3I9FA

Crystal structure of a putative type 11 methyltransferase from sulfolobus solfataricus
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
165
structure length
165
Chain Sequence
b'PEEYLPNIFEGKKGVIVDYGCGNGFYCKYLLEFATKLYCIDINVIALKEVKEKFDSVITLSDPKEIPDNSVDFILFANSFHDMDDKQHVISEVKRILKDDGRVIIIDWRKENTGIGPPLSIRMDEKDYMGWFSNFVVEKRFNPTPYHFGLVLKRKTSEGHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative type 11 methyltransferase
publication title Crystal structure of a putative type 11 methyltransferase from Sulfolobus solfataricus
rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
total genus 47
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3i9fA00
2H1RA 3F4KA 3GIWA 1P1BA 3KQOA 5FWAA 3M6XA 4POOA 1U2ZA 3OFJA 3VC2A 4HH4A 2XVMA 5E9QA 4RTKA 3T7TA 4CWAA 5HIKA 3EEOA 3AXTA 3HVHA 4PCLA 4XUCA 1NKVA 3JWJA 5EG5A 5GM1A 1YB2A 4E70A 4EMSA 4DM3A 3SXJA 2P1DA 2Z6UA 1ZG3A 1VL5A 5DM2A 3KR1A 5EZSA 5B1SA 3T0IA 1X19A 3FTDA 3P9CA 2NXJA 3B3JA 2ONYA 4FSDA 5F2NA 1BOOA 3DUWA 4U7TB 1JQEA 1V39A 3EVZA 3Q87B 1NW8A 2ZZKA 5FCDA 2PX4A 1BHJA 3A7DA 4RVHA 1ZGAA 5DT2A 3TPZA 3EGIA 3ELYA 1L3CA 4GC9A 4LWOA 5FTWA 1AQJA 2QM3A 3EGEA 5BW5A 3NWBA 3P8ZA 5EEHA 2P3LA 1VPTA 2EFJA 2P7IA 4BP1A 2PT6A 3FRIA 2JHAA 1VE3A 4PONA 2ZFUA 3LKDA 4DA4A 4DCMA 3A4TA 2WA1A 3C6KA 2BR5A 3DMHA 4KIGA 4PGHA 5G02A 4CTJA 4PYJA 2JHPA 5HIMA 3EVFA 2ZTHA 3I53A 4RVFA 5ERGB 1FP2A 3PLAE 3GJYA 5GM2A 3A7EA 4RTJA 2EJUA 3M6VA 2JJQA 4GOND 4IKPA 1INLA 5K0NA 4PNEA 3OCJA 1WXXA 3LPMA 2O57A 5DRYA 1FPQA 2AOWA 2KW5A 3UFBA 5E1DA 5E8JA 1I9GA 3B89A 2WA2A 5DM0A 3GNLA 2PWYA 3SSOA 4PINA 5BP7A 1R8YA 3DULA 4MTLA 1D2CA 2OO3A 3P97A 1EG2A 5DSXA 3BT7A 1RI1A 1KHHA 4M7RA 1JSZA 1QAMA 2AOUB 4QPNA 3DMGA 5KS2A 2P40A 1NE2A 5KVAA 1NW5A 3OZSA 2VZ9A 2UZ4A 3CJQA 3OE5A 4QDKA 5CIYA 4DMGA 3EVGA 2HNKA 3GRRA 5BW4A 4HSGA 4EKGA 2I7CA 3P2EA 2O07A 2QYOA 2FRXA 5E1OA 4YUYA 5DX0A 1AQIA 4U7PB 1WXWA 3EEYA 5K03A 5DSTA 3VYWA 2B9EA 5EMKA 3JWGA 1ZGJA 3LGAA 2HMYB 3FRHA 3O31A 4ZTBA 2IH5A 2PVCA 1R6AA 4YMGA 1VBFA 4MWZA 4DQ0A 2B3TA 1YFLA 1JQDA 5LR6A 4V0RA 3NMUF 3EVEA 5LQCA 1NW6A 3QOWA 4MIKA 4V0QA 