3I7TA

Crystal structure of rv2704, a member of highly conserved yjgf/yer057c/uk114 family, from mycobacterium tuberculosis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
118
structure length
118
Chain Sequence
b'SRTMVSSGSEFESAVGYSRAVRIGPLVVVAGTTGSGDDIAAQTRDALRRIEIALGQAGATLADVVRTRIYVTDISRWREVGEVHAQAFGKIRPVTSMVEVTALIAPGLLVEIEADAYV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Mycobacterium tuberculosis Rv2704 is a member of the YjgF/YER057c/UK114 family.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
total genus 32
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2009-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3i7tA00
1FNJA 1DBFA 1QAHA 1UI9A 2CHSA 3M1XA 4ZK7A 2IG8A 2OTMA 1XHOA 3K12A 3GTZA 3LYBA 3QUWA 1PF5A 3R0PA 2DYYA 2EWCA 3V4DA 3MQWA 3KJJA 2CSLA 3I3FA 3ZP7A 1COMA 1UFYA 3LMEA 5HP7A 2CWJA 2UYNA 5HP8A 1FNKA 1QD9A 2UYKA 2UYPA 1ODEA 4NWOB 2CHTA 1NQ3A 2B33A 3K0TA 3L7QA 2UYJA 3ZO8A 1QU9A 1JD1A 1ONIA 3D01A 3I7TA 3M4SA 1X25A 3ZOPA 3KJKA 3ZP4A 2CW4A 3VCZA 2UYNB 1J7HA 2CVLA 1XRGA
chains in the Genus database with same CATH superfamily
1IPAA 3S02A 2OTJF 3UT5B 1KNKA 1T0KB 2R751 4TV8A 5EO3A 3JARA 3CCJF 2HS4A 1Q82H 5HP7A 4X20B 1Z5VA 5EZYA 3HKDA 5J2TB 3CCSF 3U0OA 2B33A 4RQOA 3C9UA 5LP6C 1NJIH 3HTNA 5EWRA 4BT6A 5LA6B 4ZI7A 3KHNA 1SA0A 3JAWA 3JAKB 4E6EA 3NVKE 5MN4A 5GANK 3C9SA 3O85A 4O4IB 3GTZA 5EYPB 4DRXA 3LWOC 4WBNB 4O2BA 5EB1B 3CCVF 2Z1TA 1W5BA 4ZHVA 4BY9D 3HJWC 5HP8A 2ZVZA 5HY4A 5JCOC 3RYIA 4ZHWA 5IYZA 2N48A 5KX5A 4U3JB 3VYTC 2HS3A 3J81M 5JVDB 2KTUA 2CW4A 1W55A 3VCZA 1NMUB 1RA4A 1VQPF 3D54A 1JFFA 2HVYD 1CN7A 3ELCA 4ZHQA 1VQLF 3LFOA 3LDTA 2LBWA 1W5AA 1H47A 3J7AR 2IAFA 3FD6A 3NMUC 2ZF8A 3IKEA 3QTYA 5HY1A 4BT7A 1YHQF 4TUYA 4BVRA 5IJ0A 5J2UB 1W42A 3TD3A 4IIJB 3JASA 4NWOB 3WGKA 1U3PA 4NUTA 3RYFA 1JD1A 4BT2A 4O4LA 4X1IB 1VQ9F 5GONB 5HY0A 5LOVA 2KGWA 3MBMA 4C82A 2QA4F 3LWRC 3CC2F 1CLIA 3MCAB 1W41A 1XV2A 3HKCA 4ZOLA 2BTQB 1X52A 3EORA 4TZZA 4YJ2B 1QVGF 3C8LA 2UYPA 5G4VC 3UT5A 5EAZA 3CXCF 4YJ3B 3CYQA 5LP6A 1KD1H 4U39A 4B62A 3IKFA 3M4SA 5IT9M 3CMAF 1VQVA 1W57A 2OHWA 4EB6B 1KC8H 5J2TA 4ZK7A 3M1XA 4X1YB 1VK3A 2H6LA 4I55B 2BTOA 1PF5A 3NK7A 4F6RB 