3I76A

The crystal structure of the orthorhombic form of the putative had-hydrolase yfnb from bacillus subtilis bound to magnesium reveals interdomain movement
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
228
structure length
223
Chain Sequence
KRYRTLLFDVDDTILDFQAAEALALRLLFEDQNIPLTNDMKAQYKTINQGLWRAFEEGKMTRDEVVNTRFSALLKEYGYEADGALLEQKYRRFLEEGHQLIDGAFDLISNLQQQFDLYIVTNGVSHTQYKRLRDSGLFPFFKDIFVSEDTGFQKPMKEYFNYVFERIPQFSAEHTLIIGDSLTADIKGGQLAGLDTCWMNPDMKIIPTYEIRKLEELYHILNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative HAD-hydrolase yfnB
publication title The crystal structure of the orthorhombic form of the putative HAD-hydrolase YfnB from Bacillus subtilis bound to magnesium reveals interdomain movement
rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 87
structure length 223
sequence length 228
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3i76A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3i76A01
2HOQA 1VFPA 3ZVNA 3PGVA 2B8JA 2B1RA 4BYGA 2Q4RA 3NALA 2OYCA 2WHEA 2G06A 3UM9A 1VJ5A 3WK8A 1O03A 5AK6A 1YDFA 5ALLA 1L6RA 1YNSA 2CFSA 2D2VA 1ZRNA 4UATA 2GMWA 3J7TA 4PNHA 1CQZA 1ZD2P 5ALQA 2YMMA 5AKXA 4CE6A 2W43A 4CF4A 1RQNA 4UU0A 3ZVLA 1RKVA 3SMVA 4BKMA 5AW4A 2WF6A 3QU2A 2GFHA 3L8HA 3KBBA 2YMLA 2I34A 4GIBA 1SWVA 1ZS9A 2ZG6A 5ALIA 3U13A 3L0YA 3MC1A 3L1VA 5ALEA 2RARA 2YY6A 3QU5A 3AR2A 3N5KA 4Y2TA 1Z4NA 3ET5A 1JUDA 5AVQA 4UMVA 3QNMA 3ZX4A 1RRCA 4RESA 3ZWKA 3SKYA 1RKUA 4YCMA 4UMFA 5AW9A 3ESRA 3SD7A 5AIBA 4KX5A 4OHFA 1YMQA 2BDEA 2CFRA 4UASA 3ZTYA 5FP0A 3ONNA 5ALHA 5AKJA 1F5SA 2G07A 2G09A 2ZBEA 1U7PA 2NO4A 1YS9A 5ALFA 3M1YA 4DW8A 2CN1A 2EATA 4GXTA 3WK4A 1ZRMA 3I1YA 2FUEA 3S6JA 2IOFA 3N28A 5ALYA 4Y2SA 1RLOA 5AI4A 3QU4A 4NAVA 1ZOLA 3BWVA 3AR7A 2CFTA 3AR9A 5AW5A 3VAYA 5AW2A 4Y2PA 1L7MA 1Z4JA 2MU1A 1U02A 5ALNA 5IT0A 5A3SA 1KYTA 1U2TA 2P11A 4NFLA 3WK9A 2ZXEA 4J2TA 2IA5A 5AKGA 5AK3A 4MUMA 2FDRA 2DQSA 3RFUA 3ZW7A 2EAUA 2MSNA 2WF5A 1Z4OA 1QYIA 4BNDA 3WKBA 2ODAA 5AVVA 4G9BA 5ALTA 2RB5A 3IB6A 1NNLA 2HI0A 4L57A 4UAUA 5AVSA 2B8EA 1XPJA 2FI1A 5AKLA 4EENA 5AW3A 3NRJA 5ALJA 3HYCA 4OFZA 3OCXA 3SHQA 5AW6A 3MN1A 3QUBA 3U7HB 3QUCA 2EARA 2AGVA 2WFAA 5ALKA 2WF7A 2NO5A 3QU9A 3K1ZA 3W5AA 1EK2A 2ZOSA 3FZQA 2QLTA 4F71A 2G1AA 3NUQA 1J8DA 3MPOA 4YIHA 3WKAA 2IYEA 3QYPA 2FEAA 3OPXA 2B82A 3WGVA 4Y2UA 4ZEXA 1YV9A 2PKEA 4C4RA 3PCTA 1YJ5A 3N07A 1LVHA 4HGRA 2X4DA 3W5CA 4DWOA 3UMBA 3R09A 3KD3A 3OCUA 3WKCA 5AKEA 1FEZA 1WZCA 2JAOA 2HCFA 2B0CA 2Q4TA 3ZWDA 3B8EA 4MWOA 4Y2XA 2YFYA 2IOFK 4Y2RA 3QU7A 4HGQA 3NASA 2HDOA 1T9ZA 1ZD3A 2C9MA 4KNVA 3ZUPA 3QLEA 3RF6A 4HGPA 4HGOA 1O08A 1RMYA 4KYTA 5AKYA 1AQ6A 1WPGA 3HLTA 4BEVA 5AK4A 4YGYA 4YCNA 3FVVA 3ZU6A 4BX3A 3DV9A 4UARA 2HSZA 4YH1A 4AS2A 3WK6A 1EK1A 1Z4LA 2O9JA 1RLMA 2I7DA 5IS2A 2GHTA 1L8OA 2G80A 5AVWA 3N1UA 4KNWA 4C4SA 2WM8A 2I33A 3U19A 2I54A 4J03A 4DCCA 3EF0A 2ZBGA 1N9KA 4B6JA 3N8GA 4UM5A 3DAOA 4XOUA 4I9FA 2VKQA 3IJ5A 5AI0A 1TJ3A 4FFDA 3B9BA 3FPSA 4XPZA 2R8XA 4NABA 1PW5A 5AM5A 4G63A 2HX1A 2C88A 2P9JA 4JB3A 3OCYA 3EPRA 3M9LA 4E88A 4KN8A 3AR8A 3UMGA 3KDPA 3ZVMA 1Z5UA 4Y2YA 3I6BA 3L1UA 3AR3A 1L7NA 2HF7A 4QQFA 1ZD4A 5ALPA 3U7EB 3L7YA 1Q91A 5AKIA 4UW9A 1J97A 4EZEA 2RAVA 4EX6A 1VJRA 3E58A 2HHLA 4QJBA 1TJ4A 2JAUA 3OCWA 2MU2A 1NF2A 5AI8A 2QYHA 5ALUA 5IT4A 4FE3A 5AICA 3L0BA 4CF3A 4CF5A 1L7OA 2FPWA 4Y2QA 3PDWA 2GHQA 3WK5A 3UMCA 4YCLA 2HO4A 2RBKA 3L8EA 3NANA 3SLRA 3NAMA 1Z4KA 2HF2A 1TE2A 3WGUA 4FYPA 2NYVA 4BEWA 5AW1A 2HEGA 5AKZA 2C8LA 3AR4A 2FPSA 4EEKA 3ZTWA 5ALVA 5ALWA 3A1DA 5AW0A 3DNPA 4ZEVA 3KOOA 5ALXA 1L7PA 1ZD5A 3W5BA 1X42A 5AM2A 3R4CA 4F72A 5T41A 3I28A 5ALDA 5AW8A 1U2SA 1Y8AA 2JARA 5AVRA 5AI6A 4HGNA 1WR8A 4NV0A 2P27A 5A3QA 1Z4MA 2BDUA 3QUTA 4KX3A 1N8NA 5AVXA 2G0AA 3FGOA 3KC2A 2C8KA 3F9RA 1NRWA 1LTQA 4L6CA 2ZBDA 1RPZA 5AM3A 3PGLA 3A1CA 1U7OA 3B9RA 2OA0A 5E0OA 4JDPA 4Y2VA 5AI9A 4IFTA 1CR6A 3GYGA 2PQ0A 2AUTA 3EF1A 4AS3A 2I55A 2R8ZA 2G08A 2FUCA 2JAWA 2BY4A 3E84A 3WKEA 2YJ5A 2WF8A 1K1EA 2P69A 1Z4PX 1XVIA 3WK7A 1RC8A 2FPUA 2YMPA 1RDFA 4L6AA 5AHXA 2GO7A 1T5SA 5ALZA 1WVIA 3OCVA 1Q92A 4BX0A 4RETA 3ZX5A 2B1QA 1QQ5A 1L8LA 3ET4A 2YBDA 2YJ4A 3WKDA 4BNDB 1QH9A 2YN4A 1S2OA 3L0CA 1RQLA 1RKQA 3AR5A 5ALSA 4HYTA 1SU4A 5AKHA 2O2XA 3I76A 3QUQA 2R8EA 3QX7A 4O8CA 1XP5A 3D6JA 1Z88A 3DDHA 3SKXA 5AK5A 3FM9A 4EELA 3QGMA 1IWOA 3SF0A 4CNQA 1RMQA 3A1EA 3L8GA 4UMEA 3EWIA 1TA0A 1TJ5A 2ZBFA 3FPBA 2B30A 3NIWA 3E8MA 2PR7A 2C4NA 2OM6A 5AW7A 1QQ6A 5AVUA 3QXGA 4HAIA 5ALOA 2AMYA 3ZI4A 3U7FB 3CNHA 3W5DA 1MH9A 2R8YA 5ALRA 3AR6A 4ZEWA 4XE5A 1QQ7A 3P96A 4IG4A 1RMTA 4XQ0A 4UU1A 4YIKA 4UM7A 3IRUA 5ALGA 4OD0A 4BBJA 2WF9A 3L5KA 3ESQA 3BA6A 2JGAA 3TLMA 2W4MA 3L8FA 4Y3UA 5AVYA 1T5TA 5AIAA 2YJ3A 3R9KA 2W11A 2AH5A 4UAVA 3U7GA 2OBBA 4OCZA 5AM0A 2I6XA 1Z5GA 3A3YA 5A3RA 2FPXA 4I9GA 4DFDA 4BX2A 4AP9A 1S8OA 3CZ4A 4Y2JA 2YJ6A 5AI5A 5AVTA 5ALMA 4EX7A 3ED5A 4NWIA 5JJBA 5AESA 4C4TA 3OTQA 5AKKA 1RLTA 3E81A 2Q5EA 3OCZA 2IOHA 2FPRA 4UMDA 4H1WA 5AVZA 1ZJJA 5AM4A 3KZXA 2YMQA 1SWWA 3U26A 5AM1A 1Z4IA 1Z4QA 3MMZA
chains in the Genus database with same CATH superfamily
