3I96A

Ethanolamine utilization microcompartment shell subunit, euts
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
109
structure length
109
Chain Sequence
IIQEFVPGKQVTLAHLIAHPGEELAKKIGVPDAGAIGIMTLTPGETAMIAGDLALKAADVHIGFLDRFSGALVIYGSVGAVEEALSQTVSGLGRLLNYTLCEMTKSLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ethanolamine utilization protein eutS
publication title Structure and Mechanisms of a Protein-Based Organelle in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural protein
total genus 26
structure length 109
sequence length 109
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i96A00
2G13A 5DJBA 2EWHA 3BN4A 4QIFA 3DNCA 3SSRA 4DDFA 4QIVA 3N79A 4OX6A 4OX8A 3I96A 4LIWA 3SSSA 4P7VA 2A10A 4RBTA 5L38A 4OLPA 3VCDA 2A1BA 3H8YA 3CGIA 4AXIA 3PACA 3NGKA 3SSQA 4OLOA 4OX7A 3NWGA 2A18A 4PPDA 4QIGA 4AXJA 4RBVA 3IA0A 4RBUA 3MPYA 4P2SA 4P7TA 3CIMA 3I6PA 4QIEA 3DN9A 3MPWA
chains in the Genus database with same CATH superfamily
4FYWB 3BREA 2XULA 1JLGB 5GAEI 4P75A 3VAKA 4IH6A 5J2MB 3D3BJ 4JI0F 1DQ9A 4CDIA 2QLJB 3H8YA 4FXWA 2HFVA 4J9UE 4KJIA 3CJ4A 4A8YA 4XAKA 2DNNA 3DRYA 4LJMA 1K44A 1B99A 3H42A 1XMBA 4WYWA 2WAQD 3RB3A 2GMHA 1M5SA 2ADBA 2VA2A 3TQ1A 1FD8A 3WX8A 2BJ7A 1LWFA 2XSJB 2HQDA 5LMNF 1WOOA 5IS2A 5LJ5Y 1VYAA 5IT4A 4DZDA 1PBAA 1PGZA 1SQGA 2ZH8A 2D3ZA 2RD5C 3W9JA 2ILYA 4OX7A 1Y00A 3ZTQA 3PDNA 2OLWA 5H9EK 5A6PA 2VZ9A 1JKHB 1QJHA 1LOUA 2Z57B 2GW8A 4K5SA 2FVSA 2D74B 2B4PA 2XO7A 2SXLA 2PI5A 2DHHA 1VC5A 2MKCA 4NE9C 3M2RA 4KIAA 2GFFA 3A3NB 3CDEA 4CM2A 4B9SA 1JNZB 4OZ3A 2UUBJ 1IQZA 4I6WA 2KZZA 4QR2A 3JSMB 3D2WA 2V4JA 3ILOA 1VBYA 2AYGA 4RU2A 4IOCQ 2ZBQA 3UD4P 1A7GE 3LP1A 1TU0B 3ENAA 4OZ2A 3CCWA 4LRBA 4I56A 2ZUGA 4KGZB 2HMIA 2NPFA 2CPFA 4UF4A 1I1GA 3DLHA 5K8OA 1H2VZ 4O3OA 1FRIA 5DS7A 7FD1A 3I55S 3QFHA 3BPSP 1BMQB 2DK2A 2HYIB 3PW2A 3DFEA 1FWKA 1VQPS 1FK9A 2A6MA 2JEFA 2PC6A 2WVFA 4B3OB 1RXOB 4W4MA 5LSLA 3OT9A 3TO8A 1GX6A 1N33F 4YR2A 1TKTB 1B0PA 4EGLA 2C2NA 4K4ZA 1HBNB 2E1PA 4Y2MA 1RHKB 2OGUA 2C3MA 2A10A 4U96A 3CULA 5IXUA 3TVKA 2QA4S 5J2QB 4JUZA 2V0NA 3LQVA 1U09A 4MMOA 3HMJG 2R7WA 4Q2LA 2NUHA 3AT1B 4L3KA 4QWAA 3KXDA 4LR9A 4HR2A 5D3GB 1T03A 5A2QU 2LQ9A 3FBCA 4ZOSA 2NXUA 3ICLA 4IOBA 1CJKB 3HI9A 3K58A 1EHWA 1I51B 1KLMB 4BHQA 1F0XA 3IRXA 4JI1J 2PI4A 1VRUA 4OQJA 1U1NA 2LYVA 2BQRA 2HHXA 3ZTPA 5E3RA 2FVRA 3GP9A 2NSCA 4TN2A 1HQEB 3I87A 2DPIA 4I2PB 3FBFA 4E0DA 2PT0A 2DYAA 2RRAA 1P1TA 2KKHA 3AAWB 1NSAA 4QPTA 2B4OA 3UR3C 4J9SA 2ZDOA 3KMQA 5AT1B 2QLWA 4B9NA 4DZ6A 2ZH9A 4ZHRA 3R8YA 5AJ3J 4EEYA 4O3PA 4DFJA 4WBFA 4Y2CA 1D3WA 2BANA 5GVQA 3GB0A 2FLLA 2HWHA 2WBMA 3F73A 2ZOMA 3B4DA 2EEYA 2PGCA 2GVZA 3QQCD 1RWOB 1N36J 1ZAVA 4HHJA 5BXIA 1JLFA 5DGBA 2LU2A 4GKKJ 3JSRA 4TLQA 1Q8BA 2A2CA 1DTTA 2LQJA 2YNFB 1UEKA 1JX4A 3UR0A 2ZH2A 2C1EB 3QRQA 3I6PA 3Q2SC 3MXHP 4LF5J 4QWDA 1W25A 4DR6J 4EI2A 4DUYF 1SC1B 1X4BA 1BWEA 5DM6Q 1ZBTA 2ZH7A 2K8GA 2B6AA 2DCLA 1IBMF 5J1EB 2I8EA 3D0HE 1WSVA 5HAOA 2KB2A 2IC3A 3DLEA 4OYAA 2Z8QA 1Q16B 3HVRA 1RQ0A 4O4RA 2HNZA 4IG0B 5EX0A 3CCMS 3T9NA 5A8RB 3G82B 5AXKA 3TUJC 4CNZA 3MOZA 9RUBA 2G2OA 3GFHA 3J81Y 2AYBA 3GIJA 1PILA 1HNWJ 1H2UX 2CJAA 4N41A 4C8ZA 3HZGA 3SCJE 4ID5A 2P5VA 1RT3A 2ATCB 1JLBA 3CD0A 3LH2S 1F9FA 4ZA1A 2HNDB 3QIPB 4EZ9A 3G6XA 5HP1A 2DNOA 1S9EB 3NCQA 2IY5B 3M2VB 1FRJA 1DTQB 1F5CA 3QGPA 3BV8A 3EJMA 3BSCA 4RW7A 1YGYA 3V6JA 2GIFA 3JS9A 4U7CA 3NBPB 2JL9A 3A8JA 3MM6A 4USKA 3KLFB 3J7A1 1BQNB 1KDNA 3M9MB 3A8KA 2D41A 4M5JA 2YKNA 1KQGB 4XO0A 1X9MA 3QJJA 1TL1A 2BJ9A 1NHVA 2BQ3A 1MN9A 5FIIA 3VALA 4YB7A 4PCQA 3MAHA 3THPA 4OJ1A 1LEOA 2E5IA 4GVBB 1HBMA 1DAXA 2AX1A 3FRYA 1HNIB 3P3DA 2AJ0A 4KO0B 4PUOB 1DHMA 1RJJA 4F8RA 4YB6A 1RT5B 3OTOF 3NAIA 3G8SA 4J9QA 3LP0A 1KBRA 1RAEB 5C42A 1RTJB 4IH5A 4FF3A 3R5DA 4DV7F 2QC3A 2HG4A 2ZJRQ 3DRSA 3ELHA 3JAMY 2MKHA 4A8QA 2UXDF 2B9YA 3V81A 2DHAA 1RT6B 3DRRA 4N7TA 3L09A 3FSIA 1HMVA 2OPRA 1RADB 2G2YA 2J76E 1UTAA 4F25A 1FKPB 4NMLA 5D0RA 1X0PA 1RISA 5HQ8A 3O5TB 4UY85 2NYHA 5AE3A 1RWVB 2E29A 5F0UA 1NSKL 4JI6F 1QAYA 4X4NA 2VOOA 4IH7A 1YJVA 1Z2ZA 2LP4A 5AXLA 2DITA 3O3LA 5CCMA 1ZZNA 8AT1B 1V3RA 2E1RA 3NL0A 1G2EA 3NGRA 1F5AA 4DX7A 2V34A 1HR0J 5KT5A 4N47A 4CLFA 5HO4A 4UOFA 1H38A 4AL6A 1RHUB 4DR4J 4ZN1A 5GAGI 4X4TA 1L3UA 1BGXT 3DMJA 2CPDA 8RUCA 1ROFA 3UVJB 4Y0FA 2Y1LB 4ZCKA 4TVAB 4G3IA 5M2RA 3MEDA 3CCVS 2XMKA 1SB6A 1KLNA 1HI0P 2BEFA 1VI7A 1NUEA 1I6JA 3GG0A 3BSOA 4L75A 5E3AA 3VVUA 1JXEA 3UN2A 2ZKTA 1EQMA 1UJ4A 2VODA 1IR2A 4OX9J 1BXNA 3C6UB 1P6TA 4OYPA 1UP1A 4RW6B 3HVWA 4K8RA 3QBCA 3BBCA 4JI4J 2HBRB 5I3UB 3VCDA 2YBVA 3MR3A 4YDDB 4MFBB 1VBXA 4B9UA 4DOZA 4BLGA 2KM8C 1NZAA 3TRGA 1IBCB 3M9NB 3UQSA 1YIJS 2OTJS 3Q8QB 2GAGC 1ITPA 2NYIA 1ZM4A 4DSLA 5F8LA 4DEZA 1N5YB 1PO6A 1IKXA 2ZM6F 2F8MA 1JNRB 1HI1A 4EYHB 2RKIB 4RO0A 1TK0A 5KG4A 1DY3A 4K4UA 3OW2R 5EWGA 4P52A 2DNGA 4IDKA 1WI8A 4OMFG 1X4EA 4GKJF 3A8IA 4E8UA 1GMUA 1YX2A 2JFDA 3B78A 4IKAA 2GS8A 4M5LA 4DSEA 1U6FA 2XB2D 2YWGA 3MMBB 4L73A 1WTFA 3FFIB 2OEMA 2VDIA 4L6V3 2AGPA 5ETQA 2LVWA 4RW8B 4J9RA 4NXNF 1XK8A 3KLIB 3TOQA 1WHVA 4R5PA 4ILLA 1E6VB 2HZAA 1S1VA 4X62J 3VAJA 5IT9U 2MQ8A 1SC6A 3GSIA 2VQFJ 