3N4ZA 3KJJA 3S0HA 5JH7A 2ALEA 3WGLA 4C81A 5HWEA 3LMEA 1CK2A 3F0DA 4BT5A 5LA6A 3KE1A 2UYKA 4BVSA 3V7EA 2GZLA 1ODEA 2RHOA 2CHTA 3F0FA 3JAKA 1YJ9F 3LWPC 1W581 4O4IA 3RA5A 3RYHA 5EYPA 3CD6F 4LNUB 3AGKA 2ZAUA 1J7HA 4TV9B 5A2QM 3JVHA 1DBFA 3FPIA 3M84A 1KNJA 1U3LA 2HX0A 1VHAA 2K1SA 5LYJB 3JALB 5FNVA 3FBAA 5JVDA 2MQEA 3G6EF 1W2BF 4LCKA 2L26A 3CYPB 3IMPA 1VQNF 1NQ3A 3V7QA 3D01A 1IV4A 4B45A 3CCQF 3WGMA 4BW0B 3OBWA 1ZWZA 3IEQA 3VOBA 2V9YA 1VQ4F 3I55F 4IIJA 1U43A 1TVKB 1SDSA 3N2KA 3R0PA 2QTPA 3JATA 4X1IA 1IV3A 4B5CA 5KMGB 3TD4A 4B46A 1X7PA 3J80M 3GHZA 4O2AB 3F0GA 2H8EA 2LBXA 3E1YA 4O4JB 4G4WA 5ITZB 5GIOC 1N8RH 4YJ2A 1W5FA 4HNAA 4I50B 3NK6A 2AIFA 4YJ3A 3CCLF 2VGMA 5C8YB 2CWJA 5GINC 5JQGB 2HS0A 5DCVA 2RHHA 3B6NA 3PAFA 5CA0A 4I4TA 3RE3A 1ONIA 5FJ4C 1TUBA 2UYNB 1VQKF 3HKDB 2IQQA 3NVIB 1FNJA 5GIPC 1QAHA 2RHLA 3QHDA 1VQ5F 3K12A 3VOAA 1FFXB 4LNUA 2ZVYA 3HKEB 1SA0B 2HRYA 4X3LA 3FD5A 1K73H 1Q86H 1QD9A 4TV9A 3S0WA 1X7OA 2GLZA 3ON1A 4BT3A 4DRXB 1Q7YH 1IV2A 5BMVB 2Q1YA 3DDNA 3LWQC 2VAPA 5LYJA 2BTUA 5LXTB 3FFMA 3CMEF 1K8AH 3G71F 2CVLA 1H7MA 4X20A 4O4HB 3MDOA 2LCAA 2FC3A 5IYZB 5KX5B 2IG8A 1YGYA 1Z5WA 2YYEA 2DYYA 3SIUA 3CPWF 1COMA 1RQ7A 3ESJA 3P0ZA 4G4XA 4EI9A 3P4EA 4ZHQB 1VQMF 1E7KA 1OFUA 3S03A 4G4VA 3WJPA 2I6RA 2BO1A 4G4ZA 3K0TA 3VYUC 1TVKA 2KTVA 4DXDA 2F9ZC 4TUYB 4WBNA 3K2XA 1S72F 5IJ0B 1RLGA 1SZQA 5IJ9B 4C8GA 2FGYA 5GAPK 5CA1B 5KMGA 3JASB 2PMPA 2DT4A 1IV1A 1RLUA 1Q8RA 4C4WC 3E20B 2HP3A 4U3JA 3ZP7A 5ITZA 1OAPA 1PXWA 5LOVB 2AMTA 2ZODA 1K9MH 2HP0B 3BYQA 4ZOLB 4BT4A 3E22B 3I7TA 2KG4A 3RYCB 5B8FA 3PLAC 3HKBB 3MCQA 4FFBB 5JQGA 4X3MA 3CG6A 5J2UA 4IHJB 3WGJA 1UI9A 4ERHA 5LP6B 1YQNA 2OTMA 3V4DA 1H48A 3MQWA 1JJ2F 3I3FA 2Z01A 2CZWA 2HRUA 2PHNA 4X1KB 2UYNA 4G4YA 4C8EA 4EI8A 5GONA 2RHJA 1YJNF 5G4UC 1Q81H 2VXYA 3D00A 3WJQA 2Z1UA 3F0EA 3IEWA 3P10A 3S06A 1KQSF 5JH7B 1FFXA 3ZOPA 3ZP4A 3VYSC 3HKEA 4M8IA 1VQ6F 5CB4B 2HQSC 1VQOF 3C9TA 1X25A 3OONA 5EB0A 3N2GB 3CPQA 3I56F 2Z1FA 4RHAA 2LBTA 1GX1A 3OBYA 3RYHB 1YJWF 3LYBA 5BMVA 3QUWA 2H8CA 2EWCA 3V3TA 2W8BC 1T0AA 5LXTA 2ZOVA 3S0YA 3CCEF 4EB6A 1FSZA 4O4HA 3HAXD 3VTIC 5MN5A 2UYJA 4TV8B 4X1YA 5FNVB 3WPWA 1QVFF 4I55A 3VMFB 1R1MA 3JARB 3Q8HA 2AIZP 3WJRA 4F6RA 