4TA 5CA1A 1WO8A 1XCJA 5KHAA 2O2CA 2OGWA 3CMMA 4RK4A 3O83A 2A7XA 2NV2B 2CXOA 3DUFA 3EVCA 4I4CA 4Y18A 1E63A 1ZC4A 2PSDA 4P3KA 1MNQA 1U0HC 4IJ6A 2VIIA 5HK8A 1HE8B 1JKXA 2OCLA 4JVLA 3OEED 4AMVA 4OJ6A 3D6UA 3ZWNA 3JW8A 4FDTA 3SVLA 1X7WA 3N8IA 1JH8A 5EJ6A 3RRGA 2PZAA 3LT1A 4D81A 3VXKA 4QECA 2C5LA 5ILQA 2E85A 2UUPA 2VEDA 2A3VA 1G9SA 4P92A 1SO8A 4EMUA 3OU7A 1L4LA 2JEGA 2YNMC 1Q1AA 3R7AA 3LOQA 1ZY2A 1NJYA 3IN5A 4ZCPA 2QVXX 4DR6B 1RI4A 2Q0SA 4J2TA 4ARVA 1R4NA 3ID6C 1DIGA 1VJCA 1XTVA 1IN5A 2YR0A 2PFKA 4DS4A 1O8BA 2ZYUX 2XB9A 3C8HA 3CB2A 3C8ZA 3FOAA 4GC9A 3DHVA 3VGPA 4B31A 4OBXA 4DWVA 1JJ7A 4RORA 2JF0A 4P81A 3W05A 2JFVA 2QA5A 4LEIA 5BW8A 4EGSA 2C5FA 2YV5A 1Z18A 3PEUA 4KYTA 2LXNA 3F74A 4RLFA 3RW9A 3DV2A 4FUTA 2FJ6A 4KAJA 4LS3A 2OG2A 4PIMA 5F35A 4R1MA 1B00A 1GZDA 4QU0A 1GR0A 1E18A 1YGYA 1JPJA 1QDEA 2Q1YA 4L8VA 1ZA2A 2LV8A 4OHUA 2CGEA 4CLOA 1NX9A 1Y5LA 3HC7A 1NZFA 2E37A 4MUEA 4TQ9A 4B45A 5REQA 1IXRA 4CKWA 4Y9UA 3QE9Y 2A9PA 3CONA 1WMBA 3EDQA 3K0EA 2R751 5JLAA 4DM4A 2GN1A 2XAAA 1U5BB 2OMKA 1KSHA 3C7KA 3N6XA 4O3RA 4IH1A 4X5OA 4ZICA 2DC1A 1G59A 1IN1A 1SC4A 1EX1A 5J8YA 4F9TA 1HK7A 2R8JA 2VH2A 3G8BA 1CY2A 1NXSA 1XCMA 4GR4A 5DW0A 1TCVA 5FADA 5I5GA 3ZU5A 3L6OO 4BS9A 2ZBPA 4JJFA 3CURA 5CFLA 3PGVA 5KT5A 4Y2YA 2BZGA 1NQWA 3BHMA 2WA2A 3PF8A 2Q6IA 3S4YA 4DLPA 3ZE2B 3R0VA 1NFFA 4E09A 3PC6A 2X4GA 3Q0TA 4XDGA 5IBPA 2JEFA 3V33A 3V8EA 2Q7XA 2GLTA 3H86A 2Z5GA 5DP2A 1C4OA 2MYUA 1RRKA 1R16A 4BLOA 4BJHB 1DXSA 5GTIU 2EHDA 3EQZA 4D6PA 1A2BA 1EVEA 5L3ZA 4WLEA 3K0BA 4M7PA 3LTNC 4JXZA 4N5MA 1E2UA 2J0UB 2OZKA 5TPWB 4ALJA 1U6JA 1FF9A 4XWGA 2JIRA 2BFBB 4FONA 4OAPA 3L7NA 2Q6VA 4GRIA 4TVKA 4XFDA 4IIFA 4BLRA 1RAAA 1SCDA 5JNSA 3ZY4A 3W04A 1VKZA 1WXIA 3V1TC 4EQZA 3M5WA 3QG1A 1ZQLA 4O4LB 3T5DA 1V11A 3ZBQA 2FZ4A 4XD7A 3RB6A 4KXXA 2M9MA 2H7CA 2NO1A 2VDJA 1E6LA 3ONNA 3EDCA 5CDTA 4O4HA 