3I9FA

Crystal structure of a putative type 11 methyltransferase from sulfolobus solfataricus
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
165
structure length
165
Chain Sequence
PEEYLPNIFEGKKGVIVDYGCGNGFYCKYLLEFATKLYCIDINVIALKEVKEKFDSVITLSDPKEIPDNSVDFILFANSFHDMDDKQHVISEVKRILKDDGRVIIIDWRKENTGIGPPLSIRMDEKDYMGWFSNFVVEKRFNPTPYHFGLVLKRKTSEGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative type 11 methyltransferase from Sulfolobus solfataricus
rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
molecule keywords Putative type 11 methyltransferase
total genus 47
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3i9fA00
1IXKA 2ZIEA 5FQOA 3VSEA 4YUWA 1X19A 4HTFA 2C7RA 3M4XA 5EZQA 5DX8A 4M7RA 2AN5A 3D2LA 5K0LA 5ERGB 1VLMA 5DM0A 4AZTA 5F2NA 2Z6AA 3PT9A 4PGGA 3R6TA 3DXZA 1L3IA 2IGTA 4FZVA 5CUQA 5G02A 5GM2A 3GU3A 2P7IA 2BZGA 4E70A 2ZVJA 3GRUA 3PVCA 4FR0A 4RTRA 3IYLW 3PFGA 4OA8A 3B7PA 2AOTB 4OBWA 3FTEA 2B2CA 2ERCA 2ZTHA 4E33A 1QANA 1RJFA 5C0OE 2O0LA 1VPTA 2ONZA 4EQZA 5EZSA 3DOUA 5LQJA 3CJTA 2HR1A 5KYGA 3UZUA 5C9ZA 1NW5A 3KR9A 5FTWA 2P3LA 1KHHA 2E5WA 3HVIA 3BWBA 3BT7A 2BM8A 3E05A 4PYOA 4PYQA 3AWIA 2AVDA 4C08A 5E2AA 4AZVA 2UYQA 4Y30A 2AZTA 2G8NA 3CVOA 4PYKA 2Y1WA 1NE2A 1NW7A 3G2MA 5FA8A 5KQRA 4LECA 4XUDA 1YZ3A 2LD4A 4KRGA 3JWJA 1M0EA 2VS1A 3R24A 4MWZA 5E1MA 1N7IA 5EOVA 1RI4A 4X61A 3ID6C 4QQNA 1I4WA 5GIPE 4GOLD 3LDUA 3PTAA 1WZNA 3CGGA 4BP1A 3GIWA 8MHTA 1VIDA 5MHTA 2ZBRA 3HVHA 1KPHA 2H1RA 5DTRA 3P2KA 4POOA 1KIAA 4DKJA 3VC1A 3TLJA 5EEGA 2GAFA 1JQEA 2WA2A 3UJDA 4GOND 3TPZA 2HWKA 1N2XA 3FYDA 3JWIA 4KW7A 2Y1XA 4P7GA 3AJDA 2ZZNA 3UJ8A 1HNNA 3F4KA 2CWWA 3Q7EA 2NP7A 5DSXA 4CTJA 4CKEA 5EG5A 1V39A 2BM9A 2YXEA 4XCXA 3TFWA 1IY9A 2UYCA 2F8LA 3DLIA 1XCLA 2AN4A 3NVKI 1M6YA 5HIKA 3FPJA 4PWYA 1WY7A 1XTPA 2YR0A 3ME5A 4E2XA 1X1DA 2ZWVA 2FK8A 3GRVA 3HA5A 3V8VA 4QDKA 3HTXA 3V97A 4AZWA 4C4AA 1NT2A 1UWVA 3P9IA 4U7TB 3GGDA 4EMSA 2Z6UA 2G72A 5LQUA 5EEHA 1R00A 2ZSUA 4R05A 1DL5A 1G8SA 1KYZA 1NBIA 2YQZA 1XXLA 2P35A 3Q87B 4P58A 3CC8A 2ZLBA 5E1BA 3TOSA 2VDWA 3EVFA 2NP6A 4DCGA 2YXLA 2IH5A 2JHPA 1WG8A 1VQ1A 3HCEA 1SVUA 2FRXA 3DMFA 3NTVA 1P39A 3RIEA 1RI2A 2IDKA 3DUWA 3DTNA 3CJRA 3HNRA 5EIFA 2JJQA 3FPHA 3THSA 3EVZA 5E1DA 4KDRA 2PKWA 1L3BA 4H0NA 4E2YA 3KQWA 3TMAA 3QOWA 4V0RA 1XDUA 1DCTA 2JH8A 4OBXA 3SSOA 2HV9A 3S68A 3G89A 2EX4A 5E8RA 1DUSA 1G8AA 5LR6A 1FBNA 1KPGA 1WXXA 2VP3A 1RI3A 3G2OA 3GO4A 3E7PA 5T67A 4PCLA 1EG2A 2FPOA 2PX4A 3U81A 2FYTA 1AQIA 1NKVA 2AOWA 3HA7A 2V7EA 1YB2A 2B9EA 3HM2A 1KXZA 3LPMA 3QOXA 4L7VA 1YUBA 3EVGA 2YX1A 4DF3A 1MJFA 5CVEA 1WXWA 5DRYA 3DR5A 4NECA 3NVMB 5GINE 2UZ4A 3A7EA 3MTEA 5IKMA 3KR0A 3HVJA 5LQNA 4M37A 5FWDA 1JQ3A 1L1EA 3K0BA 1PJZA 3UJ9A 2G71A 1X1BA 3I9FA 4PINA 4CKBA 4UOEA 4YV0A 3LCVB 3MAGA 3KPVA 3SGLA 3MB5A 4YMGA 3SSMA 2OB2A 3SVZA 2HTEA 1NW6A 5E9JA 2XVAA 3IEIA 1JQDA 3UA4A 3AY0A 3PFHA 4OA5A 4HSGA 3UJAA 2QRVA 2IBTA 3EPPA 3GRYA 3TM5A 1KYWA 4YV2A 1AV6A 3KPUA 3EVEA 1TPYA 3UJBA 3O31A 1R8XA 2XYRA 3NMUF 3H2BA 3ORHA 4RTMA 4YUXA 4X60A 5HIMA 3BXOA 1SQGA 1SG9A 1U2ZA 4F85A 2C7OA 1D2CA 3EVDA 2B3TA 2IPXA 2CKDA 2O05A 3OZSA 3SM3A 1QYRA 2OBFA 2PLWA 4EK9A 3SXJA 3FPGA 2HNKA 3FTCA 4E2ZA 1N7JA 4RTKA 1JSZA 3LGAA 3OFKA 4OX9Y 5FCDA 1IM8A 5JR3A 2IBSA 3GWZA 1VL5A 2AOUA 3BGDA 4IV8A 5E8JA 5B1SA 2OB1A 4P7JA 4DCMA 3BWCA 2H11A 1D2GA 3FTDA 4RX1A 1KP9A 4XUCA 2PT9A 5F2KA 3LSTA 5DRTA 4MIKA 5DTMA 5JUWA 5DXJA 4DA4A 1WS6A 5D1NA 4GUAA 1QZZA 3FZGA 2BR3A 3BWMA 5DX1A 3UJCA 2AVNA 3IHTA 4MHTA 2CL5A 5C1IA 1XDSA 5M5BA 1P1CA 3I5UA 2I7CA 4X1OA 4DM3A 5K0NA 3OU6A 3SX0A 5DM2A 1P91A 3E8SA 3EGVA 3BGVA 5LQKA 4RTQA 3B3GA 1VE3A 1ZKDA 1QAOA 2ZFUA 3M6UA 2IIPA 2PXAA 5HFJA 2NXEA 1VP9A 3T0IA 4LWOA 5K0GA 3MERA 4BY9E 1O9GA 5K0FA 3C3YA 3LBYA 3DXXA 1RJGA 3KR1A 3KQYA 5K0JA 5K0BA 4C07A 3LBFA 5CM2Z 3MQ2A 2AS0A 1H1DA 1ZG3A 3OU2A 1TW3A 2DULA 2NNWB 4B17A 1KR5A 2VZ9A 5FWAA 3FPEA 2IH2A 2JG3A 5CVDA 2PSSA 1X1AA 5IH3A 5P8WA 2BR5A 3MGGA 3TM4A 5BP7A 3BZBA 1I9GA 3SMQA 2NXCA 5DLYA 2JHCA 4R6XA 3ELDA 1RJDA 1SQFA 2N47A 3M70A 4KIFA 1G55A 1SUIA 2Q41A 4C04A 4C03A 3KPJA 5BW4A 5DWQA 5K0EA 3MHTA 3PX3A 1XVAA 2GB4A 4QTUB 4RVGA 5E2BA 3A27A 4HGYA 3G88A 5FHRA 3NJRA 4QDJA 5EMKA 4YUVA 3T7RA 5EC8A 1NV9A 2ZBPA 5HILA 3PS9A 3VYWA 3EEOA 3NWEA 1JG1A 3P8ZA 5DX0A 1TW2A 1ZHFA 5DM4A 2UYOA 3HP7A 2IP2A 4HRAA 3REOA 4BLUA 4FGZA 5EVJA 1L9KA 5EMLA 2NXNA 4LWPA 1EIZA 5EMMA 4M36A 2KW5A 2YVLA 3HVKA 2ZZMA 1EJ0A 5BXYA 2G70A 3E23A 5CCBA 1HMYA 3EVBA 2PX2A 3G2QA 3OU7A 3JWHA 3UJ6A 3TKAA 1YF3A 4KWCA 4OQEA 5KQSA 4RTOA 3C3PA 1SUSA 5K03A 1YZHA 3EVAA 2JHAA 5FULA 4E30A 3G8BA 4A6EA 2PV0A 3TR6A 4AX8A 2O57A 3UA3A 1KPIA 3R0QA 4BLVA 3CCFA 3DXYA 1ORHA 3HA3A 1BOOA 3LKDA 3EMDA 1FP2A 4QVKA 5KVAA 5DXAA 5E9QA 5CVJA 3OZTA 4YUYA 1AF7A 3R9XB 3M6WA 1Z3CA 2B25A 2P1DA 3FRHA 5K05A 4O29A 3B5IA 3KPWA 4QPNA 2AOUB 1YFLA 4PGHA 5ICEA 2OPBA 1NV8A 1JG2A 2QE6A 4KDCA 3ER9A 1JTFA 3EGIA 2ORED 3HEMA 3HCDA 2C7PA 1JSXA 2BR4A 3FYCA 3FPFA 4AZSA 3GCZA 1X1CA 2A14A 3JWGA 3BGIA 1XDZA 3LDGA 5CCXA 5LQRA 5FADA 3GJYA 3WSTA 3X0DA 4XUEA 2PBFA 4YV1A 1SKMA 3B3FA 2AR0A 1G6Q1 2WA1A 5DSTA 5ICFA 4RTSA 3LCUA 4WXHA 2PJDA 