3I7UA

Crystal structure of ap4a hydrolase (aq_158) from aquifex aeolicus vf5
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
133
structure length
133
Chain Sequence
MKKEFSAGGVLFKDGEVLLIKTPSNVWSFPKGNIEPGEKPEETAVREVWEETGVKGEILDYIGEIHYWYTLKGERIFKTVKYYLMKYKEGEPRPSWEVKDAKFFPIKEAKKLLKYKGDKEIFEKALKLKEKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AP4A hydrolase
publication title Free and ATP-bound structures of Ap(4)A hydrolase from Aquifex aeolicus V5
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase
total genus 34
structure length 133
sequence length 133
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3i7uA01
1VK6A 3FSPA 1GA7A 2ICKA 4NFWA 1G9QA 1KT9A 3X0RA 5LPGA 2B2KA 1HX3A 3EXQA 3O8SA 2R5WA 1SJYA 3X0NA 4ICKA 3FJYA 3X0IA 2O1CA 2FKBA 1K2EA 4N1TA 5DEQA 5GHIA 3CNGA 4C9XA 5ISYA 1PVFA 4KYXA 2YVNA 3P5TA 4S2WA 3X0PA 3ID9A 2XSQA 3O52A 2KDWA 5FSKA 1RYAA 1X51A 3GZ6A 4KG4A 2DSBA 1JKNA 3MDGA 1MUTA 3DUPA 1PUQA 3GG6A 2FVVA 4N1UA 3O61A 2DHOA 1VC9A 3O6ZA 2DSCA 4JZSA 4S2VA 5C7QA 5IW5A 4JZTA 3U53A 5C7TA 3MDIA 4K6EA 4C9WA 1KTGA 2A8SA 4V14A 5DPKA 2A8PA 5BS6A 3E57A 1NQZA 3A6TA 2I6KA 2B06A 3X0QA 2FMLA 3BM4A 3Q2TA 2I8TA 1R67A 1VIUA 2G73A 2QJTA 2KDVA 3GZ8A 2AZWA 1PPVA 3ACAA 1JRKA 1RRSA 3A6SA 2A8QA 1VHGA 2I8UA 3R03A 3EESA 1IRYA 5IW4A 1X84A 4YPRA 5DD4A 2W4EA 4YPHA 5GHJA 5FSNA 3BAPA 3I7UA 3Q4IA 2A8TA 3P6YA 5FSOA 3X0SA 2GB5A 1XSAA 1QVJA 1Q27A 3MCFA 3Q93A 4IJXA 2YVOA 5GHNA 1U20A 3X0OA 1NFZA 2GT2A 3RH7A 1MK1A 1V8VA 5FSMA 5ANTA 1VRLA 2JVBA 2QJOA 3DKUA 3OGAA 3ZR1A 2O5WA 2VNPA 1TUMA 1SZ3A 3EF5A 2O5FA 1HZTA 1V8MA 2J8QA 1K26A 1XSCA 3N9UA 2DUKA 3L85A 5FSIA 3COUA 3N77A 5CFIA 3GWYA 3AC9A 4KTBA 4S2YA 3J7Ye 3G0QA 3F6AA 3SMDA 1RRQA 3X0KA 2GT4A 2VNQA 5ANSA 5ANWA 1G0SA 1X83A 1V8NA 1PPWA 1MQEA 3HHJA 1V8SA 1NFSA 1V8IA 1XSBA 3FFUA 3Q1PA 3A6VA 3SHDA 1PPXA 3EEUA 5BONA 2RRKA 1MR2A 2A8RA 3WHWA 1OW2A 1VIQA 1V8YA 1KHZA 1V8UA 4NFXA 3SONA 4S2XA 3QSJA 3BHOA 1SOIA 2PQVA 1MP2A 1I9AA 1V8LA 3KVHA 2G74A 3Q2SA 1VC8A 4MPOA 