4DGQA 4WERA 3GVPA 5GGXA 2E8PA 2ILVA 4DABA 4ESOA 2PBFA 3FTNA 3LM8A 2W2KA 3SFZA 4TVSA 2W4MA 3HJUA 1GG9A 4K81B 5ECWA 1NA5A 5H81A 2YWHA 2QX6A 1FE8A 4BO1A 5G0WA 3GQBB 3VYSB 3ZBTA 2Q9BA 4DSZA 4US9A 1Z15A 4D3YA 5HF8A 2BFDB 1KFDA 1YDWA 1YZ7A 1YQDA 3FPCA 3IP7A 4YJ3F 2OV2A 3HHEA 1RABA 1LNZA 3LYLA 1QORA 3WI7A 4B4WA 3FZEA 2GO1A 3V9AA 4L2IA 2XUGA 3HRKA 1IY2A 2W04A 2DBRA 3AL2A 3CBGA 3MTBA 4MVWA 3R6WA 2AX4A 1M6VB 4M0PA 4RQ0A 3LIIA 4W6QA 4WZAE 3TS1A 2HYIC 2PKEA 4Q8EA 3WKEA 3CX7A 4KQKA 2AFIB 3NH6A 3AU6A 3WAGA 2OORA 4Z9FA 1H3NA 1C7EA 3OCVA 1CQIB 1S4QA 2G1UA 1X19A 1SHLA 2QB0B 3AY0A 4N8SA 3SHVA 1YMUA 4IV0A 1SCJA 3ILYA 3O4RA 4YR3A 5HF6A 3V2GA 3O9MA 4FD2A 3LVRE 1P4HA 2VAWA 5E7IA 3JRNA 5EHQA 5D85A 5KYXA 4IDNA 1AIPA 1XVIA 3BN3A 4L4RA 2PUFA 4G86A 4PXAA 5DKWA 1U7TA 2COKA 1VL1A 4H4CA 4UEJA 4IEFB 5GONA 3SCZA 1XPUA 3AVQA 1SHJA 3OIFA 1UXJA 3F6BX 2V7PA 3FWPA 4QGSA 2ZWOA 3LCMA 4CTKA 1ZJMA 2XVTA 1EFKA 3GCDA 2D7JA 2AV6A 2J33A 3E5NA 3OHPA 2Q2OA 4KRYA 5FUVA 4BGUA 1GSIA 1PZMA 1XT6A 1IM8A 1Y7IA 1AQYA 2OENG 5F9LA 2O2IA 3NIGB 2GTIA 4H7KA 4ZYVA 3K1RB 4GI7A 1C8KA 1N6NA 4G0QA 3T94A 2O8FA 3NTXA 5P21A 2EZUA 1XTJA 4QICA 3M82A 4HVCA 3E53A 4NXNB 3AM1A 4DLKA 1XCPA 1Z4IA 3VO2A 4D4GA 2PLFA 4GPEA 3DNPA 3AF0A 1P6QA 5AI0A 2OXTA 3PX3A 4TLCA 2DLCX 1FP4B 1SOUA 1ZVKA 4ROTA 1TVMA 1WU8A 3MJVA 1ABBA 4GPBA 3UAOA 3ECAA 5KVCA 1T0BA 2ZITA 4OI0A 1A9XA 4DSLA 2P5SA 4MUFA 5J2UF 1M1YE 2YRXA 1EX6A 3C2MA 3DAYA 2JEOA 2R6JA 3A1WA 3ADKA 4ADSG 1CERA 5JSKA 1DLJA 5DPMA 3K9FC 3LVVA 4X41A 1IEVA 4OX9B 1RQ2A 1SVSA 4RKRA 1QV7A 1B8OA 3JQGA 1KEPA 4RQ2A 1E77A 1ORHA 3K0CA 3KG2A 1R66A 1VHLA 1HZZA 3UWDA 3W8EA 4DA8A 3DXFA 1J22A 2W8ZA 1K7EB 2VUSA 2G5IB 3FHLA 2OLKA 2R25B 3FR7A 3KCNA 5E7MA 1YZVA 4LSMA 5JCJD 4GX0A 1ZQAA 2ODTX 4RHUA 3IB3A 4NV0A 2GOLA 3DP9A 5E7QA 4UEWA 1ST3A 3PUHA 4EO7A 4OLBA 4LUCA 3GDFA 1XKXA 1Z45A 3EZNA 