3GIKA 3PRDA 2CQDA 3C19A 3B82A 2QFJA 1X4FA 1VHIA 4OFZA 3US5A 3EM1A 5E33A 3LO3A 1LXNA 2BACA 1N52B 3KWMA 4KFBB 3T1HJ 2JNJA 2MZ1A 2ROEA 2Y8YA 3G6YA 3AJ2A 3EZOA 1XMQF 1J5OB 4DFMA 5THWA 3CCLS 1T7PA 4HACB 3QT6A 3AJ1A 3IBFB 1F3VA 3KJVA 4NLVA 2U1AA 2CJXB 2DJWA 2CPJA 1XWLA 1N54B 3M30A 3QWPA 1TKXA 2ZOGA 4OYIA 3C15B 1RAGB 2BKNA 1FNMA 2MHNA 2HQGA 3R5GA 3W9IA 5CYQA 4DI6A 2ZEJA 4ZVSB 4MJKA 5KG1A 4CTAA 3RRHA 1R0BG 4LR7A 4NCBA 1QDUB 1TL3B 2J7UA 1TL4A 2NQPA 2CIMA 3TJAA 4K4XA 2MZRA 1DLOA 3CPWR 2V6AA 4YY3J 1T9YA 1EKSA 2OFGX 1B64A 2WSFC 2Q6BA 1N48A 2WBRA 2N7CA 3RUBL 5DDRC 3VGVA 1R8CA 2ACYA 1HKAA 4R25A 3CW2C 3T1YF 2HRYA 2WCXA 4B3TF 4FBUA 1NPKA 1AZSB 1JLGA 3Q89A 1Q4RA 2RH3A 4FYDA 4IYQA 3MPDA 3AJDA 2Q43A 4ECVA 3TA2A 5J2MA 5A2QY 3DHWC 3FJ2A 2BM0A 2P9CA 2R2SA 5C7PA 1Y3JA 4C97A 4LF8J 5KFAA 2Z2ZA 3A13A 3DKDA 3MEEB 4KH1B 5LSOA 4LRCA 2MMYA 2N3OA 3BGRA 4AL5A 2MKSA 2HHHF 3QNWB 4WYLA 2XSJA 5DQGA 2MQMA 4TKTA 4ANEA 3UDEA 4EU0A 4LT6A 4Q45A 3P45B 1QSYA 4CLUA 3BJYA 5H9FJ 3GCWP 3TNVA 5BR8J 4TQSA 4NCGA 2HW3A 2YPZA 1RT4B 1FFWB 4A46A 3EGWB 4DR3J 1GTHA 2HVEA 2L9DA 1NK6A 4DCOB 2UUAF 3U27A 3SCIE 1RA6A 1IBLF 4IUFA 4OYBA 4EO6A 1RWXB 1IKWB 1HWJA 3LA0A 4PKDB 1H0HB 1Q53A 4M1KA 2Z58B 4PXBA 3JTNA 3LP2B 1UVKA 4DV5F 3OTBA 5KFFA 2QA4G 2QMUB 1SBRA 2VICA 2PMZD 1F3FA 3KKFA 1H98A 1M0SA 3AY0A 2HLUA 2V2QA 4QWBA 2YKQA 4OHVA 4HH1A 2H48B 3QT8A 5DETA 5LSRA 2H65B 4PPZA 5I4MA 3CCJS 5K20B 1H73A 4C4WA 4F0MA 1VR6A 3UDCA 2KT2A 3UN3A 5FDLB 2FZGB 5H1SV 1UWBB 5D0GA 4IR1A 4BC7A 1EETA 2V4QA 5KG0A 3M1VB 3R6LB 4PWDB 2VG5A 1B7YB 1S6PB 3A3OB 1NRKA 5F8IA 2RF2A 4KE5A 4LFCF 3BN4A 3KMSA 2KYXA 1SH3A 4LSLB 5E5NA 5ETTA 1IKYA 1WTBA 1KOOA 2JEGA 1O5JA 4B3OA 1OSCA 1T3OA 4ZJLA 1N88A 4MAKA 4O4GB 4ZCMA 4DV1F 5CD4H 1HBNA 2CZVC 4KHPF 1NKBA 2OD6A 1WC5A 5E3PA 4C7QA 4KGXB 3KLHB 1G4CA 2R7RA 3OJUA 3CMES 4HHUA 1XNRJ 3BBBA 1TV6B 2XNQA 4JV1A 1CJTB 1ICEB 1KWMA 4ANDA 2H1YA 5SZTA 4M63A 3LAKA 2IJRA 2EC0A 3KG1A 3FCWA 3VAMA 1F6TA 3OR1A 4UT4A 3HSDA 4YB5A 1UCNA 4P2SA 5KG7A 4DR7F 3H59A 3FRZA 3IGVA 1CJKA 4HVZA 1SC3B 4LQ9A 4LBHA 4U9RA 3C16B 5B7WA 2F4FA 1PAUB 3W65A 4NLXA 2QT7A 3UNYA 1S6QA 3X1LB 3MPWA 1R31A 2PE8A 5GMEA 2R7TA 2HFSA 2MGZA 2YXLA 1FX4A 4TU8A 1UA0A 2BVZA 2M2BA 1KS2A 4I2PA 4TU9A 1J2VA 2HLTA 3E51A 4Z7YA 2FDNA 1LQ9A 2KI2A 1F2GA 4DL7A 4S0MA 4H4OB 5KT3A 3K8WA 5GMDA 1B0TA 1KHWA 1OY9A 5A8WA 2BRLA 1KP6A 1WI6A 3DOLB 3NMRA 2MKJA 1FDNA 4OYOA 1AFIA 2KG1A 4JI5J 2XSFA 4J37A 2OHDA 4HHHA 2DHSA 1VQLS 2WVEA 2RIJA 3C2PA 3MOJB 4ALZA 3CCQS 2HSEB 4NA2A 2UXCJ 5DRKA 5KFIA 4OX8A 2LECA 2R8HA 3K17A 2YNFA 1MLAA 3BR8A 2HFOA 2XTJP 2UUCF 1RA7A 3PJXA 3BGFA 1OYDA 1JQGA 2QLFB 2W2NP 1JB0C 3I82A 2Q79A 2JC0A 1YI2S 3EGNA 4XDCA 2ZHAA 3AD7C 5ETNA 1U24A 4NCAA 3AA8A 3ULHA 3E3XA 3MM7B 5BYQA 2H5JB 5KG5A 4N5SA 1FKAF 2ZBCA 3RTVA 1YJWS 2R7SA 2R8KA 3DM2B 1VRTA 3JSYA 2R7OA 3KG0A 5KFYA 2W4PA 4C98A 1X60A 4G1QB 3R5JB 3OL8A 1A6LA 3BN7A 1TFWA 2CWKA 2RILA 4IG0A 5A8RA 3G82A 2UV8A 1KD1T 3S01A 1D0EA 4PWUA 2FJXA 4ED6A 4CH1A 4DJBA 2AJQA 3M2UB 5C25B 3CCUS 2ZBIA 2V68A 4B9MA 5KT4A 3RBZA 2MZTA 3PY8A 2L3MA 3A12A 5J2PB 2RSQA 2XCPA 2LDIA 3K59A 3OXFA 1HHSA 4ZLLA 2HNDA 4DV3J 1YKWA 2B56A 2F8EX 2VG7B 3M2VA 2QSFA 2XWYA 1YTYA 4DUTA 1DFDA 1AYEA 1XR7A 3NS7B 3QGGA 5D15A 2VPWB 2MY7A 3KLFA 1BQNA 2C2EA 3H4DA 3MM8B 4HL9A 3PX6A 2NXEA 1S4FA 4N8NA 2XC9A 1U2CA 2R42A 1FESA 1M1GA 3RRKA 3ILLA 2DXDA 3GYNA 4F2SA 4ZPCA 5HBMB 1QM9A 5B09A 2W2QP 2K3KA 4GVBA 1HD0A 1S6UA 5CXTA 1TUGB 4J9VA 1HNIA 3T1AA 3CD5A 4RNFA 2CJYB 1S72S 3KTQA 4RBTA 4KO0A 1M5PC 4KT0C 3K0JA 5KFEA 3GILA 4PUOA 5A0YA 1WHXA 4JI2F 2RDJA 4FKYA 1XTZA 1KQSR 3CC2S 1TFYA 2GIQA 2HS0A 5B0DA 2YY3A 3TUPA 2H51B 1RT6A 4ECWA 1IM6A 1DURA 5IT9Y 4G6VB 1UW9A 3QSIA 4ZLPA 1WSRA 3FUYA 2RRNA 3PFEA 2PFDA 2G0JA 1RT1B 3KJQB 4J90A 1GTEA 3S8SA 1ZM2A 1APSA 1NXIA 1R0AB 1U6BA 1TAQA 1LFPA 3HHLC 2RRBA 4F67A 2JH3A 1MMNA 1YRTA 1VQOS 2E9ZA 2X3DA 3OHBA 4ZPAA 1KVKA 3HSZA 2HNYB 2R7VA 4U7UK 4LRDA 2VIHA 3AODA 2WTFA 4LF7F 4C3KA 4B3RJ 1J27A 1VISA 4LFAJ 4WCEQ 1RU1A 3R7BB 3VTIA 1WOPA 4CLLA 2AZ1A 3LALA 1Q7YT 2ZVIA 3KK1B 4QIEA 3M05A 1SI9A 4KPYA 4DL6A 2DY9A 1BQXA 4A4JA 4UOHA 4JV5J 1S1TA 4X64J 3MAAB 1QE1B 4JYAF 3C6UA 4HH0A 2FLOA 3PR5B 4RW6A 1YLXA 1YWXA 4ECTA 4J7CA 2G4BA 1EAYC 4JI3F 3Q23A 4K0KF 5IQ6A 1NMEB 3UD5A 1TMJA 2QRRA 4R8UA 1FDAA 2LQ5A 1N5YA 2XMMA 5HI7A 1OO0B 3PYDA 2VV5A 3MEKA 3TW0A 1O6XA 3J7YI 2FC9A 4DV2J 1N6QB 3TAPA 1LWXA 2IYGA 2V5HG 5HSPA 6AT1B 3IC1A 1FD2A 3SCLE 4QBUA 4QR0A 4GO5X 4EBDA 4CLZA 2M88A 1S7IA 2J0SD 1VLOA 3CNQP 1KVJA 4J91A 4OJGA 5DGAA 4OZJA 2IJFA 3MMBA 4KGKA 3MCOA 1SCJB 4KAIA 1NAQA 2FLNA 2VUGA 4NYZA 3GPAA 2HQFA 3KLIA 4URGA 3HCXA 1RK8A 4QWCA 3R9LA 3DGPA 1RZMA 3WC0A 1ZM9A 2XWXA 4C8LA 3CE8A 1PAEX 3D6MB 3HD1A 2XY7A 3CSKA 2GC8A 5KTQA 2UXBF 1SIZA 1FHTA 1QVGR 2W9AA 1F60B 1H74A 5EX3A 3WZ0A 4QIFA 1Y4ZB 2V8HA 3UNGC 4FF2A 2QX0A 4NYPA 1FF2A 3BH7B 3NOGA 2M4MA 3WQPA 1T8EA 1L3SA 1FEHA 2YNIA 3E2EA 3ITHB 2H4WB 4RUCA 5IC4B 3W3SA 1YRXA 2J6SA 1RT7A 1GNKA 4ZVTB 2WVDA 4F50A 4HT5A 4MKBA 1WACA 3DRXA 1H6KX 4X4RA 3EVWA 1B70B 2IM3A 2J9CA 3PYFA 2MKYA 2EK1A 4X4QA 1XNQJ 4P74A 3B8HA 1HNVA 3IMQJ 2O01C 4X65J 2YWHA 5KG2A 5EHHA 3AOBA 5KG3A 