4UUAA 3ZZ0A 1OB2A 1YUMA 1UEXC 2ZANA 4DA6A 1WG8A 4BO2A 1O03A 4UXJA 1DOZA 2P9QA 3R3JA 4EY4A 1M33A 4DJDC 3CRW1 5I9SA 1BMDA 2JD2A 2ZIWA 4FYYA 4RGBA 4L5AA 1MOZA 3L7KA 3Q6IA 4Z6CA 2JKVA 4RZQA 3V4SA 4UMVA 3P9ZA 2GBPA 2OQIA 2WIAA 1XL0A 3R40A 3I9NA 1JLLA 4K8OA 1XU7A 4CMCA 1YQ9A 1ZLYA 4U00A 1A9PA 4IZ6A 4YYZA 2DUJA 1V43A 1XFDA 1E1RD 3PGA1 2FKNA 3A14A 2BMEA 3L18A 3TMKA 1QONA 1R0XA 2HI0A 4UD2A 3ZCXA 3FWKA 4JXXA 1T1GA 3ABIA 2IU3A 2JLXA 4FO6A 5K4AA 3REOA 3DO8A 5JVDB 4DOCA 2R7NA 3W5AA 1WCYA 4LXQA 4MGKR 4HX5A 5J58A 4CKEA 4PIPA 3WSVA 4C06A 1J70A 4BX9C 1VPVA 2FE4A 2C5AA 2EX4A 4AROA 1TT5A 1WZCA 2Q3EA 3D7MA 1EDBA 1BIFA 1X1QA 1T10A 4PG6A 4MVJD 1T9ZA 4A2CA 1ZD3A 2JIPA 4R5MA 3OOSA 1G7RA 1SEPA 1NVBA 3HLTA 3AQFA 8ICMA 2TYSB 3JVEA 3AINA 1U2DC 4AUNA 2EW8A 2ZAIA 3WL6A 2G0TA 3R20A 2QRKA 4FHFA 1IN1A 5L53A 1DRJA 3UPQA 2IIBA 4WNAA 2FP4A 4FU0A 2PVPA 5JECA 4B6JA 5F1YA 3VU3A 1A8QA 2QY6A 4MJLA 4JYMA 3HCPA 1PWZA 3F3SA 1PQUA 2YQEA 3ZVRA 3CF6R 2ZJ3A 2GAJA 3HGQA 4NABA 2O2GA 1OA1A 5AQEA 4B6SA 2J4DA 1I2MA 3AR8A 4YHHB 1M8GA 3SSMA 1JR4A 3UG6A 2C2XA 4F0JA 1PK9A 3THWB 5IWAB 2K4EA 4KK4A 4EX6A 4LHYA 3DTVD 6REQA 4X6UA 3GLGE 2HWUA 1G291 3LVVA 4P5PA 1QPZA 5JISA 2ZRMA 2YIMA 5CD9A 4FW8A 1L8AA 3KZMA 2I4OA 2NO7A 3COYA 2O8BA 3R5KA 3H1FA 2HXSA 2XH8A 4ZEVA 5J47A 5ALXA 3AQEA 2HF9A 2HHJA 3ZDYB 2W70A 2IZOA 2NZJA 5UKDA 3AHEA 2IEAA 4HGYA 1PUJA 1SCUA 4G1CA 2ZBDA 3KFUF 2D1SA 2DZDA 2Q5FA 4EUNA 3L4SO 1JV2B 4MYDA 4AMBA 2H5XA 3B0YA 1JU4A 5EUCA 2UU9B 1NN5A 2RH4A 5JT1A 3RNOA 1SVIA 3EN0A 2D06A 3RBZA 4J75A 5JCJD 2Z1DA 2JZBB 3FBTA 4OY3A 3O38A 5BQ3A 2QLMA 1MSWD 4PLPA 1HT3A 4ECRA 4JVLA 4Y1FA 2BR3A 2V8OA 2ISCA 4FBUA 3MJSA 1MNAA 1N2GA 3FAZA 4XSVA 4KMOB 1ULUA 4GRAA 5CTJA 4OX9Y 3RRFA 2ZLBA 4RE5A 2X9VA 3CLTC 4CCAA 3D6NB 5C35A 3M6XA 3CVYA 5K4GA 4FMCB 4HXFB 2O1XA 3ABZA 1Q2XA 3LHFA 5BQ5A 3AR6A 4G5GA 3ZD9A 2EKZA 3TD2A 3O4FA 3FF4A 5KTSA 3Q0EA 3KTDA 3QY0A 2K4MA 2H11A 3RFXA 3UGTA 4MFFA 5BPFA 1H9BA 3ERCA 5TQ0A 2DWPA 3HO8A 2FX2A 3HBFA 2Y9MB 3A10A 2FRDA 4ZQGA 4B7ZA 4D4GA 4REMA 4OBEA 4IUDS 2PLRA 4M1WA 2P2DA 1ZCJA 2WTBA 3PWZA 2GNAA 5CLLA 2C42A 2GXSA 1ORVA 3PT9A 4ZXPA 1AV7A 5LLTA 1KI1A 3N2GA 3M6ZA 1EFLA 1NJSA 1VGRA 4YRPA 3T7SA 3M7DA 1YR3A 1OAOA 1V4VA 3GLHB 1EGAA 1CZRA 1WYGA 2WWTA 3RI3A 1OX5A 1CRPA 2QW1A 2WSIA 4PZLA 1TZ2A 4HXYA 4XH9B 2VYNA 1OFGA 2EX0A 1AX9A 4BMNA 5JD5A 1XA4A 4KI0A 4ZTBA 4HDKA 2XB6A 2XBLA 1K7SN 2DGZA 1HL7A 3V1NA 5BPCA 4XD7D 5JPCA 1LTHR 2HBRA 4N3AA 5FP0A 2ETVA 2BTOA 3A1WA 2H4JA 4YJ2F 1JIJA 4M55A 4DQLA 5AI4A 2C58A 5EGSA 4LMAA 1WUIS 3HN7A 4MVWA 4BNWA 1E0KA 2MU1A 3E1KA 1KYTA 1ZQWA 2HO5A 3D2BA 3PCRB 1AGRA 4R2LA 1FZQA 5AVVA 2P2ZA 3DE3X 1JU9A 3BIJA 5ED4A 3RUFA 1OUQA 2FZ5A 3K73O 3RTBA 1OW3B 4Z6FA 2CRXA 2PL5A 4DWJA 1P0QA 5CLGA 1ZUNA 5H70A 4CMHA 8AT1A 4XR9A 1AS3A 1FUKA 3ZH2A 4PCAA 3K70B 3ZU5A 4DSFA 4NCBA 2RIPA 3BREA 1U5BA 4AJKA 4LZDA 4RD3A 4CYMA 3WHPA 1SCDA 3LW7A 1IZ9A 3PQCA 1XSLA 3BB1A 5DHRA 3GCGA 4B4KA 4XA8A 3GNLA 1R0CA 2NMVA 5EP2A 4GECA 3IKVA 4MW9A 3A27A 1KDPA 4N3GA 4JL5A 4FE4A 4TUYF 7ICMA 1QANA 3SE0A 1BWSA 2YFQA 4RT2A 1QO7A 2NUAA 4C4SA 3TEMA 4QEKA 4FJ2A 2JFGA 2Q3BA 1LJLA 2Y0EA 4MO2A 1DK3A 1A9SA 3QBEA 4ZEMA 4Q4DA 3CSUA 2W6PA 1AC5A 1NMEA 1AV6A 4IOKA 4OYHA 4CR8A 3U5TA 3LF1A 3E9QA 2QQGA 8ATCA 1J97A 3H17A 2WFLB 3EWSA 3ZHUA 4OKNA 3E1SA 4RTLA 2CLHB 5KT6A 1K4KA 1IG3A 1IPEA 2C4KA 2CCGA 2R8PA 3LUDA 4RQ7A 4FFWA 4OQFA 3S2YA 2YWEA 3A0RB 1XAIA 5ALWA 2QD3A 3E7PA 2GLTA 4I2JA 5AW8A 4EQZA 1A5TA 3U9LA 3V7KA 1U9ZA 2B4QA 1MR3F 3SJAA 4C2BA 1GSIA 1SQ5A 2XXJA 1BDBA 5F3RA 2BGIA 3Q7QA 3PSTA 4Q34A 2IYUA 4PRYA 3EOAI 3IAUA 3DBVO 4JEIA 3PHCA 1A0OA 3ZI0A 3KQTA 3D3EA 3ECAA 4GZLA 4JFAA 4J0FA 2UUOA 3X44A 2QX7A 1LU9A 1QKJA 4D4JA 2JBWA 2YJTD 5KFRA 3FE2A 3QHQA 4RPIA 1CQJB 3PT5A 1CG6A 2PS3A 4CEHB 2ZBPA 4GOND 2JIZD 5KFAA 1WKVA 1XKQA 3OSNA 5DGTA 4WEQA 4QWBA 1O94A 5EIFA 1V48A 2O48X 4YQEA 3PF9A 3MWKA 3PDJA 1Z88A 2PKYX 1HYGA 4EB6B 3NZEA 3EIEA 3CWZA 3MT9A 2B30A 3QFTA 3A2KA 3ROTA 4WK0B 3CCBA 3CG4A 5BSKA 2WABA 3AXSA 4AZVA 5CVCA 2Z6UA 1NATA 4F4WA 2CXXA 4LW8A 4N9WA 2AJLI 2XQGA 3OAAD 2DTXA 2AU0A 3I6YA 2GRUA 2NRWA 4IJ5A 5AIAA 1M2WA 5I4IA 1F0NA 2FRDC 3FRJA 1SL2A 2NXNA 1BGVA 2MMGA 3KR1A 4K0RA 4O2RA 2QAJA 1GL3A 4FYXA 1VI6A 4K8RB 2MCFA 4P33A 3OHSX 4LGYA 4IF6A 4LJ5A 4C76A 2HZ7A 4IO0A 4ESHA 1U3GA 2V54A 3BD8A 2Z3ZA 3OA2A 4DJJA 4J7UA 3OQIA 2W00A 1P5RA 1VA4A 1HQKA 1R9GA 4IXTA 1OAOC 1ZMXA 1ZD2P 3VSBA 4EG8A 5EN4A 5JJCA 5J2JA 1CHDA 2NU9A 1GG2A 1C7RA 2LYHA 2WKQA 5BV1A 4FLFA 1M66A 1NASA 3ICEA 2XDYA 3THVA 2KP7A 4ECUA 4NBNA 2RARA 2XTJA 1P3DA 3MOIA 1SXIA 4PSAA 3NNDA 5AVQA 5HYVA 4KB5A 1EUDA 2FEXA 4NV1A 3IVXA 3U44B 3ZGZA 2VH5R 1YS4A 3BCHA 2C4UA 4A27A 2WWWA 4ZOHC 2GLUA 5DWDA 3RNLA 4DQKA 3G9XA 5BW6B 2FQXA 1N33B 3DKIA 4BKPA 3EFHA 2WOJA 4MR7B 1GKLA 2B2CA 3TIFA 4P38A 5KNDD 1S0NA 3MMSA 5KFUA 1QAMA 4HZIA 4TV9F 2RG1A 3EQZA 3IB6A 3T5JA 2HNKA 2HJ9A 2WTUA 1RHMA 4FEAA 3KJQA 3GRUA 1V96A 1G5IA 3NBQA 4H15A 1BX0A 3T3GA 5KUTA 3QFHA 1KFCB 2YOFA 3BSWA 4M0AA 4GLFA 4Q7KA 1U0TA 1Z7WA 3V4RA 4HTAA 3KVYA 4N5NA 4ILKA 1CDEA 3ZGVA 4UEQA 2AF3C 2WUWE 3MR2A 3O74A 4CQJA 1L6NA 4QEDA 5D3MA 3NWOA 4B8WA 2BMWA 4E4TA 5CNMA 4BQNA 2WUEA 4PQYA 3W2IA 2H7VA 2BR5A 3LRXA 2O7RA 4BIMA 4EFMA 1N5MA 1CS4C 1LPPA 1SUWA 3DV9A 2ERYA 3BULA 