2BH2A 5HIJA 3LKZA 3NDIA 1QAMA 1EJ6A 3ELUA 4WVLA 3KR2A 4GOMD 2P40A 2AN3A 4YUZA 1EQAA 4RTNA 4FSDA 3KQTA 5U4XA 5EIWA 3M6VA 3P97A 2CMHA 4KIGA 4LG1A 2PT6A 2IDJA 3KQSA 4CKCA 2JH9A 5HIIA 4GEKA 3GNLA 2P7HA 3OE5A 4PNEA 1INLA 3R3HA 3EVCA 5E9WA 1R6AA 1AQJA 1P1BA 1F3LA 3DP7A 4ER3A 4K6MA 2B78A 2P3OA 4QQKA 2WK1A 1JG3A 1RJEA 1BKYA 2EFJA 3M6XA 3BWYA 3BUSA 2P41A 2PWPA 3THRA 2FCAA 3GDHA 2VDUE 4EVIA 2FHPA 5CD1A 1G60A 4RTLA 2PY6A 1B42A 2UYHA 4G56A 1ZGJA 2QRVB 3KQVA 1ZQ9A 4V0QA 1MHTA 4QVGA 3SR4A 3EEYA 4RYLA 3C6KA 3BKWA 3MCZA 4CWAA 4X63A 4GOOD 5LQAA 2ZCJA 3DMGA 2ZZKA 2GS9A 3HCBA 3GRRA 5FHQA 2GH1A 5EKXA 4YMHA 2ZIGA 2ZW9A 4R6WA 1D2HA 5GP1A 1XJ5A 4PYIA 3UWPA 1G38A 4RWZA 2GPYA 2EG5A 3CBGA 5HOQA 3FUVA 1Q0SA 2EJUA 2XVMA 3FUXA 3LX6A 3LCCA 2OKCA 3P71T 4HGZA 4IV0A 4ER6A 5H02A 4BLWA 4OQDA 1FPQA 1R8YA 3PB3A 4P7FA 2ZULA 4PYLA 2O06A 2I62A 2G1PA 1UIRA 4GC9A 3G5LA 4FSXA 3AXSA 2PX8A 5DM1A 4EKGA 3P9CA 4C06A 4DZRA 3I58A 5GWXA 4E31A 5KS2A 7MHTA 4MQ4A 5CIYA 3A4TA 5ICGA 3KPYA 5CVUA 3ER8A 5EPEA 2CMGA 5D1HA 2ONYA 3GRZA 4HC4A 3DH0A 4P7KA 4PYMA 4Y2HA 2YTZA 3HCFA 3FTFA 5FQNA 1RI1A 1OR8A 3TKYA 4A6DA 1VBFA 5LQCA 2YUIA 3NWBA 1PRYA 4GQBA 4GBED 4RVDA 3QV2A 5DPMA 3KU1A 3I64A 3VC2A 3FUTA 3OPNA 4C05A 2ZIFA 4IWNA 5CVVA 3T7TA 4FP9A 3GXOA 1ZGAA 4Z2YA 3UFBA 2NYUA 3I53A 2K4MA 3A25A 1NBHA 3A7DA 3NDJA 5GOZA 1YFJA 5HZMA 5EKUA 1L3CA 2AOTA 2EJTA 2V74B 2OYRA 5T64A 4RVFA 5K01A 1NW8A 3G7UA 3C6MA 3HCCA 5LSAA 1XCJA 2PWYA 3BKXA 2P8JA 4FT4A 1F38A 4DMGA 4ER5A 4F84A 4PYJA 3O7WA 2QY6A 4HH4A 2O07A 2OZVA 3FUWA 4IKPA 5F2OA 3G8AA 3PLAE 5BW5A 3K6RA 3FRIA 4MTLA 10MHA 9MHTA 4EKIA 4F86A 1UFKA 1FP1D 2XBMA 4ISCA 4DQ0A 3KQOA 4HTFB 1NW3A 3KQPA 4PIPA 5K8VA 3RODA 3OCJA 4PCAA 2GLUA 3P9NA 3L8DA 4PONA 4QTTB 2OXTA 1M6EX 3TQSA 5EHIA 1ORIA 3LECA 5DT2A 1FJXA 1BHJA 2Z6QA 1O9HA 2DPMA 3G5TA 3DLCA 3ELWA 4ER0A 2ZBQA 3NW9A 3KQMA 5EGSA 2C7QA 3DULA 4RTPA 2YXDA 3MCTA 3RW9A 3ERCA 4RV9A 3LL7A 5E1OA 5K09A 1VP3A 4RTJA 2IFTA 1R18A 4E32A 4FT2A 4ZTBA 4CXMA 3IV6A 4ER7A 4GC5A 4KVZA 3P9KA 5DTQA 3OZRA 4U7PB 3KKZA 4PIMA 1Q0TA 1Y8CA 2OO3A 1QAQA 2XYVA 2PXCA 4HG2A 3O4FA 3G2PA 5T6BA 3B89A 4R8SA 3LHDA 3KQQA 1I1NA 4FS8A 4RVHA 1R74A 3AXTA 2AOXA 3ANXA 3TRKA 3OE4A 2H00A 3EMBA 3A26A 3LDFA 4R8RA 5GM1A 2I9KA 5EHGA 3C0KA 1BC5A 4PYNA 2GA9A 2XYQA 3B3JA 3EGEA 2OY0A 1O54A 2HMYB 1JR4A 5FUBA 5HEKA 2FK7A 2R3SA 5EQJB 2ZWAA 3UBTA 2PX5A 3P2IA 3DMHA 3M33A 2R6ZA 3P2EA 3MTIA 1T43A 3SSNA 2PXXA 3T7SA 1JG4A 3UJ7A 4RSRA 2PVCA 4BP3A 2NXJA 1JTEA 2ESRA 3OFJA 2AOVA 3KHKA 4M38A 3HCAA 4GF5A 4ATNA 5K0CA 5GIOE 2PGXA 4JXJA 5EMJA 4QPPA 5FA5A 3FUUA 4CTKA 3CKKA 2ADMA 2IH4A 3ELYA 1RI5A 2VDVE 3PX2A 4X41A 5ICCA 2QM3A 1EAMA 2QYOA 2P3QA 3CJQA 2I6GA 4AUKA 4E2WA
chains in the Genus database with same CATH superfamily
1FA9A 1HG1A 3SQXA 3UMCA 2D62A 2Q3MA 3AF4A 1TUBB 4IEIA 3U7EB 2ZQ5A 5EZQA 3WL3A 4EARA 1KO4A 2AN5A 3OETA 1YS4A 3X43A 6GPBA 2QXYA 4FE3A 3IQXA 3LVRE 4FWBA 4LVUA 1G2QA 3CRVA 4XLLA 4LIPD 4IZ6A 3PRYA 1M2WA 4RXTA 3W04A 2VJDA 3PFGA 1W6RA 3DEIA 4CRWB 1VFPA 2N1MA 3REGA 4AF6A 1MO5A 1UODA 1WDLA 1ESDA 1Q2UA 1VOTA 2B2CA 4HDCA 4MZDA 3F49S 1DV1A 1KE1A 3NV7A 5FA6A 4HH1A 5FDFA 2RGRA 3AW9A 3DB1A 1RWOA 1FJGB 1BW9A 4TMXA 1X7WB 1PIWA 1F8UA 3V4FA 1J6UA 2II6A 4G0WA 5B1DA 4MCAA 1SU8A 3BT7A 3MMPA 1RZVA 1JFFA 2ZJBA 3H3XA 4DPLA 3W3AA 1DC5A 1Z08A 3U7HB 4TV9A 1IOZA 1T4CB 2WYOA 4L8LA 3D4NA 3F8SA 5KYTA 4HQ0A 4LECA 3O8BA 4XUDA 4US1R 1GCIA 5KTRA 4RDXA 3NHMA 1DC4A 1H6AA 3G82C 4KLZA 5DNUA 1SVWA 3JVDA 4N49A 6YASA 4GOLD 1QIFA 4J49A 5FPHA 3NM5A 3GJTA 2EDAA 4KJXA 4HWGA 3Q3JB 1G4UR 2AFHA 3H4IA 3USZA 2BJVA 1SOMA 3E03A 1KPHA 1L8QA 3JS5A 5FOTA 3KJZA 1N9GA 3ZDYB 2ZSBA 3AF5A 4G5YA 4KOEC 1N9GB 1T3HA 4D3DA 4URHA 3JQAA 1M9NA 1N2XA 2P75A 1CFJA 1EFVB 3BK1A 3H87A 3AJDA 1D09A 3HSYA 4BLSA 2JLXA 3A0RB 1V16B 3U9SA 2DVMA 4F5WA 2PR7A 4IXMA 4C0QC 3TFWA 2GETA 1WHSA 1C30B 2JFPA 1JHZA 3KALA 1CR4A 1WCWA 4H7KA 4YYEA 1K7SN 3A1FA 3HSSA 4NEQA 3EJWA 3NVKI 5BR4A 5K0ZA 1BE0A 4OEHA 2E1PA 4L4SA 1NBAA 1V41E 2RGYA 1K3TA 3BWVA 5G4KA 4GPZA 1IY8A 3V97A 1C29B 4ABTA 2R9VA 1PSDA 3LIIA 4R9RA 3PRKE 5BSEA 5I7EA 1WBBA 5F21A 3HKEB 2W42A 1NBIA 2D0DA 3WGKA 3KKMA 3WIUA 1A69A 2VEDA 5BSUA 3C14C 1A77A 2EG9A 3EQ9A 3CBQA 4RQTA 4RZUA 4UMVA 4MEAA 2QZZA 3ENKA 1GTG1 3DTNA 3FMGA 3HNRA 4RK5A 3MJHA 2PGAA 2PT5A 5CAEB 3EVZA 1TZBA 4U3JA 3SDSA 3WL5A 1JAZA 3DAOA 5L4NA 3PU6A 3BDIA 1N1DA 4OHCA 2MWMA 5K3OA 4G4JA 3UW3A 3VR0A 4D46A 2H92A 3FE2A 4GKKB 2Z8ZA 3CN7A 1H6CA 3Q0EA 1BD4A 1DXQA 2VP3A 4KN8A 2GQ0A 3E7PA 3HN7A 4MAFA 3ABOB 1L5FA 2XODA 1GYPA 5FPTA 3E18A 4CU5A 2PX4A 1JECA 1ZK0A 1Y5RA 2G0TA 2WB4A 4M55A 2OBLA 3KZOA 2V7EA 2WG0A 1C1DB 5DK6A 3CM0A 3WGNA 1U80A 3WWOA 3NIFB 5JCJD 1IYZA 1DIGA 1OZGA 1DMSA 1SURA 1X80A 2H9AA 2IXFA 3IMEA 4MW9A 5ALQA 5AOVA 2UZ4A 3A7EA 1YZKA 1XDDA 4ZJUA 4J2OA 3PHLA 4XTCS 3O4JA 1QK4A 2J08A 4R9SA 1STOA 2MINB 4HZIA 3X1KA 4F5ZA 2D7DA 4A0FA 1Y6RA 4Q4JB 1EXDA 1VTKA 2D1QA 2QMQA 1BRTA 1G9TA 3JQFA 4F8EA 5E4FA 2OB2A 3FW1A 2HTEA 1OYYA 5BVHA 2X40A 3IEIA 4G85A 1WVMA 1Z4PX 4J4BA 4WXRA 3UJAA 4L76A 2IBTA 2ONJA 1EX1A 2AQIA 1GGEA 1QCCA 4UM7A 2NV0A 3R7AA 1QTNA 5CNJA 1SUAA 4YUXA 5BWMA 1AZTA 1EX7A 3PWKA 