3I7TA

Crystal structure of rv2704, a member of highly conserved yjgf/yer057c/uk114 family, from mycobacterium tuberculosis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
118
structure length
118
Chain Sequence
SRTMVSSGSEFESAVGYSRAVRIGPLVVVAGTTGSGDDIAAQTRDALRRIEIALGQAGATLADVVRTRIYVTDISRWREVGEVHAQAFGKIRPVTSMVEVTALIAPGLLVEIEADAYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mycobacterium tuberculosis Rv2704 is a member of the YjgF/YER057c/UK114 family.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
total genus 32
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2009-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3i7tA00
3ZO8A 1XRGA 3KJJA 2CVLA 2EWCA 2CWJA 2UYKA 1QD9A 2CSLA 3LYBA 2CW4A 3QUWA 3M4SA 1JD1A 1X25A 2DYYA 3I3FA 1NQ3A 3K12A 4NWOB 1FNJA 3VCZA 3I7TA 5HP7A 2B33A 2UYPA 1PF5A 2UYNB 2CHSA 1UFYA 3ZP7A 3MQWA 3M1XA 1COMA 4ZK7A 2UYJA 3LMEA 3V4DA 1QU9A 2IG8A 1ODEA 3KJKA 3L7QA 1ONIA 1QAHA 1DBFA 1XHOA 2CHTA 2OTMA 2UYNA 3GTZA 3K0TA 3D01A 3R0PA 3ZOPA 1UI9A 3ZP4A 1FNKA 5HP8A 1J7HA
chains in the Genus database with same CATH superfamily
3NVIB 5MN4A 3TD5A 1QD9A 3HJWC 2GLZA 3C9RA 3QTYA 1NJIH 5EZYA 4FFBA 3FFMA 5MN6A 1PF5A 2UYNB 3C9SA 2VGMA 3VYUC 4BVRA 2I6DA 3PAFA 4B62A 1W5BA 3VIUA 5IJ9A 3JARA 3K2XA 2P6YA 3V4DA 3CG6A 1JY8A 3S0HA 3WPWA 1RQ7A 2OTMA 3R0PA 3JAWA 3J81M 1U43A 1FNKA 4U3JA 5HP8A 2H8EA 3LDTA 5IYZB 4U3JB 5EAZA 3RYHB 2HQSC 1NQ3A 4G4YA 4HNAB 3TD3A 1U3LA 2HP0A 3E20B 4B45A 4BVTA 5CA1A 5IJ0B 1H48A 3VMFB 2HP3A 1COMA 3OONA 2BO1A 5LYJB 3L7QA 1ONIA 1SZQA 4FFBB 4X1KA 3N4YA 4EI9A 5EO3A 4C8IA 5CA1B 4I4TB 5IJ0A 2H6LA 4O2AB 2CSLA 2ALEA 2VAMA 1FSZA 3VTIC 5KMGA 3F6MA 5J2UB 2HS4A 3QHDA 1RQ2A 2UYPA 1KQSF 3CC4F 2UZHA 4ZOLB 5HY1A 2HS0A 3JATA 4TUYB 3DC2A 2LBTA 5JVDA 5B8FA 3CCLF 5JCOA 2LBWA 5GIOC 1K8AH 3ELCA 1VQ5F 3WGLA 2PHNA 3CC7F 2N48A 3J7AR 5JQGA 5LOVB 3HKDA 4IIJA 2OTJF 2Q1YA 3WXMB 5LP6A 3G71F 5CA0A 3JASB 3VOAA 2KGWA 3D54A 5EIBC 2Z1FA 2HS3A 2IG8A 5JCOC 1SDSA 1RA4A 1SA0A 1TUBB 2RB9A 1X7PA 3RA5A 2KTUA 2LCAA 1FFXB 2ZODA 1J7HA 4RQOA 2VGNA 1Z5WA 2CW4A 3WPXA 5FNVB 2RHLA 1XV2A 1X25A 5GANK 2BTOA 4NWOB 3I56F 5GIPC 1QVFF 3CD6F 4YJ2B 2RHOA 3CB2A 5EWRA 1Q81H 1SA0B 