4MKIA 5IH7A 2XQFA 4XB6B 1G21B 1PBTA 1VGRA 4BEVA 3OSUA 4JYCA 1DZ3A 1R5NA 5J40A 3E0QA 5FUYA 3KEGA 1X8XA 2HCFA 1QIGA 3Q8WA 4UB4A 1EM8B 3SQIA 1J21A 2OM6A 1UT6A 3AUAA 5LYJA 1WE2A 2D62A 2FMHA 4FI3F 3NAQA 3DEYX 3KUKA 1ZCAA 1LZKA 5DBBA 1GCGA 1L7AA 1TYBE 4IIEA 3UN1A 4D8YA 2F9FA 1X80B 4P4OA 3I8OA 3H8SA 5JROA 4PQEA 3JD4A 4HRVA 4LMRA 4IP0A 2F62A 2R60A 2JLSA 4MTCA 1NDQA 3PQCA 6AT1A 5ITSA 5DQHA 4IYRA 5DLYA 2G5HB 2JBWA 1O0SA 2TYSB 5AP9A 2I9PA 1O96B 1U2GC 2ZJ7A 2R8EA 2QG6A 3F6RA 3FG9A 4RK6A 4E03A 3FUXA 3NW9A 3OPNA 3MMNA 4ZCTA 2IRWA 3M6FA 1JEEA 1BU8A 4NOJA 5EXPA 3F5SA 1LD3A 3JQRA 3KSMA 2DZDA 2I6GA 2Y9UA 5HIJA 1CRZA 1CQZA 1OGIA 1M1XB 1ISJA 2ZJ4A 3MWDB 3PGMA 3UYKA 3UJCA 2YY6A 1M73E 2FW7A 2QF7A 4HXGA 1X1TA 2BHLA 4NIMA 4UBNA 2FDCA 2IV7A 5KFJA 3PFGA 1CR6A 5T8KA 3RG2A 1BFDA 1KRWA 3I64A 1MTOA 1ICEA 4MR8A 2CLFB 2JDIA 1THGA 3SYMA 4XWKA 1FDRA 2QTFA 4NFHA 1G4UR 1GPDG 2A67A 1PZNA 4Z4CA 3PA6A 2OYCA 2VOJA 5K8IA 3COWA 1DC8A 2E9SA 4OYRA 3QRWA 1DI0A 1IZ7A 3KPWA 4PW0A 1N2XA 1CIPA 1ZGBA 4LYDA 1SWVA 1GEGA 1JV2B 2CNDA 3G8AA 4MLPA 3DONA 4LRWA 4CG2A 1A71A 2B61A 3BA6A 4UNRA 1G7RA 4MPPA 1ZXXA 1N48A 5EMMA 1X1QA 3L8ZA 4JLOA 4EYQA 3WZMA 2QRPA 9ICCA 1N5RA 5G5GA 3N8GA 1FVXA 4F1WA 1JHXA 2BJWA 3M5CA 1SQ6A 2ZJ8A 5GPBA 5BPCA 2Y4OA 3I04M 4WKPA 2OEHA 2C7VA 2QL5A 3HFRA 3KU1A 3GNTA 3KQSA 1ZQFA 4TUYF 5IF9A 5C5DA 3IBGA 1EUCA 1L8XA 1PZEA 4I1YA 4UHCA 5JDIA 1F8GA 1L5KA 4EHBA 3AESB 5SZJA 3DE0X 3HU1A 4BP3A 2MJLA 3S27A 5DQIA 2V7QD 1JIQA 3LX4A 1T6XA 4TKMA 5CYPA 4QG7A 3RJTA 5K6AC 4K7JA 3AV0B 3ALRA 5LL6P 1QLNA 2OGUA 1WUIS 1XZHA 3RS8A 3EARA 3SI7A 1QRUA 3SJAA 2KJ9A 2ASDA 3ZHUA 4ZVQA 2GAJA 5IJZA 5HR7A 3HFGA 2BEUA 3X2EA 3LVWA 3BMQB 2V6MA 1N2CA 3PHCA 4PWZA 5DGTA 5ADVA 5TQJA 1QXSA 1A69A 5ALJA 3IHQB 1X7XA 3JQ7A 5EJ8A 4MF2A 1WBBA 1SG6A 1D8BA 1G6HA 1COWD 3K1TA 1HEKA 2VBGA 3LK6A 3LUCA 4NEGA 2GZRA 3ROTA 