4MJXA 4PAGA 2MT9A 2IBMA 1M67A 4CCHA 2GEUA 3ILSA 4WBNB 1PHPA 3NQ41 1FMTA 5AVKA 4M0FA 4BAGA 2W0SA 1M5RA 1VRCA 3FNBA 3PVZA 4PN3A 4J76A 1E6KA 4YRLA 3LVWA 3EUAA 1MQ9A 2XNCA 4BE9A 2YZ7A 3IOBA 4ELVA 3C2KA 1ULSA 1R0ZA 3I64A 2H2GA 3WRVA 5HIMA 4F6CA 4Z99A 1ATZA 5CJ7A 1NQVA 3U7EB 2A4KA 3EG9B 2JRLA 4RF2A 1YRYE 4LYDA 3H0RB 4JGBA 4TLDA 1JTVA 4O3SA 1Q11A 1A4RA 1CUSA 4KQMA 2WJJA 3WGUA 3UXHA 4N7JA 2VTKA 3OZSA 2AD5A 3A6ZA 1B3RA 3CVWA 2C2MA 5JW6A 4Z6KA 1GUDA 2FMTA 2R1VB 1FQKA 1PJ4A 4EZ6A 1UWVA 3X1KA 2JEJA 4PYKA 1G60A 1Z00A 1E2DA 1RAHA 2A84A 4BZXA 2XE8A 1QBKC 1P5ZB 1G20E 2Y3IA 3ORYA 3BK1A 1W1WA 2BHSA 2K89A 3EZNA 1I3OA 2LKDA 1RZ3A 4P58A 4P3KA 1CYDA 3E61A 1T9GR 3VOBA 4K4HA 1F9EA 2AW3A 4K9LA 5CCBA 4Q82A 1RZVA 1OYOA 1YE5A 1GAWA 2CZQA 2AK2A 3P2JA 3B3GA 3C6BA 4EGJA 5FYDA 1KBOA 3L0CA 1KU6A 2J3MA 521PA 3ZE9A 1UIMA 1O94C 3L9XA 4Q9LA 4XLLA 4HLDA 4K9DA 4EHJA 1KK1A 2XGGA 1ZYUA 5J2IA 1D1PA 2P0AA 3R5JA 5AT1A 5LYJB 2YS6A 1QQ7A 2O5RA 2Q1SA 1C81A 2QGNA 4KN7A 2Z8XA 4P53A 2IK8A 4P54A 3NBMA 1Q7RA 1R6DA 5EJGA 3TLYA 1ZXBA 3ORRA 1Y9ZA 2FG7C 3PW4A 4GW3A 1FFDA 5CNJA 3QVVA 2PRSA 3HJRA 4UB6U 2O6LA 1JHRA 3HB9A 3DBRA 4RM2A 2R25B 4ZCQA 4D9MA 2W6NA 4BE4A 2BFDB 1UBSB 3OQVA 1F0MA 3WRYA 3IBSA 2E21A 4ZVRA 4F5YA 2E8OA 4RNCA 4MVJG 5DB4A 2ZRAA 2J7PD 3LIPA 4JI8B 3WLLA 4IQ0A 3Q7IA 2V0NA 3KZ1E 1MN8A 3VOTA 2ZWAA 4FGLA 2CSUA 4C21A 4TL8A 1P0FA 1GL9B 1P1KA 2VCYA 1DEXA 9ICQA 1Z2PX 3OP1A 2EANA 3JX9A 4C88A 2HU2A 3EGDB 2NM0A 4IXWA 4JUDX 4FD3A 4NS1A 3JAMA 5KTRA 2PKRA 4UB2A 2QX6A 2OV6A 2WJYA 2AFVA 1H2EA 2JB9A 4BO5A 4LTDA 1ZN2A 5L51A 4J91A 4CHGA 2IA5A 4G5HA 3UY4A 4BNDA 5GP1A 3R7BA 3UQ0A 2VTDA 4DSOA 1TAMA 2HSGA 3EZ5A 5EMLA 1XJ5A 5FEMA 1GA1A 3QP9A 1D07A 2JGLA 1ZGAA 4NBVA 5F1PA 1U48A 2EP5A 2FN7A 3SHQA 3BWCA 1JNYA 3PQEA 5HA5A 3HH8A 4DG9A 1JSCA 3TD9A 2G1AA 4EJFA 1Y4SA 1AUOA 3O2QB 2AX4A 2AZDA 4URZR 1YOVA 2H63A 4OSPA 3JQ9A 5K1ZA 4NXZA 1LFDB 4MQFA 3KKNA 4P3NA 5JNTA 3KSUA 4KYVA 4U7CA 2PWAA 4QYWA 2Q07A 4KXMA 1PVPA 2M6SA 5EPUA 4PANA 2BZFA 1GRCA 1QE3A 4LNUA 4LZAA 3GB9A 4BFXA 2EZXA 3H1EA 4BO7A 4E70A 4EUKA 2YINC 4J94A 1PJQA 1A4IA 4QDOA 3C1AA 1J8QA 1JIIA 1MP0A 5J1TB 4H7PA 2ZUCA 2PGOA 1XJQA 1LS1A 2BFFB 4EAAA 1IJKA 5C34B 2ZYTX 4X1IA 1B43A 3RH6A 2JLVA 3N8GA 1CR1A 3LT1A 4O5OA 4PZCA 4HDSB 3W7AA 1UPHA 4TKLA 3PKIA 5E4YA 1AXRA 1UJBA 5AHOA 1PT6A 3AR3A 3OC0A 4NYIR 1GTG1 3OX3A 5C3UA 1LVUA 4NENA 2WJHA 4P4TA 4TS9A 3DMYA 2QLFA 1PGOA 2HIAA 4CF3A 1X9GA 2X4IA 2QN9A 4FPXA 4DR6B 3DXZA 3KK0A 3AL0C 4Y1RB 3KG2A 1OXSC 5KL1B 4UVGA 5EHQA 3DEHA 1HY3A 3L49A 4HWPA 2WPDA 1KYYA 3SM3A 2O8FB 1F6WA 2YCLA 4TLCA 3IS3A 1IFXA 1CUWA 1RPZA 1OGIA 3B9RA 2OLJA 4DKJA 3COPA 4RK6A 1O96B 2QTCA 1MZVA 1B4FA 2G08A 3UIEA 1N0VC 4MUGA 4LAFA 3DE2X 4ZC8A 2CYBA 3NM4A 4MF8A 1M72A 2BTQB 4YC7A 2B25A 3GLIE 4BWFB 3RU3A 1SXJA 2GJ8A 4RETA 3V6HA 3EEYA 4GHWA 5C0OE 3B8HA 2LIPA 1JILA 2Q5IA 1KRXA 3RYHB 2ISOA 2EAMA 3IJRA 5LVAA 3FOFC 2K8AA 3K1AB 3N2LA 3LVFO 3ENWA 1IWOA 2XSZD 1UHUA 1Z5WA 2XT9A 1YR9A 1QO0A 4ID9A 3VR6H 4BVFA 4OLFA 4U39A 2AFRA 3RYFA 3NIWA 4RTJA 4RUCA 1Z6XA 1QQ6A 4GOMD 2MSKA 1FFWA 4JGIA 4LXYA 4M0MA 2VHTA 3EBLA 3Q3JB 2Q2QA 3JASA 2C3YA 3L1IA 1JH9A 1ZD9A 2WF9A 1Z16A 2QPLA 4Z2AA 5HW0A 1JG2A 2KKPA 4MJ7A 1Y4UA 2HRQA 5JJ5A 4PG7A 2CV1A 2PUHA 1AROP 3VVCA 2PBZA 2MDTA 3RHZA 2E1RA 3ZLVA 4WESA 3VYVA 1NN0A 1UJ4A 1P1JA 2OQRA 1R0KA 4CM6A 5JASA 1LDEA 1Y3AA 1VCOA 1DARA 1L6RA 3KJHA 3WRYC 1Q12A 3GJ6A 5AOAA 3FZNA 2J85A 4YJ2B 2ZSIA 3NTUA 2EL7A 2G04A 1XEFA 1TVCA 2BH2A 2QT0A 5FDFA 1JSZA 2DKOA 2R5WA 2R18A 2ECQA 2P3LA 4QGBA 2F59A 3OWHA 2D4HA 2WSSA 1XQ9A 1G8PA 2MRLA 1QM5A 3WGKA 3H19A 4Q01A 3SDSA 1UMCB 4QOFA 3UA3A 1XXHA 3GGSA 3DCYA 1SOAA 3TJMA 4JUFA 4L4YA 2QTVB 2W7PA 4EPRA 2WKSA 3WADA 4BQFA 2GCIA 5AW5A 2PD4A 2HWXA 1MO5A 3EYWA 4J2TA 3VR4D 3VZPA 3JQGA 4I1UA 1E9CA 2GK3A 3MWJA 4L3OA 3STHA 1MLDA 3TAXA 5DEOA 2BF7A 1B0PA 4G01B 1F0KA 3ZV3A 3CWCA 4Z3OA 5JSYA 4E1AA 4I1OA 2MA1A 4TUYB 4PYJA 3O3MB 4M9LA 3UO8B 4F4KA 3LKDA 3OQPA 3IBCA 1W581 5DN6A 4AG3A 4IDNA 3ZY6A 5GJWC 4DWOA 1GQOA 3JQ9C 5CAEB 4BFLA 1AUVA 2IJGX 4FQ5A 1YDGA 3S7ZA 2JXJA 2KJ8A 1Y3IA 1NVWQ 3MRVA 4X3OA 5K45A 1ML4A 2GLXA 3OKCA 2HHQA 3TO5A 5J40A 4ITVA 4HB3A 5J2FA 1SBYA 2CV2A 4BX3A 4EW1A 1XZNA 1JBEA 3RAXA 1EK1A 2HJGA 2KX7A 5AVWA 2Z2ZA 2UYQA 1ZQGA 2UVWA 4FR0A 3WL4A 2X2FA 1WXWA 5JAUA 1H66A 3BGWA 2W7TA 2YYAA 4YP9A 5AJVB 4D3ZA 5LBUA 3CX3A 4KFUA 3B9BA 1N0UA 1EDOA 3UJPA 2Q21A 5KAMA 1IUKA 4B1FA 3MGGA 5T5QA 2G70A 2FETA 2QL7A 1XTPA 2X19A 3OQHA 4ADSG 4QXMA 3KJFA 3RIXA 3UAYA 3OIVA 1RJ9A 1Q0SA 3OZ7A 2OO3A 3UFXA 5LPNA 2C8LA 2CBXA 2IV7A 4X1KA 5CT6A 4NKRA 3T5MA 4DSTA 4LGMA 3IJEB 5BN5A 3SI7A 5AI6A 3KQWA 5FX2A 1QIEA 4R1SA 1YS2X 2CCJA 4M54A 1ZBDA 2FW6A 2QU8A 7ICGA 1NVFA 3T1HB 3AC0A 1Q77A 1IXRA 2F43A 1CR6A 4LXHA 3I53A 1CZLA 1RWQA 1WXQA 1J49A 5GV8A 3VPGA 1H5NA 2I6TA 2PHZA 2Y1IA 1NW7A 4HPXB 2SNIE 2QXTA 4JOBA 5ALZA 3EXFA 5JBIA 2A1TS 4BPBA 5J43A 1SXJC 3IEXA 3HU3A 4G67A 3LPMA 1AMOA 1SVNA 2ZYWX 2UUPA 2CSXA 3HJCA 2VAXA 4ZOLA 4XUSA 2GRAA 1E0AA 4G3IA 4TT3D 4GICA 3SEIA 3GV8B 4MS1A 5F73A 1W5FA 3T3EA 1IHOA 2QPAA 1X7ZB 5CGQB 2RHWA 3K9QO 3SZ2A 4MUFA 3P9IA 2ZE5A 1CRZA 5JAHA 3L0DA 2EZ9A 3IVMA 3DOOA 2QMQA 5FLXA 1ATIA 5LQJA 5CJ2A 5ALGA 