1GO1A 2BTUA 4R40B 3SIUA 3NK7A 2W8BC 3I55F 4ZHQA 3JAKA 4BT3A 3S02A 3CCJF 3EORA 5CA0B 5EIBD 4BVSA 3JCMM 5HP7A 1W2BF 4TV9B 4X1YB 1W40A 1CLIA 3MCQA 2KTVA 1W5AA 3N2KA 1FNJA 4X20A 3M84A 5IT9M 2ZVYA 3NMUC 1IV1A 5ITZA 2ZAUA 5JVDB 3JALB 4B5CA 4BVQA 1W41A 1H7MA 3VI6A 3JATB 2ZOVA 4ZOLA 2HX0A 4U39A 1ODEA 5LP6C 2Q1XA 2KG4A 5BMVA 1RLGA 4X1IA 4ZI7A 3BYQA 2JNBA 3NK6A 2I6RA 1VQPF 2VXYA 3ON1A 1KNJA 2L26A 2H8CA 3E1YA 3VYTC 1VQ7F 5AVMA 3IKEA 1JFFA 3RYFB 4YJ3A 2FGYA 4IHJB 5GONB 3I3FA 4EB6A 3FPIA 2YXZA 1QVGF 1VQ6F 3P4EA 5LA6A 5FLXM 1UFYA 4O4LB 3JAMM 2HRYA 3N2GA 2DT4A 2G9IA 3U0OA 5HXUA 2BTQB 3E22B 1CK2A 3ZOPA 5KX5B 5HY0A 1ZWZA 2FC3A 2IAFA 1YJWF 4G4XA 1T0KB 3N4ZA 2F9ZC 2AIZP 1JFFB 3IKFA 3LYBA 3LWPC 4DRXA 3MBMA 5IYZA 1W5EA 2PMPA 4ZI7B 2GZLA 3JAWB 5BMVB 3CCRF 3CCMF 1Q82H 3OBYA 4G4WA 3V7QA 1X7OA 1U3PA 3MDOA 4O2BB 1Q7YH 1GX1A 3P10A 3NVKE 1XHOA 2UYNA 3ERNA 3VO8A 3C9TA 3CPQA 2Z01A 4X1YA 3T80A 3UT5B 3HKEB 1K9MH 3LFOA 5FJ4C 4O4IA 3V3TA 4F6RB 1YJ9F 2RHJA 2QI2A 3G4SF 2CHSA 3ZP7A 2OTLF 2V9YA 3FBAA 5CB4B 1QAHA 1KC8H 3D00A 4O4HB 3CXCF 3CYQA 1GO0A 4BT5A 5GINC 1JJ2F 2ZVZA 5J2TB 2OHWA 5FNVA 1XRGA 2Z1EA 3KJJA 4O4JB 5J2TA 3SIVA 3RYIB 2DYYA 1CN7A 5MN5A 4O4HA 5CB4A 1NMUB 1TUBA 2HRUA 3FD6A 4ZHWA 3HKBA 4ZHVA 3LWVC 3HKCA 3ESJA 3RYCB 3IEWA 4EI7A 1QU9A 3RYCA 3LWQC 4LNUA 4BY9D 3HAXD 3S0YA 2CHTA 5LP6B 4B46A 1OFUA 4O4IB 1YHQF 3ZP4A 2AIFA 1VH8A 3HKEA 1U40A 2Z1UA 3HKDB 1W3EX 3HTNA 4BT6A 2EWCA 2CWJA 3OBWA 3S03A 1YJNF 3M4SA 1W57A 2CZWA 3GYQA 3CCUF 1K73H 1E7KA 2VAPA 3CCQF 5C8YB 2OZBA 1T0AA 3MQWA 1YI2F 2UYJA 2AMTA 3F0EA 5J2UA 4DXDA 3WJRA 5KMGB 4LCKA 2QEXF 3WGJA 3ZO8A 4F6RA 3Q8HA 2QA4F 3CMEF 4I4TA 5JH7B 3UT5A 3LWOC 1TVKA 3FD5A 4X1KB 3N2GB 3B6NA 1VQLF 3VYSC 1Z5VA 5LYJA 4X3MA 2R751 3C9UA 1GZ0A 4ZK7A 3LMEA 4O2BA 3RA6A 4I55A 4G4ZA 3GTZA 2HP0B 4EB6B 4X3LA 1DT9A 5GONA 4HNAA 4YJ3B 4PWTA 1M1KH 3RYFA 3CYPB 5G4VC 4ZHYB 3RYHA 4C8EA 5HY2A 4WBNB 3DDNA 3K14A 3TD4A 2UYKA 3GHZA 1VQ8F 3QUWA 5HY4A 1M90H 3F0FA 4DRXB 1YITF 4WBNA 4G4VA 3O85A 2K1SA 1VQKF 2VAWA 3VCZA 1H47A 1VQ9F 4NUTA 4ERHA 4I55B 5KX5A 3JARB 2NMUA 3E22A 4G88A 5IJ9B 1VQNF 1W581 1W55A 3S0WA 4BT2A 2IQQA 3JVHA 3F0GA 1X52A 3N2KB 1DBFA 3K0TA 1KD1H 4O4LA 2WALA 4C81A 3IEQA 