2C78A 3OG9A 2GD1O 3F4LA 3DO6A 2A19A 5HSGA 4KNVA 4TYWA 1DEOA 4NZPA 5F3WB 4G84A 2XXAB 3AZPA 4PQGA 5FTKA 1KEWA 3LHDA 5IXYA 4BX9A 2Q41A 1A7KA 1UPAA 2ERYA 3LDHA 3N5KA 1K3FA 2CD7A 1T1RA 1YBHA 2GA9A 2HA0A 5DBFA 3D7NA 5L3QA 3THXA 5HOQA 4OI2A 1C9JA 2LIPA 3ZJVA 2XT6A 2IW1A 2E87A 3URKA 3IXMA 4B3RB 1SU7A 1GDDA 1O95C 4K3VA 4ZC1A 1TE2A 3IRVA 2D5BA 3ZNOA 3ZNQA 1BN6A 3RTCA 4KX5A 3KQMA 4FOSA 5F73A 5CFRA 3I6MA 3ZJTA 2XT0A 1QE5A 3MJFA 4EBEA 3WMEA 1IBSA 1B8UA 2MR6A 4AJOA 4EGQA 2Z83A 2BCEA 3ZUGA 4F6RB 1KZGB 1L4HA 5AHWA 3FI9A 4FFBA 3T52A 3OE4A 3BS7A 5TNXA 4ZZIA 1KEUA 1OZAA 2EBUA 1TLFA 2I78A 5EWMA 3UHJA 4QYIB 4XVUA 1NN0A 4B34A 2C88A 1IN8A 3MN1A 3MA0A 1ZH0A 3JQ7B 5H80A 2EKPA 4HCJA 3EK2A 1IJKA 1ECJA 4L1KA 4JCOA 4NDZA 4GOKA 2BM0A 3V4PB 1Z0JA 2ZWMA 4TGLA 1ZQVA 3V4OA 3VAYA 4HNRA 8ICVA 3Q7EA 3Q9LA 2ATEA 3E2EA 4EYGA 3MTDA 4IHKA 2ZJYA 4UTZA 4ECSA 4OQYA 5THQA 3GV0A 3EVZA 1KMHB 5DBEX 3B0YA 3E3AA 5KTYA 4HSGA 4GLOA 4FCVA 5CEHA 2CHQA 2PS0A 2L18A 2JD1A 1TK2A 1IB0A 5CRIA 2BDPA 3WL5A 1UOPA 4TLMB 5KVAA 5DNDA 4MHTA 2WU4A 3KPJA 4R2KA 3PZRA 2HBRA 2RAPA 1JRPA 4GLFA 121PA 3UT6A 4BNZA 4BVHA 1YCHA 4ITVA 1P80A 3MSXA 1EUYA 3KAQA 4F4UA 3D2QA 4ED0A 4G2TA 2KM1A 4JR2A 4QATA 1HUOA 3CW8X 4RZXA 1JR6A 3KDPA 1HM5A 2CXXA 2Z9BA 3C3PA 4FFBB 2E21A 4QNLA 1J24A 2DKOA 2RGXA 2GTPA 2VUHB 1X70A 3UY4A 4JKYA 4EPRA 3A4TA 3EZ7A 3PUKA 2QUZA 1LI4A 3M6XA 5CPBA 3N2EA 2FQ1A 1Y5IA 1XTQA 2RONA 2ZRPA 4O5AA 4UNIA 1YR3A 2L17A 3WK9A 4JI8B 1PU2A 2PMDA 3QLTA 1FTNA 2IBKA 2VBFA 5F64A 2F48A 3HMQA 4YV1A 5ITZB 2XDWA 5LQCA 1O7JA 4DC1A 3FN4A 4AX4A 1RG6A 1CJMA 1GA4A 1PW7A 3H75A 5HBGA 1EEXB 4NTZA 2DR3A 3RG8A 3IAHA 2KE7A 1TDJA 2PJZA 2W71A 4MS1A 4J90A 2VDVE 3BMNB 4U39A 2EBWA 2YJ4A 1ZCBA 4EHHA 4NECA 4B4KA 1XDSA 9ICEA 3LP8A 3JWJA 4ECTA 4UDNA 1ESDA 1HTBA 5HR6A 1EXVA 3PHHA 4C4ZA 1C0EA 3VDQA 4KAAA 4EI8A 2VTKA 2WOJA 1JLHA 2AEEA 2W9BB 