4KACA 5AW3A 4PPNA 5TF0A 4REQB 2F8MA 2X15A 5CFQA 3P2JA 2OG1A 2VYFA 1KVQA 1XDGA 5H83A 3S6JA 4P3PA 3ICPA 1FSFA 3I9V1 1IJBA 5KNDH 4MO2A 1KU0A 1YJQA 4IV8A 1RHJA 2EW1A 1Q0UA 2WTNA 1DINA 4EHBA 4P22A 3FLMA 5F7ZA 3PJFA 4KE6A 4R40A 1DG1G 2BELA 2VUIB 3QVWA 1HDZA 4FJ1A 5DTMA 5CA0B 4DA4A 1UJMA 3CF4A 3HJRA 4O4JB 1TK9A 4WBNA 1QZZA 4G0QA 2JZCA 3G9QA 1ADYA 2W4QA 3BWMA 4CHGA 4QGSA 2BGTA 2CFCA 2HA0A 3IHTA 3KNZA 5LZ7A 3JQQA 4JUDX 5ERYA 3RJMA 2H16A 5DCWA 2TMDA 5JQGA 1IU9A 1AS3A 1U0FA 2XUKA 3DDOA 3GEMA 4R51A 3WGJA 1SXIA 2EAUA 3N8DA 5J4YA 1BX3A 2HTFA 1TA9A 1CUGA 4MCHA 1HETA 3FWPA 3L7NA 3NEYA 4XGIA 4ZI7F 2HCRA 1AKEA 1L5HB 4HP8A 4OP3A 4Z0NA 2ZUBA 3S27A 4KH0A 3DZDA 1KI1A 3QNWA 5A5GA 4W1PA 1W7AA 1R4NA 5K0GA 4GI1A 3M1AA 3AHDA 3OKAA 1CJSA 3P2YA 3EZLA 2VDWB 2AYZA 2NAPA 3OPVA 4Q9IA 1UC9A 3RLFA 3EC7A 3M3DA 3LYLA 3W1WA 3IKJA 1USGA 4Z4CA 1KR5A 2DLNA 1JEYA 2ZI4A 2QDXA 4NDNE 4WFJA 4HQLA 5P8WA 3Q7IA 5FTLA 1JFSA 1K5GA 1I9GA 1S1CA 1SCKA 3L1IA 3U37A 5BVHB 3GLFA 1E9EA 2N47A 2HZBA 2CLMB 2WSIA 2YJ6A 3GPCA 2HIAA 3M70A 3NRBA 4AO7A 4R0MA 1NVKA 1Z5NA 2OP1A 3EIQA 5DVZA 4RJTA 1W36C 1ZM7A 1QYVA 1XLTC 2N46A 4DXDA 3ZJUA 1M2GA 3D5QA 4I6EA 2ZRLA 3RJZA 4QLAA 1GNLA 4QDJA 3IP7A 4RK0A 5DGHA 1OKKD 1EX6A 3ESXA 3GFPA 3LXXA 4UFPA 3EIEA 1Y98A 3C3KA 3P8ZA 5DHTA 1OLUB 2GPWA 5B2ZA 3A32A 1ZINA 1BWSA 1YR2A 3K5WA 3WDMA 5JNRA 1L7OA 1ZJYA 1M75A 4G65A 2JFQA 5EVJA 1NHGA 4XOIA 1B6RA 2W2MA 3ND5A 2I6QA 4DHEA 5HHTA 3ANSA 3GFGA 3GROA 3A9UA 1CNFA 1JMVA 1L7EA 1LJLA 3ZTWA 1P7CA 3ASZA 4EEKA 4ZK6A 3I2IA 4NX2A 3V4OA 1G17A 1SC1A 4XGKA 2UAGA 3VKGA 2BGUA 3ZK8A 1JHOA 3TZHA 4DV3B 4LTNA 2ZPAA 2GZAA 4RLHA 3VOAA 4ZVSA 3ZHUA 1V4BA 2WU8A 4QUJA 3Q10A 1CR1A 3W5SA 4H16A 4INAA 2OK7A 3V4ZA 4B48A 1KC1A 3FNEA 3G7NA 5DISB 1MXFA 1H1LA 1K5HA 6REQA 5JZ9A 3M3PA 1Y3DE 5CVJA 3DNFA 4ZCIA 1MABB 1NLFA 1CW2B 3PE3A 1Q1GA 4XZ3A 5EKTA 1SC4A 3FRHA 3X1XA 4PZYA 3TMKA 3M4NA 4L2IB 4HAYA 4QVIA 1Q1QA 2XE7A 1FMTA 3DPUA 2RH4A 3PCXA 1IUPA 2RI6A 2X41A 3HKBB 5ILGA 1LLQA 4DRXA 3S8YA 3L6RA 3NR2A 2ZGVA 3K1ZA 1YL7A 1GUBA 4RMIA 1OWLA 3DTTA 5CXSA 4UFOA 4CG3A 2Q5QA 3R0IA 3DF7A 3IKMB 3AZOA 1JTVA 4OFBA 1DKNA 3TIVA 5EJEA 1B73A 1QRRA 1J1IA 3GLUA 4GT1A 2AHOA 1BYIA 5FBZA 1AHPA 1YCDA 4WTOA 1N2CB 3X0DA 1P18A 2QNIA 5C1PA 4R0VA 4XIYA 1RC1A 3PKJA 1G6Q1 2WA1A 1H94A 2PZMA 3AU8A 2AW3A 3R7DA 3U62A 1BMFA 2PJDA 1SZPA 4A8TA 4CL0A 4I50A 5KYVA 4YUZA 3KYIB 2CD7A 4NNOA 1V8DA 5EUBA 4RTNA 5JC1A 4G5SA 1L7PA 2FEPA 2J5KA 2LW7A 5DLQC 5F51A 3OTQA 1EVYA 1G4HA 1MQAA 4KZPA 4RENA 1AURA 2C7BA 4TT3D 1ZM3A 5LDDC 2JK1A 2QTLA 1GSHA 4L9RA 5TVKA 3ULKA 5TDHA 3UOAB 3WHIA 1P61B 1ACJA 1JBQA 3QHPA 1P9LA 3HB4X 2IJGX 1M2NA 4O6VA 1XMJA 1Y89A 4DLUA 4IIJA 5AW7A 4YP1A 3NNDA 1GAXA 1W8DA 2J0UB 2WW8A 2H7YA 1PEKE 3M1YA 4FE7A 4YN3A 1BKYA 4CEHA 3QLJA 3IP6A 3Q98A 3A3NA 4ZT3A 2OQIA 4D9FA 3MHPA 2FCAA 3RSZA 4XQEA 4F9FA 3ZXUB 2OK8A 4LAFA 8GPBA 3K72B 1NVVR 3PPYA 3LHFA 5DTJA 3T9AA 4NMLA 2IQ5A 4YRSA 4RMJA 2H4HA 4KL8S 5JDCA 5JNVA 1CR6A 2WSLA 2I3BA 1IVNA 2ZRGA 3C6KA 4E6EA 3CUVA 5LQAA 1W5EA 4IZOA 4PNHA 1P6QA 1BYUA 1P7VA 2BF7A 2CUTA 3QIAA 4FOLA 1Y9JA 5FHQA 2W8BB 4HWPA 1UADA 3TR0A 4DEYA 3B36A 5FBQB 3DHYA 1T13A 1OLSB 3IMKA 3PPXA 4UCXA 3W5CA 1EZ1A 1XJ5A 5KSZA 5HF8A 4PXAA 1KOFA 3HXKA 4RUKA 4W5NA 3PD0A 2OTCA 5KTYA 4LC1A 3EX7C 4YJHA 1W9MA 3JQ8B 3TRJA 1LBHA 3RKSA 3U39A 5BNZA 3LF2A 2YJ3A 4HATA 1QIMA 1O95A 3G5LA 3ZJ4A 3GDGA 1DE0A 3BXGA 3QPUA 1CLUA 1FS6A 4K9NA 4UHJA 3LWDA 1IRIA 1CZHA 3KV3O 4RNCA 1O97D 4EHFA 4XR9A 1IVSA 3E5NA 2RJNA 2IIQA 2VBFA 3FOEC 1LVHA 5B7GA 4HC4A 3P19A 3DH0A 1Q6ZA 4UE3S 4MRRA 1GV1A 1B1CA 9LDTA 3ROZA 1KKMA 3A6ZA 1D5CA 3IULA 4I4CA 2O9JA 2H29A 3O0TA 4I8DA 4JT8A 4NDZA 3SHOA 4D82A 2QRHA 4JXZA 3BFVA 3DTVA 2WHYA 4FI3F 3QV2A 2O1WA 3U4MA 1DAEA 3VC2A 1YQDA 3ECCA 4BIMA 1E1CB 2G5TA 3O2JA 1AMOA 3E0QA 1YJ5A 2P4UA 3AUJB 3VX4A 5A7HA 1ENZA 1U1GA 5LZ8A 2AC4A 4LOLA 1H3NA 3RT1A 3FWYA 4HYEA 4F84A 1NBOA 3CUYA 1MTOA 4FT4A 5A71A 4ER5A 4W5TA 2XTAA 1MT0A 1FXWA 1B6SA 3S99A 4OH7A 3P52A 4BMNA 4C43A 1FX0A 2D5LA 1HLFA 1E1DA 1M1YE 3H9QA 1X14A 1XXHB 1OX5A 1PAUA 1ESZA 1Z68A 2H4YA 2KBEA 2XUQA 3OQ1A 4CLRA 4JJ7A 1B43A 4KUEA 4RU1A 1G59A 2B30A 1JQ5A 5JJCA 4LNUA 2WUEA 3DYBA 1DHRA 2CNKA 4ZOLF 1NOJA 1Q0PA 2DBRA 1AJEA 3K1AB 4TWBA 1UKZA 2WUDA 4IUYA 1KZ1A 3ZZ0A 3STYA 1KC3A 5FAKA 2BMDA 4E14A 3AVUA 1OI2A 2M9MA 2QM0A 1SEPA 4Y67A 2IHUA 2IXTA 3GEHA 2Z3WA 1NW9B 3EUAA 4G8BA 4IIJF 4ZI7B 3DULA 1E8NA 3ERCA 4G0NA 1Z5ZA 1N5LA 2LUOA 4DR4B 5H1YA 4N82A 1XPUA 1AVTA 1W2WB 3A1CA 3NGXA 3DBRB 1VLLA 4NYIQ 1L7VC 1PGQA 1WZ2A 4IINA 3RSSA 1NVBA 3WMRA 1HFKA 2XOXA 4D41A 3EDMA 4Z99A 4ZI7A 1O89A 4CT4B 2QD5A 1L6IA 3B2QA 2FUKA 2OO3A 3GCDA 4HDNB 1H5QA 1FB5A 1VMEA 4HNTA 4NPCA 4I55F 1V4NA 4HSEA 3UATA 5IDVA 5F1YA 3VYVA 4MVJD 1F60A 2WIFA 3KO8A 1LQ2A 1PG0A 2O5VA 3AEKB 4HEA6 5LLTA 3A36A 1IY2A 4AN0A 4QUBA 4TMTA 1GKLA 2J3IA 3VU3A 3PDCA 1RHKA 2C9MA 3DBLA 4OHWA 4EGFA 4AMGA 2R3SA 2YINC 1EPUA 3QWBA 4TKUB 4HJXA 4UNNA 3NWOA 3EXIB 3DMHA 4EO9A 1QS0A 2ZPTX 3M83A 3DDUA 5J4KA 4M38A 4NG5A 1OQAA 5FNVF 3GT3A 2XNHA 2B1JA 3A4MA 2GZ3A 4FHDA 1GG5A 3F1KA 1M7BA 2GWRA 1KDOA 3FNBA 2CMKA 3PSHA 4MV4A 3WZ2A 1DRUA 2CDBA 2IXGA 2OV8A 2P3QA 2ZAOA 