5EZYB 1W42A 1TVKB 1UI9A 3AGKA 5LA6B 3KIZA 5HWEA 1KNKA 3WJPA 1Q86H 5JH7A 3OW2F 1PXWA 4IHJA 3CCSF 1JD1A 3WGNA 4BT7A 3CC2F 1Q8RA 4BW0B 3VOBA 3CCVF 5HXZA 1VQ4F 3JAKB 4RHAA 1VQOF 4X1IB 2MQEA 4I50A 5EYPA 4E6EA 5LXTA 3RE3A 3KJKA 1XBIA 5EB1B 4TZZA 3CCEF 5C8YA 3JALA 3MCAB 4NQ3A 5EB0A 5ITZB 4C4WC 1IPAA 3WGKA 4M8IA 3G6EF 3IMPA 1R1MA 5G4UC 4X20B 3CPWF 1VQMF 3WGMA 1OAPA 4TV8B 5DCVA 3K12A 4TV9A 5GAPK 3HWUA 2ZF8A 4BT4A 1JN1A 3KE1A 4C82A 2QTPA 1IV2A 4LNUB 3V7EA 3HKCB 1YGYA 1YQNA 3KHNA 3WJQA 2Z1TA 4ZHQB 5A2QM 3HKBB 1RLUA 4IIJB 2RHHA 5JQGB 5LOVA 4YJ2A 4TV8A 3S06A 2CVLA 1VHAA 3RYIA 4O4JA 1N8RH 2HVYD 2LBXA 1IV3A 1S72F 3I7TA 2B33A 1VQVA 4TUYA 2YYEA 1FFXA 3LWRC 5LXTB 3P0ZA 4I50B 5EYPB 1IV4A 1VK3A 3M1XA 1YIJF 3CMAF 1W5FA 1W59A 4XCQA 2GVIA 3PLAC 3F0DA 2R6R1 4EI8A 4KWEA 3C8LA 3D01A 4C8GA 3JASA 3IR9A 3J80M 4O2AA
chains in the Genus database with same CATH topology
3ZO8A 1XRGA 3KJJA 2CVLA 2EWCA 2CWJA 2UYKA 1QD9A 2CSLA 3LYBA 2CW4A 3QUWA 3M4SA 1JD1A 1X25A 2DYYA 3I3FA 1NQ3A 3K12A 4NWOB 1FNJA 3VCZA 3I7TA 5HP7A 2B33A 2UYPA 1PF5A 2UYNB 2CHSA 1UFYA 3ZP7A 3MQWA 3M1XA 1COMA 4ZK7A 2UYJA 3LMEA 3V4DA 1QU9A 2IG8A 1ODEA 3KJKA 3L7QA 1ONIA 1QAHA 1DBFA 1XHOA 2CHTA 2OTMA 2UYNA 3GTZA 3K0TA 3D01A 3R0PA 3ZOPA 1UI9A 3ZP4A 1FNKA 5HP8A 1J7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZO8 A;  1XRG A;  3KJJ A;  2CVL A;  2EWC A;  2CWJ A;  2UYK A;  1QD9 A;  2CSL A;  3LYB A;  2CW4 A;  3QUW A;  3M4S A;  1JD1 A;  1X25 A;  2DYY A;  3I3F A;  1NQ3 A;  3K12 A;  4NWO B;  1FNJ A;  3VCZ A;  3I7T A;  5HP7 A;  2B33 A;  2UYP A;  1PF5 A;  2UYN B;  2CHS A;  1UFY A;  3ZP7 A;  3MQW A;  3M1X A;  1COM A;  4ZK7 A;  2UYJ A;  3LME A;  3V4D A;  1QU9 A;  2IG8 A;  1ODE A;  3KJK A;  3L7Q A;  1ONI A;  1QAH A;  1DBF A;  1XHO A;  2CHT A;  2OTM A;  2UYN A;  3GTZ A;  3K0T A;  3D01 A;  3R0P A;  3ZOP A;  1UI9 A;  3ZP4 A;  1FNK A;  5HP8 A;  1J7H A; 
#chains in the Genus database with same CATH topology