4BLUA 1M0EA 3ER8A 2PGXA 1BC5A 5K0JA 1T43A 4GOOD 3ORHA 3I9FA 2OKCA 5T6BA 3V97A 1EQAA 4X60A 4OX9Y 1JG1A 4PIMA 1AV6A 2JH8A 2I6GA 1UIRA 3C6MA 3E05A 1RJEA 2AN4A 5CVVA 3SR4A 5K0CA 5K0GA 2IBTA 1P39A 3HA5A 1MJFA 4OBXA 1NW7A 1SUIA 5FULA 5D1NA 3SSMA 5KQRA 4HGZA 5DXAA 3RODA 4PIPA 2HWKA 3LL7A 5E1BA 4UOEA 4WVLA 1H1DA 1MHTA 3BWMA 3QOXA 5HILA 1JSXA 2AOTB 2LD4A 2AZTA 3FYCA 3TKYA 4R6WA 1IY9A 3SGLA 4AUKA 2I9KA 1KR5A 3CC8A 1XCJA 5CVUA 1RJFA 4AX8A 3X0DA 3ELWA 3B3FA 2PBFA 2AOUA 5DX8A 2FHPA 4HG2A 3R9XB 2PX8A 3PT9A 3EVAA 3IYLW 3UJ7A 2ZIEA 2O0LA 3B7PA 2NXEA 4C07A 3HA7A 5CVJA 1G8SA 1N2XA 1R8XA 3G8BA 3KU1A 3ER9A 5CM2Z 4RTNA 2NYUA 3CJRA 4ER0A 3PX3A 1NV9A 1G38A 1QYRA 2EX4A 3P2IA 3FUXA 1L1EA 3UBTA 3D2LA 3GGDA 2PX2A 2ESRA 3HM2A 3HVKA 5DX1A 2IIPA 3FZGA 3G2QA 1JTEA 2PKWA 3TLJA 3GXOA 4E30A 1XCLA 1NW3A 2IPXA 3AJDA 5IKMA 2ADMA 4GC5A 2NP7A 5EHGA 1KXZA 3GDHA 1JG2A 1FJXA 1XTPA 1VIDA 1Q0SA 3KPVA 3EVCA 4E31A 1ZHFA 2DPMA 2UYQA 5LQNA 2B78A 1EJ6A 1TPYA 5FQNA 4QQKA 4RTSA 3DP7A 3UZUA 1UWVA 3MGGA 9MHTA 1O9GA 3MTEA 1X1BA 1XVAA 2XYQA 4M36A 4OA8A 5T67A 2P7HA 2PLWA 1HMYA 3T7RA 3EGVA 4C4AA 2AVDA 2IH4A 2G1PA 1L3BA 3LDFA 3OZTA 2CKDA 2YX1A 4RYLA 4Y2HA 2UYOA 2AOTA 3U81A 5ICCA 3P9IA 2G70A 3THSA 5DTQA 1YZ3A 2VDUE 1G6Q1 3C3YA 3OZRA 4RV9A 2IH2A 3E8SA 1AF7A 4PYQA 1N7JA 3LCCA 3LKZA 3TQSA 3P2KA 2JH9A 3HVIA 3HCCA 3UJ9A 2C7PA 2YR0A 3KHKA 3EMBA 4B17A 4CKEA 1P1CA 5K05A 1RJDA 3OPNA 2AR0A 3CVOA 1O9HA 2P41A 4KVZA 1R18A 1NV8A 3I5UA 5EMMA 2B25A 2AOXA 1G8AA 4P7FA 3E23A 2OPBA 4IV8A 4GQBA 3TM4A 4CKCA 2G8NA 3MCTA 5GOZA 3SMQA 3KQPA 2GB4A 3LDUA 3HP7A 3WSTA 5K0EA 3NWEA 5K8VA 1R00A 3KKZA 5CD1A 4LG1A 2YXLA 2PJDA 4R8RA 5LQAA 5DPMA 3FPJA 1PRYA 1R74A 3HCFA 5EHIA 3TKAA 3ELUA 4ER6A 2Z6AA 1I4WA 5D1HA 5E8RA 2ONZA 3QV2A 4GUAA 3G88A 4K6MA 4WXHA 4FP9A 4FS8A 4JXJA 5HIJA 4C08A 1SQGA 3OU6A 2IGTA 2ZZMA 2BZGA 3O4FA 4GF5A 4ER7A 3A25A 3T7SA 3G5TA 5FWDA 1RI5A 4C03A 5ICGA 1N7IA 1NBHA 3I58A 3OU7A 4KWCA 2CMHA 3GCZA 3RIEA 5DTMA 3KQTA 5K0LA 3FTEA 4YUVA 5EIWA 4EK9A 3SVZA 2FYTA 3OE4A 1FP1D 4E33A 5T64A 5C9ZA 1WG8A 4A6EA 5DM4A 5EMLA 4F84A 3B5IA 2IBSA 4AZSA 3OU2A 4ER5A 2CL5A 