4IFEA 4CN8A 3PP8A 1IXKA 2H0QA 5CFLA 2DHDA 3CW2A 1W9HA 3D6UA 3DOJA 1KIMA 3ZJTA 1SIWA 4JI0B 1M1NA 3DO5A 4J2HA 2R00C 3H3JA 3T15A 1SB9A 2WQ6A 1JPVA 2YVQA 1YRYE 3IEMA 4YMTA 2R8PA 3DEJA 4RH0A 5JJLA 3DXZA 5B1YA 2YFYA 4MUEA 3IUMA 2EU8A 4Z0TA 2GYYA 2J3DA 1QP7A 3JD1A 5DTEA 3RARA 2FSVC 3SIXA 4J9VA 5A3VA 5KNDD 3EASA 3D2CA 3PNLA 4LF7B 3RGWS 1R12A 3N7UA 5L3QB 1V1RB 2HXYA 2ZTHA 4N47A 5HPYB 2GN9A 1Z4KA 1CP2A 2OV4A 5EXSA 4W5JA 5IDYA 3ZU6A 1KEPA 5JTUA 4GICA 3KEGA 3AR3A 1BX0A 5FTWA 2QQGA 2I4NA 2X6QA 3KR9A 2E5WA 1ZUNA 1JKJA 1T1SA 1UL1X 2XB4A 5KOIA 1WOMA 5JQGF 1J97A 4Z3DA 1GG8A 1AG9A 1US8B 4E07A 2EWMA 1NJ2A 2BGJA 1I4EB 4DABA 1U3CA 1RLTA 1ZD1A 3WZLA 2W8BA 2JK0A 2UUPA 3N1UA 4XEUA 1G7CA 1SWWA 4BMOB 1P1IA 3WTCA 4B2LA 3AY3A 2FEXA 2OORA 4Z4EA 3LO5A 3ROKA 4R1UA 4E4YA 1T2DA 2ABWA 3DKPA 3FROA 1E1CA 4RLFA 1SNYA 5DHAA 3TNDA 4C0XA 1TXGA 5C8YB 3M9LA 1DJMA 1XJCA 3T12A 4LY0A 3WWZA 2RHLA 2I6XA 1I24A 4G97A 1ZZEA 3TPZA 4WQMA 1VLHA 1RQPA 4CTJA 2GMWA 4GX5A 4B45A 5HKBA 4LBVA 3U80A 2H2FA 4ZVOA 4P53A 3LUPA 2OFXA 4EOGA 1SHJA 4YGYA 2JI4A 1PHRA 1MX5A 3IQGX 4OU5A 4EWLA 4MCIA 4Y0VA 4LDAA 4IG4A 1G1MA 1Z2OX 1NLUA 3L43A 3O1JC 3S3TA 4X7MA 1H42A 1QSGA 1BN6A 1DCMA 4RGQA 3RB8A 4G1BA 4EMSA 4EPVA 1T9KA 4AJ2A 5CTAA 5BUQA 2NSHA 4I1IA 3LY5A 3CXUA 3NNSA 5ENZA 3DAGA 4LSMA 1QDLB 2ZRCA 2YWBA 2DH5A 5I8WA 1RLMA 2NP6A 4MVWA 4LXQA 3A2LA 2AUTA 1SVUA 3HRIA 1DZIA 3AESB 3SOZA 3SR3A 4YS6A 4A27A 4ZGGA 2JJQA 4Q66C 3MUNA 3NIBA 3RREA 1QVWA 1W1WA 2Q9UA 3SDBA 3WGGA 1KEZA 1G5PA 4U3JB 3ZWQA 2PEZA 1C4WA 2ZIXA 4QELA 3WY9A 3B1WA 3TTSA 3DBRA 3WDLA 1QYCA 3HI4A 1H2EA 2LWIA 5AUOB 5E8RA 3ZWDA 5E38A 1T9CA 5FF9A 4AJOA 2IHNA 1ZESA 4FNOA 4MUFA 1Q7TA 4M46A 1ZRSA 3E9RA 1NNSA 4JVOA 4C4PA 3WNZA 4UVIA 2FYTA 1H2YA 3H42B 1E3JA 3O26A 5COBA 1O95C 1WU8A 5DI3B 4AF7A 2X19A 4D43A 2BHLA 4LNUB 1XZKA 2YS6A 1EVZA 3QMVA 2UKDA 2UZ1B 4IEEA 4NECA 3R77A 3W2FA 4ARAA 5A2GA 1W5AA 3BFJA 4U5XA 1XPOA 1T4DA 4P6VF 3MJRA 5LBUA 3AFHA 4H31A 2PUAA 1CYEA 1PEAA 2VDQB 1RRPA 4QOHA 3VSDA 1VA5A 4II7A 3D8TA 4AY5A 1RYHA 4E5SA 3Q8LA 1IK6A 2D74A 1XX6A 2XRYA 4Q3AA 3F5SA 2ID4A 1YRBA 3Q3HA 4URVR 1VC2A 3B13B 2ES4A 2QP3A 2XD9A 3OJFA 3WYGA 1AKMA 1XEXA 4FFDA 1COWA 2AQ8A 5A5DA 1PG5A 2RGNC 5ALXA 2A4KA 2CHFA 2AFHE 3G8DA 4ZTUB 3R5KA 1HNZB 4YH1A 1VCIA 5JS1A 1MOQA 1U7OA 3B1XA 1P3Y1 3PFIA 1FTWA 4ALNA 2VZEA 5AVVA 1H1LB 2BZ1A 1W5FA 3RYTC 1EX9A 1YQEA 4H7HA 4K9PA 4MUBA 2VUUA 2OPHA 2BI7A 3TB6A 4B7AA 4DWVA 1NR5A 1U9CA 4WT7A 4EK9A 4CKWA 1HL3A 5AI0A 1N7JA 3DM9B 3G2IA 4Q3DA 1DKMA 1P9WA 1X0XA 2C82A 1P62B 2VPQA 3CIOA 1VIVA 1NN1A 4G8CA 5M3BA 1E1RD 1MLDA 1SR8A 4DQXA 1N1MA 4M0MA 2OD7A 4DCMA 2Y05A 4RBNA 2IYEA 1KJZA 1ZQ1A 2HQRA 1R8JA 3RBZA 1H0SA 2BW0A 5G0WA 5JUWA 5CRIA 4Q4JA 2VP2A 2IDMA 2DKNA 1RLUA 2W0SA 2H9YA 1E2MA 4PQGA 3AR9A 5JAOA 4H0FA 4EPRA 2PPVA 1ZUD1 1V45E 4YROA 5E95A 3KIPA 4S1PA 3ZQJA 4Z54A 5M5BA 1JILA 1UBGA 2BFOA 5BY2A 3FLBA 5HXAA 4NJOA 1QOQB 1XHFA 2NZYA 2WWHA 4ZMSA 1ZD2P 2UV8A 2AX4A 3L1VA 1KVSA 4ND3A 3TIXB 5IT5A 2R96A 1F7VA 4HEJA 4TTQA 1JAIA 5EIEA 3SJUA 2QVCA 1F3OA 1GQ2A 2ODPA 1U2DC 3ODGA 4KO1S 3GJQA 2P9FA 3OIUA 5BUCA 3LBYA 4Y2JA 1GTL1 1TFRA 4RPJA 5K0JA 4BCDA 3HO1A 5J5CA 3G9ZA 4FDMA 1HEYA 3BMQB 3GYGA 3ND7A 4GVXA 2OGWA 3G59A 3T3EA 2NN3C 1ID1A 3AF3A 3B6IA 3HU2A 3H86A 3TKLA 1M6NA 4PC1A 3JU3A 2J9GA 4PLGA 4KGVA 4GMKA 2CY0A 2OO7A 3DMYA 3KE8A 2B82A 3KFVA 4CV2A 2RD2A 4J0DA 1EHIA 5CG2A 4ZZ2A 1MDBA 3QJGA 4ZDIA 5ICSA 2H1WA 4ZO4A 4MR7A 3U3KA 5B4TA 3R74A 1YR6A 2OO5C 1DWUA 4FE4A 3CS3A 2B4RO 3THYA 1SEVA 2YUTA 2IZ0A 3ZG6A 2BMJA 4Y98A 4MW6A 4YUVA 1YAHA 3L7DA 4OK5A 2C58A 3PC8C 5FFMA 5AMXA 4TL9A 4TUYB 3BS4A 2HRBA 1RWKA 4M9RA 5K3FB 1UZUA 2XZPA 2QR3A 3EA0A 3OE7D 4LTDA 4REOA 5D00A 2QWXA 1KF0A 5JPIA 1IBCA 1E9VA 1PZXA 1L5OA 2GGSA 1F0PA 3BXFA 4FONA 5TEWA 2VK4A 2ZRKA 5ADHA 3IP5A 3ILSA 1ABBA 4JFRA 4MUGA 5ISMA 2P5UA 2YWCA 1R0ZA 3HBLA 4NCHA 2L18A 1ULZA 3LW8A 1D8TA 3K0HA 4KN5A 4RAQA 3T7DA 3WO1A 5EMMA 3IMCA 2HT1A 3OH8A 5BQOA 3NC1C 3DEZA 4JL8A 1H8ED 2PWZA 3DWGA 2PX2A 4L08A 4PLCA 1WV1A 1H4QA 1C3JA 1PLLA 5G1PA 5KQSA 4EI2A 3EDYA 2PBZA 2AE1A 3C3PA 3K09C 4F1WA 5FULA 2ZI3A 4E30A 3ESBA 3JQ6A 3SQDA 1E9RA 1W30A 1R6XA 1PF7E 2O57A 4XDZA 1DTWA 2VDPB 1XMPA 2WIDA 5AVKA 4X64B 4PSUA 3AR4A 4HAUA 4L5BA 4TUYA 3H0KA 3O91A 3E4DA 1Z3CA 3TSAA 1V5GA 2AEMA 2HJ9A 3Q2OA 1GPNA 4JZYA 3EXEA 3T1OA 1MFPA 4MWEA 4UXIA 3EUWA 1DX9A 3A1WA 1F2TB 2ZIVB 3KZVA 4Z1MA 5IAEA 3UWSA 4BMCA 2B8JA 2C7PA 3D4PA 3PEYA 1QKJA 4QICA 3I9JA 3D6HA 3RT9A 3L40A 2QP4A 2GCOB 2JIRA 4FFVA 3WLLA 2A14A 3RQIA 1H8EA 4M1QA 4F04A 1A9PA 3LQRA 4BJHB 4F2WA 5LYJB 1IPEA 3VAYA 1AGXA 3EDOA 4GFDA 1WWKA 1XSEA 5DSTA 1U63A 1NDQA 3AO0B 3VMFA 1WXEA 2BEVB 2EJCA 5BW6B 3CLKA 4B73A 4CHTA 3IC5A 3THYB 2QT9A 4AB1A 4EA9A 4JBYA 3WXBA 3KR2A 4GOMD 3ZWPA 3IBGA 2HSGA 4CIVA 4O33A 1L5GB 4TPKA 3U7GA 3P97A 5KJ6A 2G6TA 4JGBA 1ULBA 4DR1B 5HIIA 5HRCA 4GEKA 1ZI8A 2Z2YA 4QU9A 3H0CA 3ZNOA 4EMBA 1INLA 5TPZD 4BECA 1I1HA 1QHHB 1R6AA 2GT1A 3IAHA 5TGZA 5BN5A 1B0AA 2HHCA 2V6FA 1USKA 2I99A 2NADA 2X8WA 2XB6A 5JZBA 2Y99A 3S2IA 4WZAA 2LIPA 3CNHA 1SULA 4Y6PA 4BCCA 4O25A 4PO9A 4EH1A 3QMPA 1QZUA 2OESA 3WS7A 1MO6A 4WXEA 1NAIA 4Z9BA 1U9JA 2GPAA 