4O0IA 2NZ4A 3FKBA 1RWWB 3IR5B 5CAAA 2Y9HA 5B0AA 2DH9A 2AT1B 4F26A 3W5ZA 1O0PA 3ZTOA 1CJUB 4BC9A 2DGVA 5EDWA 1Q82T 2IRUA 5KFQA 4MH8A 1ZA1B 3NGTA 1S57A 1AZSA 3UCUP 3HF5A 1RAJA 3QZ8A 3NRBA 2QIFA 2WONA 3JYTA 1TL7A 3M32B 2QYCA 5GAEU 1RHJB 4RW9B 4ZVRB 2UUBF 4ZVHA 4ZPBA 3MCNA 2IPOB 4F4WA 5DJBA 3U1NA 3T9ZA 3W9HA 5EGYA 4WIIA 1KRPA 2K06A 4DPXA 3RBXA 1JXLA 2OEJA 2ZHOA 2E66A 2C3OA 3C46A 5CZXA 4PPDA 3BPDA 3D1OA 4A48A 2DBBA 2FYXA 1IVZA 3A1YG 1KVIA 1YSJA 2XZTB 4I2QA 3DXSX 4RX6A 1VLYA 3RW6A 4CH7A 4MIWA 3VQTA 2XCAA 5L9NA 2BYCA 4DR1J 3SSSA 3P8BB 2GX8A 1JLCB 4Q5VA 2H54B 2MQOA 2FGCA 1U48A 1G1XA 1IJEB 3CIMA 4IO1A 4X66J 3LP2A 3FQKA 5D4LA 1R6YA 5KFUA 3W8GA 1UA1A 1YQHA 1FRKA 5D0HA 4XTTA 4CO5A 4G65A 1OMSA 1PIEA 1IWAA 2BZ2A 1QUVA 2HVIA 4V19X 2GJFA 1YBTA 4K59A 3SI8A 5FDLA 2G0IA 1AXQA 4HKQA 1R8HA 4FXVA 3OVBA 3D4JA 1VK3A 4OI0A 1CC8A 3M1VA 4NA3A 2BE9B 3LUYA 4PWDA 3Q8SB 3HHNB 4OI1A 2VF3A 4ETXA 4HDHA 1N4LA 2WSCC 4JI7J 1JK9B 4JI1F 2VPZB 1CJVB 1BLUA 1NDCA 3H20A 5E3QA 2HAFA 3G2XA 4O4GA 3MCMA 4OIXA 5T41A 4DL0C 3Q86A 4PXDA 2OEKA 3NS5A 3EXCX 3KLHA 1AT1B 2OUGA 1ZZFA 2CADA 1ZPVA 4YUDA 2QL5B 4ZLJA 5H9FK 5AJ3F 2IIHA 2DGQA 4A8MP 4NX9A 3UW1A 4AXJA 3TZZA 3WC2A 5ETVA 1FVQA 1N33J 3DDKA 1CJTA 2PMWA 1S9GA 5C2CA 4C2MA 3CIZA 3I32A 1F5BA 2GGPA 4ICLA 4V1Ak 2JLEA 2X1BA 1N36F 1YBAA 4LBPA 1CLFA 3AOCA 1YJ9S 3M8YA 4PZVA 3GFYA 1UW4A 4E2FB 4WZMA 3C16A 2J7WA 3WDOA 2E5LJ 2PA8D 3M7VA 2IYIA 4DX6A 2FJAB 4RUHA 1NPPA 2W9CA 1KC8T 4ZVOB 1RBOB 3R2DJ 2L48A 2F9DA 4O3SA 4LFBJ 4ZJQA 2B5JB 3QO9A 2G13A 4EK2A 2EWHA 2DRBA 2L41A 4LF5F 2DGOA 1Q78A 5F41A 4DR6F 4NLGA 3KDNA 4M5KA 3MM5B 1E6YA 2FVCA 4P2XA 5FD1A 3B6BA 4ZPWR 2HFNA 3S6EA 4OYXA 1RAOA 3BSAA 1SKUB 1Q86T 2HPUA 4X4PA 3NWGA 3CB4A 2VHGA 2CXEA 3DOLA 2LU1A 4HI1A 3FEYB 3TAMA 4DWIA 4Y3CA 3N6NA 2VFTA 4I68A 4Q2MA 3PW4A 5KOXA 2N7YA 4OHZA 2OELA 2R2TA 1C0UB 1RT2B 4DU8A 1X4CA 1OY6A 1HNWF 1NJIT 1U1MA 1C1BB 2F63A 4X2BA 3BF4A 1IM4A 1XJWB 5HANA 1YHQS 5ETSA 1WKKA 3MR5A 5FJ4A 2LFVA 4DV6J 2J0XA 1ZYQA 1U1QA 5F8MA 3D54A 1XERA 5ADZA 1T9WA 1KKHA 5KFRA 1MROB 4Z7CA 4F3QA 1Q1KA 2MYFA 3W8PA 3CJKB 4D3GA 3CCRS 2ROPA 3MM7A 1HIYA 2OAUA 1T0TV 2A18A 1LV5A 3OD2A 4WXOA 1JWWA 3EYZA 2BKOA 2FQQB 4DSFA 1FE4A 2KL8A 3SFGA 3TR5A 4G1QA 4ECYA 1NKEA 5E2QA 3M8ZA 3BYPA 2FD2A 1NZ8A 4NYOA 4M95A 4RBVA 4C11B 3AB4B 2EPIA 1URNA 2EG1A 4K4SA 1KQFB 1S48A 5SUHA 5EWFA 3TVZA 2ZDPA 2W2MP 3ZZZA 1JMTA 2V2VA 2JRSA 3M2UA 3T5JA 5C25A 3PX4A 3PNIA 2KXHA 4RUBA 5J2PA 1FJGJ 5KFMA 1U0HB 1FWPA 2HZCA 2RQMA 5CYJA 3MGJA 1HYSB 4OJHA 2OPPB 4OJ3A 2VG7A 2CQ1A 4ID8A 2CQIA 4JV2A 3QT7A 3UWTA 3NOCA 2CAJA 4DSJA 4GO7X 1S4EA 2OFHX 3MM8A 2DNQA 3PHEA 1MG7A 1TTHB 3KLGB 2R3VA 3HDSA 4FF4A 5I3QA 4DR5J 4AUKA 3HKWA 1WC3A 3SDEB 4K4WA 3IR7B 2VOPA 1W2BR 1A9NB 2VFSA 5HBMA 2FB0A 3OBIA 1L3TA 2HHSA 2Q66A 3GFZA 3DOKA 5ETOA 2FY8A 3POTB 3HX9A 2BE2B 2NS1B 2RUGA 1HBUB 3IN5A 1HR0F 4FZVA 3QYYA 2W8LA 3GE9A 3EXYA 4P9SA 4M8LA 4WK3A 3CJ5A 2FGOA 3DCAA 3GJRB 1EB0A 5E41A 1U45A 4DU7A 1SKRA 4DQPA 4Y2AA 2MQLA 2W4CA 2GHVC 3FVYA 4RPFA 5HJXA 4OX6A 4B3SJ 2V67A 4IFVB 1RT1A 5J1NA 5K9FA 4CYUB 5B0EA 1R0AA 1IUJA 2POKA 4OX9F 4FDFA 3RJMB 3BKFA 4FYYB 3JQMA 1FXRA 3EICA 4DG1B 4ZP8A 4ED2A 1Q81T 3M6XA 3C14B 4DV4J 1NCLA 4ZVFA 2VPXB 4TY8A 4YB1P 1YRUA 3IGNA 5F8JA 1EARA 2HNYA 3KUEA 2DH8A 1V3ZA 1PC4A 3PW0A 5KFWA 3IFEA 1V5IB 3ETMA 4NA1A 3TP2A 3ET6B 2OPSB 4I64A 1ZTTA 3W5XA 3SYZA 1YBUA 1RCXB 4ZK7M 3KHLA 5GAGU 2J6TA 2ABYA 2ZKUA 4MKVA 4LF6J 3CTRA 3P4UB 3KK1A 5J2NA 1C4AA 1UPMB 2WRMA 2CJQA 1LK5A 1TVRB 2AGQA 4LF1A 4CIOA 2YTCA 4TLRA 4ZIWA 5M2PA 3T3FA 2HK2A 2OMLA 3KK3A 4O44B 3G6VA 2JZ5A 3TA0A 5LT5A 3IG1B 1HWIA 3MFIA 1QAIA 2GVDA 3VHQA 2YKPA 4GC7A 3NG8A 4USIA 2X51A 1K47A 2WVBA 2FHKA 1JLEB 2HBQB 1UFLA 2IRYA 4X62F 2VFVA 2VQFF 2A0FB 2P2CB 3B4MA 5CYMA 4UY8T 2CPIA 3VZIA 4WIQA 3H5YA 1Q79A 4NRUA 2IA6A 4DLEA 2ZHBA 1TR0A 1X31C 4ES1A 4LIWA 1EP4B 3T1HF 5HMXA 3FC9A 1KHVA 1ZAWA 1C1CB 1WC0A 3VV2B 2CQGA 4YOEA 4EZ6A 4ZN3A 3MD1A 4I7FB 4QU7A 1N34J 2FJEB 3EGZA 2O67A 3TZXA 3WIUA 2ZWPA 3RR7A 3PVXA 1QVFR 1HNZF 3BBFA 5L1JA 4PQUA 1IKVA 4OV1A 1L5UA 3BM7A 2E7VA 4LF9J 3L9ZA 1BY9A 5H9EJ 3O44A 1ZA2B 4GKJJ 1WWHA 5ETLA 3QRRA 3LGHA 1PYOB 1WC1A 2E44A 4H4MB 1S1UB 2LQ8A 4YY3F 1K1QA 5A6WA 4DX5A 3GG1A 3BGLA 1XR5A 3BKUA 1JLAB 2HURA 3PYGA 2CPXA 3AFGA 2BE7D 4J9OA 1ZS6A 1RTDA 3MMJA 3QAUA 1MWZA 4FKXA 2OMOA 4C8MA 4PYDA 4ZVPB 2HZVA 2RT3A 4LRFA 4RNHA 2G0CA 4DHVA 1QAXA 2YQ1A 3I4PA 3BH6B 2MQQA 4WU2A 1Q8IA 4Q7AA 4LF8F 1R8BA 1NO8A 4LF4J 3G86A 1XMQJ 4L76A 5K14B 3SCKE 1NK5A 1X7VA 3FZBA 4LUBA 2XMUA 4WP9A 1TMMA 4DN0A 2Q1LA 1B4SA 2M0GB 3OFEA 4L3NA 4RBUA 2QGFB 2JVOA 2AD9A 3CJTA 5HMZA 5BR8F 3PM9A 1HW9A 1N32J 4MKYA 3U1LA 2HS3A 3MPYA 2J0QD 2C3YA 2YNGB 4DL2A 4OYZA 3M8SA 7AT1B 5KT7A 2VG6A 2DT9A 1CULB 3VZHA 3QIDA 3DLJA 2HHWA 1OIAA 1Y0HA 2FJBB 2GIRA 2CJBA 3IWXA 5JUMA 2MJNA 2APOA 1MU2A 5RUBA 1MNEA 1XBWA 3QLHB 4U8VA 2DPJA 3M32A 2ATLA 2IVFB 5A76A 3G96A 2CPZA 3DU5A 3SEOA 4Y28C 4RW9A 1T05B 3AOAA 4MK8A 3T1YJ 4LQ3A 2P6TA 4JB8B 5CZVA 2PIIA 1D09B 3HHLA 1P9QC 1RGVA 1PC5A 4USUA 2WK4A 3PRVA 3IRWP 1QD1A 3GONA 3VF0B 4WFBQ 5CD4A 1B7FA 3HJFA 4PXEA 2WVCA 2J8SA 4ZKAA 2L08A 1MW7A 2XHWA 2BABA 2XMAA 