 3NVI B;  5MN4 A;  3TD5 A;  1QD9 A;  3HJW C;  2GLZ A;  3C9R A;  3QTY A;  1NJI H;  5EZY A;  4FFB A;  3FFM A;  5MN6 A;  1PF5 A;  2UYN B;  3C9S A;  2VGM A;  3VYU C;  4BVR A;  2I6D A;  3PAF A;  4B62 A;  1W5B A;  3VIU A;  5IJ9 A;  3JAR A;  3K2X A;  2P6Y A;  3V4D A;  3CG6 A;  1JY8 A;  3S0H A;  3WPW A;  1RQ7 A;  2OTM A;  3R0P A;  3JAW A;  3J81 M;  1U43 A;  1FNK A;  4U3J A;  5HP8 A;  2H8E A;  3LDT A;  5IYZ B;  4U3J B;  5EAZ A;  3RYH B;  2HQS C;  1NQ3 A;  4G4Y A;  4HNA B;  3TD3 A;  1U3L A;  2HP0 A;  3E20 B;  4B45 A;  4BVT A;  5CA1 A;  5IJ0 B;  1H48 A;  3VMF B;  2HP3 A;  1COM A;  3OON A;  2BO1 A;  5LYJ B;  3L7Q A;  1ONI A;  1SZQ A;  4FFB B;  4X1K A;  3N4Y A;  4EI9 A;  5EO3 A;  4C8I A;  5CA1 B;  4I4T B;  5IJ0 A;  2H6L A;  4O2A B;  2CSL A;  2ALE A;  2VAM A;  1FSZ A;  3VTI C;  5KMG A;  3F6M A;  5J2U B;  2HS4 A;  3QHD A;  1RQ2 A;  2UYP A;  1KQS F;  3CC4 F;  2UZH A;  4ZOL B;  5HY1 A;  2HS0 A;  3JAT A;  4TUY B;  3DC2 A;  2LBT A;  5JVD A;  5B8F A;  3CCL F;  5JCO A;  2LBW A;  5GIO C;  1K8A H;  3ELC A;  1VQ5 F;  3WGL A;  2PHN A;  3CC7 F;  2N48 A;  3J7A R;  5JQG A;  5LOV B;  3HKD A;  4IIJ A;  2OTJ F;  2Q1Y A;  3WXM B;  5LP6 A;  3G71 F;  5CA0 A;  3JAS B;  3VOA A;  2KGW A;  3D54 A;  5EIB C;  2Z1F A;  2HS3 A;  2IG8 A;  5JCO C;  1SDS A;  1RA4 A;  1SA0 A;  1TUB B;  2RB9 A;  1X7P A;  3RA5 A;  2KTU A;  2LCA A;  1FFX B;  2ZOD A;  1J7H A;  4RQO A;  2VGN A;  1Z5W A;  2CW4 A;  3WPX A;  5FNV B;  2RHL A;  1XV2 A;  1X25 A;  5GAN K;  2BTO A;  4NWO B;  3I56 F;  5GIP C;  1QVF F;  3CD6 F;  4YJ2 B;  2RHO A;  3CB2 A;  5EWR A;  1Q81 H;  1SA0 B;  1GO1 A;  2BTU A;  4R40 B;  3SIU A;  3NK7 A;  2W8B C;  3I55 F;  4ZHQ A;  3JAK A;  4BT3 A;  3S02 A;  3CCJ F;  3EOR A;  5CA0 B;  5EIB D;  4BVS A;  3JCM M;  5HP7 A;  1W2B F;  4TV9 B;  4X1Y B;  1W40 A;  1CLI A;  3MCQ A;  2KTV A;  1W5A A;  3N2K A;  1FNJ A;  4X20 A;  3M84 A;  5IT9 M;  2ZVY A;  3NMU C;  1IV1 A;  5ITZ A;  2ZAU A;  5JVD B;  3JAL B;  4B5C A;  4BVQ A;  1W41 A;  1H7M A;  3VI6 A;  3JAT B;  2ZOV A;  4ZOL A;  2HX0 A;  4U39 A;  1ODE A;  5LP6 C;  2Q1X A;  2KG4 A;  5BMV A;  1RLG A;  4X1I A;  4ZI7 A;  3BYQ A;  2JNB A;  3NK6 A;  2I6R A;  1VQP F;  2VXY A;  3ON1 A;  1KNJ A;  2L26 A;  2H8C A;  3E1Y A;  3VYT C;  1VQ7 F;  5AVM A;  3IKE A;  1JFF A;  3RYF B;  4YJ3 A;  2FGY A;  4IHJ B;  5GON B;  3I3F A;  4EB6 A;  3FPI A;  2YXZ A;  1QVG F;  1VQ6 F;  3P4E A;  5LA6 A;  5FLX M;  1UFY A;  4O4L B;  3JAM