3CVYA 2QGNA 1RCFA 2QRVB 3PD7A 4HF7A 4K9QA 4XB1A 5HE8A 4AYWA 5B4UA 3O8LA 4DSZA 4KITB 1JH9A 3KB2A 5IF3A 3OZWA 1WPQA 2C9BA 3DE2X 4JEUA 2YWJA 4DA6A 2C5FA 3H2IA 3L6UA 4KFCA 3U4CA 3UHJA 1MO2A 2CYCA 2D3WA 4EHKA 3T95A 2H1HA 5C8ZA 1NURA 4YMHA 3N07A 5JFTA 2OL4A 4YCAA 3F6PA 4LYAA 1Y9ZA 4NMMA 1A4UA 3LZDA 2IZ7A 3GOHA 4H6XA 4INZA 2QMUA 4MJ7A 4C29A 2WNIA 4GP6A 4WVFA 3EXIA 3IUBA 3LDHA 1HMPA 4JLPA 4PHFA 3DWIA 7GPBA 1OV4A 2WLSA 1K4KA 1F0NA 1S96A 3FDIA 3QELB 5JXJA 1BN7A 2AJLI 4QXAA 5C5DA 2GDJA 1RPTA 5DIFA 3T94A 4H1TA 1PX2A 3EOZA 5KWVA 1Z17A 3F97A 3GFSA 4E31A 5IN4A 3T7KA 4AY6A 2DX7A 2FG5A 2W2LD 3OBIA 3FOCA 2XQIA 1Y80A 2E4YA 1ZLXA 4DCCA 5D3ZA 3K9HA 2JKZA 1VJGA 4UAJA 3Q7PA 4ZVPA 5TJHA 5REQB 3VNUA 1Q95A 4PC6A 3ZDEA 3GYBA 3KEMA 1PP4A 2O7SA 2PS9A 3R3VA 4OYYA 5EXXA 4D2IA 1M76A 4BKRA 1OB5A 2H1OA 2OCPA 2C84A 3AHGA 4E46A 3NWBA 1S1MA 1E3IA 3AIIA 4R9VA 5BSWA 2OENG 2V3WA 4ALKA 4C4SA 2B1RA 3OPNA 3AKYA 3HCOA 4WESB 4G86A 3ADDA 3NUZA 2OV1A 2VH1A 4P5PA 3STXA 1HKUA 3EGOA 1W48A 2BWJA 2HDHA 3GJRA 3I04A 3N2GB 4RXMA 1OX4B 2Q4DA 2X58A 2JFUA 1Z2AA 2QD3A 2QZ9A 2WIJA 2V98A 5F77A 4KLCA 721PA 3SCZA 2WWIA 3HCCA 4ZJYA 1CSEE 3G1TA 2P8JA 1XEWY 2B5VA 4JROA 4M54A 5FEMA 3WNQA 1KFBB 1S8AA 1WE2A 2XDQB 2ZSKA 3EAFA 3QUSA 4O1HA 2Q21A 4UTZA 1C3OA 5F2OA 4A3SA 5AESA 2NO6A 4DILA 5CXUA 4OFXA 4XKJA 4FD2A 4X3CA 4AZ0B 4KXVA 3CSDA 3HBJA 4AURA 2SKEA 4DQ0A 5BR8B 1OT3A 1NW3A 2NGRA 1E98A 2WIAA 2ZE8A 1LGYA 4FX2A 4O2AF 3TSWA 2IW3A 4Z0PA 2FMFA 1IIBA 2WJ4A 2A35A 3M89A 4AYXA 5EHIA 2DQZA 2DTXA 1UZMA 1P7YA 1YOVB 1U0OC 5JZSA 1TD9A 1EUYA 1BHJA 4JI6B 2EX1A 2WG1A 1UXKA 4LV5B 3RUFA 1Q83A 2ZT8A 3NHWA 4KXNA 3WMXA 4DUZB 3ZVKA 2PJRA 2LE0A 5HNKA 1BFUA 2F1OA 3BK2A 4BTEA 5KNCA 2K7FA 4WLVA 1YVRA 5H5JA 3RYCB 3TZLA 3H3FA 2ECFA 1R18A 1VPDA 2V0CA 2O6HA 1M5RA 3M5WA 1V26A 1G291 2FFAA 3MMZA 2OCYC 3EIWA 1UPCA 2PZKA 4C89A 5I7VA 2XNCA 2COKA 3HDQA 1QTRA 2QVYX 2VYQA 3CG4A 2VQ3A 3KQQA 5L3RA 4EI8A 1C0IA 1YNSA 4JJFA 2R8ZA 5E4TA 4C3VA 3T9BA 1SA0A 1AIPA 2C2KA 2DUNA 2IIVA 3RUIA 5T7BA 4NCBA 3UWDA 1R0CA 3D6TB 4RCVA 2RGEA 3C0KA 2FEKA 1BCSB 2GRJA 3B3JA 1T10A 3IP9A 1KERA 3VHQA 4W1SA 1BIFA 5HMLA 5HRAA 2OO5A 4V0ME 2CV0A 2Q3JA 4RO0A 2W2KA 2ZWAA 4Z9XA 1SN7A 2NUPB 4YHBA 4GI3A 1VLZA 1T43A 3R0VA 4U7FA 1O4WA 4WECA 4YQFA 5B58C 2X8LA 3TN7A 5B55A 4FTWA 1UEIA 4L75A 4Q3CA 2JVKA 5AW8A 2O8DA 2PYIA 2AOVA 2DWPA 2OOSA 3KHKA 4GZ6A 1V7ZA 1Y3FE 1WZUA 1IN8A 2PRIA 2AZDA 3DEAA 3MS4A 1H05A 1JEDA 3Q3VA 5EMJA 5FA5A 3V46A 5JH7A 3GCWA 3PC3A 5HOEA 1SC6A 4O4HA 1OJ7A 4ZO9A 2PRJA 1YFKA 4MWOA 1IULA 2DKFA 1NF2A 2YH2A 1PQUA 3IR7A 4OBWA 2C42A 4N12A 4U2KA 2NQ2C 3VI3B 5AIAA 4YMUA 1CB7A 1ENOA 4O59O 4KYTA 2O4UX 3O5AA 4NPHA 4UMDA 2Y92A 3QG1A 5CDFA 5THQA 4WDRA 1D9XA 1J23A 1NM5C 3HFSA 5K0LA 2P2LA 5AM5A 3RROA 1E77A 3RKRA 5F2NA 2FF5A 4GG1A 1N9ZA 1Q7RA 5CUQA 4Y2YA 1U3TA 2P7IA 4IL5A 1NUSA 3KXIA 4R84A 4OLAA 4PRYA 3BERA 2C9DA 4FIZA 4RD0A 1IOVA 4QXOA 1Q0ZA 4NC9A 3A1EA 3CKYA 4GUDA 2YY7A 4B6OA 1RJFA 1WO8A 2WC1A 4IS2A 3WGLA 4FU0A 4LCBA 1E2BA 2AXQA 2BF4A 2JFZA 2BFWA 4X62B 3BWBA 1T5TA 4CEJA 1Z28A 3EULA 1FFDA 2ZB8A 3K4PA 4Q00A 2XKBA 4FNGA 4N3AA 3NFRA 4Y30A 3FCEA 4UUMA 2Y1WA 1NW7A 2J3JA 4OHXA 3OD5A 1KP2A 5KYYA 5AK3A 3V4SA 4BBAA 5MGBA 4I08A 1TO2E 1YZFA 2W6QA 3R0XA 4XWAA 3Q9SA 1QQ5A 1K4MA 3UC9A 3AVXA 4RF2A 3Q6IA 1WA5A 4MEBA 5CDUA 4G36A 3HDVA 5ALFA 5MHTA 4V3BA 2XCSB 1CVIA 2NSDA 1JDJA 1XLUA 4HMQA 4U9HS 4Y9UA 5AVUA 5HGXA 3V6LA 1MD9A 2SHKA 4FMBB 2ZUDA 3JWIA 4XIIA 1K5PA 1ZN2A 1FP7A 1HNNA 3F73A 1X8XA 2CWWA 4R5HA 4RZ3A 3DDCA 4CKEA 1O3YA 2C2BA 4D6YA 1T9GR 4J75A 5JNWA 1VJDA 4LHVA 4RKEA 5JCJA 3OZEA 4ZKEA 3EY4A 1TQ2A 4E88A 2O3SA 3C4QA 1WUKS 1H22A 1PJLA 2FEAA 2XTMA 3CWQA 2R97A 3COYA 3OLYA 4LEIA 4N3NA 3ZY3A 1WHTB 2YJGA 3HTXA 2C59A 4B75A 5A06A 1NT2A 5BSHA 3L4EA 4IICA 4M1SA 2DUJA 1Q15A 3ER6A 3H6HA 4QOFA 3TLZA 3WOVA 3HVUA 1JDPA 3HSKA 3I2HA 3LOUA 5LA6B 5CFPA 4FR5A 5I7UA 3I37X 1OWNA 1ZNWA 4XJSA 2GYUA 3L18A 4HI0E 5TNXA 1JWLA 1ZNQO 1EUDA 3R6GA 1PR2A 1A2BA 1ELOA 1U8CB 3USCS 1KJJA 1XZDA 2VBCA 2VHQA 3ETLA 3THSA 3JPWA 1RYYA 2ZR7A 2BDEA 2HMAA 1E4OA 4FZ5A 4ZANA 4D4HA 4ENSA 4US2R 1ZNYA 1GGHA 3HE3A 4EB6B 2Y1GA 4E2YA 3OT1A 3QOWA 4V0RA 4CKEB 3IVXA 3QYPA 3TXAA 4GVPA 1T0IA 5H3CA 4I4LA 3LT1A 3TXXA 2ZJ7A 3VNBA 1QORA 1FVFA 4M8IA 3JYOA 3W9BA 1SQSA 1RI3A 3G2OA 4FNMA 3UEOA 1BQ4A 1WVIA 2GCNA 2N75A 2XF8A 3AI3A 3NT2A 3OHSX 3G0HA 5LP1A 3R7FA 4YRNA 4FDAA 1SXJE 2IWRA 1C8BA 3RV3A 4FUTA 1YB4A 3NJ8A 3ANTA 1I6KA 4FFMA 1RYMA 4DF3A 1NUPA 5AUQA 4B3GA 3K9WA 1J8YF 2Z5LA 3GUVA 4ZA2A 3Q9NA 3AJAA 4KFRA 1LPOA 3MPUA 1QIGA 4JBHA 1ADJA 5F5NA 4A5OA 2ZRBA 2VAPA 4COKA 1DUVG 1ZNZA 3AHCA 1BU8A 2C9YA 3T5BA 2B1QA 4IRMA 3ZCPA 4CKBA 4IIVA 3KAKA 1DBRA 1KGSA 2HA7A 3GY0A 1XGKA 1Q12A 4HDMA 1ZK3A 4JK3A 2NZUG 4M1KA 4KBGA 3BBLA 5CDHA 4PN7A 2ZP1A 5JY1A 2YHSA 3C24A 1EXWA 4OA5A 3KUDA 4EB0A 1IBKB 5C1OA 1KYWA 3A0UA 4NZNA 2A9RA 3KPUA 3EVEA 4AIIA 1H4SA 3MB8A 1XMSA 2D3TA 3NMUF 3H2BA 1Q5PA 1JVBA 1BDHA 3IBCA 2EF0A 3CPHA 3IFSA 1I2BA 1VM6A 2B8NA 3DW1X 3OZSA 1Q0QA 1RHUA 4UFNA 5CMLA 3UAZA 4BVKA 2IOHA 1NZFA 1IQRA 4OM8A 3T9FA 1OBFO 2ALJA 2IZZA 5I48A 1GGMA 1VL5A 4GO1A 4L6AA 4JLUA 2MSWA 4XDGA 5DIZA 5FNZA 