5HQMA 4PABA 3OFHA 1WUUA 3K2YA 4BCAA 2DVIA 3NXZA 3FBEA 3LP1B 2KDOA 1N5VA 1S9FA 1OS5A 1VBZA 2OKQA 3EX7B 2ZD1A 1S1XA 1D9FA 3IBWA 3MZIA 4LVNP 1K73T 1JLCA 3BQ2A 1AW0A 5D0EA 4ZVGA 3DI6B 2EBGA 4QWEA 2DR7A 1X4GA 3BO4A 3MCSA 3ZZOA 5F9LA 1SC4B 3FDSA 3J80Y 4OI6A 1FDBA 5F8HA 2YNHA 2GQ2A 3KDOA 3HSJA 4LREA 1TELA 1OJ4A 2GHPA 1YJRA 4QIGA 2XNRA 3H0PA 3DLLQ 4WTYA 2PEBA 4UUXA 3M8RA 4ECXA 3CF5Q 2FC8A 1RHMB 4I6YA 5HQLA 2BW2A 2CVEA 5A8KA 2O3DA 1O51A 1EKRA 1OWXA 2O5DA 2FPHX 2QSWA 4ECRA 4Y6IA 1MWQA 5KFJA 1MMDA 1FNXH 2J8AA 2LXIA 2FUG9 2GCFA 3FCVA 1T03B 1XEZA 2VBWA 1UJ6A 4OHWA 1GMWD 1FTCA 2CQPA 1WD6A 2MKIA 1TKZB 3IAM9 1CQNA 2W1BA 2RNEA 2NCKL 3OR2B 5K8PA 4USJC 3EGVA 4ENOA 2YH1A 1WC4A 2ADCA 1S5ZA 3I4HX 1RACB 3E01B 2IDEA 1HL6A 2FJVA 3ENQA 4FP9A 3OQ2A 1VC0A 1HHQA 4KHMA 2DNYA 3V6KA 4PQAA 4AE5A 4JI5F 3CJRA 1RP5A 1CS4B 2XLJA 1RLCL 1EJ7L 1PJ7A 3OHAA 2KT5A 4GVLA 2GA7A 3QRPA 3D6HB 2PDAA 1YJ7A 1S12A 2BQUA 2UXCF 5IM0A 1UKUA 2XY6A 1OPZA 1LWEB 3MHYA 3EZ5A 4G1IA 3CJ8A 2HVHA 1VDHA 2XMWA 1SIWB 2WOMB 5L1KA 4MK7A 2QO3A 4QW9A 1RB0A 4ZP9A 2UUWA 1JLFB 3V6DA 4PXCA 3QSYB 4O3NA 3MM5A 1DJ0A 1DTTB 4JOUA 4KH0B 1M5OC 3FGVA 4WK1A 1X0FA 3D6TB 3F56A 3N0VA 1FFGB 1JJ2R 2F4VJ 4YR3A 3PX0A 4PG7A 4NWBA 1HQUB 1VQ5S 1GXTA 4RWWA 2JSXA 1L3VA 3GR0A 5D4PA 4QQBA 2H9ZA 2E1CA 2QA2A 2VU5A 1BUXA 2A3JA 1T11A 2OTLS 2B6AB 2B9WA 3HT0A 2NXNA 2R7XA 1C0UA 2CVIA 1W2IA 3EDRB 1H7WA 3I9ZA 2I9SA 4C8KA 1NK8A 1D8ZA 4DPYA 2PFFB 2D9OA 4PRFA 4M5IA 4CM0A 2XMTA 2AJFE 3RB0A 1N56A 3CGIA 3MMCB 2VJUA 3I31A 5L1IA 4DV3F 3GIMA 5IC6B 4YQWA 3WHIA 4KKOB 1URRA 1RTHB 2HQIA 3CJKA 4KGVB 2R4FA 1SJ1A 2BX6A 1KSPA 1T02A 3HHEA 3H2LA 2CPHA 3TJ8A 2CZ4A 2C22A 4ID5B 1AFJA 1RT3B 2UUCJ 2FJWA 3MM9A 2HHPA 1JLBB 1MSWD 2AEFA 3DU6A 2ZH1A 1T3NA 2E7XA 4R0EA 4YFUA 2JDJA 5IFMA 4Z37A 3PKMA 1RE1B 3NKYA 4CLPA 3BGUA 4NLDA 5BYSA 4P2FA 3WX4A 3MM6B 4KR0B 2F65A 4OYMA 1HLWA 1TL1B 2PEHA 2ZZMA 1RI7A 1NKCA 1TZ0A 3EPGA 3UN5A 2HWTA 1RWUA 2HHTA 2FVPA 3TAQA 4WXWA 1U0HA 1U8SA 2EKYA 2I5JB 1HYSA 3PCOB 2OPPA 1UVIA 1GH8A 4KYZA 1R6VA 3R97A 2C3UA 4DFKA 5KFLA 2KJVA 2GMJA 4U8YA 3MMAA 3UCZP 1RAAB 2NPIA 2YWWA 3OL7A 2GO8A 3LTOA 2VQEF 3W66A 3LP0B 3JQJA 2DNPA 2GJIA 4EBEA 3RYLA 5HVGA 2C2MB 5HLFA 3DRSB 4UOCA 2IMOA 1WC6A 4YP3A 3SDEA 3DOMA 2YX7A 1VQMS 3POTA 1Y7PA 4ELVA 3GYXB 1Z2LA 3MEGA 1BC6A 2I6WA 1S59A 1H7XA 2HIQA 2RQCA 2WHOA 4C48A 3NEKA 3T19A 4FNHA 2W9BB 4LFAF 1ZM3A 1X9WA 2YWEA 2MTLA 2KHCA 2DRAA 5LMUJ 1QUPA 3CVKA 3FBBA 3K7RA 4OLOA 2OPQA 2I0XA 2MXYA 5ETMA 3FMBA 4A8XA 3GJQB 1K0VA 2HHVA 4IFVA 3C66A 4M5HA 2MY8A 2P6SA 3ENVA 4JV5F 4CYUA 2XYPB 4QIWD 4X64F 5F3ZA 2Q3PA 1UJ5A 4C3MA 3MEDB 2FLPA 3KNGA 4DG1A 4QU6A 2J6UA 4IG3A 4ED7A 3CJ2A 1S0VA 3C14A 4RLEA 1WDDA 2XGQA 4IRDA 1KFSA 4YN3B 3TANA 2QLBB 3ONQA 4J5OA 1G7CB 1REGX 1EIYB 3OUYB 1XC9A 5KFCA 4NLQA 3MDFA 3L7OA 2KVQE 1M5HA 3ET6A 2ZWOA 4OZ0A 4DV2F 2LKZA 3PEHA 2BOPA 2EFNA 5G0RB 3L7PA 3Q8RB 1SQEA 2RQKA 1RDRA 3SV4A 3S7RA 1VCTA 4DPTA 1S1WA 5T7LB 4QCLA 1U1PA 1IKXB 1UAWA 4V19J 3Q22A 4A8OA 1IBKJ 2ZVSA 2OH2A 4O44A 1FE0A 2MDAA 4DQRA 2EKNA 1FNOA 5ETPA 1Q0NA 3HZEA 5JJBA 2Y3YA 3TA1A 5L39A 2AEMA 2LXFA 3NNAA 4JYAJ 3G71S 2BMBA 3Q24A 3CJQA 4HTJA 2AX0A 4Q8FA 5B08A 3ILJA 4ZPVR 4R5PB 4CQ1A 4QZVB 1LWCB 1WKLA 1V5VA 3N5BA 4DCPB 2VBXA 3NWRA 3J7YU 4K0KJ 2VKZG 4I7FA 4LF2A 4TYAA 2FHJA 4WE1B 1ZTWA 2DGXA 5DQIA 1YVFA 2DH7A 1M5VC 5D4NA 4USWA 2W2OP 2QYGA 3F0NA 4CLYA 2VJVA 4QYZK 2V50A 4ZVEA 5HMWA 2ZNZA 3T6BA 1GX5A 4K4YA 1HPZB 3LWMA 2XS7A 1NDKA 2Z2YB 1S1UA 2DO0A 3OSPA 1R0CB 3KJNB 1XNQF 1TKXB 2RS2A 3N28A 3CXCR 4X65F 4FF1A 2DNMA 1OYEA 3MPVA 3PKYA 1JLAA 1U1LA 1S0OA 1PCAA 3CJ3A 3ZZRA 1TP7A 1QTMA 2KFZA 2XYHB 3OPKA 2YQ3A 4CI0B 1JKHA 1V6HA 2B7BB 1S99A 4K4VA 2X7IA 4KV8B 5E7OB 2QN6B 3DLGB 1BWVA 4BBYA 4Q43A 4KC5A 4QR1A 2CFXA 4MK9A 3OLBA 1WG4A 5HL7Q 2CA9A 3D1QA 1H72C 2RHQB 3IP0A 1X5PA 5KFVA 5KFBA 4CT9A 4K2JA 1R7IA 1FXLA 4F4ZA 2V8PA 4X4OA 4EYIB 4P10A 2ZH4A 3JSMA 2K7KA 1RKIA 2AF6A 3PYEA 4H4KC 2A6OA 3CDAA 3AHPA 2MPUA 3EVMA 1CQMA 2DR8A 2VBZA 3BGRB 1G3OA 1VQYA 2CNKB 3PW5A 2YNGA 2R7QA 2VPYB 4W92B 4RNNA 3MWBA 3I0SB 3QJPA 1REVB 2DXEA 4DR1F 2CKWA 1CULA 2CNOB 2KT3A 2FY1A 5L9XA 4NCGB 3PACA 3THTA 1XMOJ 3W61A 3P6YC 2QV6A 3BR9A 2KRBA 3QLHA 4X66F 2OD4A 1Q7LB 4BS2A 1VHFA 2XY5A 2BJEA 1T05A 4ED5A 3SQGB 3JB9k 3PO5A 2AYMA 1RLDA 1FI4A 5HK4A 1TKTA 2BV3A 3R1LA 3PO4A 3V2UC 4FNIA 3NGDA 4RW4B 4TXSA 3V6HA 4PG8A 3IWLA 5DO2A 4URSA 2FZKB 2VFUA 1VJWA 3C8YA 2AU0A 5HROB 2G1HA 5J2QA 4X4SA 1BQMB 2NZCA 4N56A 5IT0A 3V4IB 5D77A 2A2DA 5GADI 4USVA 2DGTA 4UTGA 4F4XA 3Q8YA 2FHMA 3IO1A 5D3GA 5K8NA 1PBUA 3OXGA 5IWAJ 1WNEA 1VQ6S 2OO4A 4I4BA 5F8NA 5JMNA 4DFPA 1A0OB 4JI7F 1WJ9A 4ZLNA 2DD8S 2V9WA 1EETB 2LA4A 4DQSA 3DC2A 1KLMA 4UOGA 3TVYA 1SJFA 3DI6A 2AJ2A 2QA1A 3NGKA 2VG5B 2I1RA 2Z4PA 2OSQA 4NLPA 2RF2B 4I6AA 3LW5C 3V4MA 4DS4A 1FKOB 1X5TA 2OJ3A 1HQEA 4YMEA 5G4DA 3JSBA 1IKYB 3H5XA 1WHWA 2ASJA 3SV3A 3IAS9 1Q8LA 4B3MJ 3CJ0A 5LL6d 3I5CA 3H2VE 4DV0J 3ZNUA 2ZH3A 5DQHA 3ISZA 1VQNS 4QW8A 3GR1A 1GXUA 2NXCA 3NGUA 4QYRA 4WFXA 4ZVUB 2Z0GA 2X3GA 3H98A 2E5LF 3O2IA 3GLJA 5D78A 1DZ5A 1QSLA 1RWMB 2IHR1 1X5SA 2DTJA 5HVFA 4MIAA 3A4TA 4ES3A 3L7UA 3OR1B 4HDGA 4LFBF 3IR6B 