3TR6A 3ME5A 4PYMA 4RTOA 4P7KA 3CCFA 3L8DA 5GP1A 3MQ2A 4P7JA 2BM9A 1SUSA 2GLUA 3FUWA 3NTVA 3G8AA 2P8JA 5DM1A 3JWHA 2DULA 5EEGA 5FQOA 2HTEA 3G2MA 5FHQA 5K0FA 4EQZA 4RTRA 3LDGA 3UJ6A 4Y30A 2VS1A 1QAOA 3SSNA 1WY7A 3K0BA 4E2YA 2R6ZA 4XUEA 3HVJA 4YV0A 4KDCA 4QTUB 1FBNA 2ZLBA 3BGIA 4CXMA 5U4XA 1SVUA 3GRYA 3KR9A 1G55A 3HCBA 3LCVB 5EC8A 1JQ3A 4R8SA 1QZZA 3KQSA 5DTRA 4BLWA 1F38A 4LWPA 3DH0A 2PX5A 3VSEA 2QE6A 4EKIA 4RTMA 1YZHA 3Q7EA 4RTLA 3GRZA 3DXZA 3M6WA 4P7GA 5K0BA 4EVIA 1BKYA 2YXDA 3MTIA 3TFWA 2R3SA 3NW9A 2NNWB 1OR8A 1X1AA 1ZKDA 2OBFA 3DTNA 4F85A 1ORIA 3P9KA 5HIIA 5LQJA 3FUUA 5EGSA 4IWNA 1PJZA 2GH1A 1VQ1A 4OBWA 5FHRA 2F8LA 4YV1A 8MHTA 5GWXA 4RVGA 4BP3A 3IHTA 2ZCJA 3NDJA 1SKMA 1L3IA 2YTZA 2PT9A 4A6DA 2A14A 5HFJA 1HNNA 3AWIA 3NDIA 5LQKA 5M5BA 3IV6A 5F2KA 3CBGA 4QTTB 5GINE 3EPPA 3GU3A 1X1CA 2Y1WA 2O05A 5H02A 3UA4A 3FPFA 3DXXA 2ORED 5E2BA 5FADA 4YUWA 2V7EA 4IV0A 2XYRA 4BLVA 4DF3A 1XDSA 1KIAA 5CUQA 5EVJA 1ORHA 3CGGA 2NXNA 3KPWA 3CKKA 4GOLD 5DXJA 2Y1XA 4C06A 5HZMA 1XJ5A 4YUXA 3BXOA 2WK1A 3A27A 3G5LA 3LBFA 1X1DA 5DWQA 5ICFA 4X61A 2ZBRA 3JWIA 4Z2YA 2XVAA 3SM3A 1JG3A 4QVGA 3GWZA 4PYKA 5CCXA 3ERCA 4M38A 2P35A 1VP9A 3BWYA 3SX0A 2XBMA 3LBYA 2VP3A 3LHDA 5LQRA 1M6YA 3KPJA 5GIOE 3MHTA 3AXSA 2ZZNA 3M6UA 2ZW9A 3P9NA 5K01A 2GS9A 3PB3A 4BY9E 3FTFA 3BGDA 5DRTA 4C05A 2Q41A 4E2ZA 1D2GA 2IFTA 3R3HA 3HCAA 4AZTA 3TRKA 1NT2A 3PTAA 2YUIA 4GOMD 1L9KA 1Y8CA 2GA9A 3LX6A 5FUBA 2PWPA 2H00A 2BM8A 2QRVB 2P3OA 3KQWA 2AN5A 3HEMA 2GAFA 5ICEA 4G56A 4XUDA 1QAQA 2OXTA 4E32A 1XDZA 2ZIFA 3EVDA 4E2XA 4X1OA 1KPGA 2IDKA 4HGYA 1TW2A 2Z6QA 2ZBQA 3MAGA 3UA3A 5EPEA 2P3QA 2OZVA 5EQJB 2XYVA 1JG4A 3H2BA 4RSRA 2H11A 3BKWA 3GO4A 1M6EX 4DZRA 4HC4A 3ELDA 2JHCA 4DCGA 3THRA 5LSAA 1YF3A 1EAMA 4KRGA 1VLMA 2E5WA 3MB5A 4QDJA 4C04A 4HTFB 4DKJA 2VDVE 3G7UA 4YUZA 4PYOA 2OB1A 4F86A 2FK8A 3B3GA 1YFJA 3LCUA 3GRVA 4PYLA 1DL5A 3V8VA 3FPGA 4FGZA 7MHTA 5EKUA 3KQMA 4L7VA 4AZVA 5FA8A 3ANXA 4H0NA 1RI4A 3NVMB 1RI3A 1IM8A 5E9WA 4ATNA 2C7QA 3AY0A 4R6XA 3DMFA 3UJDA 2HR1A 3BGVA 2PV0A 4MHTA 3FTCA 3KPYA 3KR2A 2AOVA 2FCAA 2IDJA 3DLIA 2ZULA 5EMJA 1DUSA 1EJ0A 