6YASA 1C0LA 1LPBB 2ZJBA 3GNLA 1RS0A 1PVQA 2JH9A 3LK9A 1G5HA 2D5IA 3A2NA 3L7MA 3QZ8A 4LECA 3TR0A 2GN6A 2GLEA 3I01M 3R3SA 5JJLA 1E0JA 2IL1A 3I0MA 3LRXA 1KZ9A 2JGRA 3O3CA 3PDJA 2BFOA 3HUTA 2XQGA 3QLUC 4EHFA 5KNDD 4FGUA 2RHJA 1NQ5A 3SMQA 4NE2A 1YZUA 4MW7A 1PFVA 3UF0A 1WTCA 3VYWA 2XBUA 4DDTA 2I3ZA 1SXJB 5IC6A 1TZJA 3K94A 4IIGA 4NMMA 5IT4A 2V6JA 5F2KA 5FWNA 1HUQA 3EDMA 1UJ6A 5J2EA 5KFHA 3FHCB 3AJRA 1BVUA 4NCKA 4N3CA 5JJIA 3EEYA 3EXHC 5CR9A 1YSCA 3OP4A 4QHSA 3KZMA 3MCWA 3V5NA 3QELB 3PR5B 1OLXA 4QPPA 3A6PC 4A10A 5DSTA 2WSMA 1R4NB 4XI9A 3U7QA 4O4JA 2RIRA 4FS3A 3UUEA 4NCNA 5BNTA 3KT3A 4ZEWA 3JPYA 2UYOA 1D7AA 4HYKA 1DWPA 1HO3A 4JR1A 3LY8A 5ES4B 4NL9A 5DOZA 2WAAA 3KOMA 5L3VA 3JWGA 3DEFA 3NHUA 2ONCA 3EHEA 1OBFO 1OYYA 1TZBA 1UDAA 3L1VA 3NVMB 5TLSA 1E66A 5SY6A 1UP7A 4P93A 4F97A 2IEIA 3C48A 2I2CA 2PWAA 1BXGA 4RK1A 3SHFA 1T6YA 3RSFA 3WIDA 4EYOA 2G82A 1AOXA 4CLOB 1XD8A 3PVSA 2VH1A 3NBXX 4NCAA 2W2KB 1UXIA 2GEFA 5J43A 3V72A 3Q85A 3KD3A 1CHDA 3ROFA 4BWFB 4PSUA 3NHKA 4FEEA 1T91A 9MHTA 2F59A 1NVXQ 1E0SA 3K2EA 3RYFA 3V4LA 4NYJQ 1G3UA 4JUFA 4A2WA 3RRYA 4BZZA 1C1XB 5JZBA 1GNTA 1W88A 2AN9A 5EMJA 1VTKA 2EHJA 2JJMA 4NQZA 4NSNA 2DQNB 4PZUA 4UZFA 1YRAA 1Z33A 2I76A 3HP6A 4U02A 3AI7A 3BXXA 5HF5A 2WD9A 4BL5A 2YWRA 4NBTA 3HCBA 4JI2B 2WAOA 4A0SA 3NXKA 1DFHA 4BE7B 2R6R1 3IERA 3M6AA 4XIGS 2OA0A 1XVLA 2I87A 4PXYA 4KLGA 1KFBB 4KXQA 2FFAA 2QKQA 1Q3VA 4MROA 3JSAA 5H82A 1EXWA 2AJTA 3OT4A 3IPRA 1H42A 1OX4B 1CLEA 1GZHB 1ZZEA 3OKPA 2QB5A 3FGOA 5ECYA 8ATCA 3R9WA 5LN1A 1T1GA 3MGAA 3F0TA 5J2TB 1Q7GA 1QDUA 2PV0A 1S2DA 4WN9B 3AVWA 4NY1A 4F4DA 1L7VC 4I1PA 3FTFA 4BO9A 1UINA 1NF2A 1NK8A 4Z6DA 1E3QA 2V7XA 4P22A 4P7BA 4DJTA 5ICCA 3KLMX 2LCIA 2KHQA 8GPBA 3DHYA 4AN1A 1HG1A 1ETUA 1QC5A 1SBIA 4CUKA 1NBMA 1JJBA 2QGNA 5SZIA 1PS9A 1G9TA 3MUEA 1JKJA 3MFQA 4ZI2A 2PI4A 2BPFA 8ICFA 1D1QA 3N0XA 