3I7TA

Crystal structure of rv2704, a member of highly conserved yjgf/yer057c/uk114 family, from mycobacterium tuberculosis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
118
structure length
118
Chain Sequence
SRTMVSSGSEFESAVGYSRAVRIGPLVVVAGTTGSGDDIAAQTRDALRRIEIALGQAGATLADVVRTRIYVTDISRWREVGEVHAQAFGKIRPVTSMVEVTALIAPGLLVEIEADAYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Mycobacterium tuberculosis Rv2704 is a member of the YjgF/YER057c/UK114 family.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
total genus 32
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2009-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3i7tA00
2CHTA 3ZOPA 1J7HA 2UYNB 1FNKA 4ZK7A 3I7TA 1JD1A 1XRGA 3MQWA 1ONIA 1UI9A 2IG8A 2EWCA 3KJJA 1QU9A 1NQ3A 2DYYA 3GTZA 3L7QA 3LYBA 2CVLA 3R0PA 3LMEA 1QAHA 3KJKA 3D01A 5HP8A 1XHOA 1PF5A 3QUWA 3M1XA 3V4DA 2B33A 2CWJA 3K0TA 2UYPA 3ZP4A 3ZP7A 3I3FA 1FNJA 1COMA 3K12A 2CW4A 2UYJA 2UYNA 3M4SA 2CSLA 3ZO8A 2CHSA 2OTMA 5HP7A 1ODEA 1UFYA 3VCZA 2UYKA 1QD9A 1X25A 4NWOB 1DBFA
chains in the Genus database with same CATH superfamily
2BO1A 3G4SF 1W40A 5FNVA 3N4ZA 3LWPC 3LWRC 1FSZA 3ON1A 4G4YA 4O2BB 2KGWA 4I50B 1QVGF 3LWVC 1W2BF 3CMAF 1NJIH 2Q1XA 4ZOLA 4O4IA 2H6LA 2IAFA 4R40B 3WPWA 5KX5B 3TD3A 2HS3A 3HKEA 5J2UB 2KTVA 1DT9A 5LYJA 1W57A 5HY4A 1X25A 3CG6A 2VXYA 3V7EA 5IYZB 3IMPA 3JARA 1W42A 4ZK7A 4ZHQB 4X3MA 3VYUC 5EO3A 1ZWZA 2RB9A 3KJJA 5C8YB 1QU9A 4O4LA 3K14A 1N8RH 1VQ8F 3M84A 4RHAA 1U3LA 1Q82H 3IKEA 5GINC 4HNAA 2K1SA 3WJRA 1PF5A 1U43A 3OONA 1VQ7F 3FPIA 5HWEA 2HVYD 4I4TB 3DC2A 5MN6A 2YYEA 5LOVB 1W581 1IV3A 2G9IA 3RYHB 4F6RB 1SDSA 1GO1A 1XBIA 1M90H 1IV4A 4BVRA 1YJWF 3CCRF 1SZQA 3MDOA 3ERNA 3O85A 5CA1B 2LBWA 1VQPF 3N2GA 3N2KA 5LP6B 5DCVA 4M8IA 5HY0A 3CCSF 1H47A 4B45A 5EZYB 5FNVB 4RQOA 4BT6A 1YQNA 1VQKF 2GZLA 4X1KA 2BTQB 1YIJF 2YXZA 1VHAA 4O2AA 5EAZA 2I6RA 3CYQA 3RYIA 4BVSA 2PHNA 2CW4A 1PXWA 1U40A 2IQQA 2ZOVA 5A2QM 2UYKA 3J80M 1XV2A 2Z1UA 4O2BA 3MBMA 3U0OA 1FNKA 4I50A 2FC3A 1YI2F 2MQEA 5ITZB 1VQOF 3FD5A 3I56F 3Q8HA 3CXCF 4X1IB 4EI9A 5JCOA 5KX5A 3JARB 5J2UA 3LMEA 3F6MA 3FFMA 2BTOA 2VAMA 3V4DA 3HJWC 3K0TA 5JH7B 3SIUA 2GVIA 3ZP4A 3K12A 4YJ3B 