3I8TA

N-terminal crd1 domain of mouse galectin-4 in complex with lactose
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
140
structure length
140
Chain Sequence
YNPTLPYKRPIPGGLSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLELQSINFLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the mouse galectin-4 N-terminal carbohydrate-recognition domain reveals the mechanism of oligosaccharide recognition
pubmed doi rcsb
source organism Mus musculus
molecule tags Sugar binding protein
molecule keywords Galectin-4
total genus 32
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3i8tA00
1LEMA 2JE9A 5IT6A 1PZ9A 1U0AA 4TYSA 1HQLA 5KXCA 3RSJA 1CESA 4YZ1A 1GSLA 5GZDA 2D43A 1CR7A 4FPKA 1YRZA 4TZDA 3ILRA 4MYEA 2NP0A 2A6VA 4PF5A 1W6OA 1UZZA 1UX6A 3HN1A 1FYUA 2CY6A 1MVQA 1OFSA 4Q1RA 2ZAAA 4FQZA 2GNDA 1QOSA 2ZKNA 3MW3A 3TB0A 5KXBA 3ZSMA 1G9BA 1CVNA 3WOGA 1DGLA 5GZGA 2E51A 1S0DA 2ZGRA 3B9CA 4XHBA 1C1LA 3ZXEA 4WVWA 3BOPA 1JUIA 1IS5A 2UWCA 4DS0A 3ZXLA 4LBOA 3WDTA 5CBLA 3V0AB 1LENA 2R1DA 4YG6A 2ARBA 3RMYA 3A0NA 1V6OA 3MPPG 3RS6A 1VALA 3JUUA 4UW6A 3PJQA 1JXNA 4XTPA 1W0OA 3M3QA 1LOAA 4LBNA 1DYKA 2GNMA 3B69A 2A3WA 5T5LA 1S0JA 3WDXA 1AXKA 1KQRA 2YY1A 3QLQA 2VW0A 4K1ZA 3O0WA 3USUA 4XBNA 3WG3A 2GNTA 3HR9A 1MS4A 1N1SA 1QDOA 4Q2FA 3W59A 2A5ZA 2VU9A 4PQ9A 1ONAA 4FOVA 1BXHA 1F9KA 4YM0A 2A6YA 3OYWB 2VW1A 1W6OB 1DQ6A 3N3HA 4XMAA 1GANA 5F5QA 2GN3A 2ZMNA 2ZZJA 5CA6A 4AVVA 1GZWB 3RMXA 4DRVA 1G9AA 4XXAA 3AYEA 3NV2A 3B00A 2VY0A 4UW3A 1JYCA 5IK4A 3AZWA 1JOJA 2ZGOA 1QF3A 1SLLA 1ENQA 3SISA 5GLUA 3D5OA 1RIRA 1W6MA 2OVUA 4XJZA 4FPEA 4Q26A 4GXLA 4XXPA 4M3CF 1MS0A 4Y22B 2VH9A 1D0HA 5CNAA 1YI7A 2EIGA 4U36A 3AP9A 2WKKA 3V64A 1V6JA 3FFZA 3M2MA 5DUVA 2OUJA 1DQ2A 1GLHA 1IOAA 4ATFA 2EXHA 4YM3A 3N7MA 4Y1UA 4YFWA 3RQ0A 1MACA 2VXRA 2W39A 4R9BA 4DFSA 1H9WA 1N1TA 2AGSA 1MS5A 1CQ9A 3T1LA 4ZKTB 1SLTA 3NV1A 1LGBA 1DZQA 3WDWA 3LSEA 1DQ5A 5E8AA 5H9PA 4XBQA 1QNWA 2P3KA 4CRQA 1LGNA 3AYDA 3ZYRA 4LBLA 1GICA 2TEPA 4K1YA 5EYXA 3H0OA 2A6WA 2ZABA 3W58A 1LJ7A 2D3RA 4FOQA 4L8QA 2P3IA 2NM1A 2ZA9A 3R05A 4WVVA 5DUUA 2CWSA 1DQ4A 2ES3A 4LBQA 1MR5A 1LOGA 1QMJA 4XMIA 1AX2A 1QDCA 5FRAA 2XG3A 1LCLA 4LBKA 3C2UA 3I4IA 2EXJA 4YW5A 4XJAA 3HMYA 3RG0A 1SCRA 2D6PA 3L2YA 2ARXA 1LOCA 2ZMLA 2SBAA 1WLWA 3AYAA 4HL0A 3ZVXA 1FNYA 2XB6C 1OKQA 5JVVA 3IPVB 1MS1A 2GMEA 5T52A 1MS9A 4FPCA 1APNA 2ZGKA 4XJ8A 1QNYA 3ZXKA 3WDUA 1N3QA 2CTVA 4R9CA 1G9CA 4BMBA 1DYPA 2NMOA 2DVFA 4PBPA 1WBLA 2YZ4A 2ERFA 4BQ1A 1KJLA 2DVGA 3M1HA 4P9WA 2CNAA 1ULGA 4YZ4A 5GLZA 2I2SA 3APBA 2EAKA 3N36A 3R4SA 3I8TA 1VLNA 1AJKA 1F5FA 1W6MB 4XIOA 3VUOA 5T50A 1G86A 2RHPA 3POYA 1YIFA 5GALA 3AP5A 2NN8A 5JMCA 4K20A 2YXSA 1IS6A 3N7KA 5GLWA 1DQ1A 5T5OA 4GKYA 3BTAA 1SLBA 1V6LA 4PCRA 1CIWA 4XJWA 2Q5TA 1G9DA 1DBNA 3USUB 1LECA 2ZHKA 3R4UA 5FREA 3SH3A 1WW6A 2PHUA 4UW5A 1FX5A 4XDQA 5H9SA 4IQPA 4AWDA 4DRRA 1BZWA 1V6NA 4BLIA 5HCAA 1S1AA 4CTEA 2AUYA 1S0CA 2JD4A 1VAMA 2PHTA 1XQNA 5E88A 1LHVA 4C1WA 2DUOA 5T55A 2D6KA 1Y7BA 1CPMA 4GA9A 2G4IA 2WJSA 1V6MA 4ASMB 3A4UA 4FPHA 2PELA 4XJUA 3AX4A 5T54A 2GMPA 5JOZA 4RL7A 5KXEA 3VV1A 2SLIA 4FPYA 2W08A 4P9YA 1ZM1A 3JU9A 1GBGA 5GZCA 2PHXA 3LCPA 3OBRA 3WG2A 2EXKA 3BIWE 3M3CA 1ULFA 4M3CE 1H30A 2OUHA 2UU8A 3D4KA 3M3OA 3NWKA 1IS3A 2D7FA 4YW3A 1OQ1A 1F31A 1DQ0A 1X50A 4KBBA 4P9XA 1SBFA 2E6VA 5JDBA 3IM0A 5DZEA 4AGVA 1ENSA 4YZ2A 2HYKA 3WV6A 3N7JA 3OJBA 1QKQA 1J1TA 2A7AA 3FUOA 5L73A 3V0BA 2ZGPA 2DVAA 3ZSJA 3ZXFA 4ISRA 3PVEA 1UL9A 3ZXJA 4Y26A 3SH4A 2A3YA 3OYWA 2ZACA 1DIWA 3AZVA 3DGTA 3QCWA 1JHNA 1VIWB 5DXDA 1C4RA 1HKDA 1ULEA 1SBEA 4ZXKA 2DYCA 4XZPA 2P2KA 1RINA 5EWSA 2PHFA 2WNEA 2GALA 4AYUA 1TEIA 2OW4A 4K21A 1LU2A 4FPLA 3VKOA 4Z8BA 2YMZA 4XJ9A 5CB7A 1N47A 4PBOA 1YYNA 2PHWA 1Q8PA 3AZYA 2DVBA 1LU1A 1GYKA 5T5PA 2DWRA 2ZGSA 4I30A 4YZ3A 4FOYA 1KJRA 1C57A 1GKBA 5JOWA 3TAYA 1B09A 1VAVA 3O0XA 3KQRA 2D6OX 1H9PA 3AJZA 2R0HA 1LHNA 4C1XA 4YGCA 3O0VA 3WNXA 3WDVA 3OY8B 3T1MA 1Q56A 5JLVA 1S0IA 1LOBA 4XIKA 5EYYA 1A3KA 1SACA 4BM8A 1GZWA 4Y1XA 1JYIA 4Q27A 2AR6A 1Q8QA 3VKLA 1DLLA 1GNHA 4FPFA 4XILA 1KDMA 1UAIA 4JC1A 2NYYA 3POSA 2ZHLA 4FP3A 4NO4A 1CONA 1LHUA 2AREA 1Q8VA 3AZXA 5SV8A 4M00A 4Q1PA 3WG1A 2V5YA 2DTWA 4XYXA 1FAYA 4BMEA 1IKPA 1W6NB 5JOXA 1G7YA 3WUCA 1FNZA 2FHRA 1S0EA 2VUAA 1R1ZA 3VKNA 1HQWA 1GZ9A 1UN1A 4D69A 2DVDA 2LTNA 2AENA 1G8WA 1MVEA 4GKXA 4Y1ZA 3UJQA 4JRAA 1D2SA 2A6XA 2ZGLA 4GWNA 3UK9A 5EXOA 3WCSA 2E53A 2D6NA 1MS8A 2GDFA 1ULCA 1HLCA 3SLIA 2AYHA 4Y22A 2WQZC 1UPSA 3AFKA 3AZZA 1KRIA 1AX0A 5T5JA 2YV8A 1IS4A 1SBDA 4Y1YA 3CNAA 4AGRA 2E7TA 1JN2P 1WD3A 2ZHMA 3FLPA 3WG4A 5DUXA 4BLJA 5BYNA 2A71A 1DHKB 2W68A 1CJPA 2ZGMA 4M3CA 4M3CB 1FV2A 2H0BA 1LHOA 3ASIA 5DZFA 4CZSA 1AXZA 1BYHA 3FUQA 1FV3A 4FQ4A 4RA0A 3ILNA 4FOWA 5HCFA 5GJ6A 4DPNA 2DTYA 2DU0A 1SLCA 5LK5A 3O12A 5GM0A 5KXDA 5DZGA 2ENRA 1WCSA 2D3SA 2E7QA 2GNBA 2P37A 3IMNA 4M01A 3OGGA 1URXA 3DUIA 3PVOA 3ZSLA 1S0GA 3ZYPA 5IK5A 1LEDA 2WT0A 4LBQB 1Q8SA 1IKQA 3AP7A 3NV3A 5H9RA 5IUQA 4YGDA 1AVBA 2A6ZA 2NMNA 1BJQA 2ZGQA 4XBLA 4F83A 2DUPA 1W6NA 4Y24A 5H9QA 1ENRA 1V6KA 1A8DA 1JBCA 1EPWA 1SLAA 5DUWA 3SITA 1CPNA 2A75A 2UWBA 3UL2A 