2CMGA 2ZWVA 3G89A 3HA3A 2K4MA 3KQYA 4QQNA 1NBIA 4RX1A 4OA5A 4R05A 5F2OA 5CCBA 5MHTA 3M4XA 4GEKA 4P58A 1EIZA 2CWWA 2ERCA 3BKXA 5EZQA 5CVDA 4RWZA 3E7PA 1WZNA 1O54A 3KPUA 1JTFA 2YVLA 3O7WA 1UFKA 2PXCA 2IP2A 3C0KA 4X63A 1TW3A 1ZQ9A 3GRUA 3IEIA 1QANA 3BWCA 3UJCA 2AS0A 1YUBA 3NJRA 5KYGA 5HOQA 5EIFA 2G71A 2QRVA 5KQSA 5GIPE 2UYCA 4O29A 4FSXA 4KW7A 3PS9A 2BR3A 3LSTA 2AN3A 2YXEA 4RTPA 3G2OA 5EKXA 4KDRA 3UJAA 3FUTA 2YQZA 5E2AA 4AZWA 3TMAA 10MHA 2NXCA 5IH3A 4X41A 5BXYA 2AVNA 3RW9A 1IXKA 2UYHA 2NP6A 4QVKA 5P8WA 4CKBA 3UJBA 2BH2A 3R0QA 3DR5A 4GBED 4PGGA 3OFKA 2EG5A 3FPHA 2BR4A 1XXLA 4FT4A 1D2HA 3A26A 3FPEA 2PSSA 3KQQA 3CJTA 3R6TA 1G60A 4HTFA 1Q0TA 1F3LA 1JR4A 5E9JA 3UJ8A 3UWPA 1KYZA 3BUSA 1RI2A 5LQUA 2ZBPA 4ER3A 3KR0A 2JG3A 3DXYA 4E2WA 3ID6C 3PX2A 3P71T 5E1MA 5C1IA 2PXXA 3BWBA 4FT2A 2C7RA 2C7OA 3HTXA 1DCTA 1KP9A 3C3PA 4HRAA 4RVDA 2OB2A 3DOUA 2O06A 3EVBA 3FYDA 3PFGA 4QPPA 5JUWA 5C0OE 5K09A 2VDWA 4OQDA 3I64A 3PFHA 5JR3A 4M37A 2EJTA 2OY0A 2N47A 4ISCA 4PYIA 3EMDA 2ZSUA 4XCXA 1RJGA 2PY6A 4PWYA 5EOVA 3PVCA 4RTQA 5CVEA 1B42A 4YMHA 2ZIGA 2V74B 3DLCA 3NVKI 4PYNA 4FZVA 3BZBA 2G72A 3LECA 3M33A 4MQ4A 3MCZA 3REOA 3HNRA 5FA5A 2OYRA 3S68A 3VC1A 3M70A 2PXAA 2QY6A 3KQVA 3R24A 1VP3A 4NECA 1I1NA 1KPHA 2GPYA 1P91A 3TOSA 1KPIA 3HCEA 2I62A 4FR0A 5HEKA 1WS6A 2FK7A 3FUVA 1KYWA 1XDUA 1SG9A 2FPOA 4LECA 4OQEA 4PCAA 2ZVJA 5DLYA 1SQFA 3HCDA 2ZWAA 4CTKA 2HV9A 3G2PA 3MERA 4KIFA 3K6RA 4YV2A 2B2CA 1Z3CA 3TM5A
chains in the Genus database with same CATH superfamily
4QXQA 1GPWB 1EFAA 3ZLBA 3ZK9A 1Q15A 1NVKA 2XDAA 1K89A 3UATA 1HG0A 3CM0A 2XXAA 4BGIA 5G3YA 3ZJYA 1CZUA 3FOZA 1E7YA 2WW8A 1RKUA 1T10A 2IYZA 4ZQGA 4AY4A 2QGNA 3FTDA 4CF5A 5JRZA 3HKCB 1XF9A 5TSDA 1F8GA 1Y6RA 1TQ8A 1JQEA 4JKOA 1NTRA 1NW8A 3CT4A 2PX4A 2JFYA 4B2LA 1VHWA 1MB3A 2K7ZA 4KXVA 4JUIA 2QM3A 3BGSA 4BASA 1ISMA 2Y1KA 5B3JA 3ZD9A 4MUFA 5ALVA 1HYQA 2G08A 3U0VA 5CT4A 2C3MA 4BP1A 1LY1A 4GT1A 4RORA 1U80A 4TL7A 4D57A 5BSVA 5ITVA 1IBMB 1C41A 1VE3A 5CJJA 5CPBA 4HH0A 1CIJA 4JJ4A 4US0R 2OAEA 3GAZA 2W0SA 4NE9A 3WLLA 2O6LA 2UZ0A 3EDMA 4E5DA 2J31A 1KWGA 2OYSA 1GG8A 2D2IA 2BEWB 