4LNUB 4ZHQA 1VQLF 5C8YA 4NUTA 1VQNF 3S03A 2NMUA 4O4JB 1Q86H 3AGKA 4C4WC 1IV1A 3LWQC 4TV9B 2AMTA 5EIBC 4I4TA 3ELCA 3NVKE 3L7QA 5LOVA 3CCMF 2AIFA 3RYHA 3V7QA 4F6RA 3N2GB 3ESJA 2KG4A 3TD4A 2P6YA 3D00A 5BMVB 1YJNF 3VMFB 5CA1A 3F0EA 5J2TB 3J81M 2DT4A 4G4WA 4PWTA 3CCQF 2ZF8A 4X1KB 1W41A 3CYPB 4O2AB 5LP6A 2OTJF 4TZZA 3P10A 3RYIB 3JALB 4NQ3A 3I55F 1VQ4F 5EZYA 3MQWA 1UI9A 3CB2A 4G88A 4G4XA 4KWEA 1KD1H 2I6DA 3E22B 2ZVZA 3LYBA 2Q1YA 3GHZA 3CPWF 3C9RA 1W59A 3K2XA 3VYTC 5IJ9B 3WGMA 3F0FA 1U3PA 1YGYA 4TUYB 5ITZA 3VCZA 2LBTA 5EIBD 1NMUB 4BY9D 2H8EA 4E6EA 4EI8A 1Z5VA 4X1IA 3CCVF 1FFXB 3J7AR 2R751 3QHDA 3WGNA 3RYFA 3HKBB 1W5AA 4X3LA 1X7OA 1K8AH 1ONIA 3MCAB 1Q81H 1YHQF 3WJQA 5JH7A 2AIZP 5KMGB 2HS4A 2QA4F 3HKCB 4YJ3A 5G4VC 1RLUA 4LNUA 4C8IA 3D01A 5HP8A 2CWJA 3CPQA 3P0ZA 2RHHA 4BT7A 4O4JA 2QEXF 3CMEF 2CHSA 3IEWA 4X1YB 4TV9A 3CCLF 2CHTA 3EORA 3I7TA 4EB6B 1RQ7A 4IIJB 5GONB 1VH8A 3C9SA 3KE1A 3WPXA 1M1KH 1RQ2A 3QTYA 5BMVA 3G6EF 3KIZA 4C81A 3NK7A 5EB1B 2Z1EA 5J2TA 2FGYA 3IKFA 3C9UA 4XCQA 2UYPA 4C8EA 3JALA 2HRYA 3FD6A 4I55B 3FBAA 4U3JB 3C9TA 1SA0A 1K9MH 1IV2A 3HTNA 3JATB 2Z01A 3E22A 1DBFA 3ZOPA 2UYNB 1VQ5F 3S02A 3NVIB 2BTUA 2V9YA 3T80A 5IJ9A 3HWUA 2GLZA 3VYSC 5JCOC 2CVLA 5LA6B 3RYFB 2W8BC 4BT5A 4TUYA 1XHOA 4FFBB 1TUBB 5HXUA 4G4ZA 5JQGB 3VOBA 3CC7F 1FFXA 5GIOC 5MN4A 4U39A 1VQ9F 5HP7A 3HKBA 1ODEA 3F0GA 4BT2A 3MCQA 2HQSC 3TD5A 5KMGA 5FJ4C 3VIUA 2OHWA 3HKCA 2PMPA 1JN1A 5FLXM 4ZHYB 3E1YA 3OBYA 2VAWA 4X20B 4B5CA 3JAMM 3F0DA 1H48A 1KQSF 3UT5B 4X1YA 1KNJA 2B33A 1TVKA 1OAPA 3OW2F 4WBNB 5G4UC 3I3FA 1W5FA 3CCEF 3CC2F 2CSLA 4EB6A 5EWRA 2WALA 4IIJA 5GONA 3JAKB 3HAXD 1CK2A 1R1MA 5CB4B 4NWOB 1VK3A 2ZODA 1RA4A 1JD1A 1XRGA 5HY2A 3HKDB 1CLIA 3RYCA 1JFFB 5GAPK 1SA0B 1Z5WA 1QVFF 4DRXA 4I55A 4U3JA 3E20B 3S0WA 2L26A 4DXDA 3P4EA 4ERHA 2N48A 3JATA 4O4HB 5IJ0B 1Q7YH 1W3EX 2UYNA 4TV8B 1GO0A 3LDTA 1GX1A 4G4VA 3VO8A 1UFYA 2Z1FA 1QD9A 5B8FA 3WGKA 4ZHVA 2DYYA 5LXTB 2OTLF 5JVDB 3OBWA 5LA6A 3WGJA 1K73H 2JNBA 4FFBA 1TUBA 1KNKA 3VOAA 4BW0B 3RE3A 1X52A 5GANK 5JQGA 3KHNA 4C8GA 3C8LA 3LWOC 2R6R1 4IHJB 3CD6F 4C82A 4B46A 4LCKA 3JAWB 3NMUC 3JASB 2OZBA 2HP0B 3M4SA 2OTMA 2HX0A 1T0KB 2CZWA 4YJ2B 2HRUA 3RA5A 1TVKB 4B62A 