1WW4A 4ISQA 3VKFC 4DQAA 1W0PA 4SLIA 3ENRA 1O4ZA 4H55A 3V0BB 3RRDA 2LALA 1MZ5A 3FLTA 4OZXA 4XOGA 3SH5A 3MEPA 1PZ7A 4YW2A 2EALA 1WW5A 4AVTA 3ATGA 4FPOB 4YFZA 3V0AA 5GLTA 2A70A 3PMEA 4Y20A 2WLQA 3B01A 2A3XA 1LULA 1UKGA 5GZEA 3AP4A 2C5DA 1KITA 1YO8A 2V73A 4R9DA 4YGEA 1GV9A 1W6QA 4FPGA 2JECA 3UJOA 1LOEA 5IK7A 1QOTA 4AVSA 2P3JA 4LBJA 3WZ1A 2JE7A 3ZPYA 3WHTA 1G9FA 3LSDA 1Z78A 4XTMA 3V65A 4YG0A 1JW6A 2VW2A 3KM5A 1O4YA 4XE9A 4YLZA 1ZA4A 4Y20B 5DG2A 4YM2A 4YG3A 4Y1VA 2CWMA 3PVNA 1PZ8A 2R1BA 3D6EA 4NOTA 2R0FA 1CN1A 1RITA 2R49A 3GALA 4LBMA 2JJ6A 3N7LA 1I3HA 2AH2A 1BQPA 1SFYA 4WZFA 1AJOA 4XHXA 2WSVA 1KDKA 2R16A 4JCKA 2CL2A 5AVAA 1V6IA 2ZGUA 2GMMA 5HCBA 3AXEA 3N35A 1LOFA 1LGCA 4YGBA 2ZGTA 3OPZA 1GNZA 1QOOA 4Q8KA 1QGLA 1LOFC 4FPJA 4Q8LA 1SLIA 4U2AA 3INAA 5DG1A 1HDKA 5GLVA 4ATEA 1I1EA 1NLSA 1SCSA 3FBYA 2DUQA 1UMZA 4P14A 3IN9A 1LODA 1UZYA 3IPVA 2BQPA 2EXIA 3POWA 1DFQA 2ZHNA 1LHWA 2WT2A 4LBQD 5JOYA 3WVJA 3ZSKA 2EF6A 4FVVA 2ZGNA 3B3QE 1AXYA 3GNEA 1Z0HA 2KM2A 2ZBJA 1W6PA 2JDZA 1LTEA 1V00A 3IKWA 1N3OA 2GN7A 1WLCA 3OBTA 4GWMA 1N1VA 3AJYA 4YM1A 3VKMA 1MS3A 4AGGA 1GZCA 1WBFA 3SNMA 4YZ5A 2UWAA 4R9AA 1NXD1 2PHRA 3M3EA 1Q8OA 2D44A 2NZ9A 2FMDA 3OY8A 1YXWA 1S0FA 1QU0A 2D3PA 2W52A 3AP6A 4BPZA 2D6MA 4UW4A 2UURA 1W6PB 2YROA 5F9TA 3ILFA 1A78A 4YW4A 3WUDA 2WT1A 3NV4A 2ZMKA 1AZDA 3U4XA 3AK0A 2D6LX 1LESA 2DURA 1N3PA 3A0KA 1S0BA 3WHUA 5GZFA 3AYCA 4HANA 3WLUA 3AXDA 4FP2A 3WCRA 1MZ6A 1WLDA 3T2TA 5IK8A 2CYFA 2B7YA 1C1FA 4BOWA 2C9AA 1AX1A 2DV9A 3O5SA 4ITCA 1WUVA 4YW1A 5E89A 5CAZA 3MW2A 2P34A 3BODA 2DU1A 2WSUA 4W65A 1N1YA 1W6QB 1WD4A 2Z42A 3WDYA 3FLRA 1ULDA 1WW7A 1FATA 2JKBA 1BKZA 4GALA 4WV8A 1AF9A 3MW4A 3Q9OA
chains in the Genus database with same CATH superfamily
1POV1 1LEMA 4E9KA 5IT6A 4Q4W1 1HQLA 3IAPA 1AR93 3TN91 5KXCA 3N9NA 1J83A 4YZ1A 1AL21 3UGFA 4I2OA 4NRPA 2D43A 4GWJA 4IL7A 5AC91 3ILRA 3MIDA 5DABA 5EJ1B 2NP0A 2A6VA 4IGPA 2VE1A 4PF5A 4AI2A 2OZJA 1HXS1 4Q4V1 1YEWA 5BNPA 3GJBA 3WR0A 2WABA 1MVQA 1OFSA 4IW3A 3HEIA 2ZKNA 2WQ4A 1JOPA 3KB5A 4K9SA 4BDVB 2FBEA 1S0DA 3BIEA 3ZXEA 1IQAA 1R093 2A1XA 3I3QA 4I3PA 1IS5A 1XOYA 5AFEA 4DS0A 3ZXLA 5CBLA 3V0AB 1QWRA 2R1DA 4EV0A 2CSGA 3LIGA 1NOVA 1V6OA 1DGWA 1BK1A 3ACHA 5ACA2 2P3YA 4RS5B 1L3JA 1W0OA 2BGPA 3A23A 3M3QA 4XTPA 5HPOA 1PK6B 1ZBE2 3LB9A 3TEXA 2VMEA 3B9IA 1AYN1 1BEV1 2VAUA 4Q4W2 2Y0IA 3GBWA 4PQQA 2OQ7A 1AL22 2J1UA 2J42A 4N53A 2YU2A 4Q2FA 4TN7A 4HMZA 2Y38A 2YPJA 4FOVA 1F9KA 4D6RA 4RGGA 2HWF1 3I7DA 4D0QA 5BUVA 1QQP3 1CGPA 4AK3A 3U37A 3BCWA 4AW7A 1GANA 4HN0A 4XFHA 3ACIA 5JPMB 1OPOA 2XQRA 4AVVA 5FBJA 3Q8FA 4XXAA 4CCJA 3NV2A 4EWDA 1NZIA 1WCQA 2BFUS 2HBTA 3B00A 1KD7A 3RNSA 1H8TB 5A3MA 1QJFA 5JUVA 2ZAHA 1JOJA 1U12A 1YIPA 4META 1ENQA 2G1MA 4H7LA 2FDHA 4CCLA 1ZRCA 5FZIA 1JS9A 1H2MA 1J3RA 3MFAA 4Y22B 2CHHA 3BTZA 1UY2A 5CNAA 1OXCA 2W87A 2BGCA 2VTXJ 4U36A 2WKKA 2R6QA 2YFZA 3FFZA 3V64A 2OUJA 2XVGA 1GLHA 2EXHA 2IZWA 3P6BA 5EV7A 3LKJA 3N7MA 2XVLA 3W9AA 1MACA 2W39A 5DAQA 2VZVA 2BBAA 1NLQA 4EN0A 4MZUA 3T1LA 4ZKTB 1LGBA 1VBB2 5E8AA 3T4HB 1PM7A 1C3HA 2P17A 1EUUA 1LGNA 3AYDA 1K5MC 1T6BX 1RVF2 5LA9A 2FQPA 3VBFC 2E9QA 2WS92 2A6WA 4AXOA 1LJ7A 4ZZ5A 1UU4A 4YVWB 2P3IA 1XC6A 3O1UA 2W94A 1VMJA 1RJ7A 5CU1A 2CWSA 4AVCA 5BNOC 3S7EA 2Z79A 4EN9B 3KS7A 1QMJA 4Q0UA 1AX2A 1JTZX 3B93A 4CUCA 3SXWA 1XSQA 3BKZA 4C0HA 3I4IA 4XPVA 3HMYA 4XJAA 3ZYHA 2HEVF 4AEDA 4E8CA 4MUVA 4GH4C 1AL0G 5JCTA 4CDQB 4QPYA 4HL0A 4NPLA 2TNFA 4XUQA 4MGKE 3JXSA 1DGRA 5EP9A 1H8VA 1MS1A 4N43A 1XU1A 1OA4A 1QNYA 2ARCA 4TLFA 3J9SA 2CTVA 3UKTA 4AHYA 3VDDC 4RN5A 1G9CA 1LKNA 3ST7A 1M06G 3DF0A 2R063 1WBLA 1YQ6A 4YVSA 1KJLA 5CADA 2K2SA 3M1HA 4P9WA 2VUCA 4YZ4A 5GLZA 3ZPOA 3APBA 4AI1A 3I8TA 3KV5A 4CCKA 1GU3A 4QGNA 2BUKA 5FIXA 1AR71 1W6MB 2IWGB 4HKOA 1QIQA 2JIJA 1RUC3 4UFKA 4IXLA 3AP5A 3IDBB 1ZZ6A 2NN8A 4SBVA 1IPJA 4GMP3 5IVFA 2IFRA 3M4FA 1VBD3 3O1VA 3BTAA 1V6LA 4PCRA 1CIWA 3IWZA 4Q4Y2 4QX5A 1NCRB 2UY8A 3UKNA 2VC9A 2YPDA 3SH3A 5I91A 5IVJA 4UW5A 3N9LA 2RS13 3J8F2 3N9PA 3WF1A 5FMDA 2QQNA 1FXZA 1W3VA 5FWEA 3ZIWA 1CAUB 2ZEZA 2VPVA 1COV3 3QACA 4KI5M 4BHPA 4AWDA 2VMGA 4QU2A 4S2DA 4DRRA 2VMFA 3J4UH 5BXXA 1BZWA 2YC0A 2Q8EA 3DYMA 1NKGA 4LLFA 5FQ0A 3NRUA 3OCPA 4CUGA 3K4AA 2JD4A 3Q8CA 4I0AA 3ZFGC 1XQNA 1RUOA 3WSOA 5F2WA 4C1WA 1GOFA 4LHLA 1W8FA 3LWCA 5FZMA 4DOUA 1JZ8A 1CPMA 3A21A 1EAH3 2G4IA 5CG9A 1U5YA 1X9TA 4R8HA 5BNOA 4CXWA 1YNAA 2CV6A 4Q29A 5BNNA 4FPHA 3EB7A 4XJUA 3T09A 5DQ0A 1BLZA 3NKGA 5JOZA 5FZ8A 4BQ2A 3VV1A 2XJQA 4P9YA 1CAWA 3KV6A 1ZM1A 3BN6A 5FPZA 3OUIA 1O91A 1VMFA 1HRI3 2PHXA 2VZ3A 3WG2A 1HN0A 4QX2A 2JWPA 1TME1 1ULFA 2R072 5A6ZA 1R1A1 2UU8A 3D4KA 4GJYA 1OF4A 2D7FA 3J8F1 4JX0A 5FP9A 4AFBA 2XLFA 1PK6A 5JDBA 3IM0A 4AGVA 5C3RA 1JYVA 2IC1A 2VQTA 4YZ2A 5FO9B 1UIKA 2A7AA 1RUF1 4I0BA 3B7MA 4YW6A 2VBDA 3MLLA 4YVWA 4OHVA 1VJ2A 2JDNA 3H8XA 4DB5A 1X7NA 2PQSA 1BBT3 2IVIB 5JI7A 1DGRN 4UF0B 3ZXJA 2A3YA 3AZVA 1VIWB 3UV9A 2IVJA 1W04A 4DXRA 4BQXA 3AM2A 2C4XA 1JYXA 1VBA3 1OLQA 3D8CA 1ZZCA 4QDQA 2UYBA 1PO11 1AR82 4ZU5A 1U5IA 1W99A 2VBBA 2GALA 3VZKA 1VR3A 1LU2A 1NYWA 1ZYBA 2FDJA 2V5DA 4FPLA 4C0BA 1O7FA 1RXGA 5CB7A 3RYPA 1PO21 3SCFA 1Q8PA 