3I7DA

Crystal structure of sugar phosphate isomerase from a cupin superfamily spo2919 from silicibacter pomeroyi (yp_168127.1) from silicibacter pomeroyi dss-3 at 2.30 a resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
157
structure length
157
Chain Sequence
PKLDLDSIERRIGSVYPGRLNAAMDGRSSLRLGDAGGLSQFGVNLVRLEPGAKSSLRHYHMEQDEFVMVTEGALVLVDDQGEHPMVPGDCAAFPAGDPNGHQFVNRTDAPATFLVVGTRTPTETAYYSDMDMMVKQDASGFAFTRKDGSPLTADQIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sugar phosphate isomerase
publication title Crystal structure of sugar phosphate isomerase from a cupin superfamily SPO2919 from Silicibacter pomeroyi (YP_168127.1) from SILICIBACTER POMEROYI DSS-3 at 2.30 A resolution
rcsb
source organism Ruegeria pomeroyi dss-3
molecule tags Isomerase
total genus 33
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3i7dA00
3HQXA 2XL9A 4MGZE 4X6RB 4QXKA 3CLPA 5FLIA 2H0VA 2ET1A 3FJSA 2WFPA 3PNAA 4E2GA 1Q43A 2QJVA 3BB6A 4BYYA 4WBBA 4KWJA 4AVCA 1RUOA 2MPFA 2BNNA 5I91A 4BHPA 1Y9QA 2XHKA 5JAXA 2Z69A 2ATFA 2B8MA 2B9UA 4XFFA 3RYKA 2QCSB 1LB2A 3CO2A 1O3TA 2V09A 3MPBA 1CAUA 3DV8A 2GC1A 2XLAA 3NSTA 2D5FA 2VECA 2IXJA 3I59A 1ZZ7A 5J3UA 2IXCA 4KU7A 3E5QA 3EHKA 3H50A 3BU7A 3USSA 4AQ2A 5C8WA 1OI6A 3C3VA 1VR3A 3ROUA 2Q1ZB 2ZKLA 3SCFA 4MZUA 4AXOA 1VJ2A 3E6CC 1ZRCA 1X8MA 2Q30A 5CU1A 1O3SA 1ZRRA 3ETQA 4IESA 4FAHA 1CAUB 3WW4A 3U10A 5KHKA 3D0JA 1LKNA 4IEXA 2EVXA 4PIYA 3I59B 2Y0OA 4FAGA 3MYXA 2PQQA 1I6XA 2BEOA 2CAVA 4D7SA 4MGYE 2K9ZA 5BXXA 4HLTA 3NJZA 1PM7A 1YHFA 2UYAA 1RGSA 3UKTA 2GU9A 4ONUA 4YRDA 4AQ6A 1IPJA 5BUVA 3RDIA 4BIFA 2N7GA 3UKNA 3E5XA 2BYVE 1YUDA 3S0MA 1TQ5A 4ZU5A 1UIKA 4GULA 3LA2A 4E2QA 3OGJA 3EQEA 4QM9A 3WW3A 3TNPB 2D93A 2PAKA 3RZZA 1UCXA 1CAXA 4B29A 4N9IA 1XE7A 4A2UA 1UPIA 1NE6A 4KWKA 1X82A 5LEJA 2D40A 4R8HA 3PVBB 3H1YA 4QGLA 4EV0A 5JSOA 4OLLA 5JSPA 4CYDA 5I8SA 1YLLA 1NZCA 5LRRA 1DZTA 4XF9A 2HJIA 1CAWB 4XETA 2O8QA 5LRSA 2CGPA 3DL3A 4Q0SA 3SCGA 3IBMA 3KSCA 5I0TA 1CAVA 1ZVFA 4WVZA 3TNQA 4LA3A 4LA2A 3U11A 3U0ZA 5FPZA 4XFHA 4LEJA 2GC3A 4IEYA 3RYRA 3H1WA 4UBHA 4AVBA 4QGNA 4UBGA 2PYTA 3M70A 4L11A 2VPVA 2ETEA 2GH2A 3BALA 4O9EA 1QXJA 1FI2A 3S7EA 5LEKA 1CAVB 4EROA 1QY4A 4BH9A 4LUMA 2UY8A 1J3PA 4QM8A 5JSRA 1Y3TA 1VP6A 1SFNA 4XF4A 1NXMA 3D82A 3OTFA 1DZRA 4AVAA 1X8EA 5T3NA 4MX3A 4PIXA 3H8UA 4JTOA 2PAEA 3ST7A 3H7JA 1IPKA 5E1RA 4HVQA 4EWAA 4LTAA 3SCHA 4HVOA 2PAMA 4HBNA 4ZU7A 2EA7A 4E2SA 4IEUA 3SHRA 1SQ4A 5I0RA 4XF0A 1YWKA 5JR7B 4XFAA 4YARA 1Q3EA 5D1IA 1X7NA 3IDCB 1EY2A 1CGPA 2CAUA 4R52A 3DN7A 2F4PA 1WLTA 4HZFA 3I54A 2OZJA 4HMZA 1O3QA 2BNOA 1XE8A 1YFXA 3LAGA 2UY9A 2IXIA 2IXLA 3FE5A 2D5HA 4IEQA 5I0SA 1O3RA 3S7IA 3RNSA 1H1IA 1ZNPA 5EZWA 1PMIA 1I5ZA 4Z82A 3OF1A 2K0GA 5BV6A 3LA3A 5KBFA 1OMIA 3HT2A 4EWEA 5FLHA 1QWRA 4PJYA 3QACA 1GQHA 3CL1A 1CAWA 4LUKA 2QNKA 5KHIA 1U12A 3BPZA 4I02A 4HSJA 2Q0AA 4LLOA 2XGXA 3H9AA 5JCTA 4YNIA 2MNGA 3LZZA 5FQ0B 4I3PA 2B5HA 4IEOA 4TLFA 3EO6A 3ES4A 2IXKA 1Q5OA 4HSLA 3GYDA 4JV4A 3HT1A 2P17A 3WW2A 5EFUA 4F8AA 3LA7A 2Q4SA 1FT9A 4YYOA 2KXLA 2EAAA 3GBFA 2VQAA 4XF1A 2MHFA 5KHGA 3N4MA 2FMYA 1ZZ9A 4IEVA 1DGRA 1UD1A 3OCPA 4I09A 4D7TA 5I93A 5FLJA 1ZZ8A 3B02A 4LULA 5KHHA 4MV2A 1L3JA 1XRUA 2IXHA 3E6DA 4XFCA 2OZ6A 4NVPA 2GZWA 4P9GA 3O14A 4I2OA 3H7YA 3IWZA 4Q0PA 3RPQA 2OYZA 4DINB 3UKVA 4Q29A 3ACLA 1NYWA 4FT8A 5FCCA 1ZZBA 3RYPA 1ZRDA 3LWCA 1J3QA 4MH0E 1NE4A 1UW8A 1V70A 4Q0QA 2PHLA 4HN1A 1O4TA 4QGMA 3FFQA 4HVRA 4META 3EBRA 3LOIA 2OPKA 4I01A 2XL7A 5FDBA 2UYBA 3FHIB 1O5UA 2FQPA 1ZRFA 3G7DA 4X6QB 2BGCA 5E16A 5I8TA 1YFWA 2Z2SB 5F1RA 2O1QA 2I45A 3M3IA 1HW5A 5CADA 4L2NA 4HN0A 3BCWA 2BNMA 3IIAA 2DCTA 4KU8A 5BPXA 1RTVA 1ZZ6A 2E9QA 3KCCA 2H6CA 1WGPA 5FPXA 4FBFA 4RD7A 3SXWA 2PTMA 3HIFA 4KWLA 1ZX5A 4UXAA 3NKTA 1ZZCA 4J1WA 1UIJA 3I7DA 4OFGA 1RC6A 3CJXA 4IERA 4XEZA 3CF6E 2PHDA 4H7LA 2H6BA 1EYBA 1J59A 1EPZA 3CEWA 4IEWA 3H1MA 2WC2A 2ZCWA 4MUVA 4J1XA 5FQ0A 5CVRA 4XFBA 1RL3A 4I0AA 3H3ZA 3R6SA 3ES1A 4JVAA 5HI0A 3MDPA 1QXRA 3IDBB 1WA4A 3FWEA 4QX5A 3D0SA 2HKXA 4N9HA 4MGIE 2OA2A 4O9GA 3ZDSA 3E6BA 4YSFA 4MGKE 1J1LA 1J58A 1YFYA 2C0ZA 3FZ3A 3KGLA 2ET7A 1RUNA 4IEZA 1FXZA 1EP0A 4Q0VA 2QDRA 1SEFA 2CV6A 2XLGA 2XKOA 4Z07A 1G6NA 3FX3A 4PIZA 5AVPA 3WW1A 1LRHA 3OD0A 3NVCA 5KHJA 1O7FA 3QOPA 3JZVA 4ORFA 4ZU4A 1CX4A 2XKPA 1JUHA 2IC1A 1DGWA 1OD5A 1H1MA 4F7ZA 4IETA 5J48A 5I8YA 3ELNA 3PLQA 3EJKA 3NW4A 4QMAA 3VHRA 1YFUA 2PFWA 5C6CA 4XFIA 5BY5A 5I0UA 4Q0UA 3NL1A 2GC2A 1O5LA 3E5UA 3H3UA 4XF3A 3KGZA 1OFNA 1CAXB 3KMHA 4JTNA 4K8FA 4XFGA 4WZCA 2GAUA 1J3RA 1GQGA 3SMHA 1ZREA 2QVSB 3E97A 4KL1A 5K8SA 4EWDA 3DKWA 2XLFA 4IEPA 5J7MA 3MZHA 1LR5A 2PA7A 3L2HA 4I0BA 2GC0A
chains in the Genus database with same CATH superfamily