1X7PA 5EYPB 5HXZA 3RA6A 3D54A 2F9ZC 4X20A 1VQVA 2HS0A 3DDNA 3UT5A 5CA0B 3CCJF 5IT9M 1JY8A 4WBNA 2ALEA 1H7MA 2UZHA 1YJ9F 4ZI7B 1JJ2F 3JAKA 3RYCB 1OFUA 5CB4A 5MN5A 2ZAUA 1COMA 1GZ0A 2LCAA 4EI7A 2RHLA 3CC4F 4DRXB 3HKDA 1CN7A 2QTPA 5GIPC 1JFFA 1W5EA 1KC8H 3PLAC 3NK6A 1J7HA 3WJPA 1VQ6F 3JCMM 2IG8A 1W5BA 2EWCA 2VGNA 5EB0A 3GTZA 3PAFA 4O4HA 5IJ0A 4TV8A 3KJKA 3V3TA 1FNJA 3S0HA 2UYJA 2RHJA 5LXTA 3WXMB 3N4YA 5JVDA 1S72F 2Z1TA 4ZOLB 4O4IB 3HKEB 4IHJA 3GYQA 5LYJB 2LBXA 3S0YA 1VQMF 3JAWA 3JASA 4ZHWA 2HP0A 3G71F 1QAHA 1YITF 3QUWA 3M1XA 2KTUA 4YJ2A 4O4LB 5IYZA 3BYQA 2H8CA 5EYPA 3ZO8A 4HNAB 3CCUF 3VTIC 5CA0A 3WGLA 1T0AA 2QI2A 3B6NA 3VI6A 4BT4A 1W55A 1Q8RA 5LP6C 2HP3A 4ZI7A 1RLGA 4BVTA 1NQ3A 2RHOA 3R0PA 3JVHA 1E7KA 4BT3A 2VGMA 3IEQA 2ZVYA 1IPAA 3N2KB 2VAPA 3SIVA 3IR9A 4BVQA 3ZP7A 3LFOA 5AVMA 5HY1A 3S06A
chains in the Genus database with same CATH topology
2CHTA 3ZOPA 1J7HA 2UYNB 1FNKA 4ZK7A 3I7TA 1JD1A 1XRGA 3MQWA 1ONIA 1UI9A 2IG8A 2EWCA 3KJJA 1QU9A 1NQ3A 2DYYA 3GTZA 3L7QA 3LYBA 2CVLA 3R0PA 3LMEA 1QAHA 3KJKA 3D01A 5HP8A 1XHOA 1PF5A 3QUWA 3M1XA 3V4DA 2B33A 2CWJA 3K0TA 2UYPA 3ZP4A 3ZP7A 3I3FA 1FNJA 1COMA 3K12A 2CW4A 2UYJA 2UYNA 3M4SA 2CSLA 3ZO8A 2CHSA 2OTMA 5HP7A 1ODEA 1UFYA 3VCZA 2UYKA 1QD9A 1X25A 4NWOB 1DBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CHT A;  3ZOP A;  1J7H A;  2UYN B;  1FNK A;  4ZK7 A;  3I7T A;  1JD1 A;  1XRG A;  3MQW A;  1ONI A;  1UI9 A;  2IG8 A;  2EWC A;  3KJJ A;  1QU9 A;  1NQ3 A;  2DYY A;  3GTZ A;  3L7Q A;  3LYB A;  2CVL A;  3R0P A;  3LME A;  1QAH A;  3KJK A;  3D01 A;  5HP8 A;  1XHO A;  1PF5 A;  3QUW A;  3M1X A;  3V4D A;  2B33 A;  2CWJ A;  3K0T A;  2UYP A;  3ZP4 A;  3ZP7 A;  3I3F A;  1FNJ A;  1COM A;  3K12 A;  2CW4 A;  2UYJ A;  2UYN A;  3M4S A;  2CSL A;  3ZO8 A;  2CHS A;  2OTM A;  5HP7 A;  1ODE A;  1UFY A;  3VCZ A;  2UYK A;  1QD9 A;  1X25 A;  4NWO B;  1DBF A; 
#chains in the Genus database with same CATH topology