4A42A 2DVBA 4CDUB 2ZPXA 4I30A 2R041 4YWAA 4BIOA 1ND3B 4AFMA 3MYXA 3MIFA 4IEPA 1GKBA 4XCBA 3TAYA 3KQRA 1YUDA 2D6OX 3AJZA 2R0HA 1LHNA 3O0VA 5HXMA 3WDVA 2OS2A 4QXHA 4XIKA 3D82A 5EYYA 5CKMA 3SC7X 4GH4A 4HK9A 1VBE2 5IHRA 4CDUA 1Q8QA 1DLLA 1HQNA 2X05A 4XILA 4JC1A 1MPXA 5JMOA 2H6BA 2RS53 1KFUL 4G4FA 1BBT2 3FHIB 4JQRA 1RUD3 1Q8VA 4F7ZA 5EPAA 1XNTA 3NW4A 4BMEA 2WRAA 1IKPA 1SDDB 4W50A 5JOXA 1D2QA 4QQLA 1GOHA 1AYM3 1R1A3 2OZ6A 3VBUC 2VUAA 3KWVA 1S55A 4EZ4A 3POGA 4D6QA 5FZLA 4D69A 2O8OA 4AVAA 2DVDA 5D8AA 2LTNA 2IXCA 1REEA 4Y1ZA 3RJ2X 1QXRA 5LRRA 1JZ3A 4DMIA 1PMHX 1O59A 2ZGLA 5HV4A 3J7LA 2Z4FA 1FOD2 3JQXA 2MEV2 3VBOB 3WNLA 5LA1A 3WCSA 2E53A 1GP6A 2ATFA 3CMGA 1SMVA 4E2SA 2AYHA 3AZZA 1QJX1 1AX0A 2IXKA 2YV8A 4QQ2A 1VBD2 4XZUG 1GWKA 4D94A 2E7TA 4AQ2A 1EAH2 5FP8A 2WO1A 4JGZC 3PLQA 4YVSB 2E7AA 2JENA 2CAVA 3VD5A 2A71A 3ZYIB 3I49A 4MGTA 2W68A 1E5IA 4IESA 1BBT1 4M3CA 3HBZA 3URFA 1ND3C 1QEXA 2DFBA 5DZFA 4B4QA 3FUQA 3OEBA 5FLHA 2GH8A 4WM8A 4MHUA 5GJ6A 3PURA 2XKOA 2WNVA 4RFRB 5FYMA 2DTYA 4RHV3 2BWCA 1W28A 1SLCA 2JICA 2RS12 3J8F3 3I3MA 5DZGA 5JAXA 1JHJA 2ENRA 3BPSA 1SEFA 3OGGA 3DUIA 3PVOA 3THDA 1S0GA 2XQXA 1RUH2 1IHMA 4Q4X1 5FOBB 2FZ2A 1TNFA 1OD3A 4OYUA 1Q8SA 1IKQA 3AP7A 3E1F1 3PL0A 3RZKA 3S57A 4IEYA 5FR3A 1QJX2 5IUQA 5IW0A 2ADDA 1ULPA 1EV12 2VTFA 2VG9A 2ZX0A 2BVVA 4LA2A 5F39A 5J7MA 4XBLA 1GOGA 1AR61 2HWC3 3N9MA 5F5AA 4NROA 2QZ3A 4HONA 4HLTA 1YQ2A 1JZ4A 1ZZ7A 1YQ5A 1W2AX 2VOVA 3VDBA 1V9U1 1ENRA 3T08A 1A8DA 2YHJA 4PI0A 1JBCA 5FZFA 1QJU3 1SLAA 4A7KA 5KC6A 2A75A 1U5XA 5FZAA 3JBG1 2UWBA 1WW4A 4OMDA 1GZTA 4ISQA 4CEWC 3ENRA 2JG9A 1O4ZA 3K3OA 3KLSA 3VBHC 5CYYA 2N7GA 4CCEA 3MEPA 1PZ7A 4DEVA 4YW2A 3WINE 4Z1VA 3W20A 2A70A 4Y20A 3S5QA 4KGQA 2WLQA 3NSTA 3GHNA 1UZWA 4Z92B 1CAXA 1LULA 3MV11 1YFUA 4WVMB 1PO22 4FPGA 1NY71 1NT0A 2BEOA 2P3JA 4OHZA 1WZXA 1PIV1 1LAJA 4XUPA 2XJRA 4JGYA 4XQWA 5K9YA 4QX3A 2XOMA 1UZVA 3FHAA 2XLAA 5LBFA 3NAPA 1RL3A 2XWJB 4YG3A 5FUPA 1RMU1 3TEZA 3PVNA 3D6EA 4LK6A 3VZOA 1ZBA3 1CN1A 3KSCA 3PUAA 4IDZA 3NNMA 3N7LA 1DZTA 1I3HA 5K0UA 5FJHA 2VZUA 1A8MA 1W9TA 4MADA 5K8SA 4CDUC 4WZFA 1B35B 1CAVA 4XHXA 1XE0A 2KA3A 5AVAA 2CL2A 3MFCA 1GWLA 2FMYA 2YUEA 1V6IA 1WCKA 2ZGUA 4FCAA 3VD4A 5HCBA 2H6CA 4I01A 4QPIC 2JDAA 4Q4W3 4YGBA 5L9VA 3DPRB 2WNVB 4XDPA 5C8CA 1QGLA 5J48A 1MQTB 1YFXA 2RR13 2GC3A 4Q8LA 1HW5A 1RUH3 2BPA2 2MPFA 3INAA 4NUBA 4ATEA 1NLSA 4QHBA 4HG6B 2W5FA 5HI0A 1OH4A 3G6JB 4QT6A 3POWA 4LBQD 2ZHNA 1LHWA 3BGAA 2RDNA 1V9U3 4P9GA 4NIIA 4DXTA 5JOYA 3U07A 1DYOA 3PNAA 3OD4A 2ZGNA 4MGSA 3ZSKA 4ARXA 1UY1A 2JDKA 5FYBA 2MEV1 4ZU7A 4OMCA 1HIXA 5DAPA 5FAXA 1EP0A 3OBTA 3LA2A 4UT5A 3E5XA 1MS3A 4AGGA 3VBUB 1WMFA 1PMJX 4R9AA 3ZFEB 1Q8OA 4RFT0 4UAPA 5C8WA 3N9OA 3OY8A 4NPRA 2VQUA 4Q0QA 1S0FA 2TBVA 5BY5A 3AP6A 1BK0A 4IEWA 4LITA 4BPZA 4UW4A 1QJU1 4LKSA 4UFLA 5A3UA 3AKQA 5F9TA 5JIAA 3ILFA 3UESA 5F3GA 3FX3A 3WUDA 2WT1A 3GZAA 3NV4A 1VBE3 5CEHA 3T3YA 5JZGA 3HOBA 3JZVA 2D6LX 1N3PA 4KBZA 4Z2WA 1Q5OA 1S0BA 4RR3B 5GZFA 3AKPA 4NR1A 5FP3A 4B29A 4HANA 4XUOA 5A6YA 3WQ0A 1MZ6A 2WN3A 2IXHA 3T2TA 5IK8A 4ZHNA 4LO7A 1OVSA 2C9AA 1XJAA 2QQMA 5DMYA 1ZA7A 4P9JA 4RS5A 5CAZA 4PHZA 2XL7A 2CGNA 1AYM2 4PDWA 5EJZB 3ON7A 4W65A 2QDNA 5CKQA 2WFF1 2G9FA 1WD4A 4B7EA 4MVTA 5FTTC 1ND2A 5F3EA 4KU8A 3DCQA 1FATA 4CP0A 4Y3OA 3MW4A 4FXGB 3AMNA 3Q9OA 4BYYA 1KGYA 2DFCA 1U0AA 5FYTA 2QKDA 2Q1ZB 4MO3M 4TYSA 3U4SA 4B1MA 5A6XA 1C8NA 1GSLA 3U75A 4IEXA 2FDGA 2VNGA 3WY6A 3ZSEA 4ASLA 5C8CC 2FDIA 1CZVA 3HQXA 3RI8A 2VZQA 4MYEA 3VDDB 2A73B 4IV1B 2WZPP 1UZZA 1OLMA 2QCSB 5AFBA 1H4HA 4LORA 1R082 2WBKA 2QQPA 3OSDA 4HK8A 1UY3A 2GNDA 1K45A 1QOSA 2ET1A 5KXBA 4IE4A 1CVNA 3ZXDA 1DGLA 3NNLA 3B9CA 1T6GC 3UGHA 2F4PA 4WVWA 1JUIA 1Z7S1 5IFPA 2D40A 2UWCA 5FQ0B 2I07B 1VE0A 3POIA 4DXZA 1PVC3 5FPAA 1LENA 3MPBA 4YG6A 3RMYA 4FFGA 1OT5A 3RS6A 3JUUA 4UW6A 4JGZB 1VB2A 2J1RA 4LHSA 1LOAA 3KMHA 4HVQA 5LWBA 3VHPA 4NWVA 4OHYA 2QQUA 2A3WA 2BOJA 1RUJ2 1AXKA 1W05A 2YY1A 3QLQA 4UBHA 2R061 2VW0A 3ZYBA 2D5FA 4K1ZA 3WG3A 1ODNA 2GP5A 1NQJA 3HR9A 3NAPC 2PHLA 1AHSA 1BXHA 4XUNA 3J7NA 3OYWB 4AOCA 5FY0A 5CZKA 5F5QA 3ZKUA 5FKBA 2RJLA 2ZZJA 5I0DA 4YSFA 1XU2A 1G9AA 3KCYA 4L9BA 1VBC2 4XQDA 4I0WB 3OEAA 3UGGA 4EQVA 2HH9A 5IK4A 1F35A 2P1BA 3KHBA 1QF3A 2W92A 1SLLA 1HRI2 2W91A 2CAUA 3S5AA 3HN3A 4R4XA 3ZFFA 1K5JA 5FZ9A 1RIRA 1W6MA 4XJZA 3WP3A 4XXPA 4AL9A 2W0XA 4QQOA 1PVC1 1NE4A 2E32A 3E5QA 2RMU2 2W46A 3TOJA 2X09A 2W95A 1V0AA 4R9BA 1CZTA 3WT3A 2PFWA 2VZPA 2AGSA 5FKCA 2PAMA 3KGLA 2XGXA 1CQ9A 1SLTA 5FY1A 1JYWA 1BVVA 1DZQA 3WDWA 3C8XA 4OQ9A 5C9AC 4P5HA 1QNWA 4X6RB 1ZBA2 3FN9A 3ZYRA 2YC2A 1GICA 4MXWB 2TEPA 2VOWA 3IIIA 5FMBA 4CPBD 4KMQA 1YQCA 2WYFA 1VBC1 1Z7S3 3ZYJB 1ZRRA 4FOQA 1GQHA 3I3EA 4JQTA 5C4WC 1BMV1 4L8QA 4GAZA 1YFWA 1NCQA 2ZA9A 3R05A 4N90A 4WVVA 5LATA 4DIQA 5DUUA 4L2NA 4AI0A 3MF9A 1DQ4A 4NE9A 4LBQA 2RR12 5J37A 4LIVA 4DY3A 3EXUA 4CXYA 5KHJA 1QDCA 2VOKA 5FRAA 1ODMA 1LCLA 3OGSA 4LBKA 4ZY9A 2R32A 2XR4A 4WM7C 3RG0A 2D6PA 1O5LA 1RUC2 3L2YA 4RSUA 4JGYB 2ARXA 1LOCA 2SBAA 4EN7B 5DPNA 3AYAA 5M0TA 4S2GA 5A1FA 3VDDA 4CA9A 3SCGA 1WCUA 4KL1A 2VVEA 3LA3A 1MS9A 5T52A 1RUE1 1APNA 4L11A 5HXVA 1XYOA 3WDUA 4Q4V2 