4DL4A 5KFDA 1SV5B 1U0SA 5KT6A 1TKZA 2CDRB 4KSEB 1V3SA 4UUWA 2HS4A 3HHKA 1C4CA 2XS2A 4KY3A 2YWKA 3ILIA 4ZCIA 3K5PA 3OR2A 4QJVA 2QJ3A 2EVZA 2B9EA 4Y65A 2AIRB 1S6QB 5KFNA 2YVSA 2MGZB 2IJNA 2IVMA 3QGHA 3E01A 1PG5B 3K5OA 3HKZD 3G8TA 2Z2LA 2YKMB 2W7OA 1RTIB 3BYRA 2OSRA 3KUHA 4BWJA 2N4CA 5J1EA 4K50A 3SSRA 2IAJB 1RCOB 1CS4A 2XEXA 1FVSA 4WFZA 2MZJA 4HI2A 2V8VA 3LPEA 1M5KC 3TUZC 5CABA 4RR5A 5A8WB 1KQKA 4O0NA 3H5SA 5C24B 3K89A 2DXFA 3VAGA 2PN6A 1CC7A 1C0TB 2RHSB 2MJUA 1LWEA 4ECUA 1RTZA 4DV6F 3VAFA 4X4VA 2WOMA 4AQYJ 5AE1A 3D3CJ 2GNKA 3G8QA 1S97A 3MUVP 2ZZTA 2KO1A 1S0MA 1YZ7A 2YX4A 4CWBA 1NJZA 1ZOTA 3QIPA 4U95A 1X8DA 3HHDA 1S9EA 1S7HA 2ZC4A 1DTQA 2MQNA 1W26A 2UVWA 3C3LA 1RWPB 3GU0A 5D8HB 3KHRA 1HQUA 1UVJA 5LOQA 3NBPA 2VONA 1I94J 3MAQA 3ZO7A 5KFGA 1GK8A 3DDNA 3MR2A 1GAOA 2H5IB 2F8HA 3QGIA 1CG2A 3FMWA 2NUUG 1VS3A 1JIHA 1VRTB 2VC1A 2G1DA 1RHQB 4B9TA 3PIOQ 4DUZJ 1JJCB 2R9LA 4EO8A 2H3EB 3CUNA 3MTKA 1FJGF 2MZQA 2XYGB 4KTQA 3H90A 2ZC3A 1P1LA 3MMCA 4KKOA 2HVDA 4YHHJ 1RTHA 1RT5A 1HBOB 2QEXS 2GZOA 3DLBA 2P9GA 1RTJA 3CCTA 2HQCA 3JXOA 1NNDA 3GYGA 3GMGA 2CZ9A 4F02A 3K5MA 4DR5F 5FLXY 3L95X 2NLWA 1FKPA 4IRCA 1K9MT 1U02A 1GMVA 3NY0A 2KFNA 2CWXA 1OQ6A 3OJSA 3IM8A 2BKPA 1R8AA 1F1BB 2D69A 3DN9A 2B51A 1IJFB 3JTOA 4NZ7A 1ELOA 4KRWA 3K5LA 3NAHA 5IZHA 1SPBP 3MUMP 4NASA 3HJVA 1RWNB 1X4HA 4EMDA 2V8DA 5IV4A 2UVVA 3LWLA 2I5JA 5DZ6A 2OI2A 1J5EJ 4NLRA 2DGWA 3HVTB 5KFTA 5L8RC 1DARA 3CC7S 1RYSA 2XHCA 2AZ3A 4H54A 1KN6A 5DDOC 5A0YB 2AJ1A 5KFXA 1K0TA 3UVJA 4B3SF 3TYTA 3VQSA 3GV8B 2FJDB 1NJXA 3J7Z5 3VAHA 4TU7A 2UU9F 1UVMA 3QT5A 3FEZA 1JLQB 2KFYA 1VC6A 4OI4A 2RS8A 2HHUA 4DQQA 4ETZA 2ZH5A 3S1TA 1X4AA 1T9TA 2ERRA 4J9PA 3MFHA 4G1PA 4B08A 4DV4F 2VC0A 2E5HA 3TEGA 2MZSA 3DYAB 4N77A 3PV8A 3L3CA 4WFYA 5I3UA 2JJ4D 2MSTA 5ITHA 3HP6A 1UZHA 4MFBA 3RRGA 2B0GA 7FDRA 3GSDA 3KHGA 2W9BA 3O6QA 3LAMA 4NOHA 2B7CB 4KBIA 3KNAA 4ZIVA 2QMXA 2R2UA 3MR7A 4LF6F 3PJ9A 1X9SA 2RKIA 4GMKA 3CJSA 4P7TA 1LW0B 3N5FA 3RGIA 3PRBA 4XPCA 3ZTSA 1ZAXA 4KHRA 1FERA 5CA5A 1FTRA 4RU9A 1UETA 1N5QA 2IM1A 3IM9A 4U6PA 3PXGa 4ELTA 1Y10A 4ANCA 3IS9B 3X3UA 3FFIA 3D0IE 4RW8A 2W25A 5D6GA 3TZYA 3RBEA 1S1TB 1YJNS 2U2FA 3OUYA 1Y5IB 1E6VA 4FS2A 5D4OA 4JI8F 1NB2A 1VQ7S 3M8QB 5DDQC 3M8WA 2C2ZB 1VQKS 3PIPQ 3BS9A 1NB7A 2D3OR 3CMQA 4MYTA 3FSXA 1YJUA 5G0RA 2RJZA 2EC2A 2ZBRA 2RB7A 5C5JA 2ZFHA 3KG4A 2QFIA 1R8PA 3W5YA 2BJ3A 4KFBA 1N34F 2FTRA 4R8UB 4WF9Q 1FT8A 3M6WA 5T7LA 1KONA 1J5OA 4ZVQB 1TL5A 2Y0SD 1HI8A 1U8WA 1U49A 5JVHQ 4HACA 3TI0A 4JBCA 5MLCV 4LF9F 4Q0BB 1KR4A 3GCXP 4M94A 3QMQA 4TQRA 2DNLA 3NP5A 2MHEA 1U1RA 2DO4A 1HNXJ 3C15A 4FXDA 1DQAA 1G6BA 4ZITA 3VGTA 2DGSA 2W7PA 5DLGA 2DIUA 3J81j 1TL3A 5E3CA 3KK2B 4NXMJ 1P8GA 3D7SB 4F3OA 3QZ7A 4NEYA 1LWCA 2CQBA 3DGPB 1IN0A 3M8PB 2AEJA 4ZS6A 4DR2J 3Q2TC 3N6LA 3OVSA 4F2RA 4F7VA 4DF4A 1NH8A 1HARA 4WE1A 1FJCA 3HHLD 2D3UA 2YKAA 1OY8A 2DNRA 4W90B 2ZE2B 4LF4F 3IA0A 2X1AA 4F4YA 2GQQA 4M5NA 1I5OB 2HRTA 1WF0A 2R8JA 1WF1A 1SUQB 3N6MA 1L3KA 3UFCX 1AA1B 3OTCA 4URQU 4UQGA 3WBZA 2YNIB 1DQ8A 3UD3P 2XZDB 1FXDA 2AGOA 3MEEA 1HPZA 2LEBA 2E1AA 3PG9A 3GTYX 1HNZJ 2KYZA 2DNKA 1GFWB 4ILRA 4WTOB 2M70A 5LXRA 1PJ6A 3KLEB 2AMCB 2CNNB 3RR8A 3KJFB 3A3PB 2F5GA 1RT7B 2DHGA 2C42A 1JXVA 4JI0J 1N32F 4LSNB 2AJ4A 2EBEA 3AXKA 2J9EA 2XG8A 3BGOP 5DG8A 2UV8G 3BQ1A 3QFWA 2IM0A 4RKUC 5KT2A 2JWNA 4O3QA 1RT4A 4U67Q 1HNVB 1TUWA 3FCHA 1RWKB 5BYRA 5LMNJ 4N8OA 4DL3A 1SJ3P 4IFYB 4KV8A 2LA6A 2MEWA 1SH0A 2RU3A 4OZ5A 3DLGA 1IKWA 4CCHA 3H5UA 4E98A 2B4VA 4M5DB 5KFZA 4ED0A 1IQTA 1SJ4P 4KGMA 4CP5A 3BKTA 3VVTA 3Q0AA 4QIVA 3SFUA 3NCRA 2WONB 3JYTB 4FPRA 1TL7B 1YDLA 5HJYA 5AE2A 2IBOA 1NJWA 1S76D 4WKRA 4PG5A 5E0OA 2XI3A 2YPYA 4C0OC 1U1KA 2XMJA 4F0HA 2K1RB 1DBDA 1FWLA 1SH2A 4EWTA 3OTEA 4CNYA 2MKKA 2HIYA 1HQ2A 4P6QA 2QL7B 1HA1A 2A1BA 1UWBA 3D67A 3KHHA 5L1LA 2UVRA 4ZP7A 2XO6A 3I5AA 2OP5A 3I0SA 1REVA 4TY9A 2QTWA 2AYEA 1H2TZ 1AUSL 3HFVA 1Z4UA 3EWGA 2R8GA 1S6PA 2LMIA 3EZUA 4PAAA 2LXUA 2MB0B 4I2QB 2DB1A 3QJLA 3BB5A 3R5CA 5M2UA 1Y5LB 3QATA 4RL1A 4LSLA 4OV6A 3SQGA 2C28A 1S49A 1UPPA 1OQ3A 1UWAA 2EFOA 2RU9A 3SMZA 5IV3A 2VASA 3VWSA 3W60A 3G6ES 3QWUA 4HYKA 4RW4A 3D6FB 4F4KA 2DISA 5B0CA 1CSJA 2JLFA 1VQ4S 2E9RX 2W2PP 3R6GB 2IVYA 1Q5YA 1FRLA 4IR9A 5HROA 3OFFA 1BQMA 2M3DA 1TV6A 3V4IA 2J9DA 2JC1A 3TJ9A 5KAKA 4AL7A 1LXJA 3LPYA 4B9LA 2HGLA 3V5RA 2VDHA 4CRJA 2KM8B 1N5SA 4DPWA 2UZAA 4RZRA 3FQLA 3IWNC 2KZMA 4HLBA 1HHTP 3R27A 3KUGA 5K8MA 3LOUA 3C6TB 4GKKF 4Z2XA 3VR1A 2HRUA 2MLXA 3R7NB 1QTNB 1T9VA 2XLKA 2G2ZA 5JVGQ 3JTPA 4MYUA 2CQ2A 2JEIA 1FKOA 3W1YC 1NEEA 4XDDA 4CO1A 3EUNA 2V63A 1UVLA 1FFSB 2V2ZA 2IFXA 2Q6CA 2E1MC 4H4OA 3NNCA 1ZPWX 2MQPA 4ZP6A 5IOLA 3HSGA 2V2KA 1KTQA 4OZLA 2W7AA 3SXLA 4Q8EA 4U7UD 2CQCA 4KPCA 4F4AA 2JLGA 8ATCB 2J0WA 1W7WA 4KB7A 5L46A 2YX1A 1S9GB 1QY7A 4NLOA 2XM3A 2LCWA 2YH0A 4J9LA 2ALZA 1HD1A 2GGPB 4LBIA 1SKSA 4ICLB 3W64A 2CRLA 4HT7A 1FEEA 3J80U 3CO9A 3RW7A 4J9MA 5DM7Q 1RSCA 3CCZA 1SV5A 1LW2B 1WG1A 4B02A 3SBMA 1FX2A 4F04B 3I0RB 2XBPA 3MECB 2ASYA 2W9CB 3D9BA 1Y11A 2DR5A 4C9DA 1NM2A 1NHUA 2F4VF 1LNQA 3QO9B 3OFGA 4ZPDA 2YKMA 1RTIA 1WF2A 1NH7A 1P27B 5DDPC 2EW9A 3DM2A 1E6YB 2IAJA 1BD6A 4OI2A 2XI2A 2BUNA 1SL2A 1RAIB 1MMLA 4DUYJ 3HD2A 3MTJA 1UFWA 2E5GA 1FRHA 5C24A 3U02A 3BDPA 5EWEA 2Y1RI 1K1SA 1C0TA 1IBMJ 3R2CJ 3RB6A 3CT9A 3TAMB 1N8RT 4F3MA 2NR0A 1R3NA 3ZZUA 3NCPA 2K7JA 3H40A 3ZTRA 2DY1A 4M5GA 2YWFA 2VBYA 2NSBA 2MSSA 2W8KA 5F9NA 4LVOP 5JXSA 2RMLA 4FYVB 5AXNA 3EPIA 3OXLA 2QZ8A 3HK2A 5T14A 3H2UB 4O23A 2MLYA 4C8OA 2KH9A 2ZJQQ 2IA0A 5LXYA 4CZCA 1JJHA 4H4KA 2ACMA 4ED3A 1SL1A 1RAHB 1KTVA 9ATCB 3T41A 2DRDA 1GMWA 1UZDA 4XPEA 1SVDA 3AB2B 2ASDA 3SSQA 3EE3A 3DXBA 4A8WA 4K4TA 2EFVA 3LGMA 2ZUAA 1PYSB 1X5OA 2F40A 2ZOFA 4RJVA 1HBOA 3W2WB 2CJKA 3GV5B 3ADAC 2AHOB 4AYBD 4DR4F 5KFOA 2HBYB 2B3TB 4P72A 4ELUA 6FDRA 3ISND 1QSSA 1X4DA 3KLVA 4PWWA 1D9AA 5J1PA 2CJ9A 3RB4A 3VGSA 1WEXA 3AD9C 1TKDA 4DXLA 3OTOJ 4CLWA 2M8HA 2KU7A 4LRAA 1FRMA 3MUTP 1S10A 4FBTA 2V8GA 4DV7J 1T94A 2HEKA 4B17A 3Q83A 2P9EA 4NZ6A 2H5EA 2UXDJ 3GJTB 5KG6A 3W2VB 4ED1A 4JI4F 2XZWA 2PA3A 3DDIA 5GAHU 1BE4A 1KOHA 3ZZTA 2ZZNA 2FHOB 2BJDA 4WFNQ 3DOKB 3MF5A 2XMVA 3OVAA 3P96A 3GJSB 5LMUF 2EG2A 3I96A 3HVTA 3DRPB 4MTPA 4FVMA 4JI6J 3N01A 2N82B 1VQ9S 3UPFA 1VMBA 4ZMMA 5HN0A 4WWSA 2ZITA 1XR6A 2HHQA 2D7SA 3UCGA 3LGNA 1NU4A 3H7HB 4NRTA 4EBCA 1VJQA 2LEAA 1JLQA 1D8YA 1NBEB 1NK0A 3ZZYA 1P9YA 3CD7A 2I38A 2KXNB 5U47A 4USTA 5K5MA 1SJQA 3KFWX 1FA0A 3EDQB 1R27B 2UVUA 3LANA 1MWYA 3MAAA 1QE1A 3UO0A 2VQEJ 4DL5A 1HWLA 3NMAA 3GFXA 2RVJA 3OL9A 4EUVA 3DYAA 3HFKA 3MR6A 1GQEA 4DSKA 4IQMA 2O1PA 4AXIA 2FHJD 2M7SA 3H4BA 1FDDA 4WZQA 1FCAA 1SKWA 3PEJA 1S79A 6FD1A 5L38A 4TY8B 1TAUA 1IWGA 3PTWA 5DLFA 4UQTA 1R43A 1F9HA 2WZ1A 1ZETA 2D9PA 1N6QA 2XGPA 2JFKA 1LW0A 2FVQA 2E9TA 3N79A 4WJBA 4CO4A 3K8VA 3TARA 3FEXB 4A8FA 1IBKF 4W98A 2FIUA 2V69A 4PEOA 3MD3A 2ZM6J 2B8QA 3K57A 1VGYA 3IS9A 4NZ0A 3KYLA 3Q8UA 4CO3A 5J2NB 4CH0S 1ZH5A 2RDDA 1EX8A 2VFRA 3FNNA 3ZZPA 2IM2A 1M1HA 2H4YB 2W24A 2XS5A 1QAJA 3KK3B 3FZ2A 1ACMB 1S6OA 4DQIA 4JV0A 2QE5A 1U7LA 3DNCA 3M8QA 2KHDA 2KXFA 1NDPA 2GVDB 1DRZA 1WG5A 2GAHC 5KFSA 1FO1A 4GRSA 4EFAC 4YDXA 3BZQA 4NLTA 4NXNJ 5CYMB 5I42B 4ER8A 1SL0A 3PFOA 2V94A 4WKYA 4OL8A 1O8BA 4AFFA 3HVAA 5CCLA 3I56S 3HXMA 4C3LA 4L72B 2BDPA 3CD6S 3BEGB 3AH6A 2M52A 3UI3A 1WELA 3FK4A 4F36A 2LEPA 3ITHA 4DS5A 1PSDA 4NI2B 4Q0BA 1VRQC 3DLKB 5LJ3Y 2ROGA 1N5TA 4DMZA 2F9JA 3AA9A 1VBKA 3U1MA 1D9DA 4X4UA 3EVOA 3N9UC 3TZWA 2CYYA 4MT1A 4PQUB 1IKVB 3G9CA 2Y1JA 3F41A 4C0BA 4J9NA 3GV7B 3HULA 4GC6A 2EI5A 1EZZB 4TYBA 3OV7A 2Y1IA 2L9NA 2HBZB 5DG7A 1GT8A 3KK2A 2AKWB 3R7SB 2X1FA 4LSZB 3HT3A 2PSZA 1TQLA 2WB4A 2VA3A 1N0UA 3M8PA 1R89A 4A8KA 3RAQA 4I69A 1Q8KA 4DR3F 4ZCLA 1LWFB 1T9XA 4D3HA 4DF8A 2HFUA 1RTDB 1CJUA 1Y3KA 3RG6A 2Z56B 2ZE2A 3OTDA 3CCSS 1UFKA 2HGMA 1QLNA 1U25A 2BJ1A 4Y2IA 4ECSA 1FJ7A 4QPXA 1SUQA 3I5BA 1AB8A 1V9OA 2DEIA 1Q5VA 1Y5NB 5HATA 1Z1ZA 1WEYA 1UL3A 3P49B 3JQKA 3ZFVA 3RBDA 4B3TJ 2CQ4A 2XLIA 1NK7A 2Z2MA 1NHKL 2WSEC 3KLEA 4LMZA 3ZXWA 1UEVA 2M9KA 3FSYA 4LSNA 1KEKA 3M2RB 1NPRA 3M6VA 2C2DA 2HAIA 2V9KA 3M4XA 2CQ3A 4DN9A 4ES2A 2BW7A 2V4JB 1RAFB 1U4BA 3PZPA 2J5AA 5DG9A 2HHHJ 1IR1A 2GO9A 3AXMA 2IDLA 4P73A 1XMOF 4IFYA 2F3JA 3F44A 2HMIB 3B54A 2GMLA 4DPOA 3ZZ0A 3CDUA 4L74A 2VG6B 3TX0A 2EXUA 4M5DA 1HW8A 3THVA 2UUAJ 1MU2B 1GXLA 1IBLJ 3UE2A 4UZBA 1FK9B 3TEHB 5DZ7A 1XNRF 2JVRA 1CVJA 3CC4S 4I0WA 1S77D 2YQ0A 3I9V9 4YEAA 2EK6A 2K1RA 3QPIA 2BRKA 1YITS 4DV5J 2M8DB 3NLCA 3HHLB 3UDLA 2AWZA 2JX2A 3TQEA 4ED8A 2DNHA 1M90T 1D1UA 4NPOA 5IWAF 2KG0A 1YJTA 3QAEA 4CLTA 4K7QA 1UMJA 1U2RA 3UDVA 3HLUA 1T9UA 3ETOA 4FN5A 3TWZA 1KFDA 2BA9A 1CJVA 1MN7A 3BO3A 2ASLA 1LK7A 4LIRA 1ULRA 1I3OB 1HWKA 2ZD1B 1S1XB 3AQPA 1FRXA 3SZ2A 2CG4A 2W4DA 5KOWA 1LKZA 1NK9A 4B3MF 5F8GA 1IXKA 2WB1D 3IRXB 4LFCJ 4DV0F 1WHYA 2CG8A 4R0JA 4DDFA 3RAXA 1VRUB 2Y8WA 3EMTA 3G4SS 3M9OB 3P5TL 4C8NA 3U7JA 2MLZA 2YNHB 4CT8A 1F2HA 4DV1J 3J7AN 4TNOA 1TK8A 2J9DE 4KHPJ 3PJWA 5GADU 3CCES 4P7VA 2DHXA 4N76A 4ZHRB 3A8EA 2NXJA 1M1KT 1YG0A 4AT1B 3OSNA 1H3DA 3PW7A 1U1OA 4HTIA 1NSQA 2N4DA 5A8KB 3C6TA 2BANB 3CDBA 4Y2KA 3HO1A 1IR0A 3O1LA 3SQOP 1SJRA 1VOMA 2G9OA 2LLZA 2GVZB 4ECZA 4RWXA 2CPYA 2B8PA 2B5JA 3K5NA 1RBAA 4DR7J 3O8WA 4J9KA 2J7KA 1TK5A 3TX8A 4FYXB 4CLKA 2ZH6A 1KNZA 4NLWA 4X84A 3T5KA 1CBKA 4F0KA 2OIHA 5HMYA 2YKOA 3R3TA 1VK8A 3AD8C 5I3PA 1CEZA 2PMHA 3ENWA 2BM1A 2RQ4A 2KVIA 5CH7B 4ATNA 3D28A 2UP1A 1FJEB 2C3PA 2ILZA 1JJ4A 5ETRA 2DR6A 3L4BC 5B0FA 4DPUA 1WORA 2VL1A 2IRXA 1RT2A 3ISNC 1RYRA 4AQYF 1RABB 1C1BA 1LW2A 2IC3B 2KRRA 3DLEB 1T95A 1GEHA 5GMKa 4Y34A 4KQZA 4B9VA 3NNHA 4XIUA 3I0RA 1VQSA 4A47A 2HNZB 4MIBA 5IM0B 3MECA 1YK9A 1N0VC 4RUAA 1MROA 1B0VA 5IQQA 3D66A 2BBEA 4UW2A 4WP3A 1B3TA 3HFZB 4YR0A 4NMXA 4DCJB 3N4WA 3V6DB 2B43A 3W7BA 4ILMA 4I67A 3LF0A 4C6AA 3HPOA 1I94F 1RU2A 2VH7A 4K2XA 4O3RA 4NEZA 2QLXA 5HP1B 1NSPA 4CO2A 4OI3A 3R5AA 2AP6A 4RW7B 3CEDA 2KN4A 1UVNA 4USMA 4K5RA 4OHXA 4C11A 5AXMA 3M6UA 4Q44A 2ZNYA 2HGNA 4DUZF 1CPZA 3WIVA 5GAHI 2YKNB 4OYWA 2L9WA 1Y9OA 3CO0P 1PYTA 3KOAA 2IMWP 2HQ3A 2LQBA 4YHHF 1VQ8S 4DLGA 2K2PA 3Q8PB 1RUSA 1HBMB 2NREA 4UZCA 2CDQA 1WKJA 2W01A 5LM7E 5MAOA 2B9XA 3GWCA 4HEA9 1U2FA 3D5MA 5BJRA 1AROP 1XN9A 5B0GA 1NDLA 3NS6A 3SIPB 5KFHA 5C42B 3KLGA 1EQ0A 3OLAA 1RBLA 3MM9B 1BHNA 3V81B 3DRRB 2GHWA 2DCUB 2AQ4A 1HMVB 2OPRB 1HFEL 2C2OB 4USHA 1C2PA 2WW4A 1NLKL 2BE2A 5CQGA 1J5EF 4QOTA 1OSDA 1HBUA 3PHTA 2B4UA 4B3RF 3R5BA 5KFPA 4FS1A 3W2WA 2CQHA 3IBCB 3RAMA 3CMAS 4CLSA 4LR8A 1VFJA 4PR6A 2HK3A 5EUHA 1U6ZA 3CDWA 1UEUA 2HFZA 2EFGA 5F3TA 2DIVA 4PG6A 3BSNA 3ZNJ1 2CQ0A 4Y00A 1WEZA 3T5LA 3R1HA 4JI2J 3MMAB 4ITSA 1K8AT 3IXQA 3DMJB 1NJYA 2V4RA 2DGUA 3Q8VA 1OPIA 1PKUA 4FVCA 2VKRA 2R2RA 4BDPA 3W2VA 1Q95G 2BOAA 4DX8H 3J81U 1S0NA 3MPUB 5HLFB 4YS2A 4ERDA 1RHRB 3DOMB 2CNLB 4DBQA 5ETKA 4ECQA 3BDEA 4ZJOA 4PYAA 5HVHA 2ZJPQ 3G87A 2F1FA 5C2GA 3BQ0A 4IO9Q 2QL9B 1YZ6A 4AD6A 4RNOA 2C2KB 5EN1A 3DRPA 4WU3A 3MEGB 2CPEA 4OZNA 2Z30B 2OPSA 1RKJA 5FLXU 1VIXA 4A8SA 4CO0A 4IOAQ 4WP8A 4P71A 4C8YA 1HWUA 2RE1A 2D3O1 1LFWA 1NK4A 2P8IA 2VD3A 2GV1A 4IQXA 3E8OA 1WDTA 3DHXA 2DR9A 4OZ1A 4LF7J 2HWIA 2JEJA 2EFQA 3AQOA 2OPQB 4ZDNA 1TVRA 4ZPTR 2F7VA 2JHEA 1SQFA 5CHCB 3W62A 3IG1A 1AUDA 2RAQA 4IDKB 2KJWA 2UU9J 1XQIA 4FPIA 2JOQA 1JLEA 3DGVA 3H25A 4IG3B 2ZBPA 3W63A 3T5HA 2CUYA 4P2MA 3VAIA 2BJ8A 3GQCA 3CWJA 1TUVA 4QYZJ 3MI7X 2O66A 3MURP 2AW0A 2D1CA 4OHYA 1EP4A 3D0GE 2HKEA 3TUIC 3JAMU 1U47A 4OLPA 2E5JA 1S1VB 5F0WA 4BWMA 2RDIA 2WW8A 3T6JA 1C1CA 4JI3J 1F9EB 4I1TA 4M5MA 2Y0BB 1PJ5A 2DEJA 4NLSA 2COLA 3GIIA 3RZAA 2AV5A 3RU0A 4WPAA 2DKOB 4DSIA 1S1WB 3NGSA 4JP8A 2VB6A 2PD1A 4NL5A 2XQCA 1HNXF 4RNMA 1SXLA 2M5YA 2N3LA 3J7ZT 1U26A 2R8IA 4IRKA 2GJ2A 2E7WA 3KJVB 3HM9A 2DNZA 1XIQA 2GQCA 3P5BP 4H4MA 4NXMF 3M30B 4ED4A 5B0BA 2PO4A 1VIOA 4WFAQ 2QG9B 2BR0A 2KTQA 5CYQB 2I2YA 3PR4A 4CTAB 5I42A 4DR2F 3D68A 3GIRA 1WOSA 4C0HA 4JI8J 1DLOB 3GZ7A 5KFKA 3VGUA 2UUTA 4PG4A 4NLYA 2C2RA 2UXBJ 2BXJA 2R7UA 2EFPA 2FZCB 2X1GA 3D1HA 2IBKA 4NI2A 3DLKA 2ALYB 2QMWA 2HVZA 3OL6A 2RUSA 2K3IA 4XK8C 3BO2A 2LDYA 4NLUA 5K14A 3ZC4A 4MKAA
chains in the Genus database with same CATH topology
2XMTA 4WCEQ 3BREA 2XULA 1LXJA 1JLGB 3LPYA 5GAEI 2AJFE 4B9LA 2HGLA 3VTIA 3VAKA 3RB0A 4IH6A 1N56A 5J2MB 3V5RA 4JI0F 1DQ9A 3H8YA 3CGIA 2KM8B 1N5SA 3MMCB 4FXWA 2UZAA 3I31A 5L1IA 4DV3F 3LALA 3GIMA 4RZRA 1Q7YT 3FQLA 4YQWA 4KKOB 3KK1B 1URRA 3IWNC 2KZMA 4HLBA 1RTHB 4KJIA 3CJ4A 4QIEA 4A8YA 2HQIA 3CJKA 3M05A 4XAKA 1HHTP 2DNNA 3R27A 3DRYA 1SI9A 2R4FA 3LOUA 4LJMA 5K8MA 1SJ1A 4DL6A 4KPYA 4WYWA 3C6TB 1XMBA 4GKKF 2WAQD 1KSPA 1T02A 4Z2XA 1BQXA 3HHEA 3RB3A 3VR1A 3H2LA 4A4JA 2CPHA 2GMHA 1M5SA 2ADBA 2CZ4A 2C22A 2VA2A 4ID5B 1S1TA 3TQ1A 2HRUA 1FD8A 1AFJA 1RT3B 2FJWA 1QE1B 1LWFA 2XLKA 4JYAF 3MM9A 2HHPA 2XSJB 3C6UA 4HH0A 5JVGQ 1JLBB 3JTPA 4MYUA 2CQ2A 5LMNF 2JEIA 1MSWD 2FLOA 1FKOA 3PR5B 5IS2A 1NEEA 4RW6A 3DU6A 4XDDA 2ZH1A 5LJ5Y 4CO1A 1T3NA 1YWXA 4ECTA 2E7XA 5IT4A 3EUNA 4R0EA 1UVLA 4YFUA 1PGZA 2JDJA 2G4BA 2ZH8A 2D3ZA 5IFMA 2RD5C 4Z37A 3PKMA 2ILYA 4OX7A 2IFXA 2Q6CA 3NKYA 4JI3F 1Y00A 3BGUA 4NLDA 2E1MC 4H4OA 3PDNA 5BYSA 2OLWA 3Q23A 1ZPWX 3NNCA 5IQ6A 4K0KF 3WX4A 5A6PA 3MM6B 2VZ9A 4KR0B 1JKHB 2MQPA 4ZP6A 1QJHA 1LOUA 2QRRA 4R8UA 1FDAA 2LQ5A 1TL1B 2GW8A 1N5YA 2XMMA 5HI7A 4K5SA 1OO0B 2V2KA 2PEHA 2FVSA 2ZZMA 1KTQA 1RI7A 2VV5A 4OZLA 3MEKA 3TW0A 2W7AA 2D74B 1NKCA 2B4PA 3J7YI 2XO7A 2SXLA 1TZ0A 2PI5A 3SXLA 4Q8EA 2FC9A 3EPGA 2HWTA 2CQCA 3TAPA 1N6QB 1RWUA 2HHTA 2IYGA 2JLGA 2FVPA 2J0WA 1VC5A 2MKCA 4KB7A 3TAQA 2V5HG 2YX1A 4WXWA 3IC1A 1U8SA 1S9GB 1QY7A 4NLOA 1FD2A 2LCWA 2YH0A 3M2RA 4J9LA 4KIAA 2EKYA 2GFFA 2I5JB 3SCLE 4QBUA 2ALZA 1HYSA 2GGPB 1HD1A 3CDEA 4QR0A 4GO5X 4EBDA 2OPPA 1SKSA 4B9SA 1UVIA 1JNZB 4ICLB 1GH8A 2CRLA 4HT7A 1FEEA 2M88A 1IQZA 2J0SD 2C3UA 4DFKA 1KVJA 3CO9A 3RW7A 5KFLA 2KJVA 4J9MA 2GMJA 5DM7Q 4I6WA 2KZZA 3CCZA 3UCZP 3MMAA 1SV5A 2NPIA 4OJGA 4QR2A 1LW2B 1WG1A 3JSMB 3D2WA 5DGAA 4OZJA 2IJFA 2V4JA 3OL7A 1VBYA 4B02A 2AYGA 3MMBA 2GO8A 4KGKA 3I0RB 4RU2A 4KAIA 4IOCQ 2VQEF 3LP0B 3UD4P 1A7GE 2XBPA 2DNPA 3MECB 3LP1A 2GJIA 1NAQA 2FLNA 2ASYA 4EBEA 2VUGA 2W9CB 4NYZA 3RYLA 3KLIA 2DR5A 3CCWA 4URGA 4I56A 2ZUGA 5HLFA 3DRSB 4UOCA 4C9DA 2HMIA 1RK8A 2IMOA 1NHUA 2CPFA 2NPFA 2F4VF 1I1GA 4YP3A 4QWCA 3DLHA 3SDEA 3QO9B 5K8OA 3DGPA 3DOMA 3WC0A 1H2VZ 4O3OA 2YX7A 1FRIA 5DS7A 1ZM9A 2XWXA 3OFGA 4ZPDA 4C8LA 3CE8A 7FD1A 2YKMA 3I55S 2XY7A 3CSKA 2GC8A 1RTIA 1WF2A 1VQMS 5KTQA 2UXBF 1SIZA 1NH7A 3POTA 1FHTA 2DK2A 1QVGR 2W9AA 1P27B 1F60B 5DDPC 2EW9A 3DM2A 1Y7PA 1E6YB 2IAJA 5EX3A 3WZ0A 4ELVA 2HYIB 4QIFA 3PW2A 3GYXB 1Z2LA 3DFEA 3MEGA 1BC6A 1Y4ZB 1BD6A 1VQPS 4OI2A 2V8HA 3UNGC 1FK9A 2XI2A 2BUNA 4FF2A 1SL2A 2JEFA 1H7XA 2HIQA 2PC6A 1MMLA 3MTJA 1UFWA 1FF2A 2E5GA 2WHOA 4NYPA 5LSLA 2RQCA 4B3OB 1FRHA 3TO8A 1GX6A 2M4MA 5C24A 1N33F 3T19A 4FNHA 4YR2A 1TKTB 2W9BB 4LFAF 1ZM3A 3U02A 3BDPA 1X9WA 1B0PA 5EWEA 2Y1RI 4EGLA 2YWEA 1K1SA 4K4ZA 1C0TA 2KHCA 1T8EA 1HBNB 2DRAA 1L3SA 4Y2MA 3RB6A 2C3MA 1FEHA 2YNIA 3E2EA 3CT9A 1QUPA 3TAMB 2A10A 3CULA 3ITHB 3CVKA 3K7RA 1N8RT 4F3MA 4RUCA 2NR0A 1R3NA 5IXUA 3ZZUA 4OLOA 3NCPA 3TVKA 2QA4S 2K7JA 2OPQA 3H40A 5J2QB 4JUZA 2V0NA 2I0XA 2MXYA 3W3SA 3LQVA 1U09A 1YRXA 2J6SA 1RT7A 2VBYA 2YWFA 3FMBA 4A8XA 4MMOA 1GNKA 3HMJG 2R7WA 1K0VA 2HHVA 4IFVA 4Q2LA 4F50A 2NSBA 3C66A 2NUHA 2MY8A 4HT5A 4MKBA 2MSSA 2W8KA 1WACA 2P6SA 5F9NA 3ENVA 4QWAA 3DRXA 4JV5F 4QIWD 4X64F 4LVOP 5F3ZA 1H6KX 5JXSA 4X4RA 5D3GB 2RMLA 2Q3PA 1T03A 5AXNA 3EPIA 3OXLA 2QZ8A 3HK2A 2LQ9A 5T14A 1UJ5A 3H2UB 3MEDB 4O23A 2IM3A 2J9CA 3KNGA 4C3MA 2FLPA 4ZOSA 2EK1A 2NXUA 4DG1A 4C8OA 4QU6A 3ICLA 2KH9A 4IOBA 2J6UA 4IG3A 2ZJQQ 4ED7A 3CJ2A 4X4QA 2IA0A 3HI9A 1S0VA 3B8HA 1HNVA 5LXYA 4RLEA 3K58A 2XGQA 4CZCA 4IRDA 2O01C 1KFSA 1KLMB 4BHQA 2YWHA 5KG2A 3TANA 1JJHA 4H4KA 1F0XA 5EHHA 3ONQA 5KG3A 4ED3A 4O0IA 2NZ4A 1SL1A 3IRXA 4J5OA 3IR5B 1G7CB 1KTVA 5B0AA 3OUYB 2DH9A 2PI4A 1VRUA 4OQJA 1U1NA 2LYVA 2BQRA 2HHXA 4F26A 1XC9A 5E3RA 2FVRA 5KFCA 1O0PA 4NLQA 4XPEA 2NSCA 4TN2A 3MDFA 4BC9A 3L7OA 2DGVA 1HQEB 5EDWA 2IRUA 1Q82T 5KFQA 3AB2B 1M5HA 3I87A 2ASDA 2DPIA 4MH8A 3SSQA 4I2PB 4OZ0A 4E0DA 2PT0A 4DV2F 2RRAA 1P1TA 2LKZA 3PEHA 2BOPA 2EFNA 2KKHA 3AAWB 3UCUP 3HF5A 5G0RB 3L7PA 1RAJA 4QPTA 3QZ8A 3DXBA 3NRBA 3Q8RB 2QIFA 4A8WA 2WONA 4K4TA 1SQEA 2EFVA 3JYTA 2B4OA 3UR3C 3LGMA 2RQKA 1RDRA 1X5OA 2ZDOA 3M32B 4J9SA 2F40A 3SV4A 2QYCA 3KMQA 3S7RA 2QLWA 4B9NA 5GAEU 2ZH9A 4ZHRA 4EEYA 4RW9B 4O3PA 4DFJA 1S1WA 2ZOFA 2UUBF 4Y2CA 4ZVHA 5T7LB 4QCLA 1HBOA 4ZPBA 3W2WB 1U1PA 2CJKA 3GV5B 1D3WA 1IKXB 4F4WA 2BANA 5GVQA 3GB0A 2FLLA 5DJBA 2HWHA 3U1NA 2WBMA 4AYBD 4DR4F 5KFOA 3T9ZA 1UAWA 4V19J 5EGYA 2B3TB 3F73A 3Q22A 4A8OA 2ZOMA 4WIIA 3B4DA 1KRPA 2PGCA 4ELUA 6FDRA 3ISND 1QSSA 1X4DA 1JXLA 2ZVSA 2OH2A 3KLVA 4O44A 1FE0A 2ZHOA 1ZAVA 2MDAA 2E66A 2C3OA 1D9AA 3C46A 5CZXA 4HHJA 4PPDA 5J1PA 2CJ9A 3RB4A 4DQRA 3D1OA 4A48A 2DBBA 1WEXA 1FNOA 1JLFA 5DGBA 1TKDA 3HZEA 2LU2A 5JJBA 2M8HA 3A1YG 3JSRA 4TLQA 1KVIA 1YSJA 2KU7A 1FRMA 1Q8BA 2A2CA 1DTTA 3TA1A 3MUTP 2LQJA 2YNFB 1S10A 4I2QA 3DXSX 5L39A 4FBTA 2V8GA 4RX6A 1JX4A 1T94A 2LXFA 3UR0A 4B17A 1VLYA 2ZH2A 3NNAA 3RW6A 2P9EA 4CH7A 3G71S 4MIWA 4NZ6A 3VQTA 2H5EA 3I6PA 2XCAA 3Q2SC 3Q24A 3MXHP 4HTJA 2AX0A 5KG6A 4Q8FA 5B08A 3W2VB 4ED1A 4QWDA 5L9NA 2BYCA 4ZPVR 4JI4F 4R5PB 3SSSA 1W25A 2XZWA 2PA3A 4CQ1A 2GX8A 1JLCB 4Q5VA 4QZVB 1LWCB 5GAHU 2MQOA 3N5BA 4DUYF 2FGCA 2VBXA 1KOHA 1U48A 1X4BA 1BWEA 3ZZTA 1G1XA 2ZZNA 5DM6Q 2FHOB 3J7YU 1IJEB 3CIMA 1ZBTA 2VKZG 2BJDA 4IO1A 4I7FA 4WFNQ 3DOKB 2K8GA 3LP2A 2XMVA 3MF5A 2ZH7A 2B6AA 3FQKA 2DCLA 3OVAA 5D4LA 3P96A 1IBMF 5LMUF 5J1EB 2EG2A 3I96A 3HVTA 4TYAA 2FHJA 2I8EA 4WE1B 1R6YA 5KFUA 3DRPB 1ZTWA 1UA1A 2DGXA 1YQHA 5DQIA 4MTPA 4FVMA 1FRKA 3D0HE 2KB2A 2IC3A 3DLEA 1YVFA 2Z8QA 3N01A 4CO5A 2N82B 1VQ9S 2DH7A 1M5VC 3UPFA 1Q16B 3HVRA 1RQ0A 5D4NA 1VMBA 4ZMMA 5HN0A 4O4RA 2BZ2A 2HNZA 4IG0B 5EX0A 3CCMS 3T9NA 5A8RB 1QUVA 5AXKA 2HVIA 4V19X 2ZITA 1XR6A 3TUJC 4CNZA 2HHQA 4K59A 2D7SA 3UCGA 3MOZA 3LGNA 3SI8A 1NU4A 4ZVEA 5HMWA 3GFHA 5FDLA 1AXQA 2ZNZA 3J81Y 4NRTA 4EBCA 2LEAA 3T6BA 4HKQA 1JLQA 1D8YA 2AYBA 1GX5A 3GIJA 1R8HA 4FXVA 4K4YA 1HPZB 3OVBA 1NK0A 1PILA 3ZZYA 3LWMA 1VK3A 1H2UX 2XS7A 2CJAA 3CD7A 4OI0A 2I38A 2KXNB 1CC8A 4N41A 1S1UA 2DO0A 5U47A 3OSPA 4C8ZA 3M1VA 1SJQA 4NA3A 5K5MA 3KFWX 1FA0A 3LUYA 3HZGA 1XNQF 3SCJE 1TKXB 2P5VA 1R27B 4ID5A 2RS2A 2UVUA 3Q8SB 3HHNB 3LANA 1MWYA 4PWDA 1RT3A 3N28A 3CXCR 1QE1A 4OI1A 3NMAA 4DL5A 1HWLA 4X65F 4FF1A 2DNMA 4ETXA 1JLBA 3CD0A 3GFXA 3MPVA 4HDHA 2RVJA 3LH2S 3PKYA 1F9FA 1JLAA 3OL9A 1N4LA 4ZA1A 4EUVA 2HNDB 3DYAA 1U1LA 3QIPB 3HFKA 2WSCC 4EZ9A 3G6XA 1S0OA 5HP1A 1JK9B 4JI1F 2DNOA 2VPZB 1S9EB 3NCQA 1BLUA 3M2VB 1FRJA 3MR6A 1DTQB 1F5CA 3QGPA 3BSCA 4RW7A 3CJ3A 1GQEA 1YGYA 3ZZRA 1TP7A 4DSKA 3H20A 3V6JA 4IQMA 2O1PA 4AXIA 5E3QA 4O4GA 4U7CA 2FHJD 1QTMA 3NBPB 2M7SA 2KFZA 2JL9A 4OIXA 3H4BA 3OPKA 2YQ3A 3MM6A 5T41A 1FDDA 4CI0B 4DL0C 1JKHA 1V6HA 3KLFB 2B7BB 4PXDA 3J7A1 1FCAA 4WZQA 1BQNB 1SKWA 3PEJA 1S79A 1S99A 3NS5A 6FD1A 5L38A 4TY8B 3M9MB 3EXCX 2D41A 1TAUA 2YKNA 1KQGB 4XO0A 1X9MA 3QJJA 1TL1A 4K4VA 3KLHA 1NHVA 1ZZFA 4KV8B 5DLFA 2BQ3A 1ZPVA 4UQTA 5E7OB 4YUDA 5FIIA 3VALA 1R43A 4YB7A 3DLGB 5AJ3F 1ZETA 4PCQA 3MAHA 2D9PA 2DGQA 4BBYA 4A8MP 4Q43A 4NX9A 3THPA 4KC5A 4OJ1A 2CFXA 4QR1A 2XGPA 4MK9A 3UW1A 4AXJA 3WC2A 2JFKA 3OLBA 1FVQA 1LW0A 3DDKA 1WG4A 2FVQA 2E5IA 1S9GA 5HL7Q 2E9TA 1HBMA 3D1QA 3N79A 4WJBA 1X5PA 3CIZA 3I32A 1F5BA 4CO4A 1DAXA 2AX1A 2GGPA 3K8VA 5KFVA 3FRYA 5KFBA 3TARA 1HNIB 3FEXB 4ICLA 4CT9A 4A8FA 1IBKF 1FXLA 1R7IA 2JLEA 3P3DA 4F4ZA 4X4OA 2FIUA 2X1BA 2AJ0A 1YBAA 1N36F 4EYIB 2ZH4A 4KO0B 1CLFA 3MD3A 1YJ9S 3K57A 3JSMA 1VGYA 4PUOB 1DHMA 2K7KA 3GFYA 1RJJA 3IS9A 1RKIA 4NZ0A 2AF6A 3KYLA 4CO3A 4F8RA 1UW4A 5J2NB 4YB6A 1RT5B 4WZMA 4H4KC 4CH0S 3OTOF 3NAIA 2J7WA 3G8SA 3WDOA 4J9QA 1ZH5A 2PA8D 3CDAA 3AHPA 3LP0A 2MPUA 2IYIA 2FJAB 1CQMA 2VFRA 3FNNA 2DR8A 2VBZA 5C42A 1RTJB 3BGRB 2IM2A 4IH5A 3ZZPA 4RUHA 1G3OA 2W9CA 4FF3A 3R5DA 4DV7F 1KC8T 1VQYA 2W24A 2HG4A 2L48A 2XS5A 1QAJA 2F9DA 3PW5A 2ZJRQ 3DRSA 3KK3B 3FZ2A 4O3SA 3JAMY 2MKHA 2R7QA 2VPYB 2YNGA 4W92B 1S6OA 4DQIA 4A8QA 4RNNA 2UXDF 4JV0A 2B5JB 3QO9A 2G13A 2B9YA 2EWHA 2QE5A 1U7LA 3I0SB 1REVB 2DHAA 1RT6B 3DNCA 3DRRA 3V81A 2DRBA 3M8QA 2KHDA 2KXFA 2L41A 4LF5F 3L09A 3FSIA 4DR1F 1DRZA 2DGOA 2CKWA 1Q78A 1WG5A 1HMVA 2OPRA 5F41A 5KFSA 2J76E 2KT3A 2FY1A 5L9XA 4DR6F 4NCGB 3PACA 4NLGA 4F25A 1FKPB 3MM5B 1FO1A 1E6YA 4EFAC 4NMLA 2FVCA 4YDXA 3THTA 3BZQA 1X0PA 4NLTA 3P6YC 1RISA 5FD1A 5CYMB 5I42B 2QV6A 3BR9A 5HQ8A 2KRBA 3O5TB 3QLHA 4X66F 1SL0A 2OD4A 1Q7LB 3PFOA 4ZPWR 4BS2A 2HFNA 3S6EA 4UY85 2V94A 1VHFA 5AE3A 2XY5A 4WKYA 2BJEA