5ANUA 2DSDA 1NQYA 4ILQA 2CL3A 4KG3A 5I8UA 1VCDA 3GRNA 5C8LA 3X0JA 1F3YA 3ZR0A 1MQWA 5GHOA 4HFQA 1V8TA 5ANVA 3I9XA 4JZVA 3X0LA 3O69A 4YOQA 1V8WA 1V8RA 3FK9A 3Q91A 5DDGA 5HZXA 4JZUA 3FCMA 2ICJA 3X0MA 5CFJA 2YVPA 1Q54A 1Q33A 1PUSA 1SU2A 3H95A 1VHZA 2YVMA 3F13A 5GHQA 4HVYA 3I7VA 2A6TA 2PNYA 2QKMB 5FSLA 4DYWA 5GHMA 2B0VA 4ZG0A 3MGMA 3GZ5A 2Q9PA 3A6UA 1PUNA 2YYHA 3HYQA 5GHPA
chains in the Genus database with same CATH superfamily
1VK6A 3FSPA 1GA7A 2ICKA 4NFWA 1G9QA 1KT9A 3X0RA 5LPGA 2B2KA 1HX3A 3EXQA 3O8SA 2R5WA 1SJYA 3X0NA 4ICKA 3FJYA 3X0IA 2O1CA 2FKBA 1K2EA 4N1TA 5DEQA 5GHIA 3CNGA 4C9XA 5ISYA 1PVFA 4KYXA 2YVNA 3P5TA 4S2WA 3X0PA 3ID9A 2XSQA 3O52A 2KDWA 5FSKA 1RYAA 1X51A 3GZ6A 4KG4A 2DSBA 1JKNA 3MDGA 1MUTA 3DUPA 1PUQA 3GG6A 2FVVA 4N1UA 3O61A 2DHOA 1VC9A 3O6ZA 2DSCA 4JZSA 4S2VA 5C7QA 5IW5A 4JZTA 3U53A 5C7TA 3MDIA 4K6EA 4C9WA 1KTGA 2A8SA 4V14A 5DPKA 2A8PA 5BS6A 3E57A 1NQZA 3A6TA 2I6KA 2B06A 3X0QA 2FMLA 3BM4A 3Q2TA 2I8TA 1R67A 1VIUA 2G73A 2QJTA 2KDVA 3GZ8A 2AZWA 1PPVA 3ACAA 1JRKA 1RRSA 3A6SA 2A8QA 1VHGA 2I8UA 3R03A 3EESA 1IRYA 5IW4A 1X84A 4YPRA 5DD4A 2W4EA 4YPHA 5GHJA 5FSNA 3BAPA 3I7UA 3Q4IA 2A8TA 3P6YA 5FSOA 3X0SA 2GB5A 1XSAA 1QVJA 1Q27A 3MCFA 3Q93A 4IJXA 2YVOA 5GHNA 1U20A 3X0OA 1NFZA 2GT2A 3RH7A 1MK1A 1V8VA 5FSMA 5ANTA 1VRLA 2JVBA 2QJOA 3DKUA 3OGAA 3ZR1A 2O5WA 2VNPA 1TUMA 1SZ3A 3EF5A 2O5FA 1HZTA 1V8MA 2J8QA 1K26A 1XSCA 3N9UA 2DUKA 3L85A 5FSIA 3COUA 3N77A 5CFIA 3GWYA 3AC9A 4KTBA 4S2YA 3J7Ye 3G0QA 3F6AA 3SMDA 1RRQA 3X0KA 2GT4A 2VNQA 5ANSA 5ANWA 1G0SA 1X83A 1V8NA 1PPWA 1MQEA 3HHJA 1V8SA 1NFSA 1V8IA 1XSBA 3FFUA 3Q1PA 3A6VA 3SHDA 1PPXA 3EEUA 5BONA 2RRKA 1MR2A 2A8RA 3WHWA 1OW2A 1VIQA 1V8YA 1KHZA 1V8UA 4NFXA 3SONA 4S2XA 4J7GA 3QSJA 3BHOA 1SOIA 2PQVA 1MP2A 1I9AA 1V8LA 3KVHA 2G74A 3Q2SA 1VC8A 4MPOA 5ANUA 2DSDA 1NQYA 4ILQA 2CL3A 4J7HA 4KG3A 5I8UA 1VCDA 3GRNA 5C8LA 3X0JA 1F3YA 3ZR0A 1MQWA 5GHOA 4HFQA 1V8TA 5ANVA 3I9XA 4JZVA 3X0LA 3O69A 4YOQA 1V8WA 1V8RA 3FK9A 3Q91A 5DDGA 5HZXA 4JZUA 3FCMA 2ICJA 3X0MA 5CFJA 2YVPA 1Q54A 1Q33A 1PUSA 1SU2A 3H95A 1VHZA 2YVMA 3F13A 5GHQA 2CZRA 4HVYA 3I7VA 2A6TA 2PNYA 2QKMB 5FSLA 4DYWA 5GHMA 2B0VA 4ZG0A 3MGMA 3GZ5A 2Q9PA 3A6UA 1PUNA 2YYHA 3HYQA 5GHPA
chains in the Genus database with same CATH topology
1VK6A 3FSPA 1GA7A 2ICKA 4NFWA 1G9QA 1KT9A 3X0RA 5LPGA 2B2KA 1HX3A 3EXQA 3O8SA 2R5WA 1SJYA 3X0NA 4ICKA 3FJYA 3X0IA 2O1CA 2FKBA 1K2EA 4N1TA 5DEQA 5GHIA 3CNGA 4C9XA 5ISYA 1PVFA 4KYXA 2YVNA 3P5TA 4S2WA 3X0PA 3ID9A 2XSQA 3O52A 2KDWA 5FSKA 1RYAA 1X51A 3GZ6A 4KG4A 2DSBA 1JKNA 3MDGA 1MUTA 3DUPA 1PUQA 3GG6A 2FVVA 4N1UA 3O61A 2DHOA 1VC9A 3O6ZA 2DSCA 4JZSA 4S2VA 5C7QA 5IW5A 4JZTA 3U53A 5C7TA 3MDIA 4K6EA 4C9WA 1KTGA 2A8SA 4V14A 5DPKA 2A8PA 5BS6A 3E57A 1NQZA 3A6TA 2I6KA 2B06A 3X0QA 2FMLA 3BM4A 3Q2TA 2I8TA 1R67A 1VIUA 2G73A 2QJTA 2KDVA 3GZ8A 2AZWA 1PPVA 3ACAA 1JRKA 1RRSA 3A6SA 2A8QA 1VHGA 2I8UA 3R03A 3EESA 1IRYA 5IW4A 1X84A 4YPRA 5DD4A 2W4EA 4YPHA 5GHJA 5FSNA 3BAPA 3I7UA 3Q4IA 2A8TA 3P6YA 5FSOA 3X0SA 2GB5A 1XSAA 1QVJA 1Q27A 3MCFA 3Q93A 4IJXA 2YVOA 5GHNA 1U20A 3X0OA 1NFZA 2GT2A 3RH7A 1MK1A 1V8VA 5FSMA 5ANTA 1VRLA 2JVBA 2QJOA 3DKUA 3OGAA 3ZR1A 2O5WA 2VNPA 1TUMA 1SZ3A 3EF5A 2O5FA 1HZTA 1V8MA 2J8QA 1K26A 1XSCA 3N9UA 2DUKA 3L85A 5FSIA 3COUA 3N77A 5CFIA 3GWYA 3AC9A 4KTBA 4S2YA 3J7Ye 3G0QA 3F6AA 3SMDA 1RRQA 3X0KA 2GT4A 2VNQA 5ANSA 5ANWA 1G0SA 1X83A 1V8NA 1PPWA 1MQEA 3HHJA 1V8SA 1NFSA 1V8IA 1XSBA 3FFUA 3Q1PA 3A6VA 3SHDA 1PPXA 3EEUA 5BONA 2RRKA 1MR2A 2A8RA 3WHWA 1OW2A 1VIQA 1V8YA 1KHZA 1V8UA 4NFXA 3SONA 4S2XA 4J7GA 3QSJA 3BHOA 1SOIA 2PQVA 1MP2A 1I9AA 1V8LA 3KVHA 2G74A 3Q2SA 1VC8A 4MPOA 5ANUA 2DSDA 1NQYA 4ILQA 2CL3A 4J7HA 4KG3A 5I8UA 1VCDA 3GRNA 5C8LA 3X0JA 1F3YA 3ZR0A 1MQWA 5GHOA 4HFQA 1V8TA 5ANVA 3I9XA 4JZVA 3X0LA 3O69A 4YOQA 1V8WA 1V8RA 3FK9A 3Q91A 5DDGA 5HZXA 4JZUA 3FCMA 2ICJA 3X0MA 5CFJA 2YVPA 1Q54A 1Q33A 1PUSA 1SU2A 3H95A 1VHZA 2YVMA 3F13A 5GHQA 2CZRA 4HVYA 3I7VA 2A6TA 2PNYA 2QKMB 5FSLA 4DYWA 5GHMA 2B0VA 4ZG0A 3MGMA 3GZ5A 2Q9PA 3A6UA 1PUNA 2YYHA 3HYQA 5GHPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VK6 A;  3FSP A;  1GA7 A;  2ICK A;  4NFW A;  1G9Q A;  1KT9 A;  3X0R A;  5LPG A;  2B2K A;  1HX3 A;  3EXQ A;  3O8S A;  2R5W A;  1SJY A;  3X0N A;  4ICK A;  3FJY A;  3X0I A;  2O1C A;  2FKB A;  1K2E A;  4N1T A;  5DEQ A;  5GHI A;  3CNG A;  4C9X A;  5ISY A;  1PVF A;  4KYX A;  2YVN A;  3P5T A;  4S2W A;  3X0P A;  3ID9 A;  2XSQ A;  3O52 A;  2KDW A;  5FSK A;  1RYA A;  1X51 A;  3GZ6 A;  4KG4 A;  2DSB A;  1JKN A;  3MDG A;  1MUT A;  3DUP A;  1PUQ A;  3GG6 A;  2FVV A;  4N1U A;  3O61 A;  2DHO A;  1VC9 A;  3O6Z A;  2DSC A;  4JZS A;  4S2V A;  5C7Q A;  5IW5 A;  4JZT A;  3U53 A;  5C7T A;  3MDI A;  4K6E A;  4C9W A;  1KTG A;  2A8S A;  4V14 A;  5DPK A;  2A8P A;  5BS6 A;  3E57 A;  1NQZ A;  3A6T A;  2I6K A;  2B06 A;  3X0Q A;  2FML A;  3BM4 A;  3Q2T A;  2I8T A;  1R67 A;  1VIU A;  2G73 A;  2QJT A;  2KDV A;  3GZ8 A;  2AZW A;  1PPV A;  3ACA A;  1JRK A;  1RRS A;  3A6S A;  2A8Q A;  1VHG A;  2I8U A;  3R03 A;  3EES A;  1IRY A;  5IW4 A;  1X84 A;  4YPR A;  5DD4 A;  2W4E A;  4YPH A;  5GHJ A;  5FSN A;  3BAP A;  3I7U A;  3Q4I A;  2A8T A;  3P6Y A;  5FSO A;  3X0S A;  2GB5 A;  1XSA A;  1QVJ A;  1Q27 A;  3MCF A;  3Q93 A;  4IJX A;  2YVO A;  5GHN A;  1U20 A;  3X0O A;  1NFZ A;  2GT2 A;  3RH7 A;  1MK1 A;  1V8V A;  5FSM A;  5ANT A;  1VRL A;  2JVB A;  2QJO A;  3DKU A;  3OGA A;  3ZR1 A;  2O5W A;  2VNP A;  1TUM A;  1SZ3 A;  3EF5 A;  2O5F A;  1HZT A;  1V8M A;  2J8Q A;  1K26 A;  1XSC A;  3N9U A;  2DUK A;  3L85 A;  5FSI A;  3COU A;  3N77 A;  5CFI A;  3GWY A;  3AC9 A;  4KTB A;  4S2Y A;  3J7Y e;  3G0Q A;  3F6A A;  3SMD A;  1RRQ A;  3X0K A;  2GT4 A;  2VNQ A;  5ANS A;  5ANW A;  1G0S A;  1X83 A;  1V8N A;  1PPW A;  1MQE A;  3HHJ A;  1V8S A;  1NFS A;  1V8I A;  1XSB A;  3FFU A;  3Q1P A;  3A6V A;  3SHD A;  1PPX A;  3EEU A;  5BON A;  2RRK A;  1MR2 A;  2A8R A;  3WHW A;  1OW2 A;  1VIQ A;  1V8Y A;  1KHZ A;  1V8U A;  4NFX A;  3SON A;  4S2X A;  3QSJ A;  3BHO A;  1SOI A;  2PQV A;  1MP2 A;  1I9A A;  1V8L A;  3KVH A;  2G74 A;  3Q2S A;  1VC8 A;  4MPO A;  5ANU A;  2DSD A;  1NQY A;  4ILQ A;  2CL3 A;  4KG3 A;  5I8U A;  1VCD A;  3GRN A;  5C8L A;  3X0J A;  1F3Y A;  3ZR0 A;  1MQW A;  5GHO A;  4HFQ A;  1V8T A;  5ANV A;  3I9X A;  4JZV A;  3X0L A;  3O69 A;  4YOQ A;  1V8W A;  1V8R A;  3FK9 A;  3Q91 A;  5DDG A;  5HZX A;  4JZU A;  3FCM A;  2ICJ A;  3X0M A;  5CFJ A;  2YVP A;  1Q54 A;  1Q33 A;  1PUS A;  1SU2 A;  3H95 A;  1VHZ A;  2YVM A;  3F13 A;  5GHQ A;  4HVY A;  3I7V A;  2A6T A;  2PNY A;  2QKM B;  5FSL A;  4DYW A;  5GHM A;  2B0V A;  4ZG0 A;  3MGM A;  3GZ5 A;  2Q9P A;  3A6U A;  1PUN A;  2YYH A;  3HYQ A;  5GHP A; 
#chains in the Genus database with same CATH topology
 1VK6 A;  3FSP A;  1GA7 A;  2ICK A;  4NFW A;  1G9Q A;  1KT9 A;  3X0R A;  5LPG A;  2B2K A;  1HX3 A;  3EXQ A;  3O8S A;  2R5W A;  1SJY A;  3X0N A;  4ICK A;  3FJY A;  3X0I A;  2O1C A;  2FKB A;  1K2E A;  4N1T A;  5DEQ A;  5GHI A;  3CNG A;  4C9X A;  5ISY A;  1PVF A;  4KYX A;  2YVN A;  3P5T A;  4S2W A;  3X0P A;  3ID9 A;  2XSQ A;  3O52 A;  2KDW A;  5FSK A;  1RYA A;  1X51 A;  3GZ6 A;  4KG4 A;  2DSB A;  1JKN A;  3MDG A;  1MUT A;  3DUP A;  1PUQ A;  3GG6 A;  2FVV A;  4N1U A;  3O61 A;  2DHO A;  1VC9 A;  3O6Z A;  2DSC A;  4JZS A;  4S2V A;  5C7Q A;  5IW5 A;  4JZT A;  3U53 A;  5C7T A;  3MDI A;  4K6E A;  4C9W A;  1KTG A;  2A8S A;  4V14 A;  5DPK A;  2A8P A;  5BS6 A;  3E57 A;  1NQZ A;  3A6T A;  2I6K A;  2B06 A;  3X0Q A;  2FML A;  3BM4 A;  3Q2T A;  2I8T A;  1R67 A;  1VIU A;  2G73 A;  2QJT A;  2KDV A;  3GZ8 A;  2AZW A;  1PPV A;  3ACA A;  1JRK A;  1RRS A;  3A6S A;  2A8Q A;  1VHG A;  2I8U A;  3R03 A;  3EES A;  1IRY A;  5IW4 A;  1X84 A;  4YPR A;  5DD4 A;  2W4E A;  4YPH A;  5GHJ A;  5FSN A;  3BAP A;  3I7U A;  3Q4I A;  2A8T A;  3P6Y A;  5FSO A;  3X0S A;  2GB5 A;  1XSA A;  1QVJ A;  1Q27 A;  3MCF A;  3Q93 A;  4IJX A;  2YVO A;  5GHN A;  1U20 A;  3X0O A;  1NFZ A;  2GT2 A;  3RH7 A;  1MK1 A;  1V8V A;  5FSM A;  5ANT A;  1VRL A;  2JVB A;  2QJO A;  3DKU A;  3OGA A;  3ZR1 A;  2O5W A;  2VNP A;  1TUM A;  1SZ3 A;  3EF5 A;  2O5F A;  1HZT A;  1V8M A;  2J8Q A;  1K26 A;  1XSC A;  3N9U A;  2DUK A;  3L85 A;  5FSI A;  3COU A;  3N77 A;  5CFI A;  3GWY A;  3AC9 A;  4KTB A;  4S2Y A;  3J7Y e;  3G0Q A;  3F6A A;  3SMD A;  1RRQ A;  3X0K A;  2GT4 A;  2VNQ A;  5ANS A;  5ANW A;  1G0S A;  1X83 A;  1V8N A;  1PPW A;  1MQE A;  3HHJ A;  1V8S A;  1NFS A;  1V8I A;  1XSB A;  3FFU A;  3Q1P A;  3A6V A;  3SHD A;  1PPX A;  3EEU A;  5BON A;  2RRK A;  1MR2 A;  2A8R A;  3WHW A;  1OW2 A;  1VIQ A;  1V8Y A;  1KHZ A;  1V8U A;  4NFX A;  3SON A;  4S2X A;  4J7G A;  3QSJ A;  3BHO A;  1SOI A;  2PQV A;  1MP2 A;  1I9A A;  1V8L A;  3KVH A;  2G74 A;  3Q2S A;  1VC8 A;  4MPO A;  5ANU A;  2DSD A;  1NQY A;  4ILQ A;  2CL3 A;  4J7H A;  4KG3 A;  5I8U A;  1VCD A;  3GRN A;  5C8L A;  3X0J A;  1F3Y A;  3ZR0 A;  1MQW A;  5GHO A;  4HFQ A;  1V8T A;  5ANV A;  3I9X A;  4JZV A;  3X0L A;  3O69 A;  4YOQ A;  1V8W A;  1V8R A;  3FK9 A;  3Q91 A;  5DDG A;  5HZX A;  4JZU A;  3FCM A;  2ICJ A;  3X0M A;  5CFJ A;  2YVP A;  1Q54 A;  1Q33 A;  1PUS A;  1SU2 A;  3H95 A;  1VHZ A;  2YVM A;  3F13 A;  5GHQ A;  2CZR A;  4HVY A;  3I7V A;  2A6T A;  2PNY A;  2QKM B;  5FSL A;  4DYW A;  5GHM A;  2B0V A;  4ZG0 A;  3MGM A;  3GZ5 A;  2Q9P A;  3A6U A;  1PUN A;  2YYH A;  3HYQ A;  5GHP A; 
#chains in the Genus database with same CATH homology
 1VK6 A;  3FSP A;  1GA7 A;  2ICK A;  4NFW A;  1G9Q A;  1KT9 A;  3X0R A;  5LPG A;  2B2K A;  1HX3 A;  3EXQ A;  3O8S A;  2R5W A;  1SJY A;  3X0N A;  4ICK A;  3FJY A;  3X0I A;  2O1C A;  2FKB A;  1K2E A;  4N1T A;  5DEQ A;  5GHI A;  3CNG A;  4C9X A;  5ISY A;  1PVF A;  4KYX A;  2YVN A;  3P5T A;  4S2W A;  3X0P A;  3ID9 A;  2XSQ A;  3O52 A;  2KDW A;  5FSK A;  1RYA A;  1X51 A;  3GZ6 A;  4KG4 A;  2DSB A;  1JKN A;  3MDG A;  1MUT A;  3DUP A;  1PUQ A;  3GG6 A;  2FVV A;  4N1U A;  3O61 A;  2DHO A;  1VC9 A;  3O6Z A;  2DSC A;  4JZS A;  4S2V A;  5C7Q A;  5IW5 A;  4JZT A;  3U53 A;  5C7T A;  3MDI A;  4K6E A;  4C9W A;  1KTG A;  2A8S A;  4V14 A;  5DPK A;  2A8P A;  5BS6 A;  3E57 A;  1NQZ A;  3A6T A;  2I6K A;  2B06 A;  3X0Q A;  2FML A;  3BM4 A;  3Q2T A;  2I8T A;  1R67 A;  1VIU A;  2G73 A;  2QJT A;  2KDV A;  3GZ8 A;  2AZW A;  1PPV A;  3ACA A;  1JRK A;  1RRS A;  3A6S A;  2A8Q A;  1VHG A;  2I8U A;  3R03 A;  3EES A;  1IRY A;  5IW4 A;  1X84 A;  4YPR A;  5DD4 A;  2W4E A;  4YPH A;  5GHJ A;  5FSN A;  3BAP A;  3I7U A;  3Q4I A;  2A8T A;  3P6Y A;  5FSO A;  3X0S A;  2GB5 A;  1XSA A;  1QVJ A;  1Q27 A;  3MCF A;  3Q93 A;  4IJX A;  2YVO A;  5GHN A;  1U20 A;  3X0O A;  1NFZ A;  2GT2 A;  3RH7 A;  1MK1 A;  1V8V A;  5FSM A;  5ANT A;  1VRL A;  2JVB A;  2QJO A;  3DKU A;  3OGA A;  3ZR1 A;  2O5W A;  2VNP A;  1TUM A;  1SZ3 A;  3EF5 A;  2O5F A;  1HZT A;  1V8M A;  2J8Q A;  1K26 A;  1XSC A;  3N9U A;  2DUK A;  3L85 A;  5FSI A;  3COU A;  3N77 A;  5CFI A;  3GWY A;  3AC9 A;  4KTB A;  4S2Y A;  3J7Y e;  3G0Q A;  3F6A A;  3SMD A;  1RRQ A;  3X0K A;  2GT4 A;  2VNQ A;  5ANS A;  5ANW A;  1G0S A;  1X83 A;  1V8N A;  1PPW A;  1MQE A;  3HHJ A;  1V8S A;  1NFS A;  1V8I A;  1XSB A;  3FFU A;  3Q1P A;  3A6V A;  3SHD A;  1PPX A;  3EEU A;  5BON A;  2RRK A;  1MR2 A;  2A8R A;  3WHW A;  1OW2 A;  1VIQ A;  1V8Y A;  1KHZ A;  1V8U A;  4NFX A;  3SON A;  4S2X A;  4J7G A;  3QSJ A;  3BHO A;  1SOI A;  2PQV A;  1MP2 A;  1I9A A;  1V8L A;  3KVH A;  2G74 A;  3Q2S A;  1VC8 A;  4MPO A;  5ANU A;  2DSD A;  1NQY A;  4ILQ A;  2CL3 A;  4J7H A;  4KG3 A;  5I8U A;  1VCD A;  3GRN A;  5C8L A;  3X0J A;  1F3Y A;  3ZR0 A;  1MQW A;  5GHO A;  4HFQ A;  1V8T A;  5ANV A;  3I9X A;  4JZV A;  3X0L A;  3O69 A;  4YOQ A;  1V8W A;  1V8R A;  3FK9 A;  3Q91 A;  5DDG A;  5HZX A;  4JZU A;  3FCM A;  2ICJ A;  3X0M A;  5CFJ A;  2YVP A;  1Q54 A;  1Q33 A;  1PUS A;  1SU2 A;  3H95 A;  1VHZ A;  2YVM A;  3F13 A;  5GHQ A;  2CZR A;  4HVY A;  3I7V A;  2A6T A;  2PNY A;  2QKM B;  5FSL A;  4DYW A;  5GHM A;  2B0V A;  4ZG0 A;  3MGM A;  3GZ5 A;  2Q9P A;  3A6U A;  1PUN A;  2YYH A;  3HYQ A;  5GHP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...