5K20A 3IA2A 2EEZA 4FE3A 1GNVA 2NN3C 3COYA 4YLGA 4Y30A 3TBHA 4WL0A 4C5AA 2AN4A 2IYOA 4ZDWA 1XX6A 2FPPA 4X97A 4YUAA 1BWQA 2C5GA 1TVAA 1JF8A 2E2WA 2EX1A 2IDMA 2IEDA 3D59A 3FD8A 3H1GA 4XB1A 3VQTA 1TZ2A 4QDJA 4Z1MD 3B7WA 4FE7A 3MCAA 2A0KA 2FFJA 5F9MA 3PJEA 2O5EA 4DZZA 4IVNA 2XCSB 1A5TA 2XE6A 3RSCA 3WB0A 1PWHA 3D7KA 1FPMA 1D6NA 3S2SA 3P26A 1F2TB 1RKUA 2H92A 1ZC3A 4WVFA 3TPZA 1ZUNA 3AO0B 4PSVA 3FUWA 4PTYA 2OZLA 4AY5A 5KINB 5KT3A 1UDWA 1AK1A 2REQB 5FOTA 3QBEA 3RHSA 5CNMA 3HJEA 2EU8A 4YHHB 5A5VA 2F8KA 4QELA 2IU3A 4RUKA 4E15A 4A0GA 4BX2A 5AVOA 5H3HA 3LCRA 2J3EA 3ABOB 3R3UA 4ZQEA 3S8MA 4AG6A 4BGEA 3BCUA 1Y0BA 3DWGA 2H48A 9ICVA 3GVXA 1WDMA 5JU6A 1ZXIA 1I3KA 2GH1A 4AO6A 3FCEA 3A05A 3U31A 4KWEA 4TV9A 1JU9A 1KQGA 3N8DA 1T4MA 3W3ZB 4B0PA 4OK3A 4Q3AA 2CL6X 4PFJA 1GQSA 3K30A 3M8KA 3PDCA 1X7HA 3QE0A 2C9OA 1JFFB 1YUMA 4RLQA 3OEHA 3V00A 1TAMA 1V85A 3K53A 3VR5D 5C8DA 2JI8A 4Q43A 2WZCA 3DMFA 2CMFA 3LL7A 3RAPR 1PJTA 5ICSA 3PPVA 4K3UA 2AJCA 2NADA 1EKXA 2HBLA 1WOYA 5CTAA 2J46A 4HLNA 4IQUA 2PPLA 2FF7A 3QU4A 1CUYA 1E5LA 5CDSA 1G8MA 3MS7A 3LQ1A 1J8QA 4RDIA 5AWFC 4YCXA 4MW6A 3VO8A 1GU0A 3N39C 5FOUA 4FB4A 3IJ5A 4YS6A 1M2FA 2G6TA 3DQZA 1OH7A 1JSCA 1VE5A 2HF2A 4MUKA 1I2ZA 4R9SA 1JHDA 1M33A 2AWOA 3JALA 1ZGJA 3PMLA 1Y9JA 1JHQA 4FFNA 4RVCA 1E79D 1LBHA 4Q3EA 3ZJYA 4D2IA 4OO1J 2YIMA 2PGLA 5EIAA 2A9RA 4FW8A 3MB8A 5HR5A 3KQLA 4I7EA 1YO6A 2L42A 4Q9DA 2B6HA 3K72B 5JD6A 2DPIA 5JYBA 2ZZNA 2YV2A 5FOXA 1MW9X 1U3FA 3QJGA 1JAHA 1K6MA 3EFBA 3NEAA 1Y81A 2CNWA 1NKBA 1LS6A 5DISB 2PFNA 2XNJA 4DEZA 5K3FA 2ZAYA 1Q2UA 3LGXA 2JNWA 5HVNA 1ZWKA 3NHLA 4Q47A 2FYTA 4WDRA 5EQDA 4AYBC 4CMKA 1ODJA 4X1YB 1P2GA 2VSFA 3PGJA 3JARA 2R8RA 4IRKA 2VTVA 2BEVB 2PSHA 3M0EA 4GQIA 4B2IA 3O8RA 2ZSJA 3H2YA 1I94B 2PUCA 4HB2A 4RMHA 1YAHA 4ZVRA 3RGWS 1NFRA 4Y6OA 3THVA 3FKSD 1BCSA 4G5OA 1SCBA 1U7OA 5J2TF 1R6XA 