M;  2HRY A;  3N2G A;  2DT4 A;  2G9I A;  3U0O A;  5HXU A;  2BTQ B;  3E22 B;  1CK2 A;  3ZOP A;  5KX5 B;  5HY0 A;  1ZWZ A;  2FC3 A;  2IAF A;  1YJW F;  4G4X A;  1T0K B;  3N4Z A;  2F9Z C;  2AIZ P;  1JFF B;  3IKF A;  3LYB A;  3LWP C;  4DRX A;  3MBM A;  5IYZ A;  1W5E A;  2PMP A;  4ZI7 B;  2GZL A;  3JAW B;  5BMV B;  3CCR F;  3CCM F;  1Q82 H;  3OBY A;  4G4W A;  3V7Q A;  1X7O A;  1U3P A;  3MDO A;  4O2B B;  1Q7Y H;  1GX1 A;  3P10 A;  3NVK E;  1XHO A;  2UYN A;  3ERN A;  3VO8 A;  3C9T A;  3CPQ A;  2Z01 A;  4X1Y A;  3T80 A;  3UT5 B;  3HKE B;  1K9M H;  3LFO A;  5FJ4 C;  4O4I A;  3V3T A;  4F6R B;  1YJ9 F;  2RHJ A;  2QI2 A;  3G4S F;  2CHS A;  3ZP7 A;  2OTL F;  2V9Y A;  3FBA A;  5CB4 B;  1QAH A;  1KC8 H;  3D00 A;  4O4H B;  3CXC F;  3CYQ A;  1GO0 A;  4BT5 A;  5GIN C;  1JJ2 F;  2ZVZ A;  5J2T B;  2OHW A;  5FNV A;  1XRG A;  2Z1E A;  3KJJ A;  4O4J B;  5J2T A;  3SIV A;  3RYI B;  2DYY A;  1CN7 A;  5MN5 A;  4O4H A;  5CB4 A;  1NMU B;  1TUB A;  2HRU A;  3FD6 A;  4ZHW A;  3HKB A;  4ZHV A;  3LWV C;  3HKC A;  3ESJ A;  3RYC B;  3IEW A;  4EI7 A;  1QU9 A;  3RYC A;  3LWQ C;  4LNU A;  4BY9 D;  3HAX D;  3S0Y A;  2CHT A;  5LP6 B;  4B46 A;  1OFU A;  4O4I B;  1YHQ F;  3ZP4 A;  2AIF A;  1VH8 A;  3HKE A;  1U40 A;  2Z1U A;  3HKD B;  1W3E X;  3HTN A;  4BT6 A;  2EWC A;  2CWJ A;  3OBW A;  3S03 A;  1YJN F;  3M4S A;  1W57 A;  2CZW A;  3GYQ A;  3CCU F;  1K73 H;  1E7K A;  2VAP A;  3CCQ F;  5C8Y B;  2OZB A;  1T0A A;  3MQW A;  1YI2 F;  2UYJ A;  2AMT A;  3F0E A;  5J2U A;  4DXD A;  3WJR A;  5KMG B;  4LCK A;  2QEX F;  3WGJ A;  3ZO8 A;  4F6R A;  3Q8H A;  2QA4 F;  3CME F;  4I4T A;  5JH7 B;  3UT5 A;  3LWO C;  1TVK A;  3FD5 A;  4X1K B;  3N2G B;  3B6N A;  1VQL F;  3VYS C;  1Z5V A;  5LYJ A;  4X3M A;  2R75 1;  3C9U A;  1GZ0 A;  4ZK7 A;  3LME A;  4O2B A;  3RA6 A;  4I55 A;  4G4Z A;  3GTZ A;  2HP0 B;  4EB6 B;  4X3L A;  1DT9 A;  5GON A;  4HNA A;  4YJ3 B;  4PWT A;  1M1K H;  3RYF A;  3CYP B;  5G4V C;  4ZHY B;  3RYH A;  4C8E A;  5HY2 A;  4WBN B;  3DDN A;  3K14 A;  3TD4 A;  2UYK A;  3GHZ A;  1VQ8 F;  3QUW A;  5HY4 A;  1M90 H;  3F0F A;  4DRX B;  1YIT F;  4WBN A;  4G4V A;  3O85 A;  2K1S A;  1VQK F;  2VAW A;  3VCZ A;  1H47 