2VNVA 4NOTA 3ZIXA 2XL9A 1ODNA 2VOWA 3N7JA 4LK7A 3ZR5A 1PGL2 1ASJ2 1R1A3 4TSVA 3RWKX 1R083 1OOPC 3ECQA 3FJSA 2WFPA 2ZGKA 3KZ4C 4K20A 2PLV2 4CDUC 4NUBA 1VALA 1CJDA 2LALA 1HB1A 4WBBA 3C7EA 1RUOA 1W6NB 4YGCA 5I91A 3WQ0A 4BHPA 2Z5WA 3B01A 4FPEA 2SLIA 5EYXA 4LOTA 2IUWA 2B8MA 2B9UA 1TNRA 1AR71 1C3HA 1PHMA 1RUJ1 3G6JB 3I8TA 1WKYA 3DPRC 4KGQA 1JI6A 4QQPA 1MS4A 3DV8A 1RUG2 3NSTA 2D5FA 1QJX2 3FLPA 4AEDA 1JOPA 2Y64A 4XABA 2IXCA 2W9XA 4XBQA 3BKZA 2EF6A 3SH4A 2E53A 2KM2A 1JZ8A 1VBB1 2ZMNA 4FPCA 3USSA 5FXXA 4F83A 3DYOA 1F4AA 1REDA 2ZKLA 4FOWA 5H9QA 3TBDA 2EXHA 4TTGA 4O65A 4MZUA 4Y33A 2RS32 3T2TA 3JUUA 2RM21 2EIEA 1ENQA 2Q30A 2W5FA 3A0KA 1ZRRA 3ETQA 5FY8A 4AEJA 1RXFA 3SH5A 1MZEA 1VBE3 1IS5A 1TEIA 3VHPA 1CD3G 3K3NA 5FBZA 2J1UA 1V9U1 2VQTA 3ENRA 4IQPA 1JZ2A 1LU1A 4K8RB 1GOHA 3PTYA 3SQOA 3PDQA 4B3NA 4EN6B 5E89A 1W28A 1POV0 3I2GA 2AEZA 4FP3A 4A41A 4GKXA 4UT5A 1YNAA 3LDRA 3KM5A 1OOPB 1E5IA 2K9ZA 1CIWA 4CDUB 3IKWA 5JXGA 4NO4A 1EV12 2PHRA 3KF3A 2A6VA 3NKGA 4HLTA 3NJZA 5D21A 5BXXA 3TRSB 3UK9A 1O59A 1B35C 1YYNA 2WWUA 2X8KA 1HRI3 1SFYA 1XNDA 1Y4WA 2RS51 2UYAA 3GM8A 3KVBA 1NG0A 3RI9A 4BIOA 5ABJC 1UPSA 3ATGA 2ZGNA 3N7LA 1S0IA 4CSWA 5I0DA 2HWF3 5LA9A 2QZ3A 3N9OA 4BIFA 2N7GA 4EN0A 5M0TA 5JOWA 1ND2C 3B5LB 2QQIA 1D4M3 1WCSA 1QJU2 2E26A 2W1WA 1SACA 2FCVA 3O1RA 4ZS3A 5A3PA 3D3AA 5J1XA 5FY1A 2WT2A 4QAWA 1SLAA 1GUIA 3IIIA 5C4WB 1NCRA 3OGJA 4QM9A 3KF5A 4CDXA 4DQAA 3L9JT 1FOD1 2D93A 1LECA 4RN5A 1AYN3 2ORXA 1CAXA 1YQ6A 2VW0A 4Q26A 2DUPA 2YDEA 1POV1 4CXWA 5FO8B 1OA3A 2F6BA 2D3RA 3I3MA 2VBPA 4FTSA 2V4AA 1EAH3 5CA6A 2BGPA 3E1F1 4GJYA 1JYIA 5A7QA 2WT1A 2ADDA 2X5IA 1X82A 3T08A 1IQAA 4Q1PA 4AZZA 3SITA 4DXRA 2GH8A 4R8HA 3WDWA 3ZFFC 3H1YA 4HG6B 4QGLA 4EV0A 5JSOA 1EUUA 4OLLA 2E7AA 4P9YA 4CYDA 5I8SA 5HXMA 1NZCA 3BVCA 4XETA 2VMDA 2O8QA 1W2AX 5C5UA 4AGVA 3SCGA 4MXVA 4CPBA 2BP6A 1QJY3 1DIWA 4IL7A 3WINE 5A6ZA 3ACIA 2AEYA 3BU0A 5FJKA 4QPWA 1GQPA 3ZFEB 1ZVFA 3S30A 1AL21 3A0NA 4KI5M 4QPIA 1HDKA 4AYUA 4LA2A 3U0ZA 5FZ6A 5FXWA 4XFHA 1B35B 4JHTA 1LU2A 3RYRA 1W6NA 3AJYA 3VHOA 3MI8A 5ABJB 1NQJA 2RM23 4AVBA 3K46A 1VAVA 4UBGA 1O4YA 5FZ7A 3RQ0A 3AZVA 2PYTA 1AL0G 5DDJ3 4M01A 1FPN1 4JRAA 1QGLA 1R1ZA 2BWCA 3T4VA 4DXZA 4UI9L 3Q8CA 4QD2A 4RQPA 2BQPA 5GLUA 4YVSB 1HQWA 3N9NA 4O9EA 1F8VA 2JE8A 3WXPA 1AR83 1CAVB 4CEWB 5LEKA 1T6GC 2VXJA 2EICA 2WZR2 2LTNA 4W4ZA 2G9GA 3N7MA 5CFDB 4D0QA 4OYUA 1H8TC 3O0VA 1Y3TA 5LB6A 4BQ2A 1SFNA 1WMXA 2JDUA 1I3HA 1UZZA 4DPNA 3ZYHA 5BNNC 4PF1A 3QH7A 3N9LA 3VDBA 4FVVA 4AI8A 2QZ2A 3DECA 5JDBA 1A34A 2JKXA 4PIXA 3CIHA 1NLQA 2Y6HA 2BVBA 2PAEA 1YI9A 4NIAA 3PU3A 1MS0A 1RXGA 5FPLA 4CCEA 4DEVA 3K75B 3ZFFB 4RL7A 2YMZA 1PGW1 4HVOA 4L99A 2PAMA 4YZ1A 2VL4A 1G9BA 4XCAA 4D6SA 1W2UA 3AK0A 4XF0A 5IWFA 3VBSB 3PMEA 1DQ5A 2JEMA 3W58A 2C24A 4E4DX 4XQWA 3TAYA 4XIOA 1OH4A 5L9RA 3DXTA 3U4SA 1G9AA 1KEXA 1OOPA 1Q3EA 4AHZA 1DDLA 2B4KA 2C1FA 4LORA 5D1IA 5IVFA 2CAUA 4RS5C 1SLCA 3GHMA 2F4PA 3NV2A 1MVEA 2VE1A 2Y6GA 4CUAA 2R043 2D3PA 3NNMA 4N8MA 3AB0A 3I54A 4HMZA 1O3QA 3ZSLA 2Q5TA 2UURA 3HN1A 3DPRA 3LAGA 2QQPA 3AP4A 2IXIA 4GMP0 1ZBA2 1WUVA 5I0SA 1O3RA 1RMU3 1MZ6A 1YJLA 1H8TB 1CESA 1AL23 2W47A 3RNSA 2VMEA 3OG2A 3VBFA 3WX5A 3WV6A 1HB4A 5FZ8A 1UXZA 4Y24A 4A42A 3JB4C 2P6CA 1H1IA 5BNNB 1DGLA 5CFCA 4BQ3A 1T2XA 1ZNPA 4C0BA 2RS12 3MHZA 4N43C 3TEYA 1PVC1 1XYPA 1PX3A 4FQZA 3HT2A 2B39A 3PUHA 3WHTA 1O6UA 4EWEA 3H8OA 3AL5A 2VZOA 2C4XA 1RITA 5FYSA 1RUD3 1R091 2QKDA 2XR4A 3OOXA 4AEKA 1H9WA 5EYYA 4OHXA 3CL1A 4M00A 2P3KA 2FDKA 5KHIA 1SBEA 1W6QA 4AFMA 3GALA 1SLIA 2JG8C 4COYA 4HSJA 2Q0AA 1YO8A 2MEV1 3HJRA 3POSA 4FOYA 2ZACA 1B09A 3H9AA 2X53S 3ZM8A 3WNNA 2VMHA 2MNGA 1N3QA 4RS5B 1BEV1 3JD72 4QDRA 5FQ0B 4BQWA 4EE2A 4KBBA 4Y1XA 1NLRA 5GZCA 2D97A 5IVVA 3TN93 1WA6X 3EO6A 2XHNA 4RR3B 1FV3A 5FIXA 4UFMA 1IKQA 2CSGA 3WW2A 1NQDA 1QKQA 2R16A 1ND2A 3TB0A 4BMBA 1E5RA 2BTVC 5EFUA 2ES3A 2IVIB 3P1IA 4BE3A 1ONAA 2HWE2 2HWB2 1FT9A 3V65A 3WVJA 3FHQA 4YYOA 3OGVA 1F5JA 3WUDA 3LGRA 1PO12 1W8OA 2NQYA 5F3GA 1UU4A 3N3HA 1DGRA 2VUJA 2R072 4NWWA 4Q4X2 3WDXA 1ZBE1 1NLSA 1GOFA 1VAKA 2VG9A 2YXSA 1GNYA 4N43B 4D7TA 2PHTA 3KCYA 4S2DA 2NMNA 4IE6A 4OI4A 4LULA 1BK0A 5FK8A 5KHHA 1TNFA 5CB7A 1Q8SA 5JZGC 1XRUA 3IMNA 4D6QA 1NOVA 2HWC3 3V64A 4J6GA 4NVPA 2LM3A 3O14A 4FPHA 1Q8VA 3H7YA 2D6OX 1RUF1 5T50A 3MW3A 4LBJA 3RPQA 1LEMA 1S4CA 2TBVA 2WUHA 4UOJA 2NPIA 4B1MA 2JDHA 3NWKA 2XWBB 4Q29A 2JG8B 1NYWA 5FMCA 1G7YA 1W99A 4NPRA 5FCCA 3ZFEA 3OGGA 1GKBA 1FAYA 1PK6C 3GZTB 2A75A 4O61A 1ASJ1 4AG4A 4DMIA 1NE4A 4DZGA 1W8FA 1V70A 2WNUC 1BBT2 2NLRA 3B7MA 1JBCA 2WO2A 3UJOA 2IWGB 5CEHA 1PVC3 3FFQA 1GOGA 3JBG1 1YQ8A 2VBBA 3AMMA 1W8NA 4WM7B 3F2ZA 2FDFA 3T2OA 1SBDA 2E6VA 4AR2A 2ZXQA 4Y1UA 1XSQA 1H8VA 5F7UA 1UL9A 4PDWA 1D2SA 5CZKA 5AC92 4LXLA 1RUG1 1QJX1 1QHDA 2QQUA 2Z2SB 2WA4A 4K21A 1LENA 5CADA 1H8TA 5FZBA 1IG3A 3T1MA 2Y6KA 2BNMA 2HBUA 3GZUC 1CR7A 1UYPA 2XPJA 4NRPA 2JG9C 5GKAC 4M3CE 4AAXA 4GMP3 4ATEA 5FUIA 2H6CA 4S2GA 2EAKA 1HB3A 2GN3A 2X10A 3ETPA 5HCAA 3A23A 3RVHA 4MOAA 3AYDA 2WIIB 3LEKA 4HL0A 4RD7A 2EALA 2AREA 5JZGB 2A3XA 2PTMA 1FATA 2QQNA 3GZEA 2Y26A 3NKTA 4KWLA 4Q4V3 1W0NA 2ZEYA 4EJRA 4OCTA 1SHWB 2PHXA 1OURA 4OZXA 2ZTNA 4ZKTB 1CWPA 1VB2A 4UW4A 3OD4A 1IGOA 2W68A 5AFBA 3KHBA 5C3QA 3U75A 4B4QA 1EYBA 1PK6B 1C57A 4AGRA 4UFKA 3ZN4A 2VD7A 4DO0A 1EPZA 4Z92B 2RMU3 3ZPYA 4NR1A 2WNUB 2YROA 2Q1FA 5JPNB 3C7GA 1CONA 1AR93 1EV11 1XBFA 2BVVA 2R063 4QXBA 5LASA 5C8CC 2FHRA 1ULOA 2G9ZA 4FPKA 5A3UA 3RI8A 4J1XA 4RS5A 5FQ0A 2FMDA 1BKZA 4XFBA 3H3ZA 4OI2A 3VLBB 1DYOA 5F39A 4JVAA 3UYJA 2WJSA 5HI0A 3O7OA 1IOAA 4GB33 1XSRA 3I97A 3N9MA 2VUDA 3D4KA 3MFCA 2HKXA 4QXHA 