5ILGA 3RFUA 4BNMA 2QNIA 5BNWA 5CTJA 1IY1A 3ZWQA 2YV4A 5ERGB 2AHRA 3FHCB 1LVUA 1ZY2A 2G36A 5H81A 4Q16A 5H9VA 3UXHA 3GT7A 1CEXA 2QROA 1VMDA 3M6VA 3QU9A 4PAGA 2GAOA 3LHFA 4TTJA 4TWIA 3EHDA 5EP2A 2EW8A 3L1VA 1S2DA 2BOVA 3G5UA 4X1KB 1M33A 2IYFA 1S9HA 1M1NB 4QBHA 1QP4A 1BNCA 1X0VA 2PL1A 5FPPA 3W3AA 3L8CA 2DC1A 3MJEA 4O59O 3KP1A 1EG2A 3ZDZB 1SQ5A 2HYDA 3QTTA 4QUAA 2YINC 5AM2A 1XT6A 4P2BA 2WTMA 3GFFA 3P94A 2PNJA 1D1PA 1NW5A 3RSGA 3W2GA 5IZCA 5CIQA 1GKUB 1TQDA 4ZCIA 1PQ4A 4HNGA 4NCIA 3KTDA 1RYNA 1U8TA 2HRRA 4JR2A 5ALLA 5LZ5A 2A30A 3BQMB 4Q3KA 4OATA 2IK8A 2OK8A 2QXUA 3T1VA 3TD2A 5KMGA 4HLUC 2D0OB 1YHZA 5CK4A 2FEXA 1P5JA 3GA5A 3IIJA 5CDYA 5K03A 1NVEA 4R2LA 4WLVA 2WHRA 1C0PA 4BYMA 4ABTA 1XZLA 1VE6A 3HK2A 4ZTZB 1CE8A 5ECGC 1TM5E 4GDMA 1JU9A 4I4IA 3RWBA 4IVNA 3VBEA 1JBKA 2FRDC 5THQA 2VT6A 3NT4A 4MCAA 4WUVA 4C4TA 5ALGA 3F0TA 2NX2A 1EE9A 1MAAA 3MQFA 4RKWA 2B4AA 3SYNA 4DSNA 5JEDA 5IM4F 1L5QA 1V1RA 4G84A 4UHCA 5HS6A 3RFFA 5SYAA 1EFRA 2GN6A 1IDN1 3F8TA 4GOOD 1EB8A 4IIHA 1DCFA 1F5SA 1ZVJA 3HJRA 4MVJA 4XIYA 3W05A 1YL7A 5BVGA 2PZ8A 3W2FA 5E4JA 1G1AA 2CJFA 4FIDA 3RLIA 4LOJA 4BO2A 3SVTA 1YTUA 1DXHA 1UIRA 3FTPA 3HLTA 3NYWA 5F3DA 1YJAA 2WD7B 4BNLA 3QJ5A 5JI2E 3GFVA 1ZIOA 2GZSA 3F98A 1K9VF 2HBZA 2HIHA 3DDOA 3N59A 1N5RA 4AKTA 2O0KA 2JDID 3U4GA 2YV1A 1WMBA 2QLMA 1ZL0A 1RFGE 4I66A 1DIHA 3MJ4A 1YA8A 3A6FA 4C1NA 3K5WA 1HNWB 1XVIA 3OM0A 1Y8RB 5G41A 5HF9A 4RDHA 5CDGA 2ZUUA 5CXQA 1SHZA 5JMWA 1IVYA 4OI1A 1SOAA 3WDSA 2QDXA 3M7IA 5LYJA 3GVXA 4ZU6X 3ZG6A 2HRQA 4LE1A 1D6JA 1XPUA 6LDHA 1UDRA 3QE9Y 3R9WA 3RFCA 1GGNA 5LUBA 2J6IA 4Y2SA 1LZLA 1QYRA 1Q83A 1S8OA 3F5FA 2PMDA 2NO6A 2IHTA 4KJZA 2X9GA 4L22A 4HQOA 5KQMA 3OURA 1FC0A 2OYCA 8ADHA 1A1VA 2ZUEA 3H1GA 1NNLA 1KWKA 2RMKA 4WKNA 3WA7A 4OHXA 2RB4A 1TJ5A 3CH5A 3I9V6 1L4MA 2R1TB 3FZGA 3GELA 4J9UE 1H5UA 3SFZA 1NDQA 5C1DA 5HUJA 2WUDA 1DO2A 1C7ZA 2IPXA 2ZWIA 4D9EA 4U02A 4YDHB 4GRDA 1NUSA 1E2GA 2CJXA 1JG2A 2V0CA 5ED0A 2RGUA 3HI4A 3AJEA 1IN1A 2QL6A 4TS4A 4ZJPA 1N5OX 2R25B 1XKXA 4X1YB 1NXXA 4K46A 2MYUA 2W8BA 4G1EB 4XJVA 4H4CA 5EJFA 1HZZC 5ES3A 3ONDA 5ECYA 2XDQB 2ZYDA 1E3DA 