A;  1VQ9 F;  4NUT A;  4ERH A;  4I55 B;  5KX5 A;  3JAR B;  2NMU A;  3E22 A;  4G88 A;  5IJ9 B;  1VQN F;  1W58 1;  1W55 A;  3S0W A;  4BT2 A;  2IQQ A;  3JVH A;  3F0G A;  1X52 A;  3N2K B;  1DBF A;  3K0T A;  1KD1 H;  4O4L A;  2WAL A;  4C81 A;  3IEQ A;  5EZY B;  1W42 A;  1TVK B;  1UI9 A;  3AGK A;  5LA6 B;  3KIZ A;  5HWE A;  1KNK A;  3WJP A;  1Q86 H;  5JH7 A;  3OW2 F;  1PXW A;  4IHJ A;  3CCS F;  1JD1 A;  3WGN A;  4BT7 A;  3CC2 F;  1Q8R A;  4BW0 B;  3VOB A;  3CCV F;  5HXZ A;  1VQ4 F;  3JAK B;  4RHA A;  1VQO F;  4X1I B;  2MQE A;  4I50 A;  5EYP A;  4E6E A;  5LXT A;  3RE3 A;  3KJK A;  1XBI A;  5EB1 B;  4TZZ A;  3CCE F;  5C8Y A;  3JAL A;  3MCA B;  4NQ3 A;  5EB0 A;  5ITZ B;  4C4W C;  1IPA A;  3WGK A;  4M8I A;  3G6E F;  3IMP A;  1R1M A;  5G4U C;  4X20 B;  3CPW F;  1VQM F;  3WGM A;  1OAP A;  4TV8 B;  5DCV A;  3K12 A;  4TV9 A;  5GAP K;  3HWU A;  2ZF8 A;  4BT4 A;  1JN1 A;  3KE1 A;  4C82 A;  2QTP A;  1IV2 A;  4LNU B;  3V7E A;  3HKC B;  1YGY A;  1YQN A;  3KHN A;  3WJQ A;  2Z1T A;  4ZHQ B;  5A2Q M;  3HKB B;  1RLU A;  4IIJ B;  2RHH A;  5JQG B;  5LOV A;  4YJ2 A;  4TV8 A;  3S06 A;  2CVL A;  1VHA A;  3RYI A;  4O4J A;  1N8R H;  2HVY D;  2LBX A;  1IV3 A;  1S72 F;  3I7T A;  2B33 A;  1VQV A;  4TUY A;  2YYE A;  1FFX A;  3LWR C;  5LXT B;  3P0Z A;  4I50 B;  5EYP B;  1IV4 A;  1VK3 A;  3M1X A;  1YIJ F;  3CMA F;  1W5F A;  1W59 A;  4XCQ A;  2GVI A;  3PLA C;  3F0D A;  2R6R 1;  4EI8 A;  4KWE A;  3C8L A;  3D01 A;  4C8G A;  3JAS A;  3IR9 A;  3J80 M;  4O2A A; 
#chains in the Genus database with same CATH homology
 3ZO8 A;  1XRG A;  3KJJ A;  2CVL A;  2EWC A;  2CWJ A;  2UYK A;  1QD9 A;  2CSL A;  3LYB A;  2CW4 A;  3QUW A;  3M4S A;  1JD1 A;  1X25 A;  2DYY A;  3I3F A;  1NQ3 A;  3K12 A;  4NWO B;  1FNJ A;  3VCZ A;  3I7T A;  5HP7 A;  2B33 A;  2UYP A;  1PF5 A;  2UYN B;  2CHS A;  1UFY A;  3ZP7 A;  3MQW A;  3M1X A;  1COM A;  4ZK7 A;  2UYJ A;  3LME A;  3V4D A;  1QU9 A;  2IG8 A;  1ODE A;  3KJK A;  3L7Q A;  1ONI A;  1QAH A;  1DBF A;  1XHO A;  2CHT A;  2OTM A;  2UYN A;  3GTZ A;  3K0T A;  3D01 A;  3R0P A;  3ZOP A;  1UI9 A;  3ZP4 A;  1FNK A;  5HP8 A;  1J7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...