1HRV1 5C5UA 3LEMA 2B8MA 2NMOA 4LPLA 4BQ1A 5BNOB 1RTVA 5ACA1 2B39A 1ULGA 5TSWA 2HWB3 1G6NA 1HXS2 4CEYB 5FYSA 5FPBA 2W47A 4M0NA 2AACA 1OLRA 4XIOA 3VUOA 1G86A 5EHDA 5CFDA 5GALA 2Z2SB 4BK5A 1ASJ2 1RUI3 1PO23 3CQOA 2MHFA 4K20A 3H1WA 3VZLA 4JKMA 2VUDA 3PU3A 2VGDA 2J1AA 3ZMNA 5FYIA 2VNVA 1AYN2 1BEV2 4S2HA 3I2JA 1LECA 3KV9A 2BVBA 2PHUA 1WCDJ 3SMHA 2HWB2 1PGSA 1PGW1 1PO12 1RHI1 1RVF3 5A80A 4MX3A 4P5YA 5FZ4A 2XHNA 2VZSA 2VVFA 5LA2A 1E5RA 4BH9A 1HRV3 2AUYA 1S0CA 1VAMA 4AQSA 1VAKA 2HWC2 2Y33A 5JPNB 4WZCA 1Y7BA 4GA9A 2RM21 2WJSA 3PHMA 1DU3D 1V6MA 4EZHA 1A6CA 3BTYA 5FV3A 4QPGC 2GP3A 2GMPA 1X36A 4ZPIA 4RL7A 2W08A 5GZCA 3LCPA 1HV1A 4N53B 1ZVFA 3VBHA 3VDAA 4M3CE 3CZUA 1H30A 3NWKA 1CX4A 3HAGA 1F31A 3HJRA 2V4AA 4MHRA 4P02B 2OX0A 4KGGA 4N53C 2WO2A 1XNAA 3TYJA 3RZGA 4TXWA 1O3TA 2QNKA 1RVF1 3N7JA 4O9GA 3UKVA 1QKQA 4QDRA 2DCTA 2ZGPA 3I2DA 1W8NA 4JV4A 3B02A 1NA1C 1UL9A 1XYPA 2BOIA 4LLOA 4CEYC 1QJX3 3OYWA 4YVWC 5CFDB 2HWC1 4L99A 3MZHA 1JHNA 1FOD1 2XXZA 4O7XA 4JHTA 3OUJA 4EWAA 4NHXA 1QJZA 2EICA 3K77A 4FFFA 1SBEA 1Q43A 4XZPA 5EWSA 2PHFA 5FLIA 1TEIA 2OW4A 2WZR3 1HB3A 2Y34A 4K21A 4MXVA 3VKOA 4Z8BA 4HT1T 4XJ9A 4A3ZA 3H8RA 4PBOA 4B3NA 4XFBA 5IATA 2PHWA 1LU1A 4EN8B 2DWRA 5A7WB 4E8DA 1OMIA 4YZ3A 3Q8EA 2AZ5A 4BZ4A 2P4EA 4FOYA 1ZREA 2C9KA 3RGBA 5JOWA 3IT8A 1VAVA 2W3JA 1H9PA 3H9AA 2XVKA 3WNXA 1MEC3 2WL1A 4BXFA 1YI9A 2QQKA 4CXXA 3HD8B 1Q56A 2UYAA 5B4XA 5FYCA 5K4LA 1LOBA 1YQ8A 4NJ4A 3VBFA 4CP2A 1I5ZA 1SACA 1DF0A 1MZEA 2OPKA 4H2AA 4BM8A 1GZWA 1OPMA 4Y1XA 3H8OA 1JYIA 5FPUA 1GNHA 4FPFA 5D2AA 3NMBA 3DECA 3POSA 5FJKA 3GZEA 2H0VA 3AVSA 1LHUA 5SV8A 1FOD3 4M00A 3ZIXA 2R043 2XONA 1W6NB 4AFAA 4K6BA 3SEPA 1OQEA 1FNZA 2BFUL 2WA4A 1HB4A 1S0EA 2DCJA 2O8QA 3VKNA 3UT0A 4X8PA 4XUTA 5C5TA 2AENA 2VM9A 1R083 2WQ8A 1G8WA 1MVEA 2C6SA 2XUEA 2QQVA 4JRAA 1D2SA 3LOBA 4N43C 2P6CA 3K2OA 3ETPA 2WNVC 3VL8A 5A3LA 4FT8A 3HBKA 2NLRA 1MS8A 4QHZA 4CCCA 1HLCA 1WMDA 4Y22A 3AFKA 5FFOC 2DCYA 2PTMA 2HWE3 3WQ1A 2FDKA 5JSRA 3C3VA 3HPNA 1A34A 4AGRA 1RJ8A 3RI9A 3BB6A 1WD3A 2Y6KA 5FPVA 2HWB1 1W8ZA 2WWUA 1ST8A 5FP4A 3T30A 2OKXA 4CDXC 1CJPA 1LRHA 2Z69A 1FV2A 1WLTA 1LHOA 3ASIA 4CZSA 1H6XA 5LZ6A 1MZFA 1ND2C 4OI1A 1JZ2A 4OQ8A 1POV3 3CEWA 2PAKA 4FOWA 2FDFA 1UOGA 4OHXA 1UX7A 2ZJCA 4IEQA 3O12A 2R073 1TME2 2R071 3MLKA 3IMNA 1S4CA 4M01A 2GNBA 5A7PA 4N8MA 4Y5TA 4KWLA 2F17A 4AEKA 2WT0A 4QAWA 5IWFA 1YCIA 1JI6A 2ZEYA 2JDMA 5A7WA 4Q4Y3 4IE6A 4Q0VA 4TTGA 4IGOA 4P9LA 4FSJA 4IEVA 1UXZA 1JH5A 1OH3A 3K3NA 3L2HA 4L97A 5FZKA 1L7LA 3WP4A 3E6BA 4Z82A 4YGDA 3T2QA 4WVZA 2NMNA 3FZ3A 5FBZA 4AAXA 1BJQA 2ZGQA 3GXUA 5FK7A 4F83A 3ZN6A 4HSJA 2DUPA 4DY5A 5H9QA 4FI9A 5I8SA 2RM23 2Q30A 2WR9A 3NJYA 1YFYA 3PIJA 4LKEA 3O1TA 4EWEA 5DUWA 4YPJA 1CPNA 4INDA 3JCIA 1D4M2 3LD8A 5FXZA 2J1TA 3IDEA 2Q4SA 4LQRA 4Q0SA 4DQAA 5T5PA 2R042 1MZ5A 3KV4A 3KT4A 4M4RA 2ZEWA 4OZXA 4PIYA 4PT6A 4XOGA 5CG8A 1KS4A 2D93A 2QZ2A 4OUSA 4BQ3A 1DLCA 5GLTA 5FZDA 4BE3A 3AL6A 3MIHA 5J1XA 3TWIA 3B01A 3AB0A 4NAMA 2YBSA 2WZ8A 2VUJA 3AP4A 2C5DA 4LKFA 4GQ7A 3VZNA 4R9DA 3ZLIA 2Y8KA 1GV9A 1CD3G 1H8TA 2JECA 5IK7A 1CWPA 4MH0E 2B45X 5F5CA 4EN6B 4AVSA 3ZPYA 5CFDC 2JE7A 2WO3A 2BNOA 3UETA 1G9FA 1Z78A 2Y64A 4XTMA 4YG0A 2WFPA 1GUIA 1MQTC 1JW6A 3T0DA 2VW2A 1O4YA 4UFIA 4W6XA 5FYZA 4YLZA 4BQWA 1ZA4A 4AAPA 2VL4A 1H2KA 1UOFA 3EHKA 4YM2A 4YARA 5JR7B 2LUWA 2WAAA 3SQOA 4G3YC 5L19A 4LBMA 3DV8A 1OD5A 4JZRA 2JJ6A 4QMAA 5FZ7A 3ZM8A 1PO13 1HB2A 4LUKA 2BNNA 1BQPA 2ZS6B 1J84A 3CZJA 1SFYA 5F2SA 2RJKA 4E2QA 1X33A 3R0RA 3T0AA 3H3ZA 2BGOA 3ROUA 1WA4A 4LOSA 3RDIA 4X8NA 5L7OB 4AFCA 4D6SA 3VB9A 4HPKA 3PTYA 2HBUA 1XBFA 5JZGB 1LOFC 3CJIA 1SZBA 5C9AA 1QJY1 1QJY3 4LO8A 1SLIA 3OBZA 3QH7A 4Z2AA 4WBBA 1I1EA 3FBYA 5BNPC 2DUQA 5FZOB 3WW3A 4AI8A 1D0GA 1RMU3 4BQYA 1LODA 1UZYA 3IPVA 4KU7A 5J36A 5JZGC 3WX5A 2XJUA 3ZN5A 1VRH3 2EF6A 3GDBA 3AMMA 3I3DA 1DDLA 2VXJA 1V00A 3IKWA 2GN7A 3ORJA 4JKLA 4YYOA 3CBNA 1N1VA 1VBB3 4UFHA 5C3PA 1WMEA 3CO2A 4JTNA 4NN0A 4QXCA 4QPIB 4AFDA 2IUWA 4YZ5A 1UZ0A 1NXD1 3M3EA 1ZRDA 5IAVA 2NZ9A 2W2IA 1TQ5A 3IAQA 4V1PA 3WP5A 1YXWA 2VULA 1AL23 1QU0A 2W52A 5ANNA 2HWF3 5I93A 3MBWA 1RUH1 2PA7A 3WNMA 5HV0A 1A78A 2WNUB 2QDRA 1O6UA 2ARAA 2XJTA 3ALQA 4PJYA 2L9LA 2HEYF 2ZMKA 4QXKA 2CGPA 5CFCC 1LESA 4HSLA 4KWKA 2QBXA 1ENXA 4XVHA 3AYCA 1WGPA 3AL5A 4JHZA 5FZBA 3ZYFA 1AR62 5FPXA 2YG0A 2F4LA 1UD1A 1WLDA 3LFMA 5EZWA 4QB2A 2B7YA 1C1FA 2HKXA 4ZXEA 4NIDA 3MW2A 4NPMA 2ZCWA 4QPWA 4CDWA 3BODA 3SCHA 2WSUA 2BU9A 3I59A 5FXXA 1W6QB 4EYUA 3ETQA 1K5MA 3I2IA 1ULDA 1W9YA 3AMPA 1OQDA 1BEV3 1AYN3 1IG0A 5FPLA 4FO9A 1P8JA 1FI2A 4GALA 4LE3A 1AF9A 3I97A 1TMF2 3RPQA 2JE9A 3LPGA 4H7MA 2HWD2 4CP9A 5GZDA 5IVCA 1AR92 1NA1A 4ZS3A 5FP7A 1O3QA 1VB4A 1YRZA 5DDJ3 4ARYA 4COUA 4LKDA 4P9IA 3WW2A 3NJZA 1RUF2 1UX6A 3VBFB 1FYUA 3D0JA 3VHNA 1JU3A 2C24A 2ZAAA 3QD6A 1W2UA 4QQPA 5ANQA 5KBFA 1D4M3 3MW3A 3TB0A 1K12A 3ZSMA 1G9BA 3WOGA 1JOBA 5GZGA 4IE5A 2E51A 3ME2A 1GWMA 5FMOS 2ZX4A 2G9GA 4ES8A 1K3IA 5LEJA 3VBOA 4LBOA 4DXSA 1ZBA1 2WLPA 2VNOA 4NHLA 1ZZBA 2ARBA 2WNUC 3MPPG 4V2WA 1TVGA 2RS52 5FXVA 2QFEA 2Y6GA 3PUIA 2GNMA 3B69A 3JD72 5A1AA 4XAEA 2ID4A 1R64A 1S0JA 1O5UA 4LHNA 5KR7A 3SKJE 