 2BO1 A;  3G4S F;  1W40 A;  5FNV A;  3N4Z A;  3LWP C;  3LWR C;  1FSZ A;  3ON1 A;  4G4Y A;  4O2B B;  2KGW A;  4I50 B;  1QVG F;  3LWV C;  1W2B F;  3CMA F;  1NJI H;  2Q1X A;  4ZOL A;  4O4I A;  2H6L A;  2IAF A;  4R40 B;  3WPW A;  5KX5 B;  3TD3 A;  2HS3 A;  3HKE A;  5J2U B;  2KTV A;  1DT9 A;  5LYJ A;  1W57 A;  5HY4 A;  1X25 A;  3CG6 A;  2VXY A;  3V7E A;  5IYZ B;  3IMP A;  3JAR A;  1W42 A;  4ZK7 A;  4ZHQ B;  4X3M A;  3VYU C;  5EO3 A;  1ZWZ A;  2RB9 A;  3KJJ A;  5C8Y B;  1QU9 A;  4O4L A;  3K14 A;  1N8R H;  1VQ8 F;  3M84 A;  4RHA A;  1U3L A;  1Q82 H;  3IKE A;  5GIN C;  4HNA A;  2K1S A;  3WJR A;  1PF5 A;  1U43 A;  3OON A;  1VQ7 F;  3FPI A;  5HWE A;  2HVY D;  4I4T B;  3DC2 A;  5MN6 A;  2YYE A;  5LOV B;  1W58 1;  1IV3 A;  2G9I A;  3RYH B;  4F6R B;  1SDS A;  1GO1 A;  1XBI A;  1M90 H;  1IV4 A;  4BVR A;  1YJW F;  3CCR F;  1SZQ A;  3MDO A;  3ERN A;  3O85 A;  5CA1 B;  2LBW A;  1VQP F;  3N2G A;  3N2K A;  5LP6 B;  5DCV A;  4M8I A;  5HY0 A;  3CCS F;  1H47 A;  4B45 A;  5EZY B;  5FNV B;  4RQO A;  4BT6 A;  1YQN A;  1VQK F;  2GZL A;  4X1K A;  2BTQ B;  1YIJ F;  2YXZ A;  1VHA A;  4O2A A;  5EAZ A;  2I6R A;  3CYQ A;  3RYI A;  4BVS A;  2PHN A;  2CW4 A;  1PXW A;  1U40 A;  2IQQ A;  2ZOV A;  5A2Q M;  2UYK A;  3J80 M;  1XV2 A;  2Z1U A;  4O2B A;  3MBM A;  3U0O A;  1FNK A;  4I50 A;  2FC3 A;  1YI2 F;  2MQE A;  5ITZ B;  1VQO F;  3FD5 A;  3I56 F;  3Q8H A;  3CXC F;  4X1I B;  4EI9 A;  5JCO A;  5KX5 A;  3JAR B;  5J2U A;  3LME A;  3F6M A;  3FFM A;  2BTO A;  2VAM A;  3V4D A;  3HJW C;  3K0T A;  5JH7 B;  3SIU A;  2GVI A;  3ZP4 A;  3K12 A;  4YJ3 B;  4LNU B;  4ZHQ A;  1VQL F;  5C8Y A;  4NUT A;  1VQN F;  3S03 A;  2NMU A;  4O4J B;  1Q86 H;  3AGK A;  4C4W C;  1IV1 A;  3LWQ C;  4TV9 B;  2AMT A;  5EIB C;  4I4T A;  3ELC A;  3NVK E;  3L7Q A;  5LOV A;  3CCM F;  2AIF A;  3RYH A;  3V7Q A;  4F6R A;  3N2G B;  3ESJ A;  2KG4 A;  3TD4 A;  2P6Y A;  3D00 A;  5BMV B;  1YJN F;  3VMF B;  5CA1 A;  3F0E A;  5J2T B;  3J81 M;  2DT4 A;  4G4W A;  4PWT A;  3CCQ F;  2ZF8 A;  4X1K B;  1W41 A;  3CYP B;  4O2A B;  5LP6 A;  2OTJ F;  4TZZ A;  3P10 A;  3RYI B;  3JAL B;  4NQ3 A;  3I55 F;  1VQ4 F;  5EZY A;  3MQW A;  1UI9 A;  3CB2 A;  4G88 A;  4G4X A;  4KWE A;  1KD1 H;  2I6D A;  3E22 B;  2ZVZ A;  3LYB A;  2Q1Y A;  3GHZ A;  3CPW F;  3C9R A;  1W59 A;  3K2X A;  3VYT C;  5IJ9 B;  3WGM A;  3F0F A;  1U3P A;  1YGY A;  4TUY B;  5ITZ A;  3VCZ A;  2LBT A;  5EIB D;  1NMU B;  4BY9 