4Z1MD 1E6EA 3X1JA 4MWTA 4LZPA 1U1CA 4IRCA 3NO4A 1CLUA 2E6UX 4AJ2A 2IU6A 1IEWA 4EY8A 2P2LA 3USES 5FNVF 4YR9A 2AUMA 3NVAA 1FW6A 1WCLA 4FMPA 1XS9D 2FCRA 4XQEA 5DG9A 1EM8B 3MUEA 4ZCIA 1ZK2A 1FSZA 3AUJB 2OV2A 3BMOA 4W5QA 3U26A 1KKUA 4N39A 3S2EA 3ABQB 3BQ9A 2ZJYA 3QWAA 3ITKA 2G06A 2EVWX 3UHAA 2YHIB 3K2QA 4PSUA 2RRDA 3VR1A 4AIIA 4BZWA 2JEYA 1KFDA 1XNHA 1JIUA 4PC3A 5M34A 4YV7A 4QBIA 3NKFA 2F17A 3ABRB 1U0SY 2EGGA 3K5IA 1QH1A 3GU3A 3NHFA 2PEYA 3IP8A 1SN7A 4C0LA 5IKMA 4FW9A 3GIDA 4HWOA 4DG8A 4PHTA 1GPBA 3IR6A 2IBTA 2J6BA 4YS6A 4KPUA 4TV9B 3CC8A 2ONJA 5AKJA 1LKYA 4CQMB 3M1YA 1IHDA 1TC1A 4R8KA 3PL1A 4MDYA 3HB4X 3Q8SB 1W4CA 5ESXA 2JD0A 3Q5DA 1W4BA 3AB3A 3MS2A 1N6PA 1PT7A 4G4GA 3M49A 1APBA 2A3RA 2XO7A 2QL6A 3OCXA 2XQVA 3QEKA 4GMFA 3P5SA 2FJ0A 3L6BA 1YKGA 4DQRA 1PT8A 5K9ZA 2X0IA 2FEAA 3KQKA 3K94A 2PLAA 2PZBA 3G6YA 5DLYA 4QQ8A 4UVIA 4K6GA 5KYYB 1QG6A 5K2OA 1NBHA 1BC5A 5KOJB 2YB1A 3G0CA 1DXOA 3TK1A 2QP3A 5HKKD 2ZTEA 2Z2JA 1V3QE 2JGNA 4Q9NA 1BQEA 4TTQA 4L4XA 5K6RA 3Q2OA 4IPTA 1F06A 1T8EA 2BV3A 5FTLA 2ZCUA 3BRQA 1F6DA 4B40A 4CG2A 4LFAB 1SQ6A 2Y1XA 1E0DA 3NORA 4ETMA 3PXDA 3RSSA 5JZVA 3D7RA 3GLVA 2Z2YA 4B6EA 3JWEA 3KTQA 4P1ZA 3QPAA 4P7JA 3RLFA 2YTUA 1KPGA 4HTFB 5CDHA 3C28A 5T3YA 3TLEA 5LA6A 1K63A 4P4NA 4JNCA 5JOQA 3T4UA 4FFSA 1SBQA 4HVTA 1CX9B 2OK7A 2XF8A 4FKZA 4IEEA 4TRJA 4G1VA 1O0BA 1DC7A 1M6VA 2PUFA 2C97A 1FDIA 1EE2A 3JQ7A 4GLXA 4UOEA 1BGWA 4PLHA 3VX3A 1M75A 5AKZA 3X1YA 4MO9A 3T8YA 1IZ0A 2XUJA 3AUUA 2V6FA 4WERA 4B3BA 2PH1A 3GZNB 5IDYA 1E64A 1FL9A 3NUZA 2AZMA 3NGXA 4ECQA 1Y42X 4XVQA 3GVCA 1K7FB 1ZIYA 4JVSB 3GEGA 2QLJA 1ZPDA 1U7OA 5EIAA 3PQ7A 4KXFB 2UVDA 3D9QX 3BZCA 4LSGA 2HMXA 1WU8A 1IXRC 2V0CA 1U3TA 2YY7A 3KKLA 1YVDA 4A8PA 2OV3A 4G1EB 1AKMA 3WJAA 5H1YA 3HABA 4GAEA 5CEJA 1AB5A 3GEIA 2BEKA 2P0EA 1UUFA 1ML3A 2D1FA 4O5KA 2PKQO 3F46A 2P2CA 3JSXA 5F3XB 3ETLA 2JKYA 3MWDA 5A4KA 5CG2A 2CF6A 1L1RA 1LTKA 3SQNA 2WW8A 2HBJA 3DCNA 7ICJA 4QBTA 4W8HA 4F6RB 1EFVA 2HHXA 1MAVA 3ZJVA 5AVUA 4P4MA 1CRLA 1RADA 2CJWB 5K8CA 3JATB 2X9GA 4N41A 8ICJA 3H0LB 2RGAA 4II3A 4AY6A 1XDBA 3OFSA 2EFYA 5AVYA 3TJZA 4CDNA 1RHKA 3VYRB 4E6EA 4UM8B 4KQ2A 3DHEA 4NU8X 2J45A 1U0HC 4GNRA 2ZPTX 3TUZC 1OBFO 1B16A 3P4UA 2KS6A 1UXIA 1W6RA 2PL3A 1E1KA 3KZKA 3V7JA 5AESA 3KCQA 2KWIA 1WEKA 3VR2A 1B0ZA 1U4SA 2PY6A 2J5XA 4N03A 2Q0SA 1M8PA 3ZVNA 3BWYA 5EP3A 4KRFA 2DQKA 3Q8PB 4AJIA 4QU0A 3I9JA 1A7JA 4OQPA 1M2NA 5FO0A 3MF4A 4Y9UA 5FV4A 4YWHA 1K7EB 3GJ7A 2V7QA 1VBKA 4BLWA 2GJKA 1XOIA 1ZESA 4LJSA 1POXA 4UJ5A 2R47A 2Y0DA 1PQ4A 1Z4NA 3OLQA 2OH2A 3UAGA 1UBEA 1TEXA 3OF5A 1DFGA 3RJJA 5LDHA 1XEWX 1HZJA 2JHCA 1UZUA 4AS1A 1THTA 2NO4A 1C1XA 4PHFA 4D98A 3KLOA 3VSAA 4BEJA 3ZQ6A 2ZE7A 1FDOA 3AHHA 2RHOA 3LI2A 4MVXA 1EQUA 3VJLA 1FLNA 3LPNA 5JZ9A 1IHPA 2RH5A 4RPJA 4EF5A 3QIVA 3Q0IA 2H1FA 2TS1A 1OU4A 5D8DA 4WMLA 1YD7A 4WBNF 1D3AA 2DSTA 4F06A 2FW0A 4GXIA 3OGUA 1E3WB 1O4WA 1BW9B 3QUBA 4HZUA 4ZJZA 4DXDA 5IEBA 5L3QB 2ZT6A 4KLLA 4C2UA 2YZKA 1GU7A 4OYRA 4KQJA 4M7OA 4O9MA 1KHTA 4NU5A 3GPDG 4H0NA 4KOEC 2FX3A 1U9LA 4LF6B 2REQB 2UKDA 5JTIA 5F7XA 1RFGE 1S8FA 4QRHA 1N62A 2ZIVA 2PXAA 4L4ZA 5E2IA 1NWCA 2B0CA 1W52X 2Q4TA 2GK4A 3EXIB 4ZN6A 4PG4A 5KFSA 3JD1A 4LJRA 3UZUA 1PYOA 2M6RA 2OYSA 5CDFA 2F44A 4OJLA 1Q83A 2WPNA 1SXGA 5IIJA 2ZZKA 3QRWA 1GCIA 2X6TA 2F3SA 1Z4LA 1RYDA 4D44A 3SMQA 4RM3A 4A1FA 4MMYB 1WHSA 4E1VA 3TL2A 4NEGA 1CNMA 1VP9A 3KYCA 3SOPA 4GEKA 1U6JA 4ZT3A 2I4RA 3HO6A 3TR0A 2DU8A 4JYPA 2I7VA 1M9NA 3WYNA 1T1RA 3UHFA 2BI8A 3PHIA 3EVCA 4Q3LA 4I1RA 4WLVA 1SBZA 3PJEA 1V25A 2HEIA 5MGNA 1N9ZA 3WFJA 1S7CA 3MCAA 4I1IA 2GHQA 4NU6A 3GROA 1PZMA 2C9OA 5CITA 2NYVA 2H9YA 4EEKA 4DDMA 5TPWA 4M6WA 3VKWA 4F1JA 2IH4A 2RAPA 1SA0A 4C0KA 2OBFA 5AXDA 5JAMA 4WUVA 2AOTA 2VJOA 5L4NA 5DGDA 4JV2A 1UK6A 3WL7A 4EYGA 3PPVA 4B75A 2XBMA 4NOMA 2FZCA 1KR5A 4B2PA 5CX1B 4C01A 1TLTA 4JDPA 1E9RA 2GN2A 4YLYA 2I55A 3RBEA 3HY6A 4LDNA 3TQOA 1N9GB 2QA5A 5IUKC 3OZTA 1E2KA 1R5OA 4XQ8A 4UBIA 4IIXA 2ZSBA 4XXHA 4BUGA 3WV5A 4ROTA 2R3SA 1RSZA 1TJNA 3NOOA 2DUWA 3C3AA 3AUKA 3A04A 1ZUHA 2DR3A 5E6SA 4PAMA 2X1MA 5FOVA 3QVSA 4CF7A 4NTZA 1Q15A 1N61A 2JFQA 4LQCA 3LLUA 2ZRPA 2JFYA 2PJUA 2DVMA 1D4FA 2HCJB 4DDTA 1ZQYA 4FMDF 1E2UA 5L6LB 5FPYA 5DX1A 4EMTA 2AQ0A 1TZCA 4DL9A 1TD9A 3KFLA 3KLBA 1O7JA 5A3RA 2HPHA 3NU1A 3VKVA 1NW6A 5AI5A 4FDLA 2GI4A 3K2BA 1U9YA 5K0EA 3SENA 3OTQA 2Q5EA 1VECA 4DSLA 5C81A 1ZQQA 1GPKA 2BGLA 1QQBA 3RVKA 3KQOA 4FN5A 4C6TA 2QB0A 4I0WB 5KYXB 3CF4A 4UBNA 1WHTB 5AKXA 5FQOA 1VB3A 3I1JA 4MPDA 4CE6A 4QGHA 4YDQA 4CF4A 3CZQA 3U62A 2BEUB 2MINA 2VHYA 1WQ1R 2I34A 4MR8B 1SV4A 1WUKS 1TX4B 2WZCA 3PIIA 1SIJA 2E48A 3BXXA 1N2HA 4KLUA 5GGXA 1MO2A 2OMEA 4QPCA 4BLPA 2J6SA 3L05A 1M1XB 3HUFA 4MKFA 5AW9A 3ZGOA 4OHFA 1V1JA 5C53B 4O3RA 4BQOA 4CMIB 2Y0SC 3UBMA 1U2PA 2WU8A 1JQDA 5K0LA 3AZQA 4HX9A 2R6DA 2QRMA 3LL7A 1TVKA 1ZGZA 1QP7A 3PUZA 4B2YA 1GYRA 2JHPA 5B5EU 3ASVA 1CK4A 2ID7A 5DNVA 5L1IA 5EWGA 4ML3A 5CT8A 5KNIA 3IIEA 3OKFA 1T2DA 1QTRA 4HK4A 5J59A 3UWOA 2I8LA 5KC8A 4E11A 3A28A 2V0GA 1P5JA 3KXIA 1G0OA 3CRVA 4TMTA 5H9VA 3ISCA 3BGVA 4IJQA 2PZJA 2W6ZA 2ZRLA 2INGX 5J2GA 4MWBA 3KSAC 1SCIA 4ZQCB 1CHNA 3MR5A 1JEQA 5EXPA 1LB2B 4WI1A 2PYIA 1V35A 4TMXA 2AVDA 