3DC2A 4BVTA 4PWTA 5EZYB 2JNBA 3OW2F 4XCQA 1GO1A 1W59A 2OZBA 3HWUA 2GVIA 5HXZA 3VIUA 2P6YA 1W3EX 2CSLA 1JN1A 4ZI7B 3JCMM 5IJ9A 5CA1A 1W5EA 3JAWB 1VQ8F 3IR9A 3LWVC 3N2KB 1YITF 3VO8A 3CC7F 4O2BB 2UZHA 3CB2A 5HXUA 2Q1XA 1GO0A 3JATB 1VQ7F 3JALA 5HY2A 4G88A 4EI7A 3C9RA 2NMUA 3RYIB 2HP0A 4BVQA 4C8IA 1XHOA 3E22A 2VAWA 3CCMF 3F6MA 5FLXM 2QI2A 2RB9A 3RYCA 1UFYA 3HKBA 4FFBA 2YXZA 3VI6A 1JFFB 4HNAB 4ZHYB 3KIZA 4IHJA 3WPXA 5MN6A 1QU9A 3JAMM 1YI2F 1JY8A 4NQ3A 5EIBC 1YIJF 2I6DA 2OTLF 3KJKA 3T80A 3ERNA 4X1KA 2R6R1 3CCRF 1M1KH 1M90H 2QEXF 2WALA 5CA0B 1DT9A 3WXMB 4I4TB 3G4SF 3CCUF 3SIVA 2CHSA 4KWEA 3RYFB 4O2AA 5AVMA 1GZ0A 1RQ2A 1TUBB 3N4YA 5JCOA 4O4LB 3RA6A 3GYQA 5CB4A 4O4JA 2VGNA 1FNKA 2VAMA 3K14A 3N2GA 3HKCB 1VH8A 3L7QA 5EIBD 1XBIA 2G9IA 4I50A 2Z1EA 3ZO8A 3CC4F 1U40A 3TD5A 1W40A 5C8YA 4R40B 1XRGA 3WGNA
chains in the Genus database with same CATH topology
1FNJA 1DBFA 1QAHA 1UI9A 2CHSA 3M1XA 4ZK7A 2IG8A 2OTMA 1XHOA 3K12A 3GTZA 3LYBA 3QUWA 1PF5A 3R0PA 2DYYA 2EWCA 3V4DA 3MQWA 3KJJA 2CSLA 3I3FA 3ZP7A 1COMA 1UFYA 3LMEA 5HP7A 2CWJA 2UYNA 5HP8A 1FNKA 1QD9A 2UYKA 2UYPA 1ODEA 4NWOB 2CHTA 1NQ3A 2B33A 3K0TA 3L7QA 2UYJA 3ZO8A 1QU9A 1JD1A 1ONIA 3D01A 3I7TA 3M4SA 1X25A 3ZOPA 3KJKA 3ZP4A 2CW4A 3VCZA 2UYNB 1J7HA 2CVLA 1XRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FNJ A;  1DBF A;  1QAH A;  1UI9 A;  2CHS A;  3M1X A;  4ZK7 A;  2IG8 A;  2OTM A;  1XHO A;  3K12 A;  3GTZ A;  3LYB A;  3QUW A;  1PF5 A;  3R0P A;  2DYY A;  2EWC A;  3V4D A;  3MQW A;  3KJJ A;  2CSL A;  3I3F A;  3ZP7 A;  1COM A;  1UFY A;  3LME A;  5HP7 A;  2CWJ A;  2UYN A;  5HP8 A;  1FNK A;  1QD9 A;  2UYK A;  2UYP A;  1ODE A;  4NWO B;  2CHT A;  1NQ3 A;  2B33 A;  3K0T A;  3L7Q A;  2UYJ A;  3ZO8 A;  1QU9 A;  1JD1 A;  1ONI A;  3D01 A;  3I7T A;  3M4S A;  1X25 A;  3ZOP A;  3KJK A;  3ZP4 A;  2CW4 A;  3VCZ A;  2UYN B;  1J7H A;  2CVL A;  1XRG A; 
#chains in the Genus database with same CATH topology