1O9GA 5J40A 1KY2A 4A16A 5BWMA 3WNBA 3VR4H 3ZXIA 3LIIA 1EI9A 5L51A 3JQQA 4MJ7A 5A9TA 3AESA 1B0AA 2HM7A 2YMMA 3K9LA 6Q21A 2YN2A 2EWMA 4UE3S 1UBOS 5LZ2A 2ET6A 2G70A 3EMVA 3NEJA 4I1YA 4LRWA 2PYIA 3MGKA 4O4LB 4XM1A 5JJCA 3P7MA 1CNMA 1M9NA 3O3MB 3L7OA 3WGTA 4BIIA 3HVIA 3AHHA 5CA0A 5IDYA 1L7DA 1MDFA 3F3YA 1MC1A 3EMBA 3OJCA 2V3VA 3ZDRA 5K2OA 1RJDA 2C2KA 2H52A 2BT4A 2AR0A 2VRWA 2GM3A 2NU6A 3HKEA 2NU9A 3NAMA 1UM9A 3WWDA 1KEKA 2VHYA 3GLFB 1AKWA 3G59A 1IL0A 3BSFA 5ICSA 1L5FA 1NIJA 2SICE 2Y1EA 1VGRA 3CX8A 3IELA 3OUZA 4FFWA 4BQQA 4JLSA 2B25A 2C82A 1CUCA 2QQGA 4IV8A 3HO6A 2R00A 1W2WB 2O3RA 3DE2X 3SMQA 4C7VA 2QJOA 2VAVA 4TKUA 3WSTA 4MV0A 4FYJA 4EYKA 2G06A 5CFLA 3FNHA 3REQB 3WJAA 3SDBA 1IY8A 1LBHA 3IULA 1LBQA 1I4DD 3ZCUA 1R74A 4ER6A 5FAXA 3Q85A 5JXWA 3PR3A 3HSKA 2Y66A 4L3OA 4A8JA 1V6AA 1MO5A 1K6JA 1NXOA 4O4IA 1B2RA 2WJVA 2EFCB 1DAEA 4KLCA 4R3NA 3AP1A 1FVOA 4BO6A 1XMQB 3FSGD 3CZ9A 4LOLA 3OVMA 2H48A 3CVUA 1R1DA 1NBHA 2PLFA 3W8DA 2BM0A 1JVBA 1Z2DA 2X19A 3V7NA 2ZRNA 3T41A 5C32A 1FUIA 4LBZA 4RZIA 2F43B 4BAZA 3GFGA 1KRHA 5B30A 3ZIDA 1DIOB 1A8UA 4H0FA 1RWKA 1V1MB 5AVJA 2NYRA 1ZPDA 1OLSA 1G98A 5LU8A 2AMFA 3RQSA 4P0PB 5JSFA 4BJ1A 1E9VA 3B6EA 2PKEA 3JD1A 2R4UA 3GEEA 4R1LA 9LDTA 2P9FA 1DXQA 2ZM5A 1A7AA 2PH7A 3I52A 4NKRA 5J4VA 1XAHA 1O95D 3JWHA 3O8OB 3F97A 1UQTA 1JDZA 4J2TA 4N5HX 5JZBA 1BW9A 2QK4A 1AXRA 2L18A 4AXXA 1Q2XA 3H97A 3B9PA 4JBYA 2W22A 1S96A 2HX1A 2GNAA 4WZBA 1KU0A 1Q44A 3WNDA 3W79A 1U7DA 2F1KA 1XQ6A 3BGIA 4XPZA 4LJRA 2VKTA 1WNTA 3NWOA 2C5BA 2MIIA 3JQGB 5EWJB 4I5IA 4UNIA 3GLUA 3N75A 3OBIA 4MJ3A 1B26A 1RHQA 1OLUA 2QGZA 2OSBA 3L4SO 1ZD2P 4URHA 2PX5A 1FSZA 1GFWA 2QMZA 1US8B 3A4VA 2I7XA 1KYYA 2M9MA 1O87A 1TEXA 5E4FA 4ALIA 4XLTA 3OT5A 4EVIA 1SZDA 2J5QA 1V1JA 4O2LA 2E48A 1RCFA 4OHBA 1PKXA 1TCAA 2I4LA 5JASA 3VOAA 1KI9A 3GFRA 1U0JA 2IPLA 1QRDA 5I7FA 3T5MA 4D6XA 2F8LA 1BCSB 3QHAA 3ZV4A 4H3KB 5C5IA 4A36A 1QV9A 3AKCA 3OPXA 4QSMA 2VJBA 4EJSA 5EXPA 9ABPA 4G0NA 3AWIA 3GZ4A 3IV6A 1SG0A 1HE4A 3B38A 2UVPA 3CBGA 3QX9A 4ODIA 5GINE 2CW5A 3EEFA 1HEYA 3WL8A 5KYYA 1T2AA 4HDNB 4KU4A 4D9KA 4MULA 5CFQA 5BRAA 3OZVA 