4QW8A 3DFKA 4WJLA 4RF5A 4O5CA 3DVAA 2X4GA 4XM2A 5DW0A 4YIHA 3WKAA 4U6SA 1BCSA 3HL0A 4BLTA 1C7EA 4CIYA 3IQWA 1E58A 1ONSA 2GPTA 1A9QA 2J3DA 4HB0A 5LSAA 3BB4A 4CI0B 3M82A 4QZVA 4BOYA 2G6BA 4NJMB 2J5QA 1QB8A 4YJHB 3M8RA 2VH1A 4LF7B 2QD5A 1G8JA 2ZJFA 4FBMA 2A2ZA 2XZTA 3MCTA 1Z2CA 3EBPA 3KB1A 2C5GA 4B87A 1F60A 2F1IA 1R9MA 2YWFA 1HEUA 4BNJA 3OE1A 3CNEA 5LWQA 3IDZA 5IH7A 1P74A 3EGEA 4H6XA 2RHMA 1L7XA 3K1RB 4XWTA 1US8A 2E4VA 3RBVA 4S1VA 4E14A 3B9JA 2OC9A 2D2EA 1QP8A 4C30A 2JH3A 3LECA 5ADHA 3IT3A 4QJ4A 4A2WA 2CNWD 2X8BA 3HCRA 3T38A 1DGJA 3UH0A 3NAMA 3V97A 3V72A 1LY1A 4OJMX 3KPJA 4QBGB 3VU0A 1KQQA 3OQNA 1TGYA 2HHUA 1NR1A 4KX3A 1IQRA 5IJ0A 3F9RA 4AM8A 1T26A 4UB1A 5E0OA 3FWYA 1UA1A 2FQ1A 4MWGA 4B48A 4LDQA 3QITA 1KVQA 1T24A 4LXTA 1DCFA 4CHTA 4JV0A 2XT0A 3I0MA 4C80A 1UQVA 1A5SB 1V3UA 5HHTA 2C20A 2XF2A 3F98A 4G9GA 3K71B 3E18A 3MRXA 1HSZA 1J2TA 1N5XA 4PO9A 2XDAA 3MFYA 4OU5A 4DTCA 3QMWA 2EGHA 1LSJA 1OXVA 3T9AA 5EYPB 4MRSA 3UG7A 1CETA 3IP5A 5GY7A 2F9FA 4LDAA 1JX6A 2GYVA 4NZPA 3C1UA 4GQAA 4EPYA 5FNVB 4O4JF 1VOTA 1SCBA 3HVRA 1ZJWA 2PIAA 3GJYA 2R8YA 2YS7A 3NV7A 4PPXA 2XCPA 2V9ZA 2ZW9A 4E7OA 3NGLA 3Q88A 2ZSUA 3L06A 1L3BA 3IVAA 2EWVA 5G3YA 4RHXA 1SHLA 4NC9A 2X22A 1OI4A 1M2HA 4JASB 1E4EB 4ARSA 1S3SA 2C92A 4MWEA 1G21B 2C3PA 4KC0A 3EXG1 1GCOA 2V7WA 3DYIA 4EX7A 2ZZMA 2E8NA 1PS9A 1JDUA 3FWNA 4KWIA 2P9YA 4ISCA 1CZKA 3WXMA 1VJGA 4YUZA 4QZGA 3TM4A 3NB0A 2X1LA 2LBOA 5I5GA 3RANA 1TYZA 4EDFA 3DC2A 5E79U 3BXGA 5TMEA 4UULA 3JQRA 3FCUB 4K3VA 4N54A 3ELBA 4RVUA 3W6UA 4B4DA 3E27A 1FNNA 1ZP6A 3FYDA 2XDQA 1E4YA 2ATIA 3MZ0A 1IONA 1M1YB 3M4YA 1JDNA 3AR2A 4PO1A 4HRXA 1MOSA 3DKKA 3JQQA 2IEYA 1V9CA 1DS6A 1TAQA 3EXEA 4MRMB 2BI4A 2K2WA 2Y76A 2VJAA 2I3BA 4EGAA 3C6XA 3NVZA 5KEIA 2LRHA 1KERA 4M4SA 5KI6A 2JI6A 3DAHA 2VPZA 4CMGA 3K0FB 3G7UA 5DXAA 4GWLA 1Z4JA 3AG5A 2ASEA 3IE2A 2H59A 2C5FA 1DO0A 2NLOA 3ER9A 2BSXA 3T1QA 3EQ6A 4P4SA 4CN8A 2V6JA 5I7WA 5FV7A 1E1QA 3F6YA 4CKYA 2D1TA 1WSBA 5K8VA 4J3FA 2IZ6A 2A67A 1F7UA 4WDRA 1V1MB 3SM9A 4J7AA 1CUYA 1N1EA 1YK1A 1NJ1A 4K9KA 2O50A 1TC2A 3DUFB 4ACOA 5HK8A 4W1SA 5K03A 1J07A 2X13A 1A7UA 3SYTA 4CW7A 5L3RA 2V5VA 5EIBD 3I62A 1DWPA 4UHJA 4D43A 2ZRGA 4MV9A 2OC4A 4GPD1 1HA3A 4WOCA 4DWVA 3OIWA 4C22A 3T7EA 2WVJA 4RZ2A 5HZMA 3B36A 3Q6NA 2KHVA 4ZQEA 5CB4A 2EZYA 3GP8A 4K0KB 1J39A 1XAHA 1UT8A 4X61A 4A8JA 2OHJA 2A1UA 2HA7A 4UDOA 13PKA 1USKA 2B4TO 5CLFA 5G0SA 1IOWA 4IM7A 2PIDA 4HDRA 3DFUA 1O8CA 3ABOB 2WM8A 5FPPA 2R87A 2A0WA 3O5AA 3LK7A 3SJCA 4JL8A 5G1NA 1V5EA 4B3SB 4AULA 1EX1A 1L7EA 4NY1A 1YDMA 2GF9A 3G0IA 2DUMA 4Q7QA 4UAZA 3V7YA 2R8XA 1PW5A 1BJRE 2R6FA 4OGFA 2NUPB 2VDVE 2GPSA 1XC7A 2FMUA 1F4VA 2RAVA 5F12A 1ENYA 3AJRA 2WA1A 4G4SO 4B3MB 4QRDA 3PQ6A 4XI9A 2XCLA 3R7AA 5IPFA 4WNIA 2GCEA 1A8SA 3SSAA 1J5PA 3DE4X 4HQKA 1HUQA 2R2GA 2ZJ0A 2HMTA 1W0KD 4JOSA 4ECYA 3LUKA 5DMHA 4DSIA 1OYVA 5DWVA 4ZALA 2XLBA 4G1FA 1U1IA 3CR3C 3FJYA 4LOHA 3HCOA 5BN4A 3PGLA 2JZCA 1XYGA 3PYMA 3O90A 1KQFA 4XRHA 3F0TA 4MFCA 2DBRA 3HCNA 3GPIA 5K3BA 4HR7A 1KHHA 3DQZA 1JLSA 5BW8A 1TA4A 2GTHA 1M1NB 4R8LA 1XAJA 3LPDA 2VP0A 4KLMA 2ZULA 1IZ7A 4KACA 1CVLA 1G5TA 3CYMA 3OPYA 3C3WA 3EDMA 5ABPA 5FJJA 4JI5B 1I13A 2HCTA 2P6MA 3H4BA 2NN3C 5CVVA 5M2QA 4C7ZA 4MV8A 3OE7D 4ETNA 1TFRA 1QLHA 3N2ZB 4N5IX 2HQSA 4E6PA 3PMNA 3Q9NA 3ENNA 4HVCA 5J0WA 2C9DA 2HSDA 4AZSA 2QP4A 1EZ1A 3L7CA 3KFVA 3LCRA 3IKJA 3LE8A 2D8CA 5BOSB 2YRFA 5C7IO 4C0AC 5JMOA 3OTWA 3C3KA 3GH1A 2ZIWB 2CUZA 5DNYB 4EL0A 1TTHA 4I9GA 2XCQA 4AL4A 2VSNA 1MA7A 1DAOA 5EIXA 4XKJA 1TW3A 1AKYA 5AVZA 5IJXA 4ED7A 3E2PA 1DAPA 1XPRA 1DSSG 3IURA 3S2UA 3OIYA 5JBQA 2Z43A 1JLLB 4L95C 4HQOA 4C7OA 2PKWA 4KDRA 3U4DA 1ZL2A 2W42A 5DH9A 1GPLA 2B36A 2I80A 5EKUA 1UZMA 3L9WA 3ZBPA 3H2IA 2NU8B 4V0NA 2JVKA 1QK5A 2RI1A 5TLSA 4JHLA 3QWHA 1Z3EB 1M73E 2YC2C 2H85A 2FJUA 1KAOA 1V39A 3O2NA 2F8LA 2FSHA 4DCVA 1XRJA 4KX5A 2B7CA 3BIWA 5IDWA 5J4HA 4UASA 3BXHA 3KLPX 4MLCA 1C9YA 1KJIA 1KIMA 4QWDA 4NLKA 3UHJA 1H05A 2A78A 4KITB 2V9CA 3OESA 1Q20A 1B8PA 2WUGA 4CKEB 4F2DA 3ENVA 4MCHA 1TO1E 2QS9A 2LNDA 4BLRA 2BI7A 4ZK2A 1OH6A 2QGFA 4DL5A 1ECWA 1TT5B 3BHIA 4W9NA 2Q3FA 3JQ8A 5AVSA 2PRZA 5DGIA 1JI3A 5FWYA 3MWEA 2VWHA 1TV9A 4G89A 3B1WA 2WD9A 3KEMA 2IPOA 4CZ2A 3NWEA 4Q1DA 3NBZC 1T8RA 4QTTB 2D0DA 4I27A 1BG6A 1QPGA 2X4DA 1MVOA 1KK2A 3TJRA 2IP2A 1RWOA 4MVJH 4BUCA 3WP0A 1GZ4A 1DJPA 2NWQA 1YMUA 4Q7EA 2Q7OE 3RYTC 2V4ZA 2H4YA 3FTFA 4UHBA 2FSGA 1A04A 3VZDA 6REQB 1KI2A 5E8JA 4A8JC 1DKOA 1S9DA 5T57A 2X2OA 3H8VA 1BXKA 3M6IA 3FXAA 2J87A 2Y77A 3SBEA 4XX0A 2KJ9A 4RMIA 4ZU6X 5KDLA 1JAZA 4YT8A 4AKEA 3CR8A 4DR3B 3T3IA 3FLMA 4RY0A 2F4NA 5EWLA 1Z2AA 3J81k 5D7NA 4H27A 2NP6A 1A82A 2KICA 2XPCA 1MRSA 4YBRA 2ACEA 1WL8A 3EARA 4DEYA 1ORTA 1SCUB 1ZK0A 4JLJA 1J90A 3FLEA 1OE0A 3OLZA 1WX1A 1XVLA 4KG7A 4YJGA 5DLGA 2EZZA 1KFJB 2XRFA 4C4YA 3CZCA 4WADA 1C7FA 2Z6VA 1AA9A 2AOXA 2PL1A 1Q84A 4MUNA 4LHWA 3S2FA 2DC1A 1EX9A 3R4CA 3PXXA 1ZSNA 1XT6A 3O7MA 1T15A 2JRCA 3HE3A 3OEEA 3AV0B 4C29A 4YAFA 1PWYE 4EZBA 4ZT6A 4Z49A 3WBFA 4ASUD 1RYNA 3RUIA 5JYCA 5HZKA 3D3WA 2J0QA 8ICAA 5FI0B 3CVXA 2GO7A 2WYUA 3F6RA 1O5TA 1YR1A 5TQ0B 4FMDB 2YN4A 1TK3A 2NQ2C 3SZUA 4YV0A 2C31A 1R6XA 2I2WA 3FM9A 1R50A 5CLIA 4OEHA 