 1IPA A;  3S02 A;  2OTJ F;  3UT5 B;  1KNK A;  1T0K B;  2R75 1;  4TV8 A;  5EO3 A;  3JAR A;  3CCJ F;  2HS4 A;  1Q82 H;  5HP7 A;  4X20 B;  1Z5V A;  5EZY A;  3HKD A;  5J2T B;  3CCS F;  3U0O A;  2B33 A;  4RQO A;  3C9U A;  5LP6 C;  1NJI H;  3HTN A;  5EWR A;  4BT6 A;  5LA6 B;  4ZI7 A;  3KHN A;  1SA0 A;  3JAW A;  3JAK B;  4E6E A;  3NVK E;  5MN4 A;  5GAN K;  3C9S A;  3O85 A;  4O4I B;  3GTZ A;  5EYP B;  4DRX A;  3LWO C;  4WBN B;  4O2B A;  5EB1 B;  3CCV F;  2Z1T A;  1W5B A;  4ZHV A;  4BY9 D;  3HJW C;  5HP8 A;  2ZVZ A;  5HY4 A;  5JCO C;  3RYI A;  4ZHW A;  5IYZ A;  2N48 A;  5KX5 A;  4U3J B;  3VYT C;  2HS3 A;  3J81 M;  5JVD B;  2KTU A;  2CW4 A;  1W55 A;  3VCZ A;  1NMU B;  1RA4 A;  1VQP F;  3D54 A;  1JFF A;  2HVY D;  1CN7 A;  3ELC A;  4ZHQ A;  1VQL F;  3LFO A;  3LDT A;  2LBW A;  1W5A A;  1H47 A;  3J7A R;  2IAF A;  3FD6 A;  3NMU C;  2ZF8 A;  3IKE A;  3QTY A;  5HY1 A;  4BT7 A;  1YHQ F;  4TUY A;  4BVR A;  5IJ0 A;  5J2U B;  1W42 A;  3TD3 A;  4IIJ B;  3JAS A;  4NWO B;  3WGK A;  1U3P A;  4NUT A;  3RYF A;  1JD1 A;  4BT2 A;  4O4L A;  4X1I B;  1VQ9 F;  5GON B;  5HY0 A;  5LOV A;  2KGW A;  3MBM A;  4C82 A;  2QA4 F;  3LWR C;  3CC2 F;  1CLI A;  3MCA B;  1W41 A;  1XV2 A;  3HKC A;  4ZOL A;  2BTQ B;  1X52 A;  3EOR A;  4TZZ A;  4YJ2 B;  1QVG F;  3C8L A;  2UYP A;  5G4V C;  3UT5 A;  5EAZ A;  3CXC F;  4YJ3 B;  3CYQ A;  5LP6 A;  1KD1 H;  4U39 A;  4B62 A;  3IKF A;  3M4S A;  5IT9 M;  3CMA F;  1VQV A;  1W57 A;  2OHW A;  4EB6 B;  1KC8 H;  5J2T A;  4ZK7 A;  3M1X A;  4X1Y B;  1VK3 A;  2H6L A;  4I55 B;  2BTO A;  1PF5 A;  3NK7 A;  4F6R B;  3N4Z A;  3KJJ A;  3S0H A;  5JH7 A;  2ALE A;  3WGL A;  4C81 A;  5HWE A;  3LME A;  1CK2 A;  3F0D A;  4BT5 A;  5LA6 A;  3KE1 A;  2UYK A;  4BVS A;  3V7E A;  2GZL A;  1ODE A;  2RHO A;  2CHT A;  3F0F A;  3JAK A;  1YJ9 F;  3LWP C;  1W58 1;  4O4I A;  3RA5 A;  3RYH A;  5EYP A;  3CD6 F;  4LNU B;  3AGK A;  2ZAU A;  1J7H A;  4TV9 B;  5A2Q M;  3JVH A;  1DBF A;  3FPI A;  3M84 A;  1KNJ A;  1U3L A;  2HX0 A;  1VHA A;  2K1S A;  5LYJ B;  3JAL B;  5FNV A;  3FBA A;  5JVD A;  2MQE A;  3G6E F;  1W2B F;  4LCK A;  2L26 A;  3CYP B;  3IMP A;  1VQN F;  1NQ3 A;  3V7Q A;  3D01 A;  1IV4 A;  4B45 A;  3CCQ F;  3WGM A;  4BW0 B;  3OBW A;  1ZWZ A;  3IEQ A;  3VOB A;  2V9Y A;  1VQ4 F;  3I55 F;  4IIJ A;  1U43 A;  1TVK B;  1SDS A;  3N2K A;  3R0P A;  2QTP A;  3JAT A;  4X1I A;  1IV3 A;  4B5C A;  5KMG B;  3TD4 A;  4B46 A;  1X7P A;  