3IQIX 4DWJA 1KJQA 1SG6A 4RX1A 5B1HA 4OJQA 5BWCA 4S35A 2YYZA 1PHPA 2FE4A 1T1JA 3FZGA 1U0HC 3JD4A 4AM8A 3AB7A 1P29A 2OMEA 3BDAA 3L4BC 4TVBA 3U26A 5LKRA 5I6DA 5I8ZA 2YVAA 5EZYF 2J0EA 1JQBA 2ZE6A 1PVDA 3EXG2 1C4KA 1WXIA 2QA5A 3GIDA 4ZPJA 1UEXC 1ODTC 2QX7A 3NH6A 4IGFA 4X1OA 1P17A 1L2TA 1JFRA 3PXXA 1WCXA 1ZVVA 3DVAA 3UAWA 1UK8A 1Z2EA 3BJZA 2HRDA 4ENWA 1OFIA 4UHEA 5IS2A 2Q4TA 1KAGA 3E3AA 5AI5A 3IQFA 3KQOA 1JT9A 3ED1A 3MERA 3C3WA 2WSMA 3R3JA 3V1NA 2MSDB 3RG8A 1XKXA 1UQUA 4G4SP 4GKJB 2O8EB 4OB8A 3OM8A 2C2OA 2VZ9A 4C20A 3FPEA 2B1GA 2GUGA 2YQ5A 2JG3A 2YKGA 3QEJA 2YWXA 1X1AA 3GLRA 4OL0A 3TJZA 3U5TA 2GZ1A 2XGJA 5JZVA 4LHSA 1FXWF 3R6LA 4NOMA 4WK0B 3UBTA 1TJ3A 4ZHQB 1G55A 4YRRA 2C96A 3KPJA 2ZRAA 3B9PA 3I72A 3UTCA 2FUCA 3ZZUA 2ID8A 3WIOA 4G1UC 3OC0A 1TC1A 4RVGA 4U7WA 3T7EA 4YYZA 2EZ9A 2JGFA 1BGWA 3K5PA 1TDJA 4US0R 2AE2A 1GRRA 2BFBA 3WGYA 3PEFA 3LUFA 3UK1A 4ETMA 1ORRA 1G3IA 1VRCA 3LCMA 3GRCA 1MABA 3IIJA 1A2OA 5CT4A 1L4BA 1FZQA 1JG1A 1TADA 2H9IA 1OLUA 4HGOA 3WWYA 5A5EA 5L40A 3SHWA 5JPDA 4X7BA 3GGPA 4PC3A 2J87A 5CK5A 1Z4NA 3REOA 3UJNA 3TO5A 2GA8A 3AETB 5TPWB 1DAOA 3O8OB 4KQIA 4PO1A 5EMLA 3SPXA 5LUAA 1NLYA 4KI0A 1W59A 2VF8A 4JYBA 1VHJA 1QGUA 4JN6B 4UAUA 4BO2A 1JVNA 1XMXA 4FZRA 4HAWA 4QTYA 4HLNA 1V37A 3SC4A 1N5DA 3ZI7A 2B37A 1LNQA 3OU7A 2WAYA 4WNYA 5F76A 4GIBA 4RVCA 2RBEA 2W4IA 3O75A 5G3ZA 5BR7A 4S04A 1JR6A 4FILA 3KDPA 4W7IA 1OI7A 2GN0A 4JKIA 4P4NA 3DL0A 2PV0A 3H9CA 2QSUA 2YHBA 2VHVA 3R4CA 4MVJI 1H8HD 1AUQA 1SHTX 5ELLA 2BFAA 1ZDMA 1E1RA 5ELMA 4E1BA 3ZK7A 3GEPA 1TU0A 1Z6GA 4L8VA 4FYKA 3C8HA 1YB5A 1N8SA 5FPPA 4TTAA 1HYEA 1ZEMA 2IYNA 2Z9DA 5FPKA 5K7SA 3KB8A 4LDZA 1FUEA 1PW7A 2BHSA 1HQCA 1DJOA 1DADA 1XZLA 4CG0A 1WAMA 4D8TA 4TYMA 2QRJA 5JOQA 3FCCA 2IV3A 4MA4A 1VE1A 2AOUB 3V7UA 4RA9B 1QVRA 3PC8A 2OPBA 1V11B 3AUUA 3ESQA 4OXIA 2VHJA 3EIOA 2E4UA 3BB1A 3NKFA 5FUYA 2P30A 4FZ3A 1QZXA 1RP7A 2FZKA 4TXNA 1FYXA 1XRQA 1UZNA 4ZCQA 3UH0A 1IXYA 1IM5A 5A6SA 1Q3KA 3T5CA 2NV6A 2Y1LA 1R4MB 5BQFA 1OZAA 4YDSA 1CJVC 4WASA 1YVDA 4EF6A 1W34A 4PVDA 2PRZA 2AR0A 3AQ4A 3LX4A 5DNEA 2Y8EA 3M6AA 2AMVA 2HLPA 4OJYA 2OG2A 2QV7A 4XFJA 2BH2A 5HIJA 2BGWA 3QPVA 1XQYA 1RAHA 2VAVA 1QPBA 4WVLA 1U7WA 3H1PA 3IVMA 5KU1A 3K0CC 4LKOA 1E2KA 4V39A 4M8NE 4TTPA 4BWYA 2PZAA 3IGFA 4UVHA 1ZR2A 2D4AA 4I5DA 5TQ2A 5H0IA 5TQ2B 3ONEA 4QBIA 1T5OA 2FQYA 3RKUA 1KTVA 1ZA1A 3SY8A 1MOSA 1UJNA 1O94A 2VWHA 3WJ7A 4A6XA 3ZE6A 1P5HA 3KZMA 4U9IS 2B78A 2V59A 2MOKA 4NZPA 4NE7A 4C76A 1V1JA 1IHXA 2JGEA 3CFYA 2O6LA 5KOHA 3B2EA 4NZYA 1XVLA 2B5WA 2D8MA 2PWPA 1XCPA 4UNQA 5CJPA 2QENA 1J49A 4KMSA 2Q4BA 3M1LA 3OE7A 3QV1A 3VTKA 4DA0A 1V25A 2Y0DA 4MR7B 1APBA 5A04A 1MHTA 1K27A 4PQYA 2FPSA 1IJFA 1Z0SA 3O8QB 5IVPA 2Z43A 2BBOA 1WOYA 3DFUA 4BAUA 3LRTA 3TINA 4NONA 3L1HA 3R76A 4E15A 2F9FA 1GCOA 3KLBA 2NVUB 1FMLA 4K0KB 1XD2B 4LWQA 1GPKA 1SCAA 4L4ZA 4YALA 1TMKA 3ZZ1A 1CVLA 2G67A 3OO0A 2BISA 3NB0A 4RDHA 5LU8A 5DLEA 1Q1BA 1VMAA 1IHYA 2GPYA 3MRTA 2EG5A 2C0PA 5IDXA 2Z1MA 2FZ5A 2YV2A 4EZEA 1XQ6A 4HDKB 4OP1A 3VV2A 1UDAA 1YJXA 3L8FA 2IQIA 2PT7A 2FWIA 2CNNA 3HJBA 4I55A 4P7FA 4IF6A 4YP7A 1P19A 1PWXA 2ZR0A 3EQZA 4MMXB 4YDRA 2PRSA 1NX9A 2GPTA 5HBGA 4EKGA 3OKCA 1XNRB 5LQMA 2OZKA 2EJBA 1I30A 3FA2A 1G20A 2ODAA 4J16A 4U0JA 1JB9A 5AXCA 1R0YA 4DZRA 3SX4A 3QKSA 4JI8B 3H83A 2HA5A 4YRKA 1WMEA 4KR2A 4F2HA 3KPYA 1DQZA 2GTHA 2EJWA 2YMQA 1J2UA 4NY1A 1BDIA 2QM7A 5BSRA 2J9ZB 3V3TA 2A1IA 4PYMA 4PIVA 1L8XA 1KY3A 5IMBA 1ML4A 3M2PA 5ELXA 3F96A 1NXVA 4J03A 4NPAA 2C20A 3ROXA 3EFBA 4C88A 4E7PA 3AOEC 5I9TA 4ZOLB 2O0MA 3WXMA 5D84A 3L8YA 4C05A 4TQAA 4EDFA 1CV2A 1S4MA 4M0KA 1RDFA 2ID9A 5BUZA 4EVQA 1G6HA 2IYZA 1L4GA 1Q7BA 4OQFA 1EVEA 2O54A 3QYFA 3DZ8A 3IE2A 2QLBA 1UKCA 1RHMA 3G7UA 1XRNA 2QTAA 4Z9FA 3FUCA 4EGAA 4J43A 3WLSA 1GN9A 4V0SA 8AT1A 3AF2A 1Q1ZA 4AAYA 2VEOA 3KJHA 3R0JA 4MI6A 3O8QA 1WVGA 2DM6A 5A2QA 1C1XA 1Y82A 3BRSA 2R6R1 4I36A 2C88A 5FI5A 5BWLA 3ESDA 16PKA 3H2JA 2ZIAA 4KPEC 3ZBPA 3EN0A 1GZVA 2J85A 3BCHA 4QG3A 4JEMA 1XI2A 3KQPA 5B5SA 1K08A 3IAS6 3EZ2A 4XRRA 3L8DA 5H9WA 1QXSA 2HXGA 4KJZA 3RI3A 4ECEA 3K1JA 3AETA 1UBRS 5CB4F 4MXDA 1QV9A 2WNSA 4IDBA 1EFDN 3UK7A 2EW8A 1OFGA 1K89A 2F67A 1V7PC 2QR5A 5AJZA 3EXAA 3MRSA 2OFFA 4UW9A 5AVSA 5A0TA 1LRJA 3FJ1A 1E7QA 1RMTA 2EKQA 4AJIA 2AV6A 1W36D 1X3SA 2R68A 3JAWB 5EUMA 1XRRA 3WRYA 1HE2A 4R71A 1VL1A 1VIAA 3H2SA 5K6RA 4WV3A 5AIBA 3Q5EA 2VHZA 1H2AS 5DNCA 1C7IA 2QTCA 3L1UA 4X5OA 3RFFA 4JYCA 1XAHA 4UD2A 1Z4LA 5FNVA 3GPDG 1O2DA 1GLGA 3QFHA 3SHQA 2SCUB 4PGAA 3CSSA 4JA2A 4ZODA 4ZVMA 5T3YA 4QOGA 1U2SA 2FSFA 3HEBA 2J6CA 4KKXB 3HGTA 2QZPA 4LF6B 3DDWA 1Z4OA 4YIKA 4LRUA 3NBZC 4N5HX 3GUZA 1TM5E 3DT8A 4FGKA 4MLPA 1SU4A 1MCZA 3PUKA 4RY2A 3TBKA 3OLWA 3P9XA 1WF6A 4MGHA 2I6UA 2VWGA 4QECA 2D2FA 1E2UA 3E35A 4KQEA 5EWJB 4ENRA 3HU5A 3IILA 3IT3A 3L8MA 1T9GS 2A86A 3LQYA 4YQYA 2JLVA 2XECA 1UBJS 4ONEA 3VGJA 4D9KA 3HXOA 1NVWQ 3L7JA 5GTDA 3WICA 1V95A 1T26A 3PEEA 4TTTS 2EHJA 3C3JA 1E2NA 4JXJA 1IN5A 2PKYX 5B7NA 2KMLA 3MWFA 3KQKA 4KNVA 2EBWA 3A3YA 1BGVA 3TD2A 3MG9A 5ICCA 1UOOA 3V48A 1Z36A 3F8WA 1ECFA 4Y2RA 4ZO8A 3M4ZA 3CJQA 2P9YA 2R0QC 4L1KA 1ADBA 1BMTA 3IBSA 3L49A 2ZIEA 1TEHA 1P4RA 1TAQA 2X5JO 1FTNA 3L02A 3HJTA 1DT5A 1EFLA 4HR7A 3EFOA 2OVFA 3R41A 4XB2A 4JI1B 3OQBA 1YR8A 3BA1A 4M7RA 4NOJA 4PPFA 5DX8A 4ZVUA 1VLMA 4RM2A 2BY4A 1EK5A 5AXAA 4AZTA 5B7QA 3E8MA 3QVGA 2NYRA 4RIFA 5FUQA 4ALLA 5LNK6 5ALLA 1N6OA 2ADFA 2F3SA 3HFJA 3CVJA 3PHCA 4Z49A 4RTRA 1RWMA 3IYLW 4NFHA 2FMUA 4MI1A 3TI9A 3DDHA 2O3RA 2ZUVA 2FFQA 3W06A 5AW4A 1A9XA 2R86A 1FQKA 1QANA 3OQ6A 7ABPA 2O0LA 5EJ8A 4LXYA 3ZY5A 4CT0A 5MN6A 2HMUA 2OSVA 3NAZA 2QV0A 3UC5A 1ZJWA 5HFNA 3B1ZA 3HVIA 5BQPA 2YJNA 4ZAVA 3TR5A 5IYZA 1YI1A 4RZSA 4F3RA 2H5IA 2XA1A 2WJPA 2WNHA 3CNLA 1QBKC 1KH3A 4I0WB 4CQNA 3ZDRA 1ZMTA 5H3LA 1TKBA 1BROA 3OZGA 1ZK1A 4B79A 4EZIA 1ZFNA 4U6QA 4ZQBA 2DQYA 1TT5B 3R24A 2DFTA 4CETA 4TMWA 1RI4A 2YHIB 3ETDA 3A6JA 1TOAA 2H3EA 4C6TA 4EW1A 3UUFA 2WY2D 3TVYA 3M9WA 1NVXQ 4ALIA 3CGGA 2JC3A 1CUEA 3WYDA 5HJEA 4OAPA 4RABA 3ET4A 4UQOA 1G21E 1FYFA 2BE9A 3QEKA 5FRDA 2V9ZA 5TMPA 1V3QE 2V7GA 2XQFA 1NSYA 5GONF 1S8OA 2Y2UA 3JQFC 5E6SA 2BPOA 2Y1XA 3ZWBA 3I2JA 2AQKA 2ODEA 2W70A 5IHPA 4E1VA 3U31A 2VNHA 2QN9A 3A2KA 2EKBA 2BVNA 3BG5A 3BL5A 1RR6A 1ZI9A 3MLBA 2NTYC 4E22A 2WHXA 1ORDA 3MRXA 4B0OA 4DIKA 2N3ZA 1FZTA 1WCIB 2AKEA 3G6KA 1XBTA 1PV4A 2A9OA 4J7UA 4MV1A 1NU6A 5ALVA 5JSQA 1ZOSA 1XYYA 2MSNA 2FEWB 1GWNA 4K9SA 4QDKA 3DWFA 4WOPA 4BNDB 1JFTA 3DSRA 3T4UA 1S9HA 1D7AA 5GZ3A 4JQOA 1PDVA 1Z8HA 3CO0S 5B6IA 2YQZA 3A1SA 4P58A 4LJAA 2ZLBA 3QA3E 3H04A 3WMFA 3ZE2B 3FOWA 3KUUA 2W2KB 1VQ1A 2EDCA 3I1YA 3PE6A 2J32A 3JXEA 3BHNA 4OI1A 4LDJA 1D6JA 1UBHS 3OCYA 3UB2A 1GNPA 1XDBA 3B6KA 2GK7A 4TQGA 2R751 3ENWA 5CLLA 2GFQA 2JRCA 1X3LA 5A5FA 3FOAA 4YT5A 1YFZA 2ZUTA 1K8QA 2HV9A 2Q3CA 1NQOA 2EX4A 2QRPA 3AG6A 4J0EA 5BMVB 4MVJM 3O4HA 4CEIB 5K6TA 2FFBA 1Y5IA 2VRBA 1PR1A 1T6ZA 4UZSA 2XZOA 4EQ6A 3H5NA 5KKCA 5L6LB 2NG1A 2E4ZA 4LYGA 4P5DA 1D6MA 1ZMOA 3D0RA 3D7MA 3IAUA 2IYSA 3JRNA 2YWHA 4ZOCA 4YRIA 1ANKA 2ERYA 2IU6A 3ZYZA 3E7FA 3CV3A 2PFSA 2EWWA 5A3JA 3QU9A 3C6BA 3K1AA 1F8FA 2W2VA 4DCOA 1P0CA 4YLGA 5LQNA 3O8DA 3WGIA 5K3BA 2GERA 4DN6A 4BXOA 4LJRA 2FGKA 5D2CA 3W3AD 1PJZA 4YCNA 4BXOB 3DE1X 3VOSA 3O93A 2HPVA 3I9FA 1ZOPA 1MV8A 5JROA 3K2QA 4YMGA 4KAFA 2IY8A 3CNNA 2AK2A 3OP1A 2PFKA 1FTGA 3BB4A 3B5EA 1XA0A 5E9JA 1W36B 3I1FA 4OI0A 1KVTA 2OXRA 1HX7A 1X6VA 3GRYA 2X5OA 1L5ZA 1JJIA 4BPRA 2GXSA 2ZKIA 1ECGA 1NYTA 1W75A 1ZIYA 4D3FA 4RTMA 3BXOA 3ML1A 5JSFA 4F85A 1GPJA 1J00A 1E7SA 1XTZA 4A9AA 5ES4B 4H7DA 4MVJP 3EOBI 5B37A 3K70D 4EY3A 3CF0A 2HJRA 3PK0A 1F51E 1KS2A 4EKEA 1ORTA 3QUAA 4QBTA 1CC1S 3RS0A 4A1OA 4PX5A 3CEPB 5KHLB 4YRDA 2VKTA 3JD0A 5A3RA 2DUMA 2PMDA 3GL9A 1V5WA 1XU4A 2WKWA 1ULSA 1X1QA 4L7QA 4XD7D 1N36B 1FCJA 2R1VA 1Y5MA 1PZFA 5C7IO 1A9TA 3ZGZA 1T1GA 2AG1A 4KMOA 1KK1A 3LYHA 4GZLA 4KYIB 1DSSG 1TQ8A 4AU1A 2J3LA 2AMYA 1ACMA 5COQA 5HKKA 2XUZA 2AMJA 3HG7A 4F96A 1LLUA 3HCWA 1BVRA 3A4NA 2I2FA 1XLVA 4R69A 1ODIA 1U0GA 1PVOA 3F6YA 3IB6A 2IHBA 2FPMA 1TI7A 1PZHA 4EBFA 5DM2A 3I62A 3TL6A 2V58A 1T5HX 3EGVA 3V6MA 2P6NA 4R3NA 4WBNF 1JIXA 2ZFUA 2ATVA 1EZ4A 2JLBA 4JT4A 1ZRNA 4GPTA 1Z0IA 3H9BA 3WRYC 1CD5A 2W90A 3QVGB 4CU2A 3EH1A 4MVJH 4GDFA 3C3YA 3HP4A 4ZPXA 5LIRA 3KR1A 4ZO6A 1N0IA 4LNHA 4L3OA 4F38A 1TW3A 2F43A 4G0PA 1P2VA 2G5GX 1T9AA 2R25B 3LLVA 1P2BA 3MGGA 3CRMA 2IOFA 4U9UA 1RPZA 5F9HA 4IJUA 1RSZA 1ZISA 5AJTA 3TNFA 1G19A 1NWHA 2XUGA 3V1MA 5KZMB 2O8DB 1Z6AA 3WQHA 1OIXA 4QDXA 1EVKA 1NI4B 3PGLA 3ZNQA 1LF5A 2P6PA 4DT1A 2FDXA 3PX3A 1F4VA 5I7HA 1L7BA 2EEZA 2HBQA 2IPOA 4Z86A 3IXMA 4QOEA 3LFTA 3VH3A 1WXGA 3G88A 4AMUA 3LL4A 4DNOA 4JC4A 3ZHQA 4DLKA 2X5XA 1LPNA 3M5CA 5EC8A 1UAYA 2C00A 4RF4A 4JS0A 3QX3A 2I4MA 4IAOA 2OXIA 5A62A 2O2HA 5AKZA 3GZ4A 3GP8A 3B5JA 2CK3A 5HP4A 4F0JA 5ALIA 1TU3A 2JASA 1Z13A 2NXNA 1WUJS 3JV7A 2FSUA 3KM0A 3SEFA 1TUIA 2JFBA 3SHFA 3LXMA 1XEWX 4KE9A 1MA3A 1VJRA 4Y1RB 4JOBA 4OHYA 2XNJA 1U4SA 1SBNE 5HGJA 4G07A 4UARA 4KWCA 4MAAA 1FRFS 4OQEA 3TVTA 5KDDA 3QUBA 3GZNA 1TL7C 3FM9A 4MWBA 2V0GA 3L8CA 5D3QA 3LIPA 1HDOA 3TR6A 1Y4UA 1QR6A 3PQ3A 2HK9A 1VA4A 2XUPA 3HY6A 3UHAA 1VYUA 4A92A 4EHLA 1R9MA 3CZ4A 4GI7A 4CMEC 4P82A 1QO0D 2NT3A 3F5DA 1SK8A 3PG5A 3ITNA 3W6PA 5HDQA 3OWXA 4ZQGA 1BO6A 1C7ZA 1CUSA 1RWQA 2XCLA 3OZTA 3QXSA 3ZUPA 3ZV7A 2IOQA 3BIWA 3P45A 4FEAA 4FGJA 2EZUA 1H9BA 3W9UA 2CXSA 1T9HA 4EG6A 5KQGA 3A11A 1Z5GA 3W2GA 3HKBA 3NHJA 1A72A 2DF8A 1E64A 2EKPA 2R7AA 2XF2A 3HCDA 2A1UB 1LBIA 2C5AA 3PUHA 1S2OA 3MBOA 3DFIA 2ECOA 2H0AA 2Q2QA 2ZJZA 5FR2A 4BKUA 1THTA 3T41A 5JCOC 3S1SA 1J0AA 5CDGA 2ADOA 4JQSA 4O4HF 5AOAA 4YCSA 3RYHA 4MVXA 5LZ5A 1WTCA 1TA0A 2NO4A 2J31A 2BM1A 2FFJA 2G28A 4LJ6A 5EIBD 5LQRA 2GFIA 3CUKA 2VF5X 4X20A 3B3FA 4DZTA 3ZTYA 1U28A 4GMDA 2ZB7A 4IJ5A 4DZZA 5A1TA 1MB3A 2R7LA 2J5XA 3EGDA 3L7MA 3OA2A 1OCEA 2XAUA 2HRRA 3A9RA 1X7ZB 3QYJA 1LD3A 3ISJA 5AD1A 3U13A 2PD4A 1S3SA 3GUYA 1ZKMA 1NGSA 1LK7A 3OF3A 4C1NA 4CDNA 2C8JA 1NLZA 1R1DA 1NQXA 2JH9A 3OEWA 3CYFA 4XWTA 2ILVA 2IUYA 1W0CA 3U16A 1TM7E 3D4IA 2YCBA 5JS6A 3HVRA 1BXKA 1KAMA 3VTZA 4OB6A 2CDNA 2BTEA 3DP7A 3FVWA 3LUCA 3FYUB 1LTKA 3E48A 1NJ8A 4AO8A 5ADWA 2WK1A 1V5FA 1YE8A 5KNBA 3PXBA 3CF6R 1OC4A 1V71A 2Y77A 4BEVA 1CJBA 1VIYA 3VHXB 2NQTA 2VDUE 1VJ5A 3SQOA 1CQIB 1IZYA 4QPDA 5EY5B 3BX1A 1AA6A 4RTLA 1ZHOA 2EW2A 2P2CA 