3ECQA 4XBNA 2HWD1 1N1SA 5LA0A 1NXMA 4AQTA 5JXHA 1XNBA 2A5ZA 5D8AC 2VU9A 3M3IA 4PQ9A 1ZRFA 3QBQA 3GZTB 4YM0A 2A6YA 3VBRA 1R092 1W6OB 2JDPA 1WKYA 4PLOA 1RUC1 5FO8B 3N3HA 4XMAA 5DAVA 5I0UA 1C8M2 2VOTA 2XHKA 4UYBA 1TNRA 1GZWB 1EYBA 2WN2A 3VN4A 3TNPB 3PUSA 4A7ZA 4E4HA 1VBE1 5EQUA 1I9RA 2X53S 2VY0A 1IGOA 4UW3A 3TNQA 3AZWA 2BBVA 2X5IC 1O3RA 2J1EA 5GLUA 4CCNA 1FMD1 3D5OA 3KCCA 1LNSA 1NLRA 1RUD2 5DAWA 3O1SA 1UF2C 1MS0A 4BK4A 1D0HA 2XWBB 1RUJ3 4F8AA 1NCRC 2XBO1 1ND3A 3AP9A 1ZZ8A 1V6JA 5DUVA 1IOAA 4ATFA 4YM3A 1Y3TA 4Y1UA 4FAHA 2CGOA 1W90A 3H1MA 1GP5A 5DN2A 5FZ1A 2BTVC 5FZ3A 5HBAA 1N1TA 2VMDA 1IPKA 2YYOA 5ERLA 1RUG3 5FO7B 1OURA 4MLOA 2C1FA 1NE6A 1OUXA 4OFGA 1REDA 1RUNA 4RD7A 4XABA 5E1RA 4XBQA 4AF9A 1XNKA 5L7OA 3HT1A 1QY4A 2JG8B 1C8M3 3RYRA 1SDWA 4UFMA 2ZABA 3W58A 5LBCA 1US3A 3OGRA 2C26A 2NM1A 1XE7A 3CF6E 3VDCA 1PK6C 4DINB 4IGQA 2ES3A 2QQOA 3Q8BA 5C4WA 4CSWA 2JIGA 5CFCA 1LOGA 5JSPA 3RZHA 1U5ZA 3ZMOA 3NO8A 3C2UA 4YW5A 5F6LB 3AKRA 5FZ0A 1OVPA 2CU5A 3RFRA 1DP0A 1COV1 1JUHA 3C7EA 1I5PA 4N9HA 3K4DA 1X9PA 4QXBA 1FNYA 1OKQA 2VO5A 1EY2A 2GMEA 1UYXA 3A22A 2XH6A 2ZGKA 4XJ8A 5DDJ1 3TRSB 1O8PA 3VBOC 4BMBA 5IVYA 1DYPA 3RZMA 4PBPA 1LB2A 2YZ4A 2GC0A 1YLLA 2Q0AA 1TMF1 3FL7A 4LO6B 1O4TA 2I2SA 3N36A 1RUF3 5C6CA 2GC1A 3KHCA 4QM9A 1VLNA 4XACA 1F5FA 3C7OA 5L9RA 4XFCA 2RHPA 4JTOA 5T50A 1QQP1 3POYA 4E27A 5C3OA 4I02A 2OYZA 4UFJA 5F8PA 4N7IA 1US2A 5I0TA 3N7KA 4PDWB 1OOPA 1DQ1A 5T5OA 1SLBA 1UU6A 4XJWA 2RDQA 2Q5TA 3LE0A 5FZOA 2ADEA 3S30A 1XE8A 4ET7A 3KVAA 1G9DA 2ZHKA 3R4UA 5FREA 1F15A 1MEC2 3P3NA 3DXTA 3OGJA 1FX5A 3OPWA 3R6SA 4P08A 4AHZA 4MGYE 4QPGB 1HJFA 2Q1FA 2PAEA 4Q4X3 1EPZA 3H7YA 4IQPA 2R062 3ZFGB 2WC2A 3MGUA 3P3PA 1OOPB 3NVCA 3EMRA 2QTWB 3AMHA 4CUAA 4BLIA 5BPXA 2RS51 3POFA 3JB4C 4QU1A 1S1AA 4CCOA 4K3UA 4K7JA 4TLGA 3JD71 4LTAA 4CP1A 1XNDA 1LHVA 5FCCA 1XXNA 3JB8A 3O1PA 1PIV2 2DUOA 5T55A 4XF9A 1VRBA 1PNFA 3LDBA 1IQDC 2OT7A 3L9JT 3LIHA 3DEMA 5FZCA 1AR73 4NHYA 4BQ4A 4UI9L 1R091 4S2FA 5T54A 4XAAA 2W1QA 3H42B 3VBSC 5KXEA 1W2TA 3DPRC 2BW8A 4L0PA 2RMU1 1ZRIA 2Y6HA 3O7OA 1GBGA 3AKTA 5FLJA 2WZEA 4PF1A 4BA6A 3OBRA 3BIWE 2JDYA 4IV1A 3VHRA 2OUHA 4DO0A 3GCXA 2JX9A 2W1WA 1DQ0A 1X50A 3GCWA 1FMD2 1RB8G 4P9XA 2WWSA 2QQLA 1C28A 2P5BA 4CU8A 5D1IA 4HPKB 5I8YA 1ENSA 2HYKA 3CLPA 3WV6A 3OJBA 3ACGA 3BU7A 1OI6A 4E2GA 1BHGA 1OHFA 4PLNA 2DVAA 2ET7A 3ZSJA 4ISRA 4D7SA 3PVEA 4UF0A 1PM4A 4H14A 3SH4A 5KWRA 1C5HA 2VCMA 4JGZA 1J1LA 1UMIA 2D97A 3DGTA 4KWJA 2ZX3A 5JR2A 2PLV2 5DXDA 2OPWA 1OFNA 1W2OA 4KG8A 3HQRA 2HWF2 2J1VA 1HKDA 4BWOA 1BMV2 2DYCA 5IFTA 2WNEA 4K8FA 1OA3A 4AYUA 1HRV2 4J6GA 4WM8C 1VMHA 2YBKA 2YMZA 1GR3A 4HVRA 4YVSC 3ZX7A 1YYNA 4AHWA 2WYSA 2ZGSA 5J98B 5FYVA 1KJRA 2VR4A 3ZFEA 1FT9A 1B09A 3RWNA 1XPWA 4C1XA 4XW3A 3MV01 3WW4A 1W8HA 1ZX5A 2VMIA 5F6KA 3T1MA 3ZFFB 5CISA 1GP4A 3KQ4B 5FOJB 3AMQA 5JLVA 3IBMA 1W8UA 2X10A 1A3KA 3ZFGA 3VL9A 4PLMA 4JVAA 4Q27A 2AR6A 5L9BA 3VKLA 1KDMA 1Q3EA 3UYJA 2NYYA 1W3XA 3MUZ1 3PU8A 4OUMA 2ZHLA 1RGSA 1X82A 4NO4A 1CONA 2AREA 3AZXA 3I59B 4J1WA 1W39A 5C9AB 4Q1PA 4GB33 5IVBA 1Y43B 2BERA 1FAYA 2DTWA 2GSYA 4GMP0 3WUCA 3C7GA 4ASKA 4P00B 3TEWA 1R1ZA 4IV1C 1GZ9A 1SG3A 2ZXQA 3MDPA 5G04L 3J26N 3CKHA 1UN1A 1RHI2 3ZR5A 4BCUA 4BJ0A 1QQP2 4M4PA 4Q5OA 3KZ4C 5D21A 2FCTA 3UJQA 3MUY1 3WW1A 3FFQA 4RQPB 4AR2A 2XPJA 1PGW2 5LRSA 2JDHA 2VVDA 2GDFA 1YJKA 2Y0OA 3THPA 2WQZC 1KRIA 3IIAA 5T5JA 5C71A 2HWE1 4CVUA 1MEC1 3K75B 3CNAA 4IE0A 4BQ5A 3WF0A 5L36A 3HT2A 3BUCA 1JN2P 3SKVA 2ZHMA 3PUHA 4QKDA 3FLPA 2YC4A 4N9IA 4I09A 4LIUA 3WG4A 4BLJA 1JODA 1UY4A 2MEV3 2ZGMA 4M3CB 3MIBA 1AXZA 2JB8A 2W1UA 4FQ4A 3ILNA 1OSGA 5HCFA 1NCQC 4GB31 1W8TA 3HNBM 4DPNA 2RS31 5E16A 4K8RB 4OUEA 2DU0A 3U0ZA 2Y6JA 5GM0A 2KR2A 3F2ZA 3ZYPA 1URXA 2B9VA 3ZSLA 4AG4A 1B35A 5IK5A 3LOIA 2O1QA 4LBQB 4Q4Y1 2ORXA 4ONUA 3C7FA 4CDXB 1XB9A 3T4VA 5H9RA 1F8VA 2VZTA 4HBNA 3K48A 2HWE2 1UYYA 1JU4A 4OVEA 2A6ZA 3ZN6B 1FPN1 2QE3A 4MXWA 4F3JA 4NMIA 3ZYGA 5F37A 1NCRA 3I3BA 2IFWA 3NL1A 1UY0A 3VBHB 1VRH1 4XDOA 3VBSB 3K51A 5JXIA 2EIDA 2RG4A 4IE7A 4UWDA 4CYDA 3SITA 3ZKYA 2J1SA 3UL2A 4G9SB 2YBPA 2WUHA 3VKFC 2HLEA 5FYUA 3TN92 4A44A 3V0BB 3RRDA 3BU0A 3LA7A 3EQEA 2RS32 3FLTA 4QD2A 3FMGA 5F3CA 3SH5A 1RUG2 5A3NA 2I45A 1GMMA 2EALA 1WW5A 2PLV1 3ATGA 3GM8A 4FPOB 4WM7A 4AVTA 5B2GB 3ZDVA 3PMEA 3LQCA 3ITQA 1VBA2 4NIAA 1CAXB 1PHMA 5AC93 3VBRC 1YO8A 4CCMA 4X6QB 2VD7A 5AC92 1H1MA 2YGMA 4YGEA 1W6QA 1E5HA 3ZR6A 1W2NA 1TZOA 1C5IA 2CDPA 1PGL2 4JKKA 3WZ1A 1PVC2 2JG9B 3WHTA 3OGVA 2IXIA 3LSDA 3W5NA 1FPN2 3V65A 4A7YA 4LK7A 1OOPC 3KM5A 3HNMA 3DYOA 4XE9A 4QQHA 2DF7A 3WEZA 4Y20B 1J3PA 2ZKLA 2PQQA 4LNVA 3ZO0B 1MQTA 4NOTA 1PZ8A 2R1BA 2R0FA 2R49A 3GALA 3O14A 5IYYA 1QJEA 2GZWA 5A3PA 5C7GA 3OPTA 5FWJA 3BTXA 2AH2A 4HOOA 4RGAA 2FCUA 1NCQB 4LUMA 3MF6A 5CVRA 1OKOA 4GWIA 1CAVB 1XSRA 2WSVA 1K5MB 2WAOA 3T2PA 2AEZA 2Q1MA 2GMMA 2W9XA 2XKPA 3AXEA 2RV9A 4URAA 1LOFA 3CJIC 3HNYM 1H1AA 2VMHA 1PNGA 4HVOA 2ZGTA 3ZN4A 1GNZA 1TG7A 5D8AB 3VD9A 2B46X 2RR11 3KT1A 4FPJA 4U2AA 3E97A 5DG1A 1HDKA 5GLVA 1ZBE1 1JYNA 1SCSA 1UMZA 4DUXA 1JZ6A 2VBPA 3IN9A 4BISA 5LK7B 2EXIA 3WF3A 2HEWF 2WT2A 4XQ4A 4OZOA 2GC2A 2ZX1A 2R30A 1Z0HA 2KM2A 