D;  2H8E A;  4E6E A;  4EI8 A;  1Z5V A;  4X1I A;  3CCV F;  1FFX B;  3J7A R;  2R75 1;  3QHD A;  3WGN A;  3RYF A;  3HKB B;  1W5A A;  4X3L A;  1X7O A;  1K8A H;  1ONI A;  3MCA B;  1Q81 H;  1YHQ F;  3WJQ A;  5JH7 A;  2AIZ P;  5KMG B;  2HS4 A;  2QA4 F;  3HKC B;  4YJ3 A;  5G4V C;  1RLU A;  4LNU A;  4C8I A;  3D01 A;  5HP8 A;  2CWJ A;  3CPQ A;  3P0Z A;  2RHH A;  4BT7 A;  4O4J A;  2QEX F;  3CME F;  2CHS A;  3IEW A;  4X1Y B;  4TV9 A;  3CCL F;  2CHT A;  3EOR A;  3I7T A;  4EB6 B;  1RQ7 A;  4IIJ B;  5GON B;  1VH8 A;  3C9S A;  3KE1 A;  3WPX A;  1M1K H;  1RQ2 A;  3QTY A;  5BMV A;  3G6E F;  3KIZ A;  4C81 A;  3NK7 A;  5EB1 B;  2Z1E A;  5J2T A;  2FGY A;  3IKF A;  3C9U A;  4XCQ A;  2UYP A;  4C8E A;  3JAL A;  2HRY A;  3FD6 A;  4I55 B;  3FBA A;  4U3J B;  3C9T A;  1SA0 A;  1K9M H;  1IV2 A;  3HTN A;  3JAT B;  2Z01 A;  3E22 A;  1DBF A;  3ZOP A;  2UYN B;  1VQ5 F;  3S02 A;  3NVI B;  2BTU A;  2V9Y A;  3T80 A;  5IJ9 A;  3HWU A;  2GLZ A;  3VYS C;  5JCO C;  2CVL A;  5LA6 B;  3RYF B;  2W8B C;  4BT5 A;  4TUY A;  1XHO A;  4FFB B;  1TUB B;  5HXU A;  4G4Z A;  5JQG B;  3VOB A;  3CC7 F;  1FFX A;  5GIO C;  5MN4 A;  4U39 A;  1VQ9 F;  5HP7 A;  3HKB A;  1ODE A;  3F0G A;  4BT2 A;  3MCQ A;  2HQS C;  3TD5 A;  5KMG A;  5FJ4 C;  3VIU A;  2OHW A;  3HKC A;  2PMP A;  1JN1 A;  5FLX M;  4ZHY B;  3E1Y A;  3OBY A;  2VAW A;  4X20 B;  4B5C A;  3JAM M;  3F0D A;  1H48 A;  1KQS F;  3UT5 B;  4X1Y A;  1KNJ A;  2B33 A;  1TVK A;  1OAP A;  3OW2 F;  4WBN B;  5G4U C;  3I3F A;  1W5F A;  3CCE F;  3CC2 F;  2CSL A;  4EB6 A;  5EWR A;  2WAL A;  4IIJ A;  5GON A;  3JAK B;  3HAX D;  1CK2 A;  1R1M A;  5CB4 B;  4NWO B;  1VK3 A;  2ZOD A;  1RA4 A;  1JD1 A;  1XRG A;  5HY2 A;  3HKD B;  1CLI A;  3RYC A;  1JFF B;  5GAP K;  1SA0 B;  1Z5W A;  1QVF F;  4DRX A;  4I55 A;  4U3J A;  3E20 B;  3S0W A;  2L26 A;  4DXD A;  3P4E A;  4ERH A;  2N48 A;  3JAT A;  4O4H B;  5IJ0 B;  1Q7Y H;  1W3E X;  2UYN A;  4TV8 B;  1GO0 A;  3LDT A;  1GX1 A;  4G4V A;  3VO8 A;  1UFY A;  2Z1F A;  1QD9 A;  5B8F A;  3WGK A;  4ZHV A;  2DYY A;  5LXT B;  2OTL F;  5JVD B;  3OBW A;  5LA6 A;  3WGJ A;  1K73 H;  2JNB A;  4FFB A;  1TUB A;  1KNK A;  3VOA A;  4BW0 B;  3RE3 A;  1X52 A;  5GAN K;  5JQG A;  3KHN A;  4C8G A;  3C8L A;  3LWO C;  2R6R 1;  4IHJ B;  3CD6 F;  4C82 A;  4B46 A;  4LCK A;  3JAW B;  3NMU C;  3JAS B;  2OZB A;  2HP0 B;  3M4S A;  2OTM A;  2HX0 A;  1T0K B;  2CZW A;  4YJ2 B;  2HRU A;  3RA5 A;  1TVK B;  4B62 A;  1X7P A;  5EYP B;  5HXZ A;  3RA6 A;  3D54 A;  2F9Z C;  4X20 A;  1VQV A;  2HS0 A;  3DDN A;  3UT5 A;  5CA0 B;  3CCJ F;  5IT9 M;  1JY8 A;  4WBN A;  2ALE A;  1H7M A;  2UZH A;  1YJ9 F;  4ZI7 B;  1JJ2 F;  3JAK A;  3RYC B;  1OFU A;  5CB4 A;  5MN5 A;  2ZAU A;  1COM A;  1GZ0 A;  2LCA A;  4EI7 A;  2RHL A;  3CC4 F;  4DRX B;  3HKD A;  1CN7 A;  2QTP A;  5GIP C;  1JFF A;  1W5E A;  1KC8 H;  3PLA C;  3NK6 A;  1J7H A;  3WJP A;  1VQ6 F;  3JCM M;  2IG8 A;  1W5B A;  2EWC A;  2VGN A;  5EB0 A;  3GTZ A;  3PAF A;  4O4H A;  5IJ0 A;  4TV8 A;  3KJK A;  3V3T A;  1FNJ A;  3S0H A;  2UYJ A;  2RHJ A;  5LXT A;  3WXM B;  3N4Y A;  5JVD A;  1S72 F;  2Z1T A;  4ZOL B;  4O4I B;  3HKE B;  4IHJ A;  3GYQ A;  5LYJ B;  2LBX A;  3S0Y A;  1VQM F;  3JAW A;  3JAS A;  4ZHW A;  2HP0 A;  3G71 F;  1QAH A;  1YIT F;  3QUW A;  3M1X A;  2KTU A;  4YJ2 A;  4O4L B;  5IYZ A;  3BYQ A;  2H8C A;  5EYP A;  3ZO8 A;  4HNA B;  3CCU F;  3VTI C;  5CA0 A;  3WGL A;  1T0A A;  2QI2 A;  3B6N A;  3VI6 A;  4BT4 A;  1W55 A;  1Q8R A;  5LP6 C;  2HP3 A;  4ZI7 A;  1RLG A;  4BVT A;  1NQ3 A;  2RHO A;  3R0P A;  3JVH A;  1E7K A;  4BT3 A;  2VGM A;  3IEQ A;  2ZVY A;  1IPA A;  3N2K B;  2VAP A;  3SIV A;  3IR9 A;  4BVQ A;  3ZP7 A;  3LFO A;  5AVM A;  5HY1 A;  3S06 A; 
#chains in the Genus database with same CATH homology
 2CHT A;  3ZOP A;  1J7H A;  2UYN B;  1FNK A;  4ZK7 A;  3I7T A;  1JD1 A;  1XRG A;  3MQW A;  1ONI A;  1UI9 A;  2IG8 A;  2EWC A;  3KJJ A;  1QU9 A;  1NQ3 A;  2DYY A;  3GTZ A;  3L7Q A;  3LYB A;  2CVL A;  3R0P A;  3LME A;  1QAH A;  3KJK A;  3D01 A;  5HP8 A;  1XHO A;  1PF5 A;  3QUW A;  3M1X A;  3V4D A;  2B33 A;  2CWJ A;  3K0T A;  2UYP A;  3ZP4 A;  3ZP7 A;  3I3F A;  1FNJ A;  1COM A;  3K12 A;  2CW4 A;  2UYJ A;  2UYN A;  3M4S A;  2CSL A;  3ZO8 A;  2CHS A;  2OTM A;  5HP7 A;  1ODE A;  1UFY A;  3VCZ A;  2UYK A;  1QD9 A;  1X25 A;  4NWO B;  1DBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...