5A7PA 5JLVA 1RUF3 1DHKB 3MGUA 4QX0A 3NMBA 3VUOA 2OA2A 1PM4A 4JCKA 1AVBA 3I2HA 3HD8B 3E6BA 1QJU1 2VVEA 2VUAA 3T1LA 3KGLA 3CDZB 5FXZA 3VD7A 4NWVA 4BLIA 1D0HA 3AXDA 4OULA 1EP0A 3R4UA 1UY2A 2QDRA 5FR3A 2VU9A 2RJLA 1RUH2 3ZN5A 1X9PA 4CDWA 2XLGA 1GWLA 4PQQA 4UAPA 4Q4Y3 3KB5A 2EIBA 3JBG3 3R05A 1GWMA 4UFHA 2GNTA 2VMFA 3OD0A 4YVWC 5JIAA 3U1XA 1ENXA 4P14A 4N7IA 3RRDA 3JZVA 2WWSA 4WVMB 1CX4A 3WNLA 4A3XA 3LDBA 2IC1A 4JQRA 4CZSA 2TUNA 1LODA 1OD5A 1MR5A 4CCJA 4A3ZA 3T0DA 1J83A 2BOJA 4IETA 2OT7A 5FZ1A 5A33B 5I8YA 1Z7S2 4QMAA 2ZHMA 2CL2A 4P9XA 5C6CA 2PFWA 4XFIA 4QB1A 5L7OC 2ZA9A 5KXEA 2OIIA 3POBA 2YBPA 1LOFA 3NNJA 1BVP1 1VBC3 3VBHA 3VN4A 4CCOA 1O5LA 3WDVA 3W59A 4YW4A 2YPDA 4LIUA 2VMIA 1O8PA 5C3SA 2EIGA 2HWD3 5FO7B 4PHZA 1TVGA 2V73A 4JTNA 4CP1A 1FMD2 2DU1A 3QH6A 1SPPB 4WZCA 4XJUA 1QDCA 1W9WA 1KS4A 2QQOA 2WS91 4WVWA 3SMHA 5DABA 5K4LA 1ENSA 2WZR1 1VBD2 4DUXA 5FREA 1ULPA 1OVPA 3KV5A 2QVSB 3R4DB 2GNMA 3RZLA 3PL0A 1RUI1 1DLLA 3GF6A 4YW2A 2OKXA 1OHFA 1AYM3 2AH2A 2E31A 2O14A 3ZMOA 2E7TA 3N35A 3MZHA 1GZTA 4YVWB 1LR5A 2ZGQA 4M4PA 1PX4A 2PA7A 3THTA 3HOBA 1DFQA 4BPZA 4QXKA 1K5MC 1D0GA 3WNMA 1TMF3 5FLIA 4E8DA 1DYKA 3FFZA 1H0BA 4YGEA 3ZO0B 3ZSJA 2ET1A 1SCRA 3UV9A 1Q43A 2EXIA 2BDRA 5F3EA 3CMGA 4A44A 4AVCA 2MPFA 4CE8A 4ASMB 5B4NA 3ZMNA 2WRAA 4FXGB 1JXNA 3MBWA 4OI0A 1LHOA 4MG2A 3T0BA 2Z69A 5C9AC 1HRV3 3AYAA 3KWVA 3VL9A 1JH5A 4E4HA 1APNA 2ATFA 4NE9A 3IB3A 5HCBA 2P3YA 1CX1A 2BBAA 2JECA 2WNUA 3WZ1A 3SISA 1BYHA 3AKSA 4ZPIA 4Q8LA 2XLAA 4K7JA 1JHNA 2A6WA 2DDUA 3EMRA 4XCBA 3ZXFA 4EZHA 1RUC2 4A6OA 3I59A 1ZZ7A 4DY3A 2RDQA 5IW0A 4LIVA 3OGRA 4KU7A 5DZGA 3EHKA 4ZXEA 2KD7A 3BODA 1OI6A 4DNYA 1VR3A 1YRZA 3POFA 4QB2A 3AKTA 5A6XA 1H6XA 1US3A 2AR6A 4HK8A 1GNZA 1LOBA 1ZBA1 2WAOA 1WW4A 5DZFA 3U37A 1X8MA 3GJAA 1ZRCA 3A7QA 3AMNA 2GMMA 2ZX2A 5FMDA 2RJKA 2YB7A 4AQTA 2XQXA 5IFTA 4NIDA 1C28A 4MO3M 4CXYA 1LKNA 1BXHA 1UMIA 3K51A 4CU6A 2JG9A 3I2DA 4IEXA 2ZGPA 3N9PA 1CPNA 5FUNA 4LBMA 4IE4A 2RR13 2RS11 4XUOA 2DUQA 4V2VA 3DGTA 2P3JA 5CKQA 1LNSA 3N7KA 2A6ZA 3OUJA 4ISRA 1DYPA 4MGYE 5FZOB 5A3WA 4CDXC 5HV4A 1POQA 3S6PA 3WG2A 1H4GA 1U5YA 1AUYA 3OSDA 4GALA 2ID4A 3ZXEA 2IFRA 2J1AA 4TZDA 2AENA 4IV3C 3J7NA 2X5IC 2WS93 4KQ7A 5DAVA 1W9TA 4CP2A 4L9BA 1RGSA 2OVUA 1PO22 4XYXA 2ZGTA 3I3DA 4M4RA 5A33A 3CHXA 3UKTA 1GICA 2W0XA 4ATFA 5T5PA 5LBBA 3TOJA 4DXTA 3WLUA 5BUVA 1RUI3 3VZMA 1OQEA 1DG6A 1XNTA 3UJQA 3UKNA 5GLTA 3AL6A 2BYVE 5C8CA 3VD9A 1TQ5A 2XWJB 4ZU5A 5T52A 1MPXA 2NN8A 2GDFA 4UW5A 3OJBA 4AFDA 4E2QA 4QPIC 1VPHA 3MV01 3Q8AA 3ZKUA 2ZX0A 5LA2A 2Q1MA 2PAKA 4XIKA 2C6SA 2VUCA 4OUEA 3RZZA 3LSEA 1ACCA 1MEC3 4FPLA 1F35A 2CDPA 1ULDA 3DUIA 2HWE1 4Y22A 2HWB1 1UPIA 1NE6A 3H0OA 3ZKYA 5APAA 1QQP3 3WDTA 1VE0A 5LEJA 3R4SA 3MW4A 1XNAA 2D40A 2WZEA 2GP3A 3PVBB 1PO11 1W06A 4GWIA 4RQPC 4Q4X1 4XJ8A 1KJRA 2R071 3SKJE 5JSPA 1UWWA 4KMQA 3VD3A 4KG8A 2JDPA 3AMQA 2PHWA 4ISQA 5LRSA 1NCQA 3VDCA 2CGPA 4BCUA 1X50A 3J8F3 4Q0SA 1QOTA 3IBMA 3KSCA 5I0TA 1AF9A 1JW6A 4CDXB 5IVBA 5C3OA 3M3QA 5BNPC 3UNPA 4GQ7A 2VZQA 3TNQA 3OY8A 2WO1A 2J22A 5FPZA 5KWRA 4JGZC 3ZYGA 3RGBA 2GC3A 5FRAA 2X5IB 1IS3A 3NNFA 4W6YA 5FKBA 5G05L 3IPVA 3ZYFA 2YZ4A 5JXIA 4L11A 1VBA1 5L7OA 4LKFA 4EQVA 3ZFGC 1AHSA 1OF4A 5D8AC 5JXHA 1Q56A 5FFOC 1BBT1 1COV2 2DVGA 2VZTA 4HT1T 3HNMA 5FZ4A 5A3LA 1XU1A 4Y1ZA 3VZNA 1NY72 2VCAA 1H30A 2VCMA 3S7EA 4EROA 1S0BA 2G4IA 3ON7A 1HIXA 2PHUA 3MF9A 4MSVA 4QPIB 1MQTC 2UY8A 4DEQA 4DUWA 4QM8A 5JSRA 3WP5A 1VP6A 4XF4A 1A8MA 2D43A 5HV0A 4Z2AA 5IVCA 1K5JA 2ZX4A 4PF5A 2FDGA 2VZ3A 3OUHA 4C8DA 4QKNA 5AC91 5GZGA 2PHFA 3AXEA 1F5FA 1X8EA 2PMWB 2QFEA 3H8UA 5A1AA 1OLMA 4JTOA 4YG0A 2YBSA 3IZOA 4NIIA 4GWMA 5E1RA 1F2NA 4RQPB 4EWAA 4URAA 4HBNA 2ARXA 3POGA 4FI9A 4DB5A 4IEUA 4P00B 4YW6A 4ZU7A 1IHMA 1SQ4A 1WCKA 5I0RA 1FNZA 4LK6A 4SBVA 1LGNA 1N3PA 2OS2A 2XBO2 3VBFC 1HXS2 1K5MA 5FZOA 5CFCC 3MIDA 1W3XA 4JGZB 2B7YA 4K40A 5CYYA 3ZYPA 2XVKA 5DQ0A 2BFUL 4AEMA 3DN7A 3BIWE 5C9AA 5ANQA 1WLTA 2VZUA 5F2SA 4NIHA 3KV6A 4XACA 1XPWA 1GR3A 2ADEA 4GWNA 4HZFA 3ZFGB 5D8AB 2OZJA 3PUAA 4YW5A 5FYYA 3V56A 2JB8A 1YFXA 5FK7A 2ZHNA 5FOBB 2UY9A 2IXLA 2R7EB 2CU5A 1V6NA 3RMXA 3HMYA 4URTA 4HANA 3WR0A 4GXLA 3AFGA 2VZ1A 3AP5A 3KT1A 4BWOA 5LY1A 5FYIA 4FQ4A 1C8M2 1OXCA 3OPZA 1GP4A 2VW1A 3GXUA 3I3QA 2RV9A 1I5ZA 2DVBA 4Z82A 2K0GA 5KBFA 2VZSA 4CCLA 5T5OA 3J7HA 2YBKA 3PUIA 2VMGA 4Y3OA 5FLHA 1W8UA 5JR2A 2WL1A 2Y6JA 3CKHA 3RZMA 1VBA3 3DPRB 3VV1A 1WW6A 1TE1B 3QACA 4AI9A 5GJ6A 1OH3A 3DXUA 4OQ9A 1RUH1 3GZAA 4Q1RA 4ASKA 2QNKA 2V4VA 2FDJA 1U12A 3VBFB 1G8WA 4OHYA 4QX3A 1XB9A 3HR9A 5FMBA 5CFCB 2QUOA 3P3NA 2WSUA 1JZ3A 3MFAA 4FPYA 1XU2A 4LBQA 2VZRA 4I3PA 2NM1A 4IV3A 4HXCA 3O1MA 4RFT0 4PLOA 1AR73 1JYXA 2IXKA 1Q5OA 1RUJ3 4HSLA 5FO9B 1RVF2 1Z7S1 2Y33A 3NO8A 3KVAA 4QX2A 3AZZA 4JV4A 4XILA 4B7EA 2ARAA 2P17A 3HT1A 4K6BA 3M7AA 3O1UA 1G9FA 3J7MA 2GMEA 1W6QB 2PQSA 3UESA 2D6NA 2O0OA 1V00A 3BIEA 2KXLA 2XOMA 3GBFA 1W6MB 2VQAA 2TNFA 1VBB3 5E8AA 2HEYF 2WFF2 2WO3A 5FZEA 5H9PA 5CG9A 2FMYA 1TME2 1JYCA 1QOOA 1HN1A 4RHV2 4YGDA 2W3JA 2C26A 3K48A 4FPGA 3I2OA 4I09A 2ERFA 4I30A 1FMD1 4NHMA 5FLJA 1OT5A 5IYYA 1MZFA 4UW6A 5FZIA 1SLBA 4LJHA 4UFIA 1U5IA 1ND2B 3BN6A 1PIV2 4WV8A 3WNPA 4UF0A 5DN2A 