3J80 M;  3GHZ A;  4O2A B;  3F0G A;  2H8E A;  2LBX A;  3E1Y A;  4O4J B;  4G4W A;  5ITZ B;  5GIO C;  1N8R H;  4YJ2 A;  1W5F A;  4HNA A;  4I50 B;  3NK6 A;  2AIF A;  4YJ3 A;  3CCL F;  2VGM A;  5C8Y B;  2CWJ A;  5GIN C;  5JQG B;  2HS0 A;  5DCV A;  2RHH A;  3B6N A;  3PAF A;  5CA0 A;  4I4T A;  3RE3 A;  1ONI A;  5FJ4 C;  1TUB A;  2UYN B;  1VQK F;  3HKD B;  2IQQ A;  3NVI B;  1FNJ A;  5GIP C;  1QAH A;  2RHL A;  3QHD A;  1VQ5 F;  3K12 A;  3VOA A;  1FFX B;  4LNU A;  2ZVY A;  3HKE B;  1SA0 B;  2HRY A;  4X3L A;  3FD5 A;  1K73 H;  1Q86 H;  1QD9 A;  4TV9 A;  3S0W A;  1X7O A;  2GLZ A;  3ON1 A;  4BT3 A;  4DRX B;  1Q7Y H;  1IV2 A;  5BMV B;  2Q1Y A;  3DDN A;  3LWQ C;  2VAP A;  5LYJ A;  2BTU A;  5LXT B;  3FFM A;  3CME F;  1K8A H;  3G71 F;  2CVL A;  1H7M A;  4X20 A;  4O4H B;  3MDO A;  2LCA A;  2FC3 A;  5IYZ B;  5KX5 B;  2IG8 A;  1YGY A;  1Z5W A;  2YYE A;  2DYY A;  3SIU A;  3CPW F;  1COM A;  1RQ7 A;  3ESJ A;  3P0Z A;  4G4X A;  4EI9 A;  3P4E A;  4ZHQ B;  1VQM F;  1E7K A;  1OFU A;  3S03 A;  4G4V A;  3WJP A;  2I6R A;  2BO1 A;  4G4Z A;  3K0T A;  3VYU C;  1TVK A;  2KTV A;  4DXD A;  2F9Z C;  4TUY B;  4WBN A;  3K2X A;  1S72 F;  5IJ0 B;  1RLG A;  1SZQ A;  5IJ9 B;  4C8G A;  2FGY A;  5GAP K;  5CA1 B;  5KMG A;  3JAS B;  2PMP A;  2DT4 A;  1IV1 A;  1RLU A;  1Q8R A;  4C4W C;  3E20 B;  2HP3 A;  4U3J A;  3ZP7 A;  5ITZ A;  1OAP A;  1PXW A;  5LOV B;  2AMT A;  2ZOD A;  1K9M H;  2HP0 B;  3BYQ A;  4ZOL B;  4BT4 A;  3E22 B;  3I7T A;  2KG4 A;  3RYC B;  5B8F A;  3PLA C;  3HKB B;  3MCQ A;  4FFB B;  5JQG A;  4X3M A;  3CG6 A;  5J2U A;  4IHJ B;  3WGJ A;  1UI9 A;  4ERH A;  5LP6 B;  1YQN A;  2OTM A;  3V4D A;  1H48 A;  3MQW A;  1JJ2 F;  3I3F A;  2Z01 A;  2CZW A;  2HRU A;  2PHN A;  4X1K B;  2UYN A;  4G4Y A;  4C8E A;  4EI8 A;  5GON A;  2RHJ A;  1YJN F;  5G4U C;  1Q81 H;  2VXY A;  3D00 A;  3WJQ A;  2Z1U A;  3F0E A;  3IEW A;  3P10 A;  3S06 A;  1KQS F;  5JH7 B;  1FFX A;  3ZOP A;  3ZP4 A;  3VYS C;  3HKE A;  4M8I A;  1VQ6 F;  5CB4 B;  2HQS C;  1VQO F;  3C9T A;  1X25 A;  3OON A;  5EB0 A;  3N2G B;  3CPQ A;  3I56 F;  2Z1F A;  4RHA A;  2LBT A;  1GX1 A;  3OBY A;  3RYH B;  1YJW F;  3LYB A;  5BMV A;  3QUW A;  2H8C A;  2EWC A;  3V3T A;  2W8B C;  1T0A A;  5LXT A;  2ZOV A;  3S0Y A;  3CCE F;  4EB6 A;  1FSZ A;  4O4H A;  3HAX D;  3VTI C;  5MN5 A;  2UYJ A;  4TV8 B;  4X1Y A;  5FNV B;  3WPW A;  1QVF F;  4I55 A;  3VMF B;  1R1M A;  3JAR B;  3Q8H A;  2AIZ P;  3WJR A;  4F6R A;  3DC2 A;  4BVT A;  4PWT A;  5EZY B;  2JNB A;  3OW2 F;  4XCQ A;  1GO1 A;  1W59 A;  2OZB A;  3HWU A;  2GVI A;  5HXZ A;  3VIU A;  2P6Y A;  1W3E X;  2CSL A;  1JN1 A;  4ZI7 B;  3JCM M;  5IJ9 A;  5CA1 A;  1W5E A;  3JAW B;  1VQ8 F;  3IR9 A;  3LWV C;  3N2K B;  1YIT F;  3VO8 A;  3CC7 F;  4O2B B;  2UZH A;  3CB2 A;  5HXU A;  2Q1X A;  1GO0 A;  3JAT B;  1VQ7 F;  3JAL A;  5HY2 A;  4G88 A;  4EI7 A;  3C9R A;  2NMU A;  3RYI B;  2HP0 A;  4BVQ A;  4C8I A;  1XHO A;  3E22 A;  2VAW A;  3CCM F;  3F6M A;  5FLX M;  2QI2 A;  2RB9 A;  3RYC A;  1UFY A;  3HKB A;  4FFB A;  2YXZ A;  3VI6 A;  1JFF B;  4HNA B;  4ZHY B;  3KIZ A;  4IHJ A;  3WPX A;  5MN6 A;  1QU9 A;  3JAM M;  1YI2 F;  1JY8 A;  4NQ3 A;  5EIB C;  1YIJ F;  2I6D A;  2OTL F;  3KJK A;  3T80 A;  3ERN A;  4X1K A;  2R6R 1;  3CCR F;  1M1K H;  1M90 H;  2QEX F;  2WAL A;  5CA0 B;  1DT9 A;  3WXM B;  4I4T B;  3G4S F;  3CCU F;  3SIV A;  2CHS A;  4KWE A;  3RYF B;  4O2A A;  5AVM A;  1GZ0 A;  1RQ2 A;  1TUB B;  3N4Y A;  5JCO A;  4O4L B;  3RA6 A;  3GYQ A;  5CB4 A;  4O4J A;  2VGN A;  1FNK A;  2VAM A;  3K14 A;  3N2G A;  3HKC B;  1VH8 A;  3L7Q A;  5EIB D;  1XBI A;  2G9I A;  4I50 A;  2Z1E A;  3ZO8 A;  3CC4 F;  1U40 A;  3TD5 A;  1W40 A;  5C8Y A;  4R40 B;  1XRG A;  3WGN A; 
#chains in the Genus database with same CATH homology
 1FNJ A;  1DBF A;  1QAH A;  1UI9 A;  2CHS A;  3M1X A;  4ZK7 A;  2IG8 A;  2OTM A;  1XHO A;  3K12 A;  3GTZ A;  3LYB A;  3QUW A;  1PF5 A;  3R0P A;  2DYY A;  2EWC A;  3V4D A;  3MQW A;  3KJJ A;  2CSL A;  3I3F A;  3ZP7 A;  1COM A;  1UFY A;  3LME A;  5HP7 A;  2CWJ A;  2UYN A;  5HP8 A;  1FNK A;  1QD9 A;  2UYK A;  2UYP A;  1ODE A;  4NWO B;  2CHT A;  1NQ3 A;  2B33 A;  3K0T A;  3L7Q A;  2UYJ A;  3ZO8 A;  1QU9 A;  1JD1 A;  1ONI A;  3D01 A;  3I7T A;  3M4S A;  1X25 A;  3ZOP A;  3KJK A;  3ZP4 A;  2CW4 A;  3VCZ A;  2UYN B;  1J7H A;  2CVL A;  1XRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...