3R76A 4QWEA 1AS2A 2CDAA 4OQPA 5I4CA 3ZK7A 3C3JA 2ZSHA 3FUVA 3I92A 3HH8A 1P3DA 4MQEA 4LSGA 4RADA 4XGQA 3LCVB 3UBMA 3WY9A 2E5FA 4ENPA 2CDBA 1I36A 2QZSA 3EF1A 3P9KA 3QUQA 2CPRA 4GOND 4NJMA 4FM9A 3DM5A 3WLTA 1ZRNA 4M54A 5FYQA 3TTWA 3BE5A 4BFXA 3GJ0A 4G81A 1TVCA 3PNKA 1V25A 3UAYA 3DE5X 2JLYA 3C2LA 1U0EA 3GIKA 1QFSA 1TJ4A 1A9PA 1YQUA 2OBMA 3F7MA 3K20A 2E6KA 4YMNA 1XZBA 1KYTA 1T8YA 2C5SA 4I2CA 3MINA 3NTVA 3O8DA 4EF6A 1LH0A 2B69A 1USWA 4IXNA 2GCEA 1FTSA 3A1VA 4EFNA 3NDBB 1TM3E 1MZPA 2YOHA 2FR0A 2HTEA 4X91A 2XO7A 2EP7A 3TNJA 2Q4DA 2OZEA 3RKSA 4PGQA 5B5SA 2B30A 4ZOAA 1P0FA 2NYRA 3R1IA 4RVOA 1L5SA 3P9PA 2FWJA 2NQ2C 2ZJFA 1HURA 3CLHA 3I3SR 4WQMA 3ZCPA 4DJDC 3IDSA 4LDRA 3B78A 3JQ9C 5CNKA 4FGSA 4QO8A 4FHCA 3I05A 5AK4A 2X76A 4A8JA 3HQ4O 3WSTA 1Q1ZA 3AHDA 1RIIA 3JQFA 4MDFA 3C0KA 2O2YA 2HF7A 3FNQA 3RPEA 3NHFA 2QUHA 1XU7A 4TQRA 1SPXA 2C4TA 1FOEB 1MX1A 2F2TA 3PO4A 4KRGA 3GMSA 4Z4FA 1ESMA 1RXEA 3H11A 3OM0A 1KMNA 4A8EA 1AKMA 3HCNA 3PUWA 2FUG1 3RU2A 3WHIA 3ZW8A 4C6RA 2NNLD 5U9CA 1UBTS 1AX9A 1EJBA 3LF2A 1D2NA 4LBWA 4OOEA 3C39A 4XM1A 5LBUA 3KZIU 3ESYA 3SJZA 4AJJA 5IF3A 3H7IA 2QSUA 1SIOA 2AFRA 1KERA 3OZGA 3R0IA 1L3UA 1X6IA 2FP4A 3I2HA 1W85A 3IULA 3NWBA 2FWMX 2AGVA 3DHEA 3KKEA 8ICKA 1K86A 1Z19A 4XIYA 4CR8A 3JYNA 1AO0A 9ICXA 4AUNA 1V96A 4U6PA 3OE5A 1MG0A 1H8HD 1W6RA 2FCAA 1HLFA 2J87A 2WNSA 1YJ8A 3CNBA 2OXIA 4BEJA 2R4UA 2G07A 1LWNA 4RD6A 1M0WA 2GPNA 3GAFA 5H5JA 4YJ2A 3OX2A 3KB8A 4NNJA 3DT9A 3D4IA 4DSNA 1G41A 1OA1A 3AHCA 1NRWA 1UMKA 3NNDA 4Y6GB 4PS0A 1JQ5A 3EC1A 3R9XB 1GUZA 2BMEA 4PYOA 5FX2A 5JQWA 5TGZA 4ZHQF 2QP4A 3P9XA 1W9HA 4A8JB 8ICIA 1BG6A 4E70A 1WW3A 1E4EA 3H3FA 1ODCA 3LPNA 3X3HA 4TTQA 2B2NA 4UNPA 1IIPA 4W7HA 5C8YB 5SZHB 4MYTA 4J9KA 1YA8A 3I1FA 1J0EA 3DQQA 1UKYA 3CLTC 5AUOB 1X7XB 4MH0R 1T3LA 2X2OA 4TOIA 1NVEA 5KKNB 1KNXA 3IVGA 3CJTA 4OBBA 3ZY5A 3KLNA 3QKSB