5IJ9A 1HLPA 1TNDA 3AY3A 2ZE8A 3PGMA 4JUBA 2DJ5A 3RKSA 3DMNA 4YMMA 4EABA 1R6AA 4F4HA 1KVUA 1UWCA 1BJTA 1WDTA 1JJVA 2B7LA 1YB1A 3HB5X 5AUNB 3ZHXA 3RRJA 2GZ3A 1X7WA 3ZCRA 3SXUA 4A36A 1PR9A 5JC8A 3HY3A 2QW0X 1NYRA 3BL8A 1ZUWA 2X5XA 3EZ2A 3W77A 3W2HA 3JAWB 2NNWB 4H1WA 3W1EA 3BTOA 5CFLA 5KTKA 1CV2A 3KOMA 5CRXA 4MUJA 5JANA 1H1TA 4HDCA 1WDKA 1URJA 2I6QA 3G9ZA 2JFHA 1V4BA 3A2LA 3G0HA 2AOUA 5ALQA 3HYNA 4KTQA 5J0RA 2DWUA 1EFRD 3EVEA 1RYUA 3ZHVA 3C41J 1GV1A 3QOYA 2XMZA 3PS9A 3CEAA 2BMFA 3OPNA 3AZOA 5LL6P 1R7RA 5GM1A 2R2AA 3HXQA 5KNBA 1NV8A 4C78A 2EFCB 2IE8A 2G07A 1ZUNB 1XG5A 2VDKB 2C7BA 2VIIA 1D1SA 5FPKA 1T8TA 2R97A 5LJIA 1U5BB 2QDKA 1QU2A 5A2QA 1CNFA 3JD3A 2XICA 3QNUA 3UHPA 5KOHB 3RVRA 4EGSA 3C43A 1CTQA 2B6HA 1SVUA 4OHXA 4XYBA 5JNLA 4W9NC 3ZOKA 1UBRS 1UM8A 4HAUA 5GZ6A 4MVCA 3CRQA 2XNJA 3N8KA 3I23A 3IP7A 1HZZA 2IY8A 3UTCA 4DCSA 2WWVD 4PU0A 2NUAB 2NTEA 1LWOA 4GWGA 2EP7A 1FDUA 2UXDB 5IKPA 1U3DA 2FW1A 1CDDA 4DMRA 3WGQA 4YMNA 3KIPA 3WBJA 4JELA 5ARBA 5KQLA 2CE7A 4HDQB 5FA5A 3QSYA 4HGQA 4QPDA 4UFNA 2XYHA 3NKLA 4GVXA 2I7DA 3WWCA 2DPIA 3QEBZ 2LYAA 1LBQA 3C0KA 4ZYYA 3C85A 4F92B 2KV2A 5GJVC 1YH3A 4FE7A 5L45A 3DW3X 2GFIA 1HYEA 3A8TA 2M1ZA 4YMVA 2HX1A 1V16A 4TL9A 5ADUS 6PFKA 2R00A 4C7BA 1WSAA 2RHDA 1Q46A 2BE7A 5H8WA 1KFKB 2OCGA 4PXYA 4NZMA 5CDSA 5KKNB 1QF9A 4DJTA 5L1JA 2FCAA 3DC7A 3U7RA 2IYWA 2HMWA 4AYBC 3LCCA 2QN2A 2Y6UA 1XZIA 4D6YA 5JBNA 1GPJA 4GSLA 5T4BA 5ETJA 3O8BA 1YE8A 2B5WA 1RYMA 4U6QA 1VE1A 4HNTA 1BSVA 2EFGA 2BGWA 3ZHCA 4BU0A 1RYYA 5H4GA 5BORA 4H0FA 4HQLA 3AVPA 3JQFA 3R0IA 2GBGA 4DSNA 5EIEA 4V0OA 4QXOA 3O0DA 4ZQBA 4KQHA 1XVIA 4WLOA 5T3UA 5IC5A 2ZVJA 8ICYA 5AHXA 4O4JB 1OV6A 2YWXA 3KOUA 5IXYA 4ZOLF 1F14A 1R0LA 1UA0A 2QG4A 2HA3A 3OHMA 5ALSA 1U5CA 1AK2A 1OILA 2GWHA 3A9WA 1J0AA 4FCCA 2IVFA 1XRRA 2IYVA 4G4JA 2BELA 3JWPA 2DBQA 4ZTUB 1L3SA 1UCVA 3A1EA 3BX1A 4FI3F 3TXYA 1OKKD 5LQUA 1WCWA 4KXNA 2C84A 4IOJA 1O87A 1ZM3A 2ZTHA 2WWYA 5LXTA 4LV8B 5JJLA 4FWBA 1PJZA 3CEPB 3OG9A 1JKJA 1R3DA 1V4NA 4I36A 4KWTA 5IC6A 1PYDA 3RFCA 4M9NA 2NU9B 3R9KA 4I2GA 2W98A 3P1JA 3OPMA 4GI2A 1KY4A 4LK3A 5CMLA 2NADA 4AC9A 1ZCFA 2MSWA 4PC1A 1NP3A 3D8SA 3HXKA 1I33A 3QPCA 2GB4A 4DCPA 4LN1A 5IMBA 3M8SA 3FPJA 3EPLA 4RNMA 4DLNA 1ONNA 4DARA 1AGPA 2BHNA 1EUDB 3FAKA 5IASA 3O1HB 3R3SA 2FOIA 3STYA 3L4BA 3QW2A 2AEMA 2B99A 4H60A 4OIFA 3U39A 4KU4A 5K3EA 3SBOA 2ZSEA 4LZOA 2XQJA 3U0BA 2LR0A 1U3FA 3R6WA 1NURA 3BJYA 5B30A 2DPGA 4A6PA 3DZBA 4I08A 4QIWC 2WF6A 4KHPB 2BCQA 3U3KA 3ZY3A 4TVSA 3P7MA 2RC6A 2C2OA 1J33A 1GL7A 1NJ2A 2O8DA 2Z3VA 3RSFA 2XA2A 5FEUA 4CKCA 4XIYA 4M1MA 4B3DA 1S89A 2WB1F 2YJNA 1YB6A 4JT4A 1RXYA 2K5UA 3H6KA 2KG5A 1HT2E 1KAMA 5FA6A 4IGKA 4F4ZA 2FMKA 5JEEA 4YBZA 4HRAA 3NC1C 1XQWA 3W8EA 2KZMA 2AXQA 3DO6A 1VXOA 1E9VA 3UATA 4BJHB 3TLCA 3K3PA 4GWKA 4S1TA 4L57A 2B8EA 3SVZA 3IIIA 3NXSA 4NFSA 1T2EA 3RS8A 2BGNA 4LNAA 1Z34A 3D5QA 3WFIA 2YYSA 3D5TA 1NK0A 1JQAA 1RRKA 3G5AA 2AN9A 2VLIA 2KN7A 5CFMA 1HZZC 4QZDA 2IYEA 1IN4A 3ST7A 2DH6A 4JUZA 5J29A 1B3BA 3AUXA 2YWJA 1E9SA 3UMBA 4H7EA 5KSYA 5H4HA 3PNQA 5JMTA 4ZAZA 4FKBA 1FP4A 1WWUA 4OXNA 1IZYA 3IEKA 4Y2XA 1FO4A 3TTYA 2IOFK 1SUAA 3R24A 3QU7A 2QRQA 4ZZIA 3S5JA 4WCFB 1D6JA 2C2ZA 5E9JA 3W5HA 3G68A 2P91A 2ZT5A 5KYWA 2IX3A 4FNOA 3VSDA 4A10A 4HVLA 4NL4H 1OLSA 2IMWP 1U8TA 2X41A 1PUIA 2FZGA 4NK5A 4HAZA 621PA 3R0ZA 4QZBA 1CQPA 3D64A 2AFHA 3PITA 3SSNA 1IQ0A 2BAGA 3WY9A 4CQLB 2J3IA 4P92A 3AH8A 4Z54A 2W6OA 3WGZA 1RWPA 4GQBA 4C2TA 4RC9A 5NULA 3PUJA 1R4MA 3F53A 2VG8A 2A8YA 4XDZA 2R00C 4HEA6 3DDNA 3WO1A 1Z00B 3GPCA 2CLKB 4IIEA 4QXAA 4TTIA 3WNBA 3GJ0A 4OHOA 4RNOA 5EJFA 3K8ZA 4YN3A 1JJAA 3I5AA 4ZI7F 1GUFA 3MINA 2K6GA 4ITRC 2P8JA 1L7QA 3A9SA 2I99A 5DK4A 4LVCA 4TUSA 3BJRA 1J7KA 2PT7A 4U3JA 1NVVQ 1Y9DA 4C8KA 3ICPA 2CVFA 1SBTA 5B37A 2P2NA 3DGEC 2AKYA 5BSTA 3JQFC 2ZPUA 3D2QA 1Q57A 5LZ5A 5JZOA 3FCOA 1N2CA 1FRVA 1CLEA 3BK7A 4B3JA 3PV8A 4LXIA 2ZSFA 1QOZA 4MV1A 3RROA 3UC9A 2CHEA 2ZAOA 4HNVA 2UVRA 5BYBA 3W34A 5I48A 1XWLA 4D0NA 1CUFA 4WRRA 3HGTA 3TSWA 3ZH9B 3VH2A 4GQIA 3ZHTA 1ZVKA 2QENA 1DNPA 4BNZA 3DBRB 3K4GA 5C1BA 1NZPA 1E3QA 4AD8A 3ROKA 2XT6A 5J63A 4Q0MA 3OF2A 3IRUA 4GO1A 2H8GA 5FT9A 2VYVA 1JJBA 1LW6E 3FROA 4H31A 4G0PA 3U7GA 2G82A 3K32A 2SECE 3PEFA 1CUZA 3WHKA 2QTLA 1W47A 3QUAA 1J1UA 3RJ5A 3VBCA 1JT9A 2L2QA 2F4VB 2EF1A 3DMDA 2IYAA 1YBAA 4EYEA 4MUXA 3D43A 2A5GA 4D6XA 1BYIA 1GT6A 2PPLA 4HDOB 3F7NA 5BN3A 3TGPA 4OHBA 2BM8A 3ZXIA 4GX0A 3L4BC 4OHWA 1E60A 2GEKA 2VKTA 1QYRA 5BSGA 4BNMA 2ZXFA 5D3QA 4C6HA 1QDEA 3QIAA 1OIVA 3VISA 1YU9A 3JPWA 1VKHA 5EJ2A 4GPAA 3N05A 4ZKDA 3AVOA 2DUYA 2QKYA 4K7JA 3QU5A 3V5NA 4AZ0A 4EM6A 4K6HA 4QYTA 1YVRA 3PVSA 2QN1A 1LPSA 5BVHA 5F9NA 2D6FA 3TZEA 4BLQA 1A5BB 3OD5A 4C2AA 1Z22A 3WDMA 1W4LA 4L4RA 4BP3A 3LVBA 1KYZA 4FDAA 3IA7A 1YK0A 3PHJA 1GJRA 4CQNA 1YOVB 4ZCMA 1Q44A 1J0XO 2P9FA 1NDQA 2YICA 2PQ6A 2HHSA 4GS5A 4I4TA 4TS4A 1QYIA 4K9SA 3A9VA 3LBHA 1FY2A 4LNUB 3REFA 2P79A 2PZFA 5AW6A 2RH8A 2I65A 3B9QA 2ZK7A 1KARA 2ZR9A 2H3ZA 3ETNA 1NDHA 1T4DA 3A4IA 4OJKA 1X2IA 3UWMA 1QCYA 4X1IB 3NJ4A 2E8PA 3UMJA 3PC3A 1NKSA 4R66A 4RZHA 2BBWA 1ZJZA 2V7GA 1W0CA 4MAFA 4WJKB 1SUSA 1L6IA 1FNDA 4XVRA 4IXNA 2Q6VA 1Z47A 4UQGA 4NENB 1EB9A 1TOAA 1COWD 2IEBA 1QF7A 4UNRA 2PT6A 3E4CA 3ZQJA 3AI3A 3MCVA 4LTMA 4ND4A 4UFPA 2JEOA 3OI7A 1K8ZB 5AOCA 2WYOA 3TCKA 5ECWA 5B6IA 4Q44A 5C8ZA 1OI3A 3U4QA 3BQ2A 1SZJG 4TLAA 4JMLA 4Z3DA 2WVGA 3UW1A 2E4UA 2C4MA 2GXAA 2Q1WA 3B6MA 1FLAA 1N0HA 1SK9A 2CLCX 2DFDA 3TZQA 1UDWA 1DI0A 4H6PA 2NRTA 3NM6B 2B5OA 5AMXA 3E58A 2X40A 1Y9EA 3FF1A 4JGGA 3WNVA 3LC1O 3BIXA 5H7XA 4CM3A 4FYMA 3QVGB 2PD6A 1SNYA 1DRGA 5IT5A 4U5QA 1BA2A 3CH6A 1F48A 2G7MC 3AR4A 1RQ7A 1JYSA 4Q00A 1D8TA 2D8AA 1SXJB 4I81A 1P1IA 3IE0A 1JALA 3LWDA 3G59A 4V03A 1PGQA 2X6RA 1H8ED 4QUKA 5EJ7A 3ENQA 2IX9A 4E13A 3N7TA 1MC8A 5EWMA 3UUEA 3OTOB 4K5QA 4A6DA 1GZDA 1C7QA 4OU4A 3E15A 3DE7X 2BYTA 3ZQKA 3RYFB 2CDNA 4QZAA 4NIMA 4PV7A 5CHYA 2OSVA 3O95A 3RJKA 1KMHA 4DIKA 4U7PB 1OTYA 1V8PA 4LA4A 3JASB 4AF6A 9ICIA 1CY1A 2AXEA 4P4OA 5FPSA 4F86A 4YRSA 4FWIB 2BKVA 4RQ1A 1D2EA 1TTQB 1NT4A 4C3UA 3NDIA 2FEOA 4RYDA 2OEPA 3D0QA 4IQ8A 1OHHA 4QNNA 1L3UA 5ICSA 3W2GA 3GEHA 4WESB 4AMZA 4IRUB 5TEWA 4F3CA 5DVZA 3INGA 4BTLA 1XTBA 3DFIA 4LOJA 3AEZA 3NT4A 2PU7A 3KCNA 3DM9B 4OGWA 1MGOA 1E89A 4HXGA 5KHAA 9ICBA 9ICKA 3AHDA 2ZUTA 4TKUA 1P1RA 4DEZA 4JDUA 1QFZA 2JLAA 4ZMRA 3GUZA 3GLFE 1UBJS 3GFBA 4U7TB 1JRLA 1RKBA 1PJCA 4DZRA 4C5BA 2QTZA 3SZGA 3M89A 4MHTA 1FTQA 2C9YA 3K8QA 2JLBA 3I6ZA 3QLUA 2Q9CA 4G0NA 3JZIA 4Y6SA 2IYOA 4OK3A 2VQFB 3EISA 1XCLA 1RJWA 5CJPA 3RE1A 5D51S 3V8BA 1FJXA 3FDIA 1O6ZA 2R8IA 1SB8A 1VIMA 4IFEA 2F8TA 3V4OA 3JQGB 4AKSA 1E7QA 4ZT5A 2OAP1 3OY7A 4NXNB 2HJWA 4EHNA 3MTGA 5A0FA 2D6FC 2I4TA 1W2WB 2G9UA 1GAJA 3CLSD 2KD1A 4O29A 3TTXA 3ETCA 3DEJA 4QDTA 3R8FA 1FLDA 1L4LA 5LR6A 4O3MA 4QPNA 3CCFA 5EE1A 4QA9A 1LI5A 1E66A 1KU0A 1GGNA 3R0JA 1TQ4A 3L6DA 4LV5B 1P9WA 3KT8A 5MDHA 1T9KA 3E23A 5K0ZA 4ARBA 1AUQA 5C5DA 4DQUA 2EIXA 3G85A 2FEPA 3F5DA 2G5IB 1MT0A 2I2FA 3QUCA 2EARA 2OT3B 2IQIA 4NLGA 2KBFA 3S7TA 5DRTA 1N7GA 4KXUA 3NC0C 4RD0A 2BPFA 4G0XA 1QF6A 1E63A 4Q4CA 4FVTA 3QI2A 5AOBA 3MGHA 1JL3A 4HH1A 1E59A 1KIFA 3CUTA 4JJAA 4QELA 1Q16A 5EIOA 1NSFA 4HMPA 2GF2A 2E3TA 2GAFA 4JU8A 3JVDA 3ZU6A 3FKSA 4D5GA 4UARA 4FZJA 1L5UA 4FOTA 4LJ8A 5FR2A 4ZO4A 1E8NA 1RJ9B 3LO8A 4BLUA 4KGZA 1KJZA 1UFOA 5FBKA 1U98A 4INPA 4X1KB 4E46A 5JQGA 5IX8A 4JC0A 5FTJA 2UVPB 3FFWA 5REQA 1YDWA 4G63A 3FOWA 3U1TA 2FFQA 3HKBA 1SXDA 5CM8B 4X7RA 1C1YA 4HXEB 5IF3A 3QWIA 1F17A 1KORA 1U9JA 4Z6DA 2MU2A 2F43B 4BBAA 2JA1A 5A1TA 1TI7A 4EKGA 1ZI6A 2R8RA 2W9XA 3LTEA 1OC2A 3M81A 3NG1A 1MAWA 5TVGA 3L8EA 1JLKA 5E6RB 4L74A 4FGSA 5MF6A 3LP5A 3ZV6A 3C24A 1FZTA 4DM7A 3EXFB 5KTPA 4TXMA 4YMUA 1BMTA 4KQ1A 5B3KA 1YR2A 3I2HA 2I2DA 4Q3DA 4H18A 2AS0A 4H7JA 3TG8A 3G6WA 1X66A 4ZOLB 3VZRA 4JI6B 2WAQC 4PX3A 2ODPA 2ZTVA 4E4YA 2JJ8A 1MH1A 4HT3B 3STWA 3HB7A 4QFCA 2W90A 3U37A 2RD2A 1RDFA 1JQBA 3NETA 2W6CX 1WVIA 1OH5A 3A1SA 4J43A 5DB7A 1FVXA 5LZ2A 3NS1A 1SKSA 5GTHU 1QGUA 2C2KA 3H4IA 3RAJA 3ADBA 5KHOC 4QGGA 5DULA 3ETHA 1TMYA 2AZ4A 3EGCA 1LBEA 3ZIUA 1YSCA 4KOAA 2FXIA 3BMOB 3S3TA 4F11A 3CINA 1XSPA 4HAIA 2XEXA 4ZWNA 2J3LA 4GLLA 1JXQA 1X38A 1C2YA 4PYQA 3CKKA 4RQ5A 2NUTB 1YUBA 3BH6A 2XECA 2RKWA 2B8TA 4MHVA 2FLKA 4CLXA 3CVOA 4L8WB 2BCVA 5FPHA 1KY3A 1QYXA 5DMXA 4FTWA 2WC1A 1Z5GA 3QEJA 1QH1B 4AMYA 3SEQA 1P6XA 3Q15C 4KTTE 4RQ2A 2M6KA 3R6TA 1QVAA 1KJJA 2FN4A 1UBUS 5J0SA 4FFOA 5AM1A 4KPUB 3TG2A 1Y8ZA 1OLUA 3F7TA 2MSCB 2G63A 5EJMA 1UBGA 3A6GA 3PQ3A 1HF3A 1SBIA 3QLUC 4J29A 5BQFA 3UHOA 4FDMA 2CMDA 3LM8A 1TQ2A 4YR7A 3A3OA 5KYKA 4H1TA 4R51A 2EXXA 5EZYA 3VI4B 4RS4A 1JR3A 2W2NA 3A4VA 3WGNA 1WLSA 1VSQA 2BZ0A 4Q93A 2WHPA 5K8JB 1KEUA 1PWHA 4KLNA 3SIWA 3B0XA 4HFMA 1SVSA 4KQ9A 1ODTC 5ALHA 2XWSA 3GRVA 5K8IA 2HMVA 2OZEA 1F12A 4JVNA 2WTEA 3WHIA 3K9NA 1QDUA 2OHFA 4I7EA 4WK2B 5U4QA 2R65A 4Y6OA 3BGIA 3TZKA 1XDDA 3DVSX 4X24A 3T0FA 2NRXA 2Z6QA 1TRKA 2WWIA 3OZXA 2DFKB 4GKJB 3NYWA 3DO5A 1YI0A 4RJTA 1XDSA 4B3HA 3WLIA 4G5FA 4B6GA 2ZRJA 3GLHE 4WE3A 3CEHA 1SHTX 4EMUA 5TISU 4JXJA 1VMKA 3C1OA 2P0YA 5TVKA 4JBWA 2EF0A 5KT3A 3LUHA 5A4MS 2DF8A 2GO1A 4CTJA 3LPAA 3WVNA 3EZFA 1P7VA 3UT5B 5F4BA 2R6R1 4D99A 1CF4A 4RENA 2VFAA 2C5BA 4ND7A 2IFTA 4PRLA 4YCJA 3UXMA 4XQCA 1XMVA 2IELA 4UTVA 1TTTA 3K0CA 1AB6A 3FVTA 5LZ4A 3DFFA 3BCSA 4JODA 4DUGD 1M6VB 4X60A 4EW6A 4OH7A 4CIBA 4J0GA 3JQ7B 1QSSA 3C7AA 2ESEA 5BV7A 3LGXA 3EF0A 1IVYA 1G4UR 2BGTA 2B1IA 5KBYA 2PYDA 1NV9A 2CXSA 3W6ZA 5GAJA 4QQNA 1XIVA 4ZHSA 4OQEA 4ZI7B 4K26A 1CJCA 5BQOA 3RWBA 2BHLA 4L4SA 1Q6YA 3AVWA 3ZVMA 1Z5UA 3H11B 4CFSA 2VP5A 2VWQA 5CPBA 4B9AA 3UMFA 1II8A 3VM6A 4EARA 2IXFA 3GVIA 2FPWA 1MRNA 2A1JA 3P20A 3WQQA 3K92A 2C7QA 1ZUD1 4NICA 1V7CA 4X0EA 3IVCA 3KJIA 5I9NA 2ZJZA 1HX7A 1R66A 2I6GA 2B9VA 2ADOA 2CXNA 2DHRA 1SGWA 1W34A 3O9MA 1ZD1A 3BJEA 1SKAA 2O4CA 2PWYA 5FWXA 1ZM4A 3UXOA 1I1NA 1KMIY 5C80A 4XVHA 3HKCA 4DANA 4RPGA 1U0GA 1GPNA 4OATA 3MWDB 4F4UA 2QXUA 2AUTA 1XQYA 2PXXA 1P2DA 4BVAA 5AXAA 5I51A 1EFVB 2CL0X 1RC8A 5AFSA 2YV5A 4L6IA 2GYWA 2H08A 2WLTA 3SF8A 2J59A 3DVRX 2GZAA 1XZAA 5IIKA 4TQAA 3KHRA 3EA4A 3K6SA 4PZ9A 2MSLA 4TV8A 1QH8B 2FPIA 2XCTB 3RT9A 5HDQA 3OJFA 1HDIA 1VLMA 3N8IA 1V47A 1XCPA 3H5VA 2ODTX 4Q3AA 8LDHA 3ND5A 3IDWA 1HE8B 5KO2A 3NNSA 1NNEA 1GGHA 3LU1A 1H0RA 1AHIA 2DTEA 2VYQA 4BC1A 5AW7A 5CXXA 1DIAA 3TW0A 2VNIA 1G3QA 2OTCA 3CLRD 3ZE6A 5IG2A 3VTAA 2MAXA 4PRKA 5HM6A 1XCGB 4C8MA 4LIPD 4UJ3A 3BA6A 3OHPA 2ZSHA 3KUCA 3HFSA 3HCWA 3KQYA 3ZK9A 4IMRA 3A6DA 1NUQA 3ZHYA 1OIXA 3O26A 3CR7A 1K3TA 5F5NA 2GDJA 5ER6A 3LQYA 5LLSA 1JNXX 8OHMA 3CLHA 1KEEA 3I2FA 1Z73A 3W9BA 3WOHA 1MPTA 1D4AA 3MERA 2D5CA 2OVBA 4M8SA 1WW8A 4KO2S 2ZJ6A 3H5NA 3RSZA 3AJEA 2RAFA 3NPAA 5B55A 4ZDIA 1UPBA 4KIWA 2GF0A 4HYEA 1BWRA 2A4MA 2KFNA 5FOUA 3T7DA 4M9GA 4FXOA 2PX6A 4LWOA 4YRRA 4AI6A 2WU0A 5KFCA 2JF0A 1HPLA 4RGVA 4IH9A 3PBKA 3G49A 4J9MA 2DERA 4OHPA 2I7XA 3MABA 4KVAA 3TGWA 3O83A 4HZUB 3D4OA 5K3DA 5WRFA 3AETA 4L28A 4UREA 3T7RA 1AHHA 1H1DA 3NVDA 1D2CA 2J0UA 2IUTA 4YRAA 3D59A 1KDZA 3FVQA 3V1LA 1EE9A 4PO8A 4BNXA 3HBLA 4XGKA 3ZLUA 2ZIVB 2PSDA 5G0WA 3RYIB 3W1WA 3C3MA 2EWMA 4JEHA 2QV0A 1HI9A 2VPTA 4M36A 3V8PA 4EENA 3OFKA 1M1UA 2CNDA 4L9WA 2C2WA 2B7BA 3JR7A 4ZYZA 2DKNA 5GTIU 2AG6A 5ENDA 1PBTA 2J46A 1GNVA 2PMEA 2BOVA 1ECFA 1CY0A 3RJFA 4MX8A 2V7UA 2A9FA 3Q10A 3U40A 5J0UA 2WEKA 2B82A 1WHSB 4V1CA 2PBRA 1Y1LA 4ZEXA 3CE9A 4UVEA 3KYCB 5LIRA 1QIJA 2WAMA 1CUXA 2NXWA 3THYA 1K0UA 2E5LB 5CW1A 5F2EA 2PO5A 5HJ2A 2HDOA 3ND7A 4U6NA 2PFOA 1HEYA 1D8AA 2HFJA 3MSCA 4QAJA 3QXJA 3EULA 1TUEA 3EMKA 3I42A 4J16A 1K7XB 3K0CC 1EG2A 3WI7A 1ACMA 2JLRA 3MBOA 2YUIA 4IMJB 4MF2A 4ZTZB 2ZJBA 2G5TA 1ZBQA 4A0HA 2QIPA 4HQRA 3QMMA 1HE4A 1X9WA 3NLLA 3AHFA 2ZTLA 1SA0B 2FQQA 3KT3A 3R9WA 3IJ5A 2XYRA 3TS1A 3PQ5A 1QHYA 1GHTA 3MMPA 1WBBA 5K3OA 5LU8A 1P9OA 3UMGA 2JS7A 4NV3A 3M4JA 2XQFA 1V8OA 1K8YB 1T4CA 1D6NA 4CL2A 4AYBF 3OTHA 4FE3A 3SSOA 2HZBA 3ZWNA 1A7AA 4HUJA 1TE2A 3AQ4A 4C7MA 1PK8A 2FHPA 4E5KA 1JX4A 3QKTA 2WWFA 4M0LA 3H2BA 1BH2A 3HXMA 2QE7D 5E9WA 5ALDA 4LC0A 2NYUA 1L4FA 1FTYA 3I2JA 3TAPA 3R3HA 3OX2A 5A62A 5H83A 5HS6A 1ZVJA 1YJAA 3ENKA 4YXMA 4PEVA 3ZKWA 5E6SB 3K2IA 3GYGA 2JKZA 1PLLA 2DY1A 2C2BA 3BCRA 3P2MA 1K1EA 5HQ3A 2A5DA 1IVSA 3FR7A 3GFSA 1IHUA 1KEZA 1BD4A 2YV4A 4F2HA 1CYEA 4OJ5A 2XQIA 3VC2A 3A1NA 3G2MA 4JLAA 3ANTA 3AM3A 1BPBA 1LPMA 4F5OA 3UQ2A 5E7JA 1K3UB 5T4EA 4PN7A 1GV0A 4JI0B 4YRDA 1T0IA 2NZVG 1QZTA 4EYOA 3AF4A 3GUYA 5GONA 2Q5LA 2BGMA 3JVVA 4CU2A 3BS7A 3PSFA 2ATXA 4UFOA 1EBUA 3LC7O 3VZBA 1MO4A 4L7VA 1ZW6A 3D02A 3F4BA 2AEEA 2X7HA 4R8RA 4C6TB 4D4HA 3ZHRA 3T5PA 4HZGA 4R9RA 2NYAA 5BYKA 1K5HA 4OLBA 4HSGA 3N2EA 1YT3A 2OQ2A 5ICGA 2HLHA 4PR3A 2MINB 1M1ZA 3M6FA 1QGAA 4RD2A 3CEJA 1BS2A 4R9UC 3ZS8A 3JRXA 3T15A 4BGIA 4DLUA 2IEGA 1X77A 2ZBQA 1OW5A 1E9DA 3O1JC 1MIHA 4A2QA 1LZKA 3MMZA 1FBNA 5ICCA 4ECTA 1NXXA 1T6BY 4WNAB 2FP4B 4D8WA 4QIWF 4EBFA 2QF7A 2PH5A 3O31A 4ND2A 4H4CA 3TFWA 1BNCA 2W43A 3UJCA 4Q9HA 4EZ9A 4AWBA 1GDHA 4P93A 4YT4A 3GJTA 2ZRQA 3MC1A 5G1PA 4RDHA 1OV4A 3O9VA 3MIZA 4MV3A 3RTDA 3ZWKA 4O3QA 3ZY4A 1B76A 1NUUA 1VZ3A 3RD5A 5CCEA 1WBJB 1A9XA 5LB4A 2O8BB 1JEQB 3ETEA 1Z9BA 4YROA 1TCUA 2YUTA 3I1YA 1UXJA 5I7HA 2R44A 3RVBA 2VO1A 4AUEA 4AKTA 2QUKA 1BCSB 3V7LA 3WIEA 2X4LA 4F93B 4G0OA 3FKQA 4E5PA 4DXHA 1J9EA 3F6SA 1TKBA 1ED1A 1ZMBA 4JUIA 5B4TA 2YW2A 3H97A 4PYRA 4QZEA 3BYZA 4G24A 3EEBA 5DHFA 3ADPA 4EFNA 4PS0A 4ZYVA 4JFRA 3IHTA 2FB9A 5FFFA 2JAQA 1SG0A 2PX0A 3IHLA 3GUUA 1G5FA 3I39X 4JBNA 2W3RA 1SC1A 3GJ4A 4H9GA 4NMLA 1MB4A 2ZKIA 3TE6A 4N5DA 2ST1A 3EUWA 2A1TR 2QORA 3AK4A 5B7PA 1WM1A 4UDNA 2CBGA 1IWPB 4Q21A 2YFYA 4S24A 5IABA 4ROSA 5JUWA 1S0OA 1BEEA 2QMOA 2R8KA 4B9NA 2FOLA 1YFZA 1US8B 4ZCPA 3R7FA 4BHTA 3FVVA 2ZRBA 2FLPA 4J16C 3VJRA 5C4IA 1Y6GA 1NBME 5JRDS 4JUAA 2ORWA 4OHVA 2GD0A 3UFBA 1A1SA 4V0KA 3K05A 3V8MA 3OQMA 2QQ5A 4Q1BA 3VV3A 4DGQA 1LLDA 2IZ5A 1RE1A 3M9NB 4K9PA 4BV8A 4M98A 3IP6A 1QV9A 1STOA 5K0FA 3DCJA 1W5AA 4X71A 2AJCA 1SCQA 1L1EA 3RUPA 4M1OA 2MUTA 3CYFA 5DSTA 4ZU3A 2GVDC 1WB4A 2H1WA 4HFJA 5IJ0B 1GAEO 3N2GB 3T3FA 3P4YA 1TJ4A 1WB5A 3FZYA 4GX2A 4DNQA 3PR1A 4L9AA 3C8DA 1XRQA 1I7QB 2Z5VA 3SICE 1Z17A 1U47A 4LRXA 5J0QA 1WBDA 5EMHA 1SFRA 4WJZA 1PR6A 2J9ZB 4KSCA 3RQIA 3PUWA 3NOVA 3R76A 4HDKB 3JW8A 5DCLA 821PA 1KK3A 1JQEA 1HFKA 1I0LA 1E1NA 5DASA 3MPUA 1CR0A 4XRGA 1U90A 1NJ6A 1CP2A 1JQKA 4ON9A 4MRRA 1JEYA 3L6CA 2QVZX 4KN6A 3P9CA 4EP1A 1Y7PA 4NVRA 3MT8A 2XB4A 3O1IC 2ODQA 2P9TA 4HB2A 4F38A 3PA6A 3T99A 1E4OA 2OB1A 5LBIA 3LZ6A 4C4XA 2ZB7A 3RFTA 4JEMA 2WKWA 4HCJA 3L8GA 5LXTF 3WB1A 4EH1A 4ZCSA 3ZDBA 1EK6A 4TX1A 3QEAZ 3MD9A 3MUNA 3GG9A 3G2PA 5JNVA 1KWGA 1H3NA 3ZDCA 4QYIA 2ALJA 1GFSA 3SQMA 4AJLA 3LW8A 1KY5A 5KFXA 2PT5A 3CZ4A 2XDQB 5K8LA 5C1DA 1O95D 2BTEA 4D42A 4X62B 1A0PA 2Q8QA 3E81A 3I8OA 3ONDA 3EGXA 4FR5A 3EXEB 1DBVO 2VDRB 5NLLA 3D5EA 2Q4DA 4GDMA 4S1OA 2V7PA 1FFYA 2N9UA 3SQIA 1YS1X 4JLVA 4CDRA 1N3IA 5F7OA 2R5NA 5DYNA 2QZ4A 1E6CA 4U9IS 4CM4A 4GIBA 4AX8A 4Q1CA 3DULA 3LBNA 3O93A 4LCEA 1HE2A 1T3LA 2I8AA 3PO5A 1AZSC 4MGHA 4LYYA 2PGDA 2B78A 3FNFA 2Z98A 1TYCA 1FS4A 4O2LA 3RJGA 3AMZA 2RI6A 1NVVR 5BUQA 4I2FA 4CV3A 1F0YA 3D8RA 3HX0A 4G81A 4Q4HA 4BFYA 2VT3A 2Z1MA 4Z86A 4PZAA 1XYYA 2CCKA 1V3VA 2EV9A 5TSDA 4PX2A 1RXWA 3TXXA 2V9WA 3S70A 5DHAA 4BO8A 1W35A 4BGUA 4Q5IA 3ZCQA 2HKIA 3D2CA 1PK1A 4I6JA 1ZZEA 1ZCAA 5DTEA 1E69A 4WOBA 4DLEA 1BPXA 3D4LA 3NIGB 4PONA 4A8JB 4CCWA 3TNLA 2R0QC 4HH3C 1Z15A 4NZYA 4HDRB 4TMZA 3AEQA 3TNDA 1HFJA 4PZZA 3H9BA 2FGJA 3BMQA 3PCTA 5C1IA 3DP7A 3H9GA 2FZLA 5IXJA 2HDHA 4JKYA 1E7SA 2C4HA 3WRWA 2OOKA 2BCJQ 1FEZA 2FR0A 4RYLA