1S1AA 4XFCA 1V9U3 2GZWA 4LBNA 4I2OA 2ARCA 3ALQA 3CBNA 3MUZ1 1JYNA 3W5MA 1W0OA 3ILFA 3IWZA 4PDWC 2OXBA 2OYZA 5J98B 3AMHA 1AJOA 1STMA 2CWMA 2DV9A 3ACLA 1BJQA 4FT8A 1ZZBA 3RYPA 5FY5A 1ZRDA 3LWCA 1BVVA 5BNPA 4C90A 4MH0E 5GZDA 2UWCA 3I49A 2VQ0A 1AJKA 2PN5A 1JU4A 1UW8A 5LBEA 3DCQA 2RS53 4R9CA 4JGZA 4Q4W2 1RUE2 5F6KA 5A1LA 1REFA 2XMLA 4HVRA 3EBRA 4PCRA 2JWPA 1SBFA 1UZ0A 4NPMA 3EXUA 5IT6A 2P5BA 1PMHX 2CHHA 1LHNA 2F4LA 1HV1A 3FHIB 3ZFGA 4FO9A 3GNEA 5D8AA 4BA6A 4DY5A 1JTZX 1O5UA 5JPMB 5A3NA 4B4PA 3G7DA 3T4HB 4X6QB 4LQRA 5GZEA 1LGBA 3IM0A 1OSGA 4H7MA 1IS6A 4LO5B 5E16A 1JYTA 2Q8EA 2XONA 2O1QA 4JAAA 1MQTA 1FOD3 2K46A 4BISA 4WM8A 5F5QA 1POV3 3NNGA 2WNVC 3MUY1 5A3OA 3U4XA 4LBOA 1PZ8A 1ZZ6A 5ACA1 3KCCA 4IXLA 1IQDC 3B9CA 3ZN6A 1LHVA 1WGPA 5FPXA 4FBFA 1VMHA 4NHKA 3VDDC 5DMYA 1UZWA 4LHNA 4XXPA 1JMUB 4C1XA 1ZX5A 2BOIA 4PLMA 2BV4A 2QTWB 1GYKA 1U5ZA 1ULEA 4PDWB 5A6QA 2ZGLA 1BHGA 2LUWA 4J1WA 4AVVA 4DS0A 2VC9A 5DAWA 4LOSA 2CY6A 4DUVA 2VOTA 2VOXA 3ZR6A 2JDYA 1G9DA 2WNEA 5GLVA 2JDMA 3CEWA 3F95A 4IEWA 3VKOA 3MV11 1LJ7A 3OPTA 4CDWC 2ZCWA 3VHNA 3K4ZA 2I74A 1HN0A 3WP3A 3BYWA 3POEA 3KS7A 1X36A 1FPN3 3KD4A 3MDPA 4OVEA 2ZJCA 3IDBB 1VRH2 5B4XA 4QX5A 4TN7A 5L36A 3LD8A 3O12A 4MGIE 5LWBA 2P1BA 1XQNA 2W91A 1JYWA 1AR61 5E88A 3PVNA 1RHI2 3A22A 4FOVA 1OF3A 4YSFA 4Y26A 1W3VA 3JQXA 5FYZA 1JODA 2WKKA 1J58A 1YFYA 2C0ZA 4NHXA 4LMFA 5DPNA 1W6MA 3OEBA 1HB2A 1CZSA 2ET7A 3NJYA 5IAVA 3VKFC 5JOYA 3ORJA 1FXZA 1LOFC 2VO5A 1CPMA 1GMMA 4Q0VA 3VBHC 1R1A2 4XURA 1R082 1REEA 1BCXA 2VH9A 2XKOA 3B69A 4NRMA 3H3LA 2VBDA 5IAXA 3FX3A 3WW1A 3VDDB 5FUPA 4RYDA 3T3YA 3J26N 1A6CA 4Q8KA 2RDNA 2UWAA 4AHYA 5DXDA 2XKPA 1HLCA 1JUHA 1MS3A 2DU0A 1CJPA 3AKPA 1DGWA 2ZEZA 3HBKA 5F3IA 2D6KA 2LRPA 3VD5A 5IK4A 5EHDA 1H1MA 4YW3A 4Z2WA 2K2SA 3MIEA 1ZM1A 3ELNA 3M2MA 3EJKA 4Q5OA 1X33A 4GAZA 1YFUA 1WD4A 4CDWB 3WNKA 3OBAA 5ACA3 3TEZA 1ZRIA 2ZPXA 2SBAA 2Y0IA 3LIGA 4Q0UA 3ZYRA 2C5DA 1I1EA 3E5UA 1YIPA 5ERLA 5LK5A 4BJ0A 1SDWA 5SV8A 5FP3A 4BK4A 5LZ6A 1JUIA 2DCKA 4B7KA 3KGZA 4XOGA 3RS6A 4BXSV 5JI9A 4Z1VA 1OFNA 3POJA 1SLLA 2IZWA 3POIA 1H2LA 3CNAA 4OHVA 1VBE2 1COV1 1PMJX 3W9AA 1W6PB 3WCSA 4XZUG 1NY71 5EJZB 5HXVA 4AVSA 1W2OA 5F8PA 2L9LA 1BLZA 1PGL1 1GQGA 5K9YA 4CCCA 2PELA 1I5PA 2PLV1 3VBHB 4I3GA 3QLQA 4DXSA 2W1QA 5K8SA 2ORZA 3PURA 4IEPA 1UU5A 2D98A 2XLFA 1KXGA 3QD6A 2VNRA 5HPOA 4META 4I0BA 2GALA 4B29A 1HRI2 3AZWA 1R093 3HQXA 4L8QA 4MGZE 4BQ5A 4H55A 1UX7A 3CLPA 3FUQA 2XUEA 4BQXA 1QDOA 3INAA 2P34A 4QHZA 3RG0A 3THCA 5BNOA 2XB6C 2A5ZA 2HWF2 4XXAA 1JHJA 2QJVA 4AI1A 1AR63 3KT4A 4KWJA 2WZPP 2WAAA 2BNNA 4QPGC 2XHKA 1D4M2 5A6YA 4XDQA 3D6EA 3O5SA 2MEV3 2WQ8A 4D3WA 1NXD1 2XBO1 1HXS1 1S2KA 4LITA 3S57A 3JCIA 1S0JA 2QCSB 1E5HA 4AFBA 1LB2A 1BEV3 4PT6A 1O3TA 3MPBA 1CAUA 2BBVA 4EN8B 5JVVA 2GC1A 2RS31 5EJ1B 1AYN2 1W39A 1V6JA 1YXWA 3QCWA 1Y9MA 1EAH2 3VBRC 4XPVA 3SEPA 3NAPC 4H14A 4GZ9A 3E5QA 1JZ5A 3H50A 2X05A 2A3YA 1WZXA 4M0HA 4AQ2A 3C7OA 1R64A 2NP0A 1X9TA 2A71A 2Q1ZB 3T2QA 3M3EA 1QH7A 5D2AA 3AX4A 3SCFA 1M4WA 1VJ2A 2BJSA 3E6CC 5C3PA 2DFCA 3DKQA 5CU1A 2P37A 5IVEA 1QJY2 1ZBE3 4IESA 4FAHA 1MZ5A 3WW4A 3EYPA 5IJRA 3D0JA 2WNVA 3KV9A 1ULGA 1C8M1 5J09A 4PIYA 1QIQA 3I59B 4LBQD 2HEWF 1QJFA 2QQVA 5F32A 3WF4A 1AXZA 2PQQA 4B4RA 1QH6A 2YUEA 1XOYA 1OFSA 2CAVA 2Y60A 5DUWA 3VDDA 1H6YA 4A7ZA 2RM22 4RGAA 1WCDJ 4K1YA 5KC6A 5DDJ2 2OX0A 5A7WB 1K45A 3Q8FA 1UMZA 4XJAA 5GLWA 5CBLA 4QQ2A 3LOBA 4XDOA 1RJ8A 1W0PA 4QPGB 5G04L 1U5XA 5FWEA 2VCCA 4PI0A 1YHFA 4BZ4A 3SC7X 2VTFA 2BUKA 1ASJ3 2V72A 1AR82 1UOFA 1J1TA 4FXKB 2JG9B 2PLV3 4XBLA 5DZEA 3VZJA 4CU7A 3RDIA 3E5XA 1W8WA 1NCQC 3O0WA 1YUDA 2Y6FA 1UIKA 1Q8OA 3USUA 2C9AA 5AVAA 1V0AA 4RGGA 4GULA 1W9FA 2RHPA 3M3CA 3NAPB 2ZGRA 4ZONA 2XUMA 2VGDA 1RVF1 4BOWA 4LHLA 1BMV2 3EQEA 1UOGA 3OB8A 3TNPB 4GD4A 3ILNA 1RUG3 3GBGA 4M0NA 5DUVA 1QJX3 2XDVA 2VMCA 1XE7A 3CQOA 1S0FA 4JX0A 2VZVA 3LPGA 3WD5A 4A2UA 5A3MA 2R1DA 1W6PA 2BFUS 3V0BA 3ZVXA 2FCTA 3H8RA 2ZKNA 4YWAA 4JGYC 4KWKA 2WT0A 3ABZA 2WFF1 5C8CB 4RGKA 5A32A 3AP7A 1GU3A 1TME1 1URXA 1Y7BA 2WBKA 3ZYIB 4HETA 4RHV1 2WO7A 5LRRA 4LBKA 1DZTA 4XF9A 2HJIA 2RS33 4NN0A 4UW3A 2W46A 5FZLA 4D94A 1N1TA 3HN3A 1YQ5A 2AUYA 1HQNA 4CU8A 4MADA 4XTPA 5FP9A 1QU0A 1UX6A 2R042 4WVZA 1W2TA 4ES9A 3ZSMA 1PZ9A 1SLTA 4KG0A 4CUGA 1UNBA 5ANNA 2B46X 4Y22B 5E6HA 1UOJA 3PVOA 4LEJA 4IEYA 1S2EA 1V6OA 1K12A 4UBHA 3NRUA 5IVJA 4LHKA 3WF2A 4OUMA 2ZBJA 1EV13 1RMU2 1W05A 2QE3A 2VPVA 2JJ6A 5FY9A 4BB3A 1AL22 1NCQB 3OPWA 3AZXA 2LW8A 1YIFA 3C7FA 3KLSA 5F37A 1ND3A 1SG3A 2ZABA 3MIBA 3FBYA 4FPOB 5FY4A 3P6BA 1QXJA 1FI2A 2VJXA 5JI7A 3RSJA 1QY4A 3KV4A 3KT7A 5F5IA 1JOJA 3OY8B 4E4ZA 4FTBA 1H2KA 1OD3A 5FYVA 4HONA 3POYA 2J1VA 4LBLA 4RSUA 1E5SA 3WG4A 1FPN2 1NA1C 1N1YA 1QJU3 1RUD2 4LO7A 1NXMA 4UFJA 4A4AA 4YG6A 4LLFA 4YLZA 2FDIA 3IPVB 4BQYA 1N1VA 1DZRA 4AVAA 4WZFA 5T3NA 4MX3A 3PIGA 4CA9A 1LTEA 4JGYB 1VIWB 5KXCA 2W94A 5L7OB 3FMGA 5FY0A 3FHAA 2FBEA 3ST7A 1IPKA 4LTAA 1LCLA 5DUUA 3SCHA 5FYCA 1D4VB 2RE9A 5KXDA 4YPJA 2EA7A 4E2SA 3MLJA 3SHRA 1W90A 4AFAA 4XZPA 4FOQA 4Q2FA 5L73A 4D6RA 3MIFA 3TEWA 1BZWA 4QQLA 4XFAA 4QU1A 3TN92 3W20A 5CG8A 3WQ1A 4DRRA 1PGW2 5A7WA 1C5HA 1X7NA 3IDCB 4YW7A 5IHRA 1I9RA 4MXWA 