2WFF3 4MOAA 2Q8OA 3BVCA 1ASJ1 3MIGA 5JXGA 1QHDA 4IEUA 3MLJA 1JZ5A 1RUE2 2E33A 3VKMA 4CP9B 2CDOA 3DKQA 2UY9A 2PHRA 2EVXA 3GF6A 2XLGA 3DXUA 4WM7B 4LO4B 3CHXA 1NX9A 5A33A 2UURA 3HIFA 1W6PB 4HXCA 1O8SA 3UNPA 1DG6A 4IUGA 4YW4A 4A6OA 3W5MA 4JDOA 4XF1A 2FD8A 4OULA 3U78A 1TMF3 1OLME 3AK0A 4XFFA 1UYZA 1UO9A 3RWKX 1ACCA 3A0KA 2VQ0A 3ABZA 4YRDA 3WHUA 2AEYA 1D4M1 1L7RA 3WLUA 3AXDA 5BNNC 3WCRA 1ULOA 4NVPA 5FUIA 3EYPA 2JG9C 3V56A 4DUVA 3FC0A 1Y9MA 5A33B 5IVVA 4ITCA 3S6PA 2WWJA 5E89A 1B35C 2P34A 4LEJA 4MGIE 2JD9A 3WP6A 3ZFFC 2LRPA 3H8UA 1N1YA 2VTXA 2PMWB 1HB1A 4KNCA 2WINB 1OUSA 3FLRA 4A41A 4XF4A 1BKZA 2WS91 3POEA 4WV8A 4D7TA 3M70A 4XFAA 4YW7A 1RYYA 2HWD3 1PZ9A 4GH4B 4EE2A 1ZNPA 3RSJA 2D5HA 1CESA 3U1XA 4LHKA 3LF7A 4ORFA 1NZCA 1CR7A 1QXPA 1IG3A 1RUI2 2JDUA 4FPKA 4IETA 4QB6A 4AQ6A 4TZDA 2PXJA 1F2NA 3GZUC 2ZTNA 3WD5A 4NIHA 1BVP1 1PX3A 2XBO2 3GJAA 3T0BA 4AVBA 1W6OA 4QM8A 3KCXA 1HXS3 4AZZA 3HN1A 1F5JA 3U14A 4CCDA 2W1SA 2YB7A 2CY6A 2BJSA 4Q1RA 2NQYA 4FQZA 5F7UA 1REFA 4OI4A 1FMD3 2K0GA 4LR4A 1BCXA 2ZGRA 4XHBA 1C1LA 3JQWA 3BOPA 2V09A 3RJRA 1JMUB 4A3XA 3WDTA 1H4GA 5K7PA 1DZRA 1SPPB 2XBO3 5FZHA 1DGWX 5LBBA 3A0NA 3CJXA 4DEQA 1VALA 1QJY2 2EIEA 3PJQA 1JXNA 3NAPB 5LEKA 3C7HA 3K46A 4LBNA 2XJSA 1DYKA 4XFIA 5A1LA 4GD4A 4JGYC 5LCWL 1UIJA 1AR72 5T5LA 3WDXA 5A7QA 1KQRA 2VCBA 1UU5A 3E6DA 3O0WA 4QWNA 3USUA 3RZJA 4RR3A 2GNTA 2ZZQA 1MS4A 4R4ZA 5ACA3 1QDOA 3P1IA 3W59A 1KEXA 1RXFA 4GZ9A 1ONAA 3S0MA 5ISLA 2VJXA 2VW1A 1OF3A 2LW8A 1DQ6A 1RUE3 3CDZB 4J25A 1NAEA 4IEOA 2GN3A 1KS5A 2ZMNA 5CA6A 1UOJA 2IXLA 3RMXA 4DRVA 4Q4V3 3AYEA 1NUKA 1YHFA 1NA1B 2PHDA 4D8MA 3OB8A 4WVMA 1JYCA 3I2GA 2ZGOA 3KF3A 5C3QA 4ES9A 3SISA 2E63A 3B94A 3GYDA 4MG2A 4BXSV 2DCZA 2Z5WA 4QKBA 2OVUA 4D3WA 2WDBA 4FTSA 4FPEA 2QVSB 4GXLA 4Q26A 1NY72 1EV13 4M3CF 4MGZE 2VH9A 3D0SA 4N43B 3FBMA 5KHHA 1YI7A 2RMU3 3E5UA 2EIGA 5C33A 4ZU4A 2QJVA 3OTFA 3M2MA 1DQ2A 1CJDA 4GJZA 4OLLA 2ZX2A 4CDWB 3RQ0A 4YFWA 3J7MA 3LGRA 5A32B 2VXRA 5IJRA 4DFSA 4COWA 4A6SA 1H9WA 2DCKA 3IZOA 1MS5A 5FY5A 4LA3A 4LJHA 1YC61 3NV1A 4CE8A 1NQDA 3AC0A 3WQBA 2WA3A 3LSEA 1DQ5A 4RHV2 4BU2A 4W6YA 5C4WB 5FDBA 5H9PA 2X5IB 2P3KA 3AVRA 4AEMA 4CRQA 4Y4YA 4AI9A 2YFUA 4LBLA 4K1YA 3PDQA 3H0OA 5EYXA 1OC1A 5FY9A 1R1A2 3K4ZA 3I2FA 2D3RA 4HKWA 4QKFA 2VCCA 3ACLA 3THTA 1Y4WA 4V2VA 4LT5A 1SPPA 4PIXA 1WMXA 3LZZA 1MR5A 1H0BA 4EJRA 4QPGA 4XMIA 4RQPC 2VECA 4A2UA 2XG3A 2KXLA 1AR81 2EXJA 4MV2A 1SCRA 4CEYA 1DCSA 4K40A 2EA7A 2BWAA 3DL3A 4FXKB 2ZMLA 4JRLA 1WLWA 1AR91 5FUNA 2LS6A 3ZVXA 3BYWA 1TME3 2XB6C 5JVVA 3IPVB 4L92A 4E4SA 1KXGA 5FYHA 4FPCA 3ZXKA 1N3QA 1VBC3 4R9CA 3POJA 4BB3A 5LY2A 3MICA 2DVFA 3MI8A 1HJGA 2ERFA 3H3LA 4R52A 2DVGA 5J96B 4Y33A 2CNAA 3BPZA 2EAKA 1X8MA 3R4SA 1J58A 5FY8A 3WF2A 2O14A 5KHKA 2B42B 1AJKA 2FZ1A 4HKLA 2VCAA 5FYYA 3FHQA 3Q8AA 1JYTA 1AR83 3QH6A 1YIFA 1RUI1 3W21A 3GHMA 4CDWC 5JMCA 5HCHA 3N4MA 2ZOEB 2GAUA 1STMA 2YXSA 1IS6A 4HZFA 5GLWA 3EO6A 5K0UB 4XEZA 4GKYA 5F5IA 5KC5A 2QQWA 1UXXX 5LASA 4NWWA 5A6QA 1DBNA 3USUB 3AFGA 3NJVA 3NQHA 4AEJA 1WW6A 5IVEA 3ES4A 3LEGA 4XDQA 3J7HA 4C8DA 4HFSA 4E4DX 3OG2A 4CU6A 5H9SA 3DPRA 5C8CB 2QQJA 4Q0PA 4QGLA 3TN93 3USSA 1JZ7A 1S2BA 4CDXA 1GQPA 2JEMA 4O9EA 4XFGA 3IDAA 4C91A 1V6NA 3DKWA 1C8M1 3TEYA 4FBFA 5HCAA 1CX1A 3IB3A 3IMMA 4ZS2A 1FPN3 3LEKA 4CTEA 2PHTA 5E88A 4B7KA 3G7DA 2ORZA 3FJSA 3OOXA 5G05L 2D6KA 1KFXL 2DDUA 1EAH1 1AYM1 1PX4A 4ASMB 3A4UA 2PELA 3AX4A 5I0RA 1UMHA 4FFIA 1M4WA 3ZOIA 4B4PA 1R081 1RUD1 2SLIA 4FPYA 4IEZA 4XC9A 3I2HA 3JU9A 4RGKA 3U10A 1VBD1 4CDQA 5J3UA 3HQUA 1WWYA 4Y4RA 5EJ3A 3ZDSA 2EXKA 2RS33 1UPIA 1Y9GA 3A7QA 3M3CA 3NKTA 2WIIB 3VHOA 4M0HA 3M3OA 4YW3A 1IS3A 4I3GA 1OQ1A 3LAGA 2XMLA 3MHZA 4KBBA 3SHRA 2LROA 2RS11 1SBFA 2E6VA 4UBGA 3M7AA 4Y5SA 5DZEA 3HWJA 4Y5Z0 1UQXA 3WNOA 3U11A 3EBRA 5APAA 4NAOA 5L73A 1J1TA 3FUOA 4RQPA 4RYDA 4E4ZA 4GULA 5I0SA 2WZR2 5FY4A 3V0BA 1CAUA 3ZXFA 5FMCA 2GH2A 3O1RA 1PVXA 2G19A 3ES1A 4Y26A 3ACFA 1E5SA 2PN5A 2VQAA 2ZACA 1DIWA 3QCWA 4QDSA 3JD73 3NNFA 2FCVA 1C4RA 2XJVA 1F4AA 3H3UA 1ULEA 4RHV1 4ZXKA 3TBDA 2P2KA 1RINA 5FZGA 1CAWB 3DN7A 2E26A 2G9ZA 2V72A 4IV3B 5LBEA 1EV11 5J09A 1N47A 3WF4A 3BI3A 3VGIA 1H8TC 1GQGA 3AZYA 1RUJ1 1QH6A 1POQA 1X8EA 1GYKA 2OIIA 1RHI3 2ILMA 3FE5A 3P5BA 1HRI1 1UW8A 2KD7A 1UKRA 5FMOL 4AE2A 1HN1A 2X8KA 1H6YA 1COV2 4O65A 4COZA 1C57A 1S2EA 1UYPA 5DAXA 1V9U2 2EAAA 5E6HA 5BV6A 3PIGA 3O0XA 4KH9A 4YNIA 5JSOA 1AUYA 1J59A 1SQ4A 1H2LA 4XF0A 4YGCA 1AR63 2XJPA 3GBGA 4GB32 4QKNA 3D3AA 3JBG2 5F32A 3OY8B 5DDJ2 2Y60A 1S0IA 2YGLA 3POBA 1UNBA 4NIGA 2B4KA 1I6XA 1UAIA 1VP6A 1WA6X 1W8OA 2QQIA 4QHOA 4W8JA 4AEDB 4CU7A 4B4RA 5EFUA 5C70A 5FZEA 4QX8A 4FP3A 2GU9A 2BYVE 3VLBB 3WG1A 2V5YA 5F1RA 4XYXA 3FWEA 2Y6FA 1H1IA 1IPSA 4XURA 1G7YA 3KVBA 3LDKA 3OF1A 3RVHA 4AHXA 2FHRA 4J1XA 1HQWA 4RR3C 2WNUA 4UOJA 5FY7A 4TSVA 3O1OA 1GNYA 5A3TA 1VRH2 4GKXA 2VZ1A 2HYXA 2A6XA 3NNJA 3N9QA 3E6CC 4A4AA 1RMU2 3IDCB 4GWNA 3UK9A 2AC1A 3LFIA 5EXOA 4OCTA 2D6NA 1ULCA 3NNGA 4LXLA 3SLIA 5GKAC 1UPSA 2OQ6A 4LULA 4NHMA 4HETA 1S2KA 1IS4A 1SBDA 2BZDA 4FFHA 4Y1YA 4CDQC 1W0NA 2VZOA 3I2OA 1IZ3A 1YJLA 2HJIA 1VBA1 2XUMA 1PIV3 5DUXA 5BYNA 5IAXA 1DHKB 4A45A 2X29A 