2PY6A 3WHLA 5K20A 5JAPA 3RT7A 4G56A 1JP7A 3R40A 3TZBA 1AGRA 1CTQA 1G7RA 2DR2A 4JJ8A 2G7ZA 1IG0A 4J1QA 3P9QA 4YXWA 1RD4A 1GCUA 1XJWA 3DB2A 5EZYB 3H1BA 4H6WA 4J76A 3DUFB 4PLHA 2ZCJA 3IPYA 2XAAA 2DGDA 3VOTA 2J6IA 4K6CA 2FCRA 2IE0A 4AG3A 4JLMA 2ZIGA 2IS1A 4W5HA 1LLDA 3FNHA 2ILTA 4MITA 4WACA 1Y3IA 2PH1A 1P80A 2QUJA 3V80A 5BOSB 4W9MC 4DSUA 1EUCA 3I9OA 5FWYA 1EE2A 1L4NA 1Q0SA 4DIDA 5BN3A 2G6BA 3LCCA 2JGKA 3U19A 1NQ5A 1KSJA 5EXTA 5HDBB 4YJHB 3STVA 3PB3A 2CV2A 3PQ4A 1LCIA 5A6SB 4FHCA 3PHGA 5EJAA 5F12A 2FRDC 4CF4A 3RUPA 1NF8A 5L4LA 2HMTA 3DL2A 3NDRA 4KODA 4YEDA 4MA5A 2CW5A 2ODNA 4RS3A 1XAIA 2JD2A 3PKIA 2BEKA 5BSFA 3V2GA 4PAGA 2HHHB 4Q3OA 5ICGA 2FR8C 2EGGA 4MV8A 1X9HA 4TQUS 2P91A 3K2IA 5AVWA 4GYYA 3S55A 2ONYA 4P7KA 3DMRA 4G5XA 2WUFA 2ZJ3A 4IIDA 4TTIA 1OKKA 1EGHA 1HK7A 2EOAA 3CLUD 3U7FB 1NVUQ 3GNTA 3TG2A 1Y6ZA 1OH7A 3N2NA 4R9UC 1H69A 4LBWA 3AFNA 5DPMA 1R4NB 3HYRA 3RVNA 2V7QD 1GFSA 1IJEA 1S8NA 4IWNA 1P44A 3Q0TA 4LX0A 2XWPA 4EJ6A 2OYSA 2OKGA 2PLRA 2YW2A 3N0XA 4Z2YA 2NYUA 3ZXIA 3PC2A 1W76A 4YECA 4MS3B 5CM8B 5DK4A 1A98A 4FC6A 1PJ8A 3SXUA 2XX3A 2WVAA 2OFWA 1SUWA 4DSOA 6PFKA 4CLDA 1JYSA 5JSYA 2X4GA 4CM6A 1M2EA 3L2OB 5A4KA 4EL5A 2ZIXB 2ORWA 5JNUA 2ZRFA 3BQNB 3QBTA 1HLGA 3BMCA 4TSKA 1M1YA 3ZHSA 3FX2A 4BZQA 1SG0A 3RFVA 1EA7A 3VUFA 1YC2A 2H5JA 2P4HX 3RS5A 2PWAA 3BEDA 4PZCA 4J16C 2NACA 1XTUA 3BFPA 1KQPA 4KR6A 1NFQA 2QTVB 1TU4A 1YHNA 2G08A 3FPLA 1GV0A 2Q1SA 5A4FS 1QB8A 1JSRA 1V4VA 1E5QA 1R88A 1OLSA 2XW6A 3AVQA 1TCVA 1O0SA 1EB9A 3G79A 4XDHA 4RDIA 3UMRA 3FMIA 3P9NA 1E2LA 1YO6A 2FZVA 4FYVA 4M9CA 3SYMA 1UPFA 1YOVA 3GFOA 3IX7A 3LGSA 4I2NA 4HXFB 4JEHA 4RGBA 2AF4C 3PZRA 4XGRA 2GBLA 3H4VA 5BN3B 4D56A 5TT1A 1PLKA 1M67A 1Y4ZA 2GVDC 4EAAA 1MNQA 1QFXA 2GTPA 1T8RA 3NW9A 3NCHA 1YBVA 2HF2A 2R65A 1QVAA 2ZBFA 3QU7A 3MWEA 3D9QX 5DMXA 2XGOA 3HHEA 4A0GA 4DMCA 1VP3A 4HFRA 1UMBB 2I7VA 2CLLB 2Z58A 1L1QA 2BFEA 3ORSA 2RC6A 1KMNA 2BFEB 3CINA 4IDDA 5JDIA 4PIMA 1G0OA 2BEVA 4IXDA 5A9SB 4H6PA 1IBSA 2VDJA 1QAQA 3PIIA 1DLJA 2BYTA 1L4MA 3G2PA 1OWPA 2VJNA 3QKUA 1TB4A 1IXSB 3KL2A 5SY9A 3QM1A 4GDMA 1GPAA 1VYTA 3O1IC 4KQ2A 4HNHA 1Z45A 5D3KA 3M49A 4U8HA 4CKWB 3IQEA 1PS9A 3ZCTA 1EFPA 3UH1A 1QJ4A 3QE9Y 3ESCA 2W6JA 3JYHA 5NLLA 3BGSA 3B70A 2J1LA 1UBCA 2X8JA 3BHMA 3F67A 3EGEA 3BREA 4NJMA 3M4JA 5FEUA 2EZ4A 1O54A 4YPFA 5I9NA 1D3AA 1YIAA 3B6ZA 1GTMA 1QKKA 3DVLA 4O1IA 4ND6A 4TLDA 5EQJB 3ZOKA 4BB0A 3L7YA 1CWUA 1LEHA 1AY0A 2X0RA 4OOEA 4WRRA 3A3OA 3RS2A 3P2EA 3SSNA 4QD3A 2HU8A 2OQ2A 3UJ7A 1Z6YA 4PEVA 5ALOA 4BP3A 4C87A 2XZLA 4E5NA 4GPBA 3RIHA 3PYLA 1X7HA 1C30A 1VMDA 4CIXA 5C8XA 2QM3A 3IVCA 2CLHB 3NKLA 5FORA 3ZPXA 1GSAA 5EJIA 1YZYA 1Y6QA 1BVHA 1JALA 1Y7LA 3V3KA 2I03A 4NBTA 3ZZMA 4QSMA 2ZYAA 4FYWA 3AL2A 4AJ4A 4OTZA 4PHCA 4CM1A 1IFXA 3ZCSA 4H15A 2PKQO 4ZOLA 3TTWA 3ORQA 1IONA 1IEWA 4BNWA 3NOVA 4KXYA 1BVUA 1OYOA 3WRVA 5IFLA 4OL9A 5G02A 5BN4B 3P96A 2WWVD 5CBPA 1GUYA 2X8BA 3GGSA 2CJWB 1SBZA 2IUSA 1QGUB 4MYSA 2L19A 4HLCA 5AK4A 3H0EA 2JVJA 3QGMA 5ESDA 2HOQA 4H3SA 4Y0AA 1ZK4A 2ERCA 3SOPA 1VFNA 4EYOA 3FCYA 1L7MA 4BE4A 2H1SA 3CTMA 3FFAA 1AU9A 1VSTA 1W0JA 2A9VA 1IBRA 1RWWA 3I23A 3MWGA 4ZAZA 2JH3A 2P3LA 3Q4GA 5D6OA 3W5AA 3F4BA 3QEMA 2Z56A 4MKRA 3WB2A 3AWIA 1UAGA 2AVDA 2G0NA 4LJYA 4NYJQ 4BNJA 3S5JA 4BBJA 3DLBA 1HT0A 3PE4A 4WZZA 3WNCA 4B3DA 5GVRA 2PU7A 2QZ4A 1LPPA 2VIIA 2ZT7A 3G2MA 4LBZA 4YAOA 3NX4A 2OD2A 2LD4A 2P5SA 2YC2C 2WD7A 4JENA 3TW4A 4YXWD 1NP7A 4DQDA 5KPDA 4ZGBA 2IUFA 1X80B 1I4OA 1KKUA 5BOSA 3MILA 3QKRB 3O4VA 4F4HA 2XOEA 3R4VA 4GYJA 1QG2A 3FJOA 3LWNA 4EA7A 5G1NA 1A2QA 5I51A 2QYTA 4K2HA 4D8WA 1TC2A 1UK6A 3NT5A 3ZV3A 1G4AE 5IT4A 4GOND 4LW8A 3QXHA 1TJ5A 3UUEA 1Z22A 2TECE 2ZRNA 3K32A 3UJ8A 4K28A 2FWAA 4AJJA 5JAUA 3DMTC 4LOKA 2R6DA 5EG5A 2BZSA 1KI6A 1EGAA 2Y1FA 3WHKA 2FQQA 5BWNA 2ZANA 2ZVPX 4Z7OB 1ZJ6A 3UAYA 4O4IF 1Y37A 1KI7A 1M6HA 5HIKA 1F20A 3FPJA 1LBQA 3AIMA 3BPSA 4ZCLA 2WJGA 2H1IA 2YR0A 3FVVA 3IJ5A 3ME5A 4P98A 3E2MA 1RXIA 3S7ZA 5CLHA 3V8VA 4FYMA 1XQ9A 3UGTA 3TUJC 4C4AA 1ACLA 4ILEA 2H2GA 1OZ0A 3CMCO 1PNTA 1NPDA 1R0SA 1G98A 3SF8A 621PA 1TZKA 2F00A 1Y1QA 3I73A 1VCOA 3BMXA 5AVOA 3JY6A 1E3MA 1RKVA 4QBHA 4LV8B 4G0MA 4BUJA 2OVBA 2QRMA 2V3VA 1U0TA 2BHTA 2CUKA 4LPKA 3M5DA 3GI1A 3W5DA 4O2AB 2LVBA 4TZ6A 1QFZA 3TNJA 1AXGA 2BONA 2QROA 3ZD7A 2QX6A 4H0NA 4Q4AA 4E2FA 1N3YA 3BE6A 1PQ4A 3HNPA 5DP1A 3U5ZB 1XE3A 3I0MA 5DNWA 4HEQA 1CUVA 1X74A 2R4QA 4NMHA 1AKQA 4P08A 2GAJA 5CVTA 3I9LA 2C8LA 1QGED 4G9BA 4ZAGA 5T67A 2QTVA 3OTIA 1IN6A 4PW0A 1FTYA 4OHUA 3OO1A 2VNJA 3R8CA 4BFUA 4LCJA 5CNKA 1YUBA 3EVGA 4CQMA 2P0YA 4PR3A 3PFNA 3FI0A 1PUIA 1G5QA 4W8OA 4FYIA 1EQUA 2G9ZA 3C3AA 3IRUA 4I99A 4Q4HB 1W4LA 1X7XA 4P4SB 3UMYA 3FVRA 1SOVA 2G9QA 5FWDA 5B6JA 3MS7A 1MQ9A 3PC7A 2HA6A 1X1EA 1VLQA 3CE9A 1V3VA 1JKMA 2QW1A 3NXKA 4WNAA 2NO7A 5HA5A 2GDZA 3HLYA 3EGXA 2VK1A 3MAGA 5LP6B 3KPVA 1YQQA 4AULA 4Q9DA 4LGYA 4MUXA 5DHUA 4AFNA 4EVSA 3FPCA 4U2EA 1T2FA 4R2KA 3GDWA 3FDXA 4RD3A 3GA5A 4DNPA 4RFSB 1MJGA 3QX7A 1OPXA 2H0RA 3ZBTA 1FDOA 4LYJA 3B8HA 2X4IA 5JT1A 1JYFA 5KVVA 5ARBA 4BJ6A 1Q92A 1Z0DA 3GN1A 4G0UA 4FHGA 1O6CA 1OXVA 3FMFA 1DJNA 2CD9A 2REQB 1FTSA 3WIBA 5JMPA 4TKZA 2PLWA 3BIFA