3ITQA 4QPGA 2C9KA 4HPKA 2TEPA 2JXAA 4A6SA 2YU1A 4CDQC 4ZZ8A 5K7PA 3AJZA 2W52A 4N53C 1DU3D 5KXBA 3X29B 5CKNA 1HQLA 2JIJA 1GP5A 4IV1A 3ACGA 5FOJB 2BNOA 1XE8A 2QBXA 4N7UA 4FFHA 3FE5A 1VAMA 4IEQA 3LQCA 1K5MB 5FJHA 2YGMA 1LULA 2B45X 1AX0A 1OA2A 2R32A 4LKDA 4PBPA 4JHZA 1LAJA 1LOGA 3VBRA 3NAPA 1VRH1 2CGNA 2YC0A 1NA1B 4LKSA 3LCPA 4JQTA 2HWC2 2DBIA 4MGTA 2W1UA 5C9AB 4LO4B 4CUCA 3AP9A 5JOZA 2WZR3 1LGCA 3OF1A 3LA3A 1ST8A 5LATA 2ZZQA 3WP4A 1QWRA 4NJ4A 4XJWA 4P9LA 1XYNA 2J1RA 4KBZA 4MHRA 4PJYA 3URFA 4GKYA 3IMMA 2VVFA 1G9CA 2JE9A 1R1A1 3JD71 4GH4C 4QXCA 1GQHA 4CEYC 1DF0A 5A1FA 2JIGA 5A3TA 5JMOA 5F3CA 4ZY9A 5FKCA 2XVGA 3BPZA 1PVC2 3MW2A 4ZHNA 4C0HA 2FCUA 3IDEA 1LEDA 2XGXA 3BPSA 3LDKA 4IE0A 1YJKA 4Y4RA 1O4ZA 4K1ZA 5FMOL 5FYUA 4IGQA 4EZ4A 3O1PA 4YNIA 2WNOA 5IVYA 3LZZA 4UWDA 4CUBA 3BTXA 1AXYA 2B5HA 4AI0A 4Y20B 2DF7A 4P02B 2P3IA 1KJLA 1WBFA 1WCUA 4TLFA 4AHXA 4N53B 4YZ5A 1RB8G 4YM1A 2Q8CA 5T54A 1WW5A 3HPNA 5DAQA 5FP7A 3WCRA 3FLRA 2VW2A 3TWIA 1AX2A 2DCZA 4JZRA 4AAPA 2JB4A 4NIGA 1OBNA 3LA7A 2OQ7A 1MS1A 2Z42A 4B8EA 3RZJA 2EAAA 4LKEA 4XBNA 1MS5A 3U78A 4OZOA 4Y5Z0 5F5AA 4IEVA 4LBQB 2AZ5A 3ZXGA 4IV3B 4EN9B 3RZKA 2VY0A 1UD1A 5J37A 3OCPA 4COVA 1ZBA3 1VBE1 4Q4V2 5I93A 3ACHA 1ZZ8A 4BQ4A 5FZKA 5KR7A 3B02A 4XAEA 1H2MA 5KC5A 3BI3A 1WLWA 2CYFA 4JGYA 2DYCA 4E27A 1L3JA 4XDPA 2YG0A 5FP8A 1S0CA 3E6DA 1MS8A 2OZ6A 3I2KA 4P9GA 2Y8KA 5L9BA 2VTXJ 2X29A 4GH4B 4CEYB 2RMU2 2RS13 4FPJA 4COZA 1H9PA 1KS5A 5A7OA 3WDYA 3AC0A 1AR92 4NPLA 2R062 2WSVA 4YZ3A 5FYHA 3UKVA 2ARBA 4WM8C 3WP6A 1HRI1 1DLCA 1OUXA 4ZXKA 1JZ6A 1UF2C 3AVSA 4GB32 4Q0QA 3GDBA 4HN1A 1RUF2 1OLME 4LO8A 2E32A 3N36A 1D4M1 4XUNA 3LFIA 4QT6A 4UF0B 5GLZA 2R0HA 3LOIA 4PLNA 2OPKA 4I01A 2XL7A 2DFBA 3OYWA 3PU8A 1D2QA 2UYBA 2WLQA 3WF0A 5CAZA 2QQJA 3JD73 2BU9A 4P5HA 4YFWA 3JB8A 3RZHA 4D8MA 2BGCA 5I8TA 1UY4A 1AYN1 2DCYA 5BNPB 4Q27A 1WMEA 2J1EA 4XUPA 3WY6A 3U07A 4Q4Y2 3GHNA 2I45A 1Y43B 1HW5A 1XJAA 1EAH1 3JBG2 4OUSA 4HN0A 2ZS6B 4WVVA 3MICA 1QNYA 2DCTA 4QX8A 3T30A 1NA1A 4KU8A 2HWE3 1C8NA 4D69A 2HWB3 1RTVA 2E9QA 3N9QA 5EP9A 1UMHA 3BUCA 5GZFA 3ZYBA 2BWAA 1O91A 2JKBA 4SLIA 1PO13 1LOCA 4NRQA 4Q4X3 2R073 3AKQA 3ZXKA 1QJY1 4LR4A 2AYHA 4XQDA 4NHYA 4UXAA 3J4UH 1UZYA 2JX9A 5C4WC 4FFIA 2YFUA 4LE3A 2DVFA 4FTEA 3CJXA 1MQTB 1VBC2 3R0RA 4NAOA 4WM8B 3CF6E 2H6BA 2JE7A 2JDKA 3MPPG 1J59A 3S5AA 2YC2A 3VKMA 3OEAA 5JIUA 3IAPA 3ZN6B 5DDJ1 2HWD2 3PUQA 5FBJA 4DRVA 4IGPA 4NHLA 4L97A 4ARXA 1QMJA 4Y20A 4E9KA 2VOKA 4AF9A 4CDQA 3ES1A 4BDVB 1UYZA 4N53A 4BXFA 2A7AA 1OUSA 1AR81 1QXRA 1YC61 3WG1A 1BBT3 3D0SA 4V2WA 5FZ0A 2OUHA 5GM0A 2VOVA 3SEEA 2W39A 3VL8A 3ZFEC 4O9GA 4W65A 3MLLA 3ZXLA 2XJTA 1AYM2 4XMIA 4F3JA 4QDQA 2ZAHA 2CNAA 2QQWA 3FZ3A 5K0UA 3VBOC 2FD8A 3M3OA 1JOBA 5FZ3A 1BMV1 4PBOA 1TMF2 1F4HA 1AZDA 4QB6A 1SEFA 1XNKA 2LROA 4QWNA 5AC93 4AL9A 3BGAA 1RINA 3UGGA 2R0FA 2DVDA 4Z07A 5C3RA 3B3QE 4PIZA 5AVPA 4HFSA 2ENRA 5LCWL 4JDMA 4YVSC 3NVCA 1US2A 4XTMA 3LEIA 2LS6A 1HRV2 2WWJA 1O7FA 4BK5A 4CEWC 5JOXA 4ORFA 4ZU4A 4O7XA 3J7LA 2ILMA 5FPVA 5A80A 5CFDC 3UGFA 4GH4A 4CEYA 1KRIA 2WABA 2ZMKA 3I3BA 3THDA 4F7ZA 1HX6A 2DBNA 2P4EA 1N47A 2QQKA 3MIHA 1C4RA 1OPOA 3IT8A 3KHCA 3NW4A 4XW3A 2ZGOA 4FSJA 2R041 2ZGMA 4HKWA 2P6HA 4C1WA 2D7FA 5BY5A 5I0UA 3VB9A 4XHBA 2DCJA 4QKBA 3RJ2X 3NL1A 1FV2A 1DBNA 2WQ4A 3BTYA 1XE0A 1G86A 5H9SA 1VBD1 4X8NA 4JKMA 2W95A 1GZWA 1H2NA 3BOWA 1OQ1A 4CXXA 3VBSC 3A4UA 5BNOC 5IUQA 1RMU1 4EN7B 4CU9A 1OKOA 2CGOA 3KMHA 1F15A 5IATA 1FYUA 2BZDA 1W9YA 3HQRA 3PJYA 5FZHA 5LY2A 2BW8A 2GAUA 2RR12 3VBOB 2A6YA 3W21A 1ZREA 4XVHA 4ARYA 3O1SA 3AKRA 5LA0A 3OBTA 1XXNA 5EXOA 1RUD1 4P9JA 4YW1A 3DKWA 4KNCA 2EIDA 4EWDA 1YQ2A 1EUTA 4YZ2A 1DP0A 4IGOA 4QKDA 5IFPA 1O3SA 1E57A 4X6RB 2WS92 5BYNA 1ZYBA 2H0VA 1RUH3 3PNAA 4E2GA 5FP4A 4CCMA 4JDNA 3BB6A 4BYYA 2ZEXA 1RUI2 4MGSA 3PMSA 3S5QA 1QOSA 2BRTA 1RUC1 1Y9QA 3SKVA 3K2OA 5JAXA 2A1XA 2WYFA 3WDUA 1U0AA 1UY3A 2BERA 1D7PM 2IFWA 1JYVA 5EJ3A 4XFFA 3RYKA 3O0XA 3TN91 4XE9A 5FZMA 2OUJA 3CO2A 3GGLA 2XJUA 3MF6A 2V09A 5EPAA 4MHUA 2XJVA 4FPFA 4OMDA 3VGIA 1L7RA 1K42A 2VECA 3CZUA 1MVQA 1GFF2 1MEC2 1Z7S3 2RDRA 2IXJA 3FUOA 5SV5A 5CNAA 3UGHA 3WQ7A 2W1SA 5FYBA 5BNOB 5J3UA 1W9SA 4R9DA 5CIRA 1QQP2 3FC0A 4DIQA 3H42B 3BU7A 5C8WA 4CTEA 3C3VA 4CDUA 3ROUA 2DUOA 4AHWA 4UYBA 4A7YA 4IDZA 4JDOA 2D6PA 4AXOA 3WEZA 1UXXX 2GMPA 3AZYA 4NAMA 3J8F2 1CVNA 3APBA 4S2FA 4AWDA 1CAUB 3RFRA 3U10A 5KHKA 4RR3C 1FMD3 1N1SA 1GP6A 2HWC1 4MGQA 3PIJA 4L0PA 2EVXA 3VBUC 1DCSA 3ZLIA 1MACA 3BOPA 2Y0OA 2O8OA 3MYXA 4R4ZA 2ZX1A 1PO21 1VBD3 3WNXA 1I6XA 4FAGA 3T0AA 3O1OA 2BEOA 3GBWA 1KFXL 3HNBM 2VR4A 4D7SA 3JQWA 2Z79A 4K9SA 2VNGA 4MVTA 2KA3A 4K3UA 1A8DA 1H4HA 2YPJA 5C4WA 2ZEWA 1OLRA 3NNLA 1ULCA 4EYUA 2J7MA 1OPMA 1PM7A 4M3CB 3B00A 4XUTA 3ZPOA 3IDAA 2ZHLA 2E33A 2WNVB 2GU9A 1NX9A 2QQLA 3ME2A 4ONUA 4YRDA 4AQ6A 1IPJA 4BU2A 1QEXA 3BTZA 2XJQA 1JZ4A 3DYMA 3Q9OA 3S0MA 3FL7A 4AE2A 1C5IA 1WCQA 2OPWA 1UZVA 2XQRA 3M8LA 5FYTA 4YFZA 3VKLA 3D8CA 4GIQA 3LA2A 1WWYA 3P3PA 2ZGSA 5FY7A 1JZ7A 1ZA7A 2UWBA 3NV4A 4R9BA 2YYOA 3WW3A 2XJSA 3BTAA 2VZPA 4JKLA 2I2SA 1L7QA 4S2HA 1UCXA 4M3CF 4YGBA 3WG3A 1KITA 4N9IA 5HBAA 1GWKA 1DQ0A 5ISLA 1RUC3 3M1HA 1LOAA 5T55A 1W03A 2VQUA 4GMP1 1HJFA 2R30A 2E51A 1B35A 1OA4A 3ZDVA 5F2WA 2WYSA 4W50A 1GZCA 5FYMA 3VBOA 1GNHA 1VMFA 5ABJA 3DF0A 5FXVA 4AK3A 2FDHA 2DTWA 3LEMA 4LO6B 1ND3C 1DQ1A 4WM7C 1SMVA 2ZOEB 3VBUB 2ZZJA 3USUB 1YLLA 5IK8A 2GNBA 1CN1A 1CAWB 4P9IA 4R9AA 1A78A 4Q4V1 4IUGA 3DL3A 3LEGA 2CDOA 4FCAA 1KGYA 5LBFA 1AX1A 4YVSA 4XJZA 1QJZA 2Y34A 5C5TA 1CAVA 4OMCA 4CEWA 3RZGA 4LE4A 1KD7A 1HJGA 2R1BA 5CFDA 2YY1A 4LA3A 4FFGA 1ZA4A 3U11A 1BQPA 4BQ1A 2RMU1 3PTRB 3V0BB 2WN2A 4A45A 3AM2A 3PHMA 4Y1YA 1AR91 1CQ9A 3K3OA 3H1WA 2R061 3LKJA 4QGNA 4BMEA 3ZIWA 5A32B 1TZOA 1GLHA 1OVSA 3M70A 4HOOA 5FTTC 3SH3A 3ZSEA 1LHUA 4ZZ5A 2IVJA 4G9SB 2F17A 4GB31 5CKMA 3ZFFA 3L2YA 2ETEA 2GH2A 4CP9B 1JN2P 2YV8A 3BALA 1PO23 3OUIA 1WMDA 3SLIA 1Q8PA 2FZ2A 4RFRB 2FZ1A 5DG1A 4LUMA 4BH9A 1UYXA 1J3PA 1V6KA 4HK9A 1GANA 3VBSA 1S2BA 4BM8A 2D6LX 3LE0A 5FMOS 1XC6A 1ODMA 1VBA2 4OHWA 2A70A 4YM0A 4CCNA 3D82A 3H8XA 4OI1A 3LFMA 3O1TA 2G19A 2JENA 2JICA 3GCXA 3OTFA 2OQ6A 4QPYA 1W6OB 3WQBA 1W8HA 3ILRA 2XJRA 2W2IA 4G4FA 4Q4Y1 3H7JA 3OBZA 4IV1C 5DAXA 4HVQA 4NMIA 2GP5A 1ND3B 2WDBA 1UKGA 5JWPA 4W8JA 2DURA 1J84A 1TG7A 5L19A 3HWJA 3ZSKA 2WA3A 4QDSA 1YWKA 1K3IA 4JC1A 4YZ4A 5JR7B 2CWSA 4CP0A 1F9KA 5DAPA 1AR72 4TLGA 4GJZA 4YARA 1RUJ2 3D5OA 2QDNA 1EY2A 1CGPA 3NV3A 2WZ8A 1S0DA 2DWRA 2WR9A 3B94A 5BNNA 3GCWA 4M3CA 4R52A 5IK7A 1VBC1 1CZTA 1ULFA 3C7HA 1IPSA 1AXKA 1RYYA 4AGGA 2VTXA 2AC1A 2XH6A 1V6LA 1VLNA 3ZX7A 5FZFA 1VBB2 3NJXA 4FFFA 5BNQA 4HKOA 4JRLA 3V0AB 4J25A 2HWD1 4QHOA 1Z78A 2BGOA 2D5HA 3WF3A 1OLQA 2Q8DA 1FX5A 1QXPA 1SZBA 4PQ9A 1YEWA 5EWSA 1DGWX 1DQ2A 4CCKA 2AGSA 3Q8EA 4L92A 2R6QA 3S7IA 1WLDA 3CJIC 2RVAA 3DEMA 4KGGA 1COV3 2JD9A 4N90A 3MIGA 4MXWB 3AMPA 4HPKB 1V9U2 5EZWA 1PMIA 1S0GA 4Z8BA 2GSYA 1AYM1 5BV6A 3VZLA 1NUKA 3ZOIA 1OMIA 1FNYA 4AI2A 4IV1B 1V6IA 1NT0A 4RR3A 3O1VA 4IW3A 4I0WB 1TMF1 2H0BA 3VZOA 4TYSA 3VBUA 2VXRA 1CZVA 1SDDB 3AYEA 1CAWA 1WW7A 2RS52 3C8XA 1XNCA 4LUKA 4XJ9A 3VBRB 3K4AA 3LPFA 3GJBA 4H2AA 2YHJA 3FBMA 4I02A 4QQHA 4LLOA 2B42B 4CPBD 1UY0A 1CIYA 1HRV1 2VCBA 2Z4FA 5HCFA 5FWJA 2DVAA 5JCTA 2RDSA 1RIRA 1LHWA 1UKRA 1V6MA 2RG4A 2KR2A 2HH9A 1S55A 4IEOA 4QQOA 2XBO3 3ZYJB 1HXS3 1XYOA 2JDAA 2YGLA 5GALA 1Z0HA 4N43A 2W87A 4PI2A 4KWUA 3ES4A 2RJ2A 1M06G 5C7GA 5H9RA 3GYDA 4ES8A 4QKFA 4XQ4A 1A3KA 1NKGA 1DQ4A 4OQ8A 3AFKA 1FOD2 1LESA 3THPA 4P5YA 3FLTA 2V5YA 3I2JA 1MS9A 2D44A 4F8AA 1UU6A 2HBTA 2YU2A 2D3SA 5T5LA 2Q4SA 4U2AA 4CP9A 3MEPA 5AFEA 5A7SA 1UQXA 5LK7B 3LIHA 2A6XA 3ZXJA 3ASIA 4AOCA 1PIV1 4XF1A 3WSOA 3AYCA 3CJIB 2MHFA 4X8PA 2WLPA 2JG8A 1DGRN 4QX1A 1ZZ9A 5KHGA 5LW9A 3N4MA 3B93A 5JXJA 1UYYA 5FZAA 2NZ9A 4G3YC 4XAAA 3U14A 1UY1A 2VVDA 3RMYA 3JU9A 2CTVA 3DYPA 5EV7A 4P9WA 1W6OA 2ZMLA 2RR11 1HKDA 3IAQA 4MV2A 2XVLA 3RJRA 3ZXAC 1C8M3 2IXHA 1WBLA 1RJ7A 4WM7A 1DQ6A 3NJVA 1VRBA 4Q0PA 4Q4W1 1RUE1 4HKLA 4QU2A 4DINB 2AACA 4GA9A 1XNBA 4DOUA 5LA1A 4LT5A 2Y38A 5IK5A 1IZ3A 5FPBA 2R49A 4INDA 1J3QA 5FZDA 3VDAA 4CVUA 3T09A 4Y4YA 4YG3A 1HV0A 4E4SA 2OW4A 2HEVF 3EB7A 2PHLA 3AP6A 2WINB 1O4TA 2B9VA 2W92A 4AEDC 2WQZC 2VNOA 4QGMA 1W8ZA 1C1FA 2ZAAA 1OC1A 2ZHKA 4U36A 5EIYB 1IS4A 4A7KA 1IKPA 3I3EA 4ITCA 4XUQA 5FDBA 5JZGA 1GBGA 5FZGA 3UETA 2FQPA 4XHXA 3V0AA 3P5BA 1ZRFA 1JS9A 5DG2A 1F31A 1VMJA 1MEC1 1RVF3 1PNFA 1SFPA 1YFWA 5F1RA 2YC4A 2G1MA 3M3IA 2I07B 4L2NA 3FN9A 3BCWA 1GZ9A 2ZGUA 3MLKA 1OKQA 1QQP1 3IIAA 4V1PA 2YFZA 4E8CA 3W5NA 1PK6A 3KQ4B 3IN9A 5BPXA 1QF3A 2XXZA 3JXSA 2UU8A 2GNDA 3HNYM 2PXJA 1KFUL 1NAEA 1QNWA 2A73B 1Y9GA 3OYWB 2WFF3 3NV1A 3RWNA 1TME3 4C91A 3J8F1 2BPA2 3SXWA 4RHV3 4FP2A 3HVDA 3HEIA 3HIFA 3NQHA 5EQUA 1ALYA 2P2KA 2NYYA 3WHUA 1ZZCA 2X09A 1IG0A 3LB9A 1UIJA 3I7DA 4OFGA 1RC6A 2HYKA 2V5DA 2NMOA 4AI3A 5ACA2 3K4DA 4IERA 5C33A 5JUVA 3PJQA 4XEZA 5K0UC 2PHDA 1PIV3 2VM9A 2Q8OA 4H7LA 4COUA 1DZQA 5DUXA 4ET7A 3KCXA 2D6MA 3POWA 4UFLA 1W2NA 4QHBA 3H1MA 4CRQA 5C71A 1Q8QA 3I2IA 4XC9A 2JD4A 2WC2A 3C2UA 5F5CA 1RHI1 1VB4A 4DFSA 4MUVA 1SCSA 4AEDB 3M4FA 2XG3A 5CVRA 1RL3A 4I0AA 1NZIA 4YM2A 3R6SA 3LF7A 2HLEA 3CZJA 1S0EA 2J1TA 1KDMA 1PGSA 4MLOA 1WA4A 3FWEA 1NCRC 1YCIA 1PZ7A 3VKNA 2HYXA 3LSDA 4N9HA 1R081 4BLJA 3MO4A 4GWJA 4Q4W3 2E63A 1RUE3 4AQSA 4LHSA 4B1LA 3ZDSA 4WVMA 2WN3A 4Y1VA 4MGKE 4Y5SA 2EXKA 1J1LA 2A3WA 4H3WA 4LNVA 1GSLA 3K77A 1LOEA 4W6WA 5FZCA 1C1LA 2DTYA 3CJIA 3WOGA 1RUNA 1PVXA 1R092 2JDNA 4IEZA 3OBRA 4JKKA 1W04A 2CV6A 5C70A 3WF1A 4CDQB 5FAXA 1G6NA 1AR62 5FPUA 3Q8BA 3B9IA 1LRHA 2E7QA 3T2PA 3WUCA 4ASLA 5KHJA 2MEV2 5JMCA 2JDZA 4COWA 3QOPA 4IE7A 4R4XA 1N3OA 1QJEA 1L7LA 1BEV2 1UOBA 3VD4A 3TYJA 1JU3A 5K0UB 2Y6LA 4AW7A 5FV3A 5CISA 1SPPA 3TEXA 1YI7A 5F6LB 4W6XA 3VHRA 3PLQA 5J48A 2XJPA 5F9TA 5J36A 4CCDA 5FPAA 4XMAA 1YQCA 3UT0A 1GV9A 5A7NA 3VZKA 1WD3A 2GC2A 2GN7A 1PNGA 2QQMA 2J42A 1KDKA 3PVEA 4IE5A 4Y5TA 1UAIA 3H3UA 5LBCA 3UL2A 3ZXDA 4TWTA 4NROA 4D7YA 3ACFA 3CU7A 5FZ9A 4XF3A 1NCRB 4KH9A 4YVWA 3SNMA 5B2GB 4YM3A 2ZX3A 2VAUA 1OQDA 1ZBE2 4RA0A 5A70A 3HQUA 1CAXB 3HAGA 3PUSA 5HCHA 1UN1A 4K8FA 4XFGA 4ZS2A 3AVRA 4MYEA 1P8JA 4TXWA 3WNOA 3WT3A 3J9SA 5T5JA 1J3RA 1VRH3 1ENRA 4OHZA 4AFCA 1WLCA 1KQRA 2EXJA 3A21A 3QBQA 1BK1A 2J1SA 4LPLA 2HWF1 3E97A 3HBZA 1UO9A 3I2FA 1O8SA 4P08A 4KL1A 1EPWA 4QX7A 1RHI3 3KQRA 5J7MA 1W8TA 2W08A 3I4IA 5TSWA 1WMFA 5L9VA 2VULA 1GZWB 4AVTA 1H1AA 3OGSA 5J96B 3L2HA 2G9FA 2GC0A 1T6BX
chains in the Genus database with same CATH topology
4NOTA 3ZIXA 2XL9A 1PGL2 2VOWA 3N7JA 1ASJ2 1R1A3 4TSVA 1R083 1OOPC 3ECQA 3FJSA 2WFPA 2ZGKA 3KZ4C 4K20A 2PLV2 4CDUC 1VALA 1CJDA 2LALA 4WBBA 1RUOA 1W6NB 4YGCA 5I91A 3WQ0A 4BHPA 2Z5WA 3B01A 4FPEA 2SLIA 5EYXA 2B8MA 2B9UA 1TNRA 1AR71 1C3HA 1PHMA 1RUJ1 3G6JB 3I8TA 3DPRC 4KGQA 4QQPA 1MS4A 3DV8A 1RUG2 3NSTA 2D5FA 1QJX2 3FLPA 4AEDA 2IXCA 4XBQA 2EF6A 3SH4A 2E53A 2KM2A 1VBB1 2ZMNA 4FPCA 3USSA 4F83A 5H9QA 1REDA 2ZKLA 4FOWA 3TBDA 2EXHA 4MZUA 2RS32 3T2TA 3JUUA 2RM21 1ENQA 2Q30A 3A0KA 4AEJA 1ZRRA 3ETQA 4BCUA 1O3SA 3SH5A 1MZEA 1VBE3 1IS5A 1TEIA 3VHPA 1CD3G 5FBZA 1V9U1 3ENRA 4IQPA 1LU1A 3PTYA 4EN6B 4B3NA 5E89A 1POV0 4FP3A 4GKXA 1YNAA 3KM5A 1OOPB 2K9ZA 4CDUB 1CIWA 3IKWA 4NO4A 1EV12 2PHRA 5BXXA 2A6VA 3NKGA 4HLTA 3NJZA 3TRSB 3UK9A 2X8KA 1B35C 1YYNA 1HRI3 1SFYA 1XNDA 2RS51 2UYAA 3VHOA 3RI9A 1NG0A 4BIOA 5ABJC 1UPSA 3ATGA 2ZGNA 3N7LA 1S0IA 2HWF3 2QZ3A 4BIFA 2N7GA 4EN0A 5JOWA 1ND2C 3B5LB 1D4M3 1WCSA 1QJU2 1SACA 2WT2A 1SLAA 5C4WB 1NCRA 3OGJA 4QM9A 4CDXA 4DQAA 3L9JT 1FOD1 2D93A 1LECA 1AYN3 1CAXA 2VW0A 4Q26A 2DUPA 2YDEA 1POV1 4FTSA 5FO8B 1OA3A 2D3RA 2F6BA 1EAH3 5CA6A 1JYIA 2WT1A 2X5IA 1X82A 1IQAA 4Q1PA 3SITA 2GH8A 4R8HA 3WDWA 3ZFFC 3H1YA 4QGLA 4EV0A 5JSOA 4OLLA 2E7AA 4P9YA 4CYDA 5I8SA 1NZCA 4XETA 2O8QA 4AGVA 3SCGA 4MXVA 1QJY3 1DIWA 4IL7A 3WINE 3ZFEB 1ZVFA 3S30A 1AL21 3A0NA 4QPIA 1HDKA 4AYUA 4LA2A 3U0ZA 4XFHA 1B35B 1LU2A 3RYRA 1W6NA 3AJYA 3MI8A 5ABJB 1NQJA 2RM23 4AVBA 1VAVA 4UBGA 1O4YA 3RQ0A 3AZVA 2PYTA 1AL0G 5DDJ3 4M01A 1FPN1 4JRAA 1QGLA 1R1ZA 2BWCA 4DXZA 4RQPA 4QD2A 2BQPA 5GLUA 4YVSB 1HQWA 1F8VA 4O9EA 3WXPA 1AR83 1CAVB 4CEWB 5LEKA 1T6GC 2WZR2 2LTNA 2G9GA 3N7MA 5CFDB 1H8TC 3O0VA 1Y3TA 1SFNA 1I3HA 1UZZA 4DPNA 5BNNC 3QH7A 4FVVA 4AI8A 2QZ2A 5JDBA 4PIXA 2BVBA 2PAEA 1YI9A 1MS0A 3ZFFB 4RL7A 2YMZA 1PGW1 4HVOA 4L99A 2PAMA 4YZ1A 1G9BA 1W2UA 3AK0A 4XF0A 3VBSB 4E4DX 3PMEA 1DQ5A 2JEMA 3W58A 4XQWA 3TAYA 4XIOA 1G9AA 1OOPA 1Q3EA 4AHZA 1DDLA 2C1FA 5D1IA 2CAUA 4RS5C 1SLCA 3GHMA 2F4PA 3NV2A 1MVEA 2R043 2D3PA 3AB0A 3I54A 4HMZA 1O3QA 3ZSLA 2Q5TA 2UURA 3HN1A 3DPRA 3LAGA 2QQPA 3AP4A 2IXIA 4GMP0 1ZBA2 1WUVA 5I0SA 1O3RA 1RMU3 1MZ6A 1YJLA 1H8TB 1CESA 1AL23 3RNSA 3WX5A 3VBFA 3WV6A 4Y24A 5CFCA 3JB4C 5BNNB 1H1IA 1DGLA 1ZNPA 4C0BA 2RS12 4N43C 1PVC1 1XYPA 4FQZA 3HT2A 2B39A 3WHTA 4EWEA 1RITA 1RUD3 1R091 2QKDA 4AEKA 1H9WA 5EYYA 4OHXA 3CL1A 4M00A 2P3KA 5KHIA 1SBEA 1W6QA 4AFMA 3GALA 1SLIA 2JG8C 4COYA 4HSJA 2Q0AA 1YO8A 2MEV1 3POSA 4FOYA 2ZACA 1B09A 3H9AA 2X53S 2VMHA 2MNGA 1N3QA 4RS5B 1BEV1 3JD72 5FQ0B 5GZCA 4KBBA 4Y1XA 1NLRA 2D97A 3TN93 3EO6A 4RR3B 1FV3A 1IKQA 3WW2A 1NQDA 1QKQA 2R16A 1ND2A 3TB0A 4BMBA 2BTVC 5EFUA 2ES3A 4BE3A 1ONAA 2HWE2 2HWB2 1FT9A 3V65A 3WVJA 4YYOA 1F5JA 3WUDA 3LGRA 1PO12 2NQYA 1UU4A 3N3HA 1DGRA 2VUJA 2R072 4NWWA 4Q4X2 3WDXA 1ZBE1 1NLSA 1VAKA 2VG9A 2YXSA 4N43B 4D7TA 2PHTA 3KCYA 4S2DA 2NMNA 4OI4A 4LULA 5KHHA 1TNFA 5CB7A 1Q8SA 5JZGC 1XRUA 3IMNA 1NOVA 2HWC3 3V64A 4J6GA 4NVPA 2LM3A 3O14A 4FPHA 1Q8VA 3H7YA 2D6OX 1RUF1 5T50A 3MW3A 4LBJA 3RPQA 1LEMA 2TBVA 2NPIA 3NWKA 2XWBB 4Q29A 2JG8B 1NYWA 1G7YA 5FCCA 4NPRA 3OGGA 1GKBA 1FAYA 1PK6C 3GZTB 2A75A 1ASJ1 4AG4A 4DMIA 1NE4A 4DZGA 1V70A 2WNUC 1BBT2 2NLRA 3B7MA 1JBCA 3UJOA 2IWGB 1PVC3 3FFQA 3JBG1 3AMMA 4WM7B 1SBDA 2E6VA 4Y1UA 1H8VA 1UL9A 4PDWA 1D2SA 5AC92 1RUG1 1QJX1 1QHDA 2Z2SB 2WA4A 4K21A 1LENA 5CADA 1H8TA 3T1MA 2BNMA 3GZUC 1CR7A 2XPJA 2JG9C 5GKAC 4M3CE 4GMP3 4ATEA 2H6CA 4S2GA 2EAKA 2GN3A 5HCAA 3AYDA 2WIIB 4RD7A 4HL0A 5JZGB 2EALA 2AREA 2A3XA 2PTMA 1FATA 4KWLA 2Y26A 3NKTA 4Q4V3 4EJRA 2PHXA 4OZXA 2ZTNA 4ZKTB 1VB2A 4UW4A 3OD4A 1IGOA 2W68A 5AFBA 4B4QA 1EYBA 1PK6B 1C57A 4AGRA 3ZN4A 1EPZA 4Z92B 2RMU3 3ZPYA 4NR1A 2WNUB 2YROA 5JPNB 1CONA 1AR93 1EV11 2BVVA 5C8CC 2R063 2FHRA 4FPKA 3RI8A 4J1XA 4RS5A 5FQ0A 2FMDA 1BKZA 4XFBA 3H3ZA 4OI2A 3VLBB 4JVAA 2WJSA 5HI0A 3O7OA 1IOAA 4GB33 3D4KA 3MFCA 2HKXA 5JLVA 1RUF3 1DHKB 3MGUA 3VUOA 2OA2A 4JCKA 1AVBA 3HD8B 3E6BA 1QJU1 2VVEA 2VUAA 3T1LA 3KGLA 4NWVA 4BLIA 1D0HA 3AXDA 4OULA 1EP0A 3R4UA 2QDRA 2VU9A 2RJLA 1RUH2 3ZN5A 4CDWA 2XLGA 4Q4Y3 3KB5A 3JBG3 3R05A 4YVWC 5JIAA 4AVTA 2GNTA 3OD0A 1ENXA 4P14A 4N7IA 3RRDA 3JZVA 2WWSA 4WVMB 1CX4A 4A3XA 2IC1A 4JQRA 4CZSA 2TUNA 1LODA 1OD5A 1MR5A 4IETA 5A33B 5I8YA 1Z7S2 4QMAA 2ZHMA 2CL2A 4P9XA 5C6CA 2PFWA 4XFIA 5L7OC 2ZA9A 5KXEA 2OIIA 1LOFA 3VN4A 1BVP1 1VBC3 3VBHA 1O5LA 3WDVA 3W59A 4YW4A 2VMIA 2EIGA 2HWD3 5FO7B 2V73A 4JTNA 4CP1A 1FMD2 2DU1A 3QH6A 4WZCA 4XJUA 1QDCA 1KS4A 2WS91 4WVWA 3SMHA 1ENSA 2WZR1 1VBD2 5FREA 2QVSB 3R4DB 2GNMA 1RUI1 1DLLA 3GF6A 4YW2A 1OHFA 1AYM3 2AH2A 3ZMOA 2E7TA 3N35A 3MZHA 4YVWB 1LR5A 2ZGQA 2PA7A 3THTA 1DFQA 4BPZA 4QXKA 1K5MC 1D0GA 1TMF3 5FLIA 1DYKA 3FFZA 1H0BA 4YGEA 3ZO0B 3ZSJA 2ET1A 1SCRA 3UV9A 1Q43A 2EXIA 4AVCA 2MPFA 4ASMB 3ZMNA 4FXGB 1JXNA 4OI0A 1LHOA 5C9AC 2Z69A 1HRV3 3AYAA 3VL9A 1JH5A 1APNA 2ATFA 5HCBA 2JECA 2WNUA 3WZ1A 3SISA 1BYHA 3AKSA 4Q8LA 2XLAA 4K7JA 1JHNA 2A6WA 3ZXFA 1RUC2 3I59A 1ZZ7A 4DY3A 5DZGA 4KU7A 3EHKA 3BODA 1OI6A 4DNYA 1VR3A 1YRZA 3AKTA 2AR6A 4HK8A 1GNZA 1LOBA 1ZBA1 1WW4A 5DZFA 1ZRCA 1X8MA 3AMNA 2GMMA 2ZX2A 2RJKA 4AQTA 1C28A 1LKNA 1BXHA 3K51A 2JG9A 3I2DA 4IEXA 2ZGPA 1CPNA 4LBMA 2RR13 2RS11 2DUQA 3DGTA 2P3JA 3N7KA 2A6ZA 4ISRA 1DYPA 4MGYE 4CDXC 3S6PA 3WG2A 1H4GA 1U5YA 1AUYA 4GALA 3ZXEA 2IFRA 4TZDA 2AENA 4IV3C 2X5IC 2WS93 4KQ7A 4CP2A 4L9BA 1RGSA 2OVUA 1PO22 4XYXA 2ZGTA 3UKTA 5A33A 4ATFA 1GICA 2W0XA 5T5PA 3TOJA 3WLUA 5BUVA 1RUI3 3VZMA 1OQEA 1DG6A 3UJQA 3UKNA 5GLTA 2BYVE 5C8CA 1TQ5A 2XWJB 4ZU5A 5T52A 2NN8A 2GDFA 4UW5A 3OJBA 4AFDA 4E2QA 4QPIC 2ZX0A 2Q1MA 2PAKA 4XIKA 3RZZA 3LSEA 1MEC3 4FPLA 1ULDA 3DUIA 2HWE1 4Y22A 2HWB1 1UPIA 1NE6A 3H0OA 1QQP3 3WDTA 5LEJA 3R4SA 3MW4A 2D40A 3PVBB 1PO11 4RQPC 4XJ8A 4Q4X1 1KJRA 2R071 5JSPA 4KG8A 3AMQA 2PHWA 4ISQA 5LRSA 1NCQA 2CGPA 1X50A 3J8F3 4Q0SA 1QOTA 3IBMA 3KSCA 5I0TA 1AF9A 1JW6A 4CDXB 3M3QA 5BNPC 4GQ7A 3TNQA 3OY8A 5FPZA 5KWRA 4JGZC 3ZYGA 2GC3A 5FRAA 2X5IB 1IS3A 4W6YA 3IPVA 2YZ4A 4L11A 1VBA1 5L7OA 3ZFGC 1AHSA 5D8AC 1Q56A 5FFOC 1BBT1 1COV2 2DVGA 4HT1T 5A3LA 1XU1A 4Y1ZA 3VZNA 1NY72 1H30A 3S7EA 4EROA 1S0BA 2G4IA 1HIXA 2PHUA 3MF9A 4MSVA 4QPIB 1MQTC 2UY8A 4QM8A 5JSRA 3WP5A 1VP6A 4XF4A 1A8MA 2D43A 2ZX4A 4PF5A 5AC91 5GZGA 2PHFA 3AXEA 1F5FA 1X8EA 2QFEA 3H8UA 4JTOA 4YG0A 4GWMA 5E1RA 1F2NA 4RQPB 4EWAA 4HBNA 2ARXA 4DB5A 4ZU7A 4IEUA 1IHMA 1SQ4A 1WCKA 5I0RA 1FNZA 4SBVA 1LGNA 1N3PA 3VBFC 2XBO2 1HXS2 1K5MA 5CFCC 3MIDA 4JGZB 2B7YA 4K40A 3ZYPA 2XVKA 2BFUL 4AEMA 3DN7A 3BIWE 5C9AA 1WLTA 1GR3A 4GWNA 4HZFA 3ZFGB 5D8AB 2OZJA 4YW5A 3V56A 1YFXA 5FOBB 2ZHNA 2UY9A 2IXLA 1V6NA 3RMXA 3HMYA 4URTA 4HANA 3WR0A 4GXLA 3AFGA 3AP5A 3KT1A 4BWOA 4FQ4A 1C8M2 3OPZA 2VW1A 1I5ZA 2DVBA 4Z82A 2K0GA 5KBFA 5T5OA 2VMGA 5FLHA 2WL1A 1VBA3 3DPRB 3VV1A 1WW6A 1TE1B 3QACA 5GJ6A 1RUH1 3GZAA 4Q1RA 2QNKA 4OHYA 1U12A 3VBFB 1G8WA 3HR9A 5CFCB 2QUOA 3P3NA 2WSUA 3MFAA 4FPYA 1XU2A 4LBQA 4I3PA 2NM1A 4IV3A 4RFT0 4PLOA 1AR73 2IXKA 1Q5OA 1RUJ3 4HSLA 5FO9B 1RVF2 1Z7S1 3NO8A 4XILA 4B7EA 3AZZA 4JV4A 3HT1A 2P17A 4K6BA 3M7AA 1G9FA 2GMEA 1W6QB 2D6NA 2O0OA 1V00A 2KXLA 3GBFA 1W6MB 2VQAA 2TNFA 1VBB3 5E8AA 2HEYF 2WFF2 5H9PA 5CG9A 2FMYA 1TME2 1JYCA 1QOOA 4RHV2 4YGDA 4FPGA 3K48A 4I09A 2ERFA 4I30A 1FMD1 4NHMA 5FLJA 1MZFA 4UW6A 1SLBA 1U5IA 1ND2B 1PIV2 4WV8A 1S1AA 4XFCA 1V9U3 2GZWA 4LBNA 4I2OA 3ALQA 1W0OA 3ILFA 3IWZA 4PDWC 2OYZA 5J98B 3AMHA 1AJOA 2CWMA 2DV9A 3ACLA 1BJQA 4FT8A 1ZZBA 3RYPA 1ZRDA 3LWCA 1BVVA 5BNPA 4C90A 4MH0E 5GZDA 2UWCA 2VQ0A 1AJKA 2PN5A 1UW8A 2RS53 4R9CA 4JGZA 4Q4W2 1RUE2 5F6KA 1REFA 4HVRA 3EBRA 4PCRA 1SBFA 3EXUA 5IT6A 1LHNA 4BA6A 1HV1A 3FHIB 3ZFGA 4FO9A 3GNEA 5D8AA 4DY5A 5JPMB 1JTZX 1O5UA 4B4PA 3G7DA 4X6QB 5GZEA 1LGBA 3IM0A 1OSGA 4H7MA 1IS6A 4LO5B 5E16A 2O1QA 4JAAA 1MQTA 1FOD3 4WM8A 5F5QA 1POV3 2WNVC 3U4XA 4LBOA 1PZ8A 1ZZ6A 5ACA1 3KCCA 4IXLA 3ZN6A 3B9CA 1LHVA 1WGPA 5FPXA 4FBFA 4NHKA 3VDDC 4LHNA 4XXPA 4C1XA 1ZX5A 4PLMA 4PDWB 1GYKA 1U5ZA 1ULEA 2ZGLA 2LUWA 4J1WA 4AVVA 4DS0A 2CY6A 2VOXA 1G9DA 2WNEA 5GLVA 3CEWA 4IEWA 3VKOA 1LJ7A 4CDWC 2ZCWA 3VHNA 2I74A 3WP3A 3KS7A 1X36A 1FPN3 3KD4A 3MDPA 4OVEA 2ZJCA 3IDBB 1VRH2 4QX5A 5L36A 3O12A 4MGIE 1XQNA 1AR61 3PVNA 1RHI2 4FOVA 4YSFA 4Y26A 3JQXA 2WKKA 1J58A 1YFYA 2C0ZA 1W6MA 2ET7A 3VKFC 5JOYA 1FXZA 1LOFC 1CPMA 4Q0VA 3VBHC 1R1A2 1R082 1REEA 1BCXA 2VH9A 2XKOA 3B69A 3FX3A 3WW1A 3VDDB 3J26N 1A6CA 4Q8KA 2UWAA 4AHYA 5DXDA 2XKPA 1HLCA 1JUHA 1MS3A 2DU0A 1CJPA 3AKPA 1DGWA 5IK4A 2D6KA 1H1MA 4YW3A 4Z2WA 2K2SA 3MIEA 1ZM1A 3ELNA 3M2MA 3EJKA 1X33A 1YFUA 1WD4A 4CDWB 5ACA3 2ZPXA 2SBAA 2Y0IA 4Q0UA 3ZYRA 2C5DA 1I1EA 3E5UA 1YIPA 5LK5A 1SDWA 5SV8A 1JUIA 2DCKA 4B7KA 3KGZA 4XOGA 3RS6A 5JI9A 4Z1VA 1OFNA 1SLLA 2IZWA 4OHVA 1H2LA 3CNAA 1VBE2 1COV1 3W9AA 1W6PB 3WCSA 1NY71 5HXVA 4AVSA 1PGL1 1GQGA 5K9YA 2PELA 2PLV1 3VBHB 4I3GA 3QLQA 5K8SA 4IEPA 1UU5A 2D98A 2XLFA 1KXGA 3QD6A 2VNRA 4META 4I0BA 2GALA 1HRI2 3AZWA 1R093 3HQXA 4L8QA 4MGZE 4H55A 3CLPA 3FUQA 1QDOA 3INAA 2P34A 3RG0A 5BNOA 2XB6C 2A5ZA 2HWF2 4XXAA 2QJVA 4AI1A 1AR63 3KT4A 4KWJA 2WZPP 2BNNA 4QPGC 2XHKA 1D4M2 4XDQA 3D6EA 3O5SA 2MEV3 4D3WA 1NXD1 2XBO1 1HXS1 1S2KA 3JCIA 1S0JA 2QCSB 4AFBA 1LB2A 1BEV3 1O3TA 3MPBA 1CAUA 2BBVA 4EN8B 5JVVA 2GC1A 2RS31 1AYN2 1W39A 1V6JA 1YXWA 3QCWA 1EAH2 3VBRC 4XPVA 3NAPC 4H14A 3E5QA 3H50A 2A3YA 4M0HA 4AQ2A 2NP0A 2A71A 2Q1ZB 3M3EA 1QH7A 3AX4A 3SCFA 1M4WA 1VJ2A 3E6CC 2DFCA 5CU1A 2P37A 1QJY2 1ZBE3 4IESA 4FAHA 1MZ5A 3WW4A 3D0JA 2WNVA 1ULGA 1C8M1 5J09A 4PIYA 3I59B 4LBQD 2HEWF 4B4RA 1AXZA 2PQQA 1QH6A 2YUEA 1OFSA 2CAVA 5DUWA 3VDDA 4A7ZA 2RM22 4RGAA 1WCDJ 4K1YA 5KC6A 5DDJ2 5CBLA 1UMZA 4XJAA 5GLWA 3LOBA 4QQ2A 1RJ8A 1W0PA 4QPGB 1U5XA 1YHFA 4BZ4A 2BUKA 1ASJ3 1AR82 1J1TA 4FXKB 2JG9B 2PLV3 4XBLA 5DZEA 3VZJA 3RDIA 3E5XA 3O0WA 1NCQC 1YUDA 1UIKA 1Q8OA 3USUA 2C9AA 5AVAA 4RGGA 4GULA 2RHPA 3NAPB 3M3CA 2ZGRA 2XUMA 2VGDA 1RVF1 4BOWA 4LHLA 1BMV2 3EQEA 3TNPB 3ILNA 1RUG3 3GBGA 4M0NA 5DUVA 1QJX3 3WD5A 4B29A 1XE7A 4A2UA 1S0FA 5A3MA 2R1DA 1W6PA 2BFUS 3V0BA 3ZVXA 2ZKNA 4JGYC 4KWKA 2WT0A 2WFF1 5C8CB 5A32A 3AP7A 3ZYIB 1TME1 1URXA 1Y7BA 4HETA 4RHV1 5LRRA 4LBKA 1DZTA 4XF9A 2HJIA 2RS33 4NN0A 4UW3A 4D94A 1N1TA 2AUYA 1HQNA 4XTPA 1QU0A 1UX6A 2R042 4WVZA 4ES9A 3ZSMA 1PZ9A 1SLTA 4KG0A 2B46X 4Y22B 3PVOA 4LEJA 4IEYA