3JBG3 4URTA 1F4HA 1H2NA 2H0BA 2YU1A 4EROA 3DYPA 1CZSA 1BYHA 2WS93 4IV3A 2BP6A 3QOPA 4GMP1 1FV3A 4QGMA 4XF3A 5LB6A 4H3WA 3VZMA 4FAGA 4RA0A 1PGL1 2JKXA 4B8EA 3CL1A 4OI0A 1QJU2 4CU9A 2LM3A 4O61A 4C90A 3LDRA 4HN1A 5LK5A 2ZEXA 3OD0A 5KXDA 1ND2B 3PJYA 1WCSA 2D3SA 2E7QA 3THCA 1ALYA 2P37A 3ELNA 4QB1A 5JWPA 5F3IA 3F95A 2J7MA 1LEDA 2R7EB 3BOWA 4AEDC 1XNCA 4NRMA 1D7PM 1SFNA 2PLV3 3NV3A 1TE1B 2K46A 4JAAA 5FK8A 4B1LA 1LR5A 3NJXA 1ASJ3 1AVBA 2B5HA 4MGQA 2JG8A 3M8LA 3WXPA 2Y6LA 3VBRB 5ABJA 5JIUA 1W6NA 4Y24A 5LW9A 4CUBA 4TWTA 1CIYA 1W9WA 1Y9QA 3KT7A 3CIHA 4N7UA 1V6KA 2J22A 5BNPB 3WNPA 1PMIA 1UWWA 1EPWA 2VOXA 3GBFA 3H7JA 3LPFA 3H50A 2WZR1 5JXJA 5LY1A 4ZONA 2WFF2 3KGZA 2C0ZA 1W0PA 4NRQA 3PTRB 4SLIA 3BALA 4H55A 4KG0A 1W03A 2LALA 1XYNA 2XL9A 2RM22 4NHKA 2P6HA 4W6WA 2RVAA 4D7YA 4YFZA 3V0AA 4COYA 5A70A 5K0UC 1D4VB 2A3XA 1W9FA 3B5LB 4GIQA 1UKGA 5GZEA 3WNNA 3RYKA 1KITA 1W8WA 2V73A 1ZBE3 3T2OA 4LMFA 5B4NA 1QH7A 2WNOA 2ETEA 3H1YA 3UJOA 1LOEA 5KHIA 1QOTA 2EIBA 4LBJA 3VD7A 2BNMA 3LEIA 2B9UA 5C3SA 4LE4A 1Z7S2 3RZLA 4MSVA 5A7NA 2TUNA 5T3NA 4CEWA 3RZZA 4ZZ8A 2RE9A 5DG2A 1K42A 5CKNA 4Y1VA 2JB4A 2CWMA 3S7IA 1UCXA 3WQ7A 1RITA 4Q4X2 3SEEA 1V70A 1YWKA 3ZXAC 2VZRA 3PMSA 1EUTA 1AJOA 1KDKA 2R16A 4JCKA 3PVBB 5A3OA 4BIFA 5JI9A 1J3QA 2OA2A 3VBSA 3N35A 1T2XA 1HV0A 1E57A 2Y26A 1LGCA 3ZFEC 2YDEA 4AI3A 1O3SA 2X5IA 2XDVA 2VNRA 2RDRA 2BDRA 3OPZA 5A3WA 1QOOA 4Q8KA 2MNGA 1L7QA 4WM8B 4COVA 4OHWA 4QPIA 4DUWA 5I8TA 2Q8CA 4PI2A 4PIZA 4JDNA 5A32A 4P14A 4JDMA 1W9SA 2JG8C 2O0OA 3KF5A 2BQPA 1DFQA 5EIYB 1SHWB 3WVJA 2RDSA 4FVVA 3GNEA 3B3QE 1AXYA 4KQ7A 2WO7A 2ZBJA 3MO4A 3PUQA 4QX7A 1W6PA 2JDZA 1LTEA 3R4DB 5BNNB 4LOTA 1N3OA 2OXBA 1WLCA 1ZZ9A 2PYTA 1NG0A 3OBAA 4GWMA 4IERA 2D98A 2Q8DA 1VBB1 3AJYA 4YM1A 5KHGA 3O1MA 1SFPA 1UOBA 3CJIB 1GZCA 1QXJA 1WBFA 1XRUA 2QUOA 2UWAA 3SNMA 3GGLA 4RS5C 3VD3A 3HVDA 1POV0 2D44A 3VBUA 5FZ6A 2FMDA 5AVPA 2F6BA 3I54A 5CIRA 1W06A 2D3PA 2BRTA 2D6MA 2VMCA 5A7SA 2JE8A 3X29B 3I2KA 4XCAA 3VZJA 2YROA 4QX1A 5ABJC 5BNQA 3WNKA 2E31A 2V4VA 4KWUA 4IV3C 1HX6A 1VPHA 3OUHA 3CU7A 3U4XA 1AZDA 2NPIA 2DURA 2I74A 3MIEA 5ABJB 4CPBA 2BV4A 1GFF2 4FP2A 5FXWA 2CYFA 1RC6A 1OA2A 5CFCB 2JXAA 4BOWA 3O5SA 1AX1A 2DV9A 4YW1A 1WUVA 4FTEA 4Z07A 4XETA 2DBIA 4UXAA 2DU1A 4DZGA 3EJKA 4FTBA 3AKSA 4QX0A 2RJ2A 3KD4A 5A7OA 5SV5A 2Z42A 4DNYA 5L7OC 4PDWC 4OI2A 3WDYA 1WW7A 2IXJA 1OBNA 4CEWB 2JKBA 3ZXGA 1RUG1 2K9ZA 4LO5B 4W4ZA 2DBNA
chains in the Genus database with same CATH topology
1POV1 1LEMA 4E9KA 5IT6A 4Q4W1 1HQLA 3TN91 1AR93 5KXCA 4YZ1A 1AL21 2D43A 4IL7A 5AC91 3ILRA 3MIDA 2NP0A 2A6VA 4AI2A 4PF5A 2OZJA 1HXS1 4Q4V1 5BNPA 3WR0A 1MVQA 1OFSA 2ZKNA 2WQ4A 3KB5A 4K9SA 2FBEA 1S0DA 3ZXEA 1IQAA 1R093 4I3PA 1IS5A 5AFEA 4DS0A 3ZXLA 5CBLA 3V0AB 1QWRA 2R1DA 4EV0A 1NOVA 1V6OA 1DGWA 1BK1A 5ACA2 4RS5B 1L3JA 1W0OA 4XTPA 3M3QA 1PK6B 1ZBE2 3LB9A 3B9IA 1AYN1 1BEV1 4Q4W2 2Y0IA 3GBWA 1AL22 4N53A 4Q2FA 4HMZA 2Y38A 2YPJA 4FOVA 1F9KA 4RGGA 2HWF1 3I7DA 5BUVA 1QQP3 4AK3A 3BCWA 4AW7A 1GANA 4HN0A 4XFHA 5JPMB 1OPOA 4AVVA 4XXAA 3NV2A 4EWDA 2BFUS 3B00A 3RNSA 1KD7A 5A3MA 1H8TB 2ZAHA 1JOJA 1U12A 1YIPA 4META 1ENQA 4H7LA 1ZRCA 1H2MA 1J3RA 3MFAA 4Y22B 5CNAA 2BGCA 4U36A 3V64A 2WKKA 2R6QA 3FFZA 2OUJA 2XVGA 1GLHA 2EXHA 2IZWA 5EV7A 3LKJA 3N7MA 2XVLA 3W9AA 1MACA 2W39A 4EN0A 4MZUA 3T1LA 4ZKTB 1LGBA 1VBB2 5E8AA 1PM7A 1C3HA 2P17A 1LGNA 3AYDA 1K5MC 1RVF2 3VBFC 2FQPA 2E9QA 2WS92 2A6WA 4AXOA 1LJ7A 1UU4A 4YVWB 2P3IA 1RJ7A 5CU1A 2CWSA 4AVCA 5BNOC 3S7EA 2Z79A 4EN9B 3KS7A 1QMJA 4Q0UA 1AX2A 1JTZX 3B93A 3SXWA 4C0HA 3I4IA 4XPVA 3HMYA 4XJAA 2HEVF 4AEDA 4MUVA 4GH4C 1AL0G 5JCTA 4CDQB 4QPYA 4HL0A 2TNFA 4MGKE 1DGRA 1H8VA 1MS1A 4N43A 1XU1A 1OA4A 1QNYA 4TLFA 3UKTA 3J9SA 2CTVA 4AHYA 3VDDC 1G9CA 1M06G 1LKNA 3ST7A 3DF0A 2R063 1WBLA 4YVSA 1KJLA 5CADA 2K2SA 3M1HA 4P9WA 4YZ4A 5GLZA 3APBA 4AI1A 3I8TA 4QGNA 2BUKA 1AR71 1W6MB 2IWGB 4HKOA 1RUC3 4IXLA 3AP5A 3IDBB 1ZZ6A 2NN8A 4SBVA 1IPJA 4GMP3 2IFRA 3M4FA 1VBD3 3BTAA 1V6LA 4PCRA 1CIWA 3IWZA 4Q4Y2 4QX5A 1NCRB 2UY8A 3UKNA 3SH3A 5I91A 4UW5A 2RS13 3J8F2 1FXZA 3ZIWA 1CAUB 2VPVA 1COV3 3QACA 4BHPA 4AWDA 2VMGA 4QU2A 4S2DA 4DRRA 3J4UH 5BXXA 1BZWA 2YC0A 4LLFA 5FQ0A 3OCPA 2JD4A 4I0AA 3ZFGC 1XQNA 1RUOA 4C1WA 4LHLA 3LWCA 4DOUA 1CPMA 1EAH3 2G4IA 5CG9A 1U5YA 4R8HA 5BNOA 1YNAA 2CV6A 4Q29A 5BNNA 4FPHA 4XJUA 5JOZA 3NKGA 3VV1A 2XJQA 4P9YA 1CAWA 1ZM1A 5FPZA 1O91A 1HRI3 2PHXA 3WG2A 1TME1 1ULFA 2R072 1R1A1 2UU8A 3D4KA 2D7FA 3J8F1 4AFBA 2XLFA 1PK6A 5JDBA 3IM0A 4AGVA 2IC1A 4YZ2A 5FO9B 1UIKA 2A7AA 1RUF1 4I0BA 3B7MA 3MLLA 4YVWA 4OHVA 1VJ2A 4DB5A 1X7NA 1BBT3 5JI7A 1DGRN 3ZXJA 2A3YA 3AZVA 1VIWB 3UV9A 3AM2A 1VBA3 1OLQA 3D8CA 1ZZCA 2UYBA 1PO11 1AR82 4ZU5A 1U5IA 2GALA 3VZKA 1VR3A 1LU2A 1NYWA 1ZYBA 4FPLA 4C0BA 1O7FA 5CB7A 3RYPA 1PO21 3SCFA 1Q8PA 2DVBA 4CDUB 2ZPXA 4I30A 2R041 4BIOA 1ND3B 4AFMA 3MYXA 3MIFA 4IEPA 1GKBA 3TAYA 3KQRA 1YUDA 2D6OX 3AJZA 2R0HA 1LHNA 3O0VA 3WDVA 4XIKA 3D82A 5EYYA 4GH4A 4HK9A 1VBE2 4CDUA 1Q8QA 1DLLA 1HQNA 4XILA 4JC1A 2H6BA 2RS53 1KFUL 4G4FA 1BBT2 3FHIB 4JQRA 1RUD3 1Q8VA 4F7ZA 3NW4A 4BMEA 1IKPA 5JOXA 1D2QA 4QQLA 1R1A3 1AYM3 2OZ6A 3VBUC 2VUAA 1S55A 4D69A 2O8OA 4AVAA 2DVDA 5D8AA 2LTNA 2IXCA 1REEA 4Y1ZA 3RJ2X 1QXRA 5LRRA 4DMIA 2ZGLA 3JQXA 1FOD2 3VBOB 2MEV2 3WCSA 2ATFA 2E53A 1SMVA 4E2SA 2AYHA 3AZZA 1QJX1 1AX0A 2IXKA 2YV8A 4QQ2A 1VBD2 4D94A 2E7TA 4AQ2A 1EAH2 4JGZC 3PLQA 4YVSB 2E7AA 2JENA 2CAVA 2A71A 3ZYIB 2W68A 4IESA 1BBT1 4M3CA 3HBZA 3URFA 1ND3C 2DFBA 5DZFA 4B4QA 3FUQA 5FLHA 2GH8A 4WM8A 5GJ6A 2XKOA 2WNVA 2DTYA 4RHV3 2BWCA 1SLCA 2JICA 2RS12 3J8F3 5DZGA 5JAXA 2ENRA 1SEFA 3OGGA 3DUIA 3PVOA 1S0GA 5FOBB 1RUH2 1IHMA 4Q4X1 2FZ2A 1TNFA 1Q8SA 1IKQA 3AP7A 4IEYA 1QJX2 5IUQA 1EV12 2ZX0A 2VG9A 2BVVA 4LA2A 5J7MA 4XBLA 1AR61 2HWC3 2QZ3A 4HLTA 1ZZ7A 2VOVA 1V9U1 1ENRA 1A8DA 2YHJA 1JBCA 1QJU3 1SLAA 4A7KA 5KC6A 2A75A 1U5XA 3JBG1 2UWBA 1WW4A 4ISQA 4CEWC 3ENRA 2JG9A 1O4ZA 3VBHC 3KLSA 2N7GA 3MEPA 1PZ7A 4YW2A 3WINE 4Z1VA 2A70A 4Y20A 4KGQA 2WLQA 3NSTA 3GHNA 4Z92B 1CAXA 1LULA 1YFUA 4WVMB 1PO22 4FPGA 1NY71 2BEOA 2P3JA 4OHZA 1PIV1 2XJRA 4JGYA 4XQWA 5K9YA 2XLAA 3NAPA 1RL3A 2XWJB 4YG3A 1RMU1 3PVNA 3D6EA 3VZOA 1ZBA3 1CN1A 3KSCA 3N7LA 1DZTA 1I3HA 5K0UA 1A8MA 5K8SA 4CDUC 4WZFA 1B35B 1CAVA 4XHXA 2KA3A 5AVAA 2CL2A 3MFCA 2FMYA 2YUEA 1V6IA 1WCKA 2ZGUA 4FCAA 5HCBA 2H6CA 4I01A 4QPIC 4Q4W3 4YGBA 3DPRB 2WNVB 5C8CA 1QGLA 5J48A 1MQTB 2RR13 1YFXA 2GC3A 4Q8LA 1HW5A 1RUH3 2BPA2 2MPFA 3INAA 4ATEA 1NLSA 4QHBA 5HI0A 3G6JB 4QT6A 3POWA 4LBQD 2ZHNA 1LHWA 4P9GA 5JOYA 1V9U3 3U07A 3ZSKA 3PNAA 3OD4A 2ZGNA 4ZU7A 2MEV1 1HIXA 5FAXA 1EP0A 3OBTA 3LA2A 3E5XA 1MS3A 4AGGA 3VBUB 1WMFA 3ZFEB 4R9AA 1Q8OA 4RFT0 5C8WA 3OY8A 4NPRA 4Q0QA 5BY5A 1S0FA 2TBVA 3AP6A 4IEWA 4BPZA 4UW4A 1QJU1 3AKQA 5F9TA 5JIAA 3ILFA 3FX3A 3WUDA 2WT1A 3GZAA 3NV4A 1VBE3 5JZGA 3JZVA 2D6LX 1N3PA 4Z2WA 1Q5OA 1S0BA 4RR3B 5GZFA 3AKPA 4NR1A 4B29A 4HANA 3WQ0A 1MZ6A 3T2TA 2IXHA 5IK8A 4LO7A 2C9AA 4P9JA 4RS5A 5CAZA 2XL7A 2CGNA 1AYM2 4PDWA 4W65A 2QDNA 2WFF1 2G9FA 1WD4A 4B7EA 4MVTA 5FTTC 1ND2A 4KU8A 1FATA 4CP0A 3MW4A 4FXGB 3AMNA 3Q9OA 4BYYA 2DFCA 1U0AA 2QKDA 2Q1ZB 4TYSA 1C8NA 1GSLA 4IEXA 2VNGA 3ZSEA 4ASLA 5C8CC 3HQXA 3RI8A 4MYEA 3VDDB 2A73B 4IV1B 2WZPP 1UZZA 2QCSB 5AFBA 1H4HA 1R082 2QQPA 4HK8A 2GNDA 1QOSA 2ET1A 5KXBA 1CVNA 3ZXDA 1DGLA 3B9CA 1T6GC 2F4PA 4WVWA 1JUIA 1Z7S1 2D40A 2UWCA 5FQ0B 2I07B 4DXZA 1PVC3 1LENA 3MPBA 4YG6A 3RMYA 3RS6A 3JUUA 4UW6A 4JGZB 1VB2A 1LOAA 3KMHA 4HVQA 3VHPA 4NWVA 4OHYA 2A3WA 1RUJ2 1AXKA 2YY1A 4UBHA 3QLQA 2R061 2VW0A 2D5FA 4K1ZA 3WG3A 1NQJA 3HR9A 3NAPC 2PHLA 1AHSA 1BXHA 3OYWB 5F5QA 2RJLA 2ZZJA 4YSFA 1XU2A 1G9AA 3KCYA 4L9BA 1VBC2 4XQDA 4I0WB 5IK4A 1QF3A 1SLLA 1HRI2 2CAUA 4R4XA 3ZFFA 1RIRA 1W6MA 4XJZA 3WP3A 4XXPA 2W0XA 4QQOA 1PVC1 1NE4A 3E5QA 2RMU2 3TOJA 4R9BA 3WT3A 2PFWA 2AGSA 2PAMA 3KGLA 2XGXA 1CQ9A 1SLTA 1BVVA 1DZQA 3WDWA 5C9AC 4P5HA 1QNWA 4X6RB 1ZBA2 3ZYRA 1GICA 4MXWB 2TEPA 2VOWA 1VBC1 1Z7S3 3ZYJB 1ZRRA 4FOQA 1GQHA 5C4WC 1BMV1 4L8QA 1YFWA 1NCQA 2ZA9A 3R05A 4N90A 4WVVA 5DUUA 4L2NA 4AI0A 3MF9A 1DQ4A 4LBQA 2RR12 5J37A 4DY3A 3EXUA 5KHJA 1QDCA 2VOKA 5FRAA 1LCLA 4LBKA 2R32A 3RG0A 4WM7C 2D6PA 1O5LA 1RUC2 3L2YA 4RSUA 4JGYB 2ARXA 1LOCA 2SBAA 4EN7B 3AYAA 4S2GA 3VDDA 3SCGA 4KL1A 2VVEA 3LA3A 1MS9A 5T52A 1RUE1 1APNA 4L11A 5HXVA 1XYOA 3WDUA 4Q4V2 1HRV1 2B8MA 2NMOA 4BQ1A 5BNOB 1RTVA 5ACA1 2B39A 1ULGA 5TSWA 2HWB3 1G6NA 1HXS2 4CEYB 4M0NA 4XIOA 1OLRA 3VUOA 1G86A 5CFDA 5GALA 2Z2SB 1ASJ2 1RUI3 1PO23 2MHFA 4K20A 3H1WA 3VZLA 2VGDA 3ZMNA 4S2HA 1AYN2 1BEV2 1LECA 2BVBA 2PHUA 1WCDJ 3SMHA 2HWB2 1PGSA 1PGW1 1PO12 1RHI1 1RVF3 4MX3A 2VVFA 4BH9A 1HRV3 2AUYA 1S0CA 1VAMA 4AQSA 1VAKA 2HWC2 5JPNB 4WZCA 1Y7BA 4GA9A 2RM21 2WJSA 3PHMA 1DU3D 1V6MA 1A6CA 4QPGC 2GMPA 1X36A 4RL7A 2W08A 5GZCA 3LCPA 1HV1A 4N53B 1ZVFA 3VBHA 4M3CE 1H30A 3NWKA 1CX4A 3HAGA 1F31A 4KGGA 4N53C 3TYJA 1O3TA 2QNKA 1RVF1 3N7JA 4O9GA 3UKVA 1QKQA 2DCTA 2ZGPA 3I2DA 4JV4A 3B02A 1NA1C 1UL9A 1XYPA 4LLOA 4CEYC 1QJX3 3OYWA 4YVWC 5CFDB 2HWC1 4L99A 3MZHA 1JHNA 1FOD1 4EWAA 1QJZA 1SBEA 1Q43A 4XZPA 5EWSA 2PHFA 5FLIA 1TEIA 2OW4A 2WZR3 4K21A 4MXVA 3VKOA 4Z8BA 4HT1T 4XJ9A 4PBOA 4B3NA 4XFBA 2PHWA 1LU1A 4EN8B 2DWRA 1OMIA 4YZ3A 2AZ5A 4BZ4A 4FOYA 1ZREA 5JOWA 3IT8A 1VAVA 1H9PA 3H9AA 2XVKA 3WNXA 1MEC3 2WL1A 1YI9A 3HD8B 1Q56A 2UYAA 1LOBA 3VBFA 4CP2A 1I5ZA 1SACA 1DF0A 1MZEA 2OPKA 4BM8A 1GZWA 1OPMA 4Y1XA 1JYIA 1GNHA 4FPFA 3POSA 2H0VA 1LHUA 5SV8A 1FOD3 4M00A 3ZIXA 2R043 1W6NB 4AFAA 4K6BA 1OQEA 1FNZA 2BFUL 2WA4A 1S0EA 2DCJA 2O8QA 3VKNA 4X8PA 2AENA 1R083 1G8WA 1MVEA 4JRAA 1D2SA 3LOBA 4N43C 2WNVC 3VL8A 5A3LA 4FT8A 2NLRA 1MS8A 1HLCA 1WMDA 4Y22A 3AFKA 5FFOC 2DCYA 2PTMA 2HWE3 3WQ1A 5JSRA 3C3VA 4AGRA 1RJ8A 3RI9A 3BB6A 1WD3A 2HWB1 4CDXC 1CJPA 1LRHA 2Z69A 1FV2A 1WLTA 1LHOA 3ASIA 4CZSA 1MZFA 1ND2C 4OI1A 1POV3 3CEWA 2PAKA 4FOWA 4OHXA 2ZJCA 4IEQA 3O12A 2R073 1TME2 2R071 3MLKA 3IMNA 4M01A 2GNBA 4KWLA 4AEKA 2WT0A 1YCIA 4Q4Y3 4Q0VA 4FSJA 4P9LA 4IEVA 1JH5A 3L2HA 4L97A 3WP4A 3E6BA 4Z82A 4YGDA 4WVZA 2NMNA 3FZ3A 5FBZA 1BJQA 2ZGQA 4F83A 3ZN6A 4HSJA 2DUPA 4DY5A 5H9QA 5I8SA 2RM23 2Q30A 1YFYA 4EWEA 5DUWA 1CPNA 4INDA 3JCIA 1D4M2 3IDEA 2Q4SA 4Q0SA 4DQAA 2R042 1MZ5A 3KT4A 4OZXA 4XOGA 5CG8A 4PIYA 1KS4A 2D93A 2QZ2A 4OUSA 5GLTA 4BE3A 3MIHA 3TWIA 3B01A 3AB0A 2VUJA 3AP4A 2C5DA 4GQ7A 3VZNA 4R9DA 1GV9A