3CIFA 3VYTB 4RJIA 1P0FA 3BMXA 6CHYA 3SQWA 2VF2A 3FPAA 3R6DA 4X00A 5F5NA 2P5SA 1JLLB 2UZAA 5J23A 3IFSA 3EA4A 1YR6A 2XGMA 3GYGA 4MRVA 2M6KA 1NXSA 3SC2B 3MTQA 4HYYA 1WV0A 2G4CA 1L5GB 4ARVA 4C4XA 2H4ZA 5ICFA 4AP5A 4G4GA 5DBOA 2Z8YM 2PYDA 4JU9A 5FUXA 4PTLA 3UV3A 2H7XA 2H7YA 1OV4A 3SX0A 4M0DA 1MJGA 1PTJA 2J7KA 1WMSA 3AHIA 3EG9B 3HZZA 4O4HF 1J20A 4ZQBA 3SF0A 2Z5GA 1V2HE 2AI2A 1GN8A 5ALXA 4UBOA 3M6UA 4DZZA 5BN1A 1VL2A 4EW2A 4CUKA 1PJAA 2QMOA 3C5CA 1BKSB 4ND2A 1A4IA 3NEAA 4EKYA 1S4MA 4BXOB 3L1HA 2XNDA 2DFNA 1YZFA 4W9NC 4Z53A 1GPH1 3DM9B 4BN4A 2P2SA 5AIAA 2A1TR 4Z4IA 1DKRA 4GXTA 2JIBA 3JAWB 2OORA 4MB2A 4Z86A 4YDQA 1XTRA 1WKCA 4JJGA 3ZVNA 3C16C 3AW8A 3VAYA 4FOPA 1QH1B 2WABA 4IOJA 1V16A 4MPRA 4NS4A 3WGLA 3P0HA 1POXA 1VFNA 4OQPA 4WZAB 4ARIA 3MAGA 3U31A 2Z3WA 3UA3A 1M67A 2JI7A 2VA8A 4BFYA 2O7QA 1N7GA 3H2BA 1HTBA 3KVOA 2OOKA 1NLFA 1ZI9A 1M6EX 1HDZA 2OZKA 4HC4A 5GQSA 1PJBA 1GEEA 1Z6XA 2JHCA 4FUQA 1ZS9A 2JFWA 1CUHA 3QYFA 4J90A 4CJXA 5JBQA 3S2SA 4BV3A 1EAMA 1RWWA 5LLDA 2ZK7A 1DOZA 4WAUA 4C22A 4FR2A 2QYTA 3DE5X 4XSVA 3H5WA 4N8DA 1RPZA 3OKFA 1XXHB 5LB2A 2IV7A 1DVRA 3CGWA 2NMVA 2BBTA 3A9RA 3LC2O 5HNKA 3D7SA 2ZM6B 4U5XA 1BE6A 1U5BA 4RF4A 5E9WA 3LWDA 4YGYA 3BWVA 3UMCA 4OVKA 3DEAA 3EZNA 5AKJA 3UYLA 3T5GA 4DRXA 4JOSA 3D1JA 4D2IA 1KJJA 1P2BA 2J6HA 3OAAD 2RHTA 3DLIA 4U2DA 5BW5A 5H7XA 2NO0A 2P9GA 2Q0QA 4OFBA 5DHPA 4JL8A 4R05A 5CCBA 3S2FA 2Y76A 1L0BA 1O96B 1JHAA 5CVDA 4E4RA 2RHCA 3FFXA 4WLNA 4U0JA 3C0KA 1YJBA 3GRUA 1YI8A 4IHKA 4TYPA 1U0FA 4EW3A 3H8JA 1SAYA 3BXEA 4W9RA 1JSCA 2AS0A 1YUBA 3C8ZA 3UJCA 4Q6BA 3QVTA 5JV5A 4RD4A 3OZCA 4R2WA 4ZYXA 1IJBA 1I0IA 1ULAA 1ZHHA 2IP1A 1X9HA 1A69A 1Y5RA 1OXVA 1RZ3A 2OCYC 3A9VA 3LT2A 4U7JA 2YWDA 4D97A 3NATA 3OQNA 2WWIA 4AZWA 4KX3A 2CCGA 2PZFA 3H19A 1WETA 3L6EA 1R9NA 1HM5A 1BEEA 2VDQB 2NP6A 4QVKA 4CMBA 1U28A 4WCFB 2P0YA 1XTKA 5K6AC 5J5AA 3BMCA 3BTOA 1MF7A 2V3CC 4MGEA 3OFKA 3C5VA 3E22B 3LQ2A 3QPWA 2HSDA 1JMKC 2CDNA 2VQ3A 4FT4A 5FF9A 3M4ZA 3KQQA 5JYEA 4P35A 1AH2A 3A4IA 1GAEO 1JR4A 1W52X 2HBYA 3AR8A 3PRYA 2HC9A 2GPBA 3KV1A 4LXYA 4ER3A 4HZUA 2AW5A 2O5VA 4IZIA 3ID6C 5K6TA 3QVSA 4G5OA 1LK0A 4KO1S 1XHFA 1T1EA 2X4DA 3GLQA 3WHKA 4ETNA 4LRXA 5JCOA 4GI3A 1OE0A 4ERNA 1RJWA 1T8WA 3AMVA 3BFXA 3GCWA 1ENOA 1DBVO 3GUHA 4YAWA 3TPCA 4ZMSA 4UU0A 2RHMA 4ITRC 3T35A 4GZMA 1L4EA 5C0OE 2ZRGA 2C1EA 3I64A 3VHXB 1AZSC 1PNVA 2PRKA 2WF9A 3L7AA 1F0PA 1TYCA 1NI4A 2O52A 3H2IA 4A8TA 1XVTA 3O82A 3LVBA 2BYTA 2ZJ8A 1RCUA 5GADl 2JI9A 3T3EA 2Y6UA 4JZYA 4F06A 1JHQA 3B12A 3O2JA 1SA0A 4HPWA 3F7MA 3MWJA 4LYEA 1DG3A 4M1WA 4N5NA 4QRDA 4R1UA 2EV9A 3JQEA 2ZYWX 4GXQA 4R9RA 4P4LA 4D99A 3CO0S 2QY6A 3OH8A 2PAAA 2LGJA 3I34X 1E96A 3BICA 4BMSA 1ZJ5A 4CF4A 5IVHA 1JB1A 3WLPA 2WFMA 3WTCA 1PT5A 2ZRFA 4P3PA 4B43A 4FR0A 1SELA 2XA2A 4KIUA 4LZWA 4YRPA 3FUVA 5JZSA 4HAXA 5DLYA 4C29A 4YXWA 1T9DA 1IUKA 3WJ7A 3K6RA 1ZUD1 1SBHA 3KOUA 2VPXA 3BXXA 4MDHA 5EZSA 4DJEC 3DLBA 2BBWA 3ESDA 3KQOA 4XUGB 2G8LA 2PU7A 1Z6AA 2IVFA 4INAA 4S35A 2ZRBA 2J0QA 2YZNA 4JUAA 5EG5A 4PCLA 2CVQA 1F8XA 3IDQA 2YXBA 4X62B 3L84A 3WOHA 821PA 1WCIB 2P1DA 2YWBA 3HJBA 3L0IB 3SEAA 3G85A 2DUNA 4JA2A 1TNDA 4KGVA 1Q50A 2QE7A 4KQJA 1ZK2A 3RGWS 3HHEA 4Q9DA 1BOOA 1PR5A 3Q87B 1Z2NX 3GJXC 3TX6A 2XKJE 4OUDA 3NEYA 1UK9A 1OD6A 2O2SA 3W6PA 4DOMA 3PD7A 2EEPA 3PTAA 4MJLA 2M6LA 3OG9A 2ZITA 1OWMA 3LA6A 6REQA 2XOXA 5ARCA 1U98A 1K08A 4HAIA 4B4DA 2ZUTA 3U60B 2GCOA 3MRXA 2ENWA 1ORDA 2C9BA 3RVJA 3L1JA 1XJCA 1PS0A 3IBFA 1PCXA 4QUBA 4AU1A 4URVR 3L0YA 3JRWA 1JFSA 1IQ0A 4J0DA 4HGRA 3H4MA 4HV4A 3ILXA 3K0AA 1AXEA 5K51A 2GK6A 3EZFA 2JAWA 3L8EA 3OLCX 2YCBA 4WGGA 2IEIA 2JJQA 2C59A 3AHCA 5ICMA 4LNHA 2X58A 5JVDB 3NAQA 1X8LA 3WYAA 5C35A 1DU4A 3P9XA 1FPQA 3RSCA 5LWHA 1ADBA 1SR8A 1BMFD 3Q9UA 3OIVA 5AWFC 4HNTA 1RLIA 2B35A 2Y4NA 3LW7A 1SKBA 3A37A 5D3QA 1U0BB 1SXJD 3GFOA 3SZ3A 3OQ6A 1DKLA 3M49A 4PNHA 5B4UA 3BT7A 1M8GA 4YJ3A 3RS5A 3PQ6A 3IUEA 1PJLA 4LGCA 3U3RA 4PQGA 5AVKA 1E2NA 2FSUA 2GZDA 3BCHA 3QIVA 4EO4A 2WFZA 1JEAA 3IA7A 3AERA 2EGUA 1HFEL 1Z4OA 4AQ7A 4AMVA 1TQ6A 3AUFA 4B4VA 2GOYA 3DUFA 2HNKA 3EVGA 1QQ7A 2DQYA 1ZCBA 5FI3A 1J09A 2E4AA 2YWFA 4H27A 3ENQA 4TYMA 4U7PB 3R1IA 5T6MA 1XI2A 2B1IA 2PQ0A 3IMFA 5E9AA 2J3QA 1MRZA 4TV9A 3O31A 4X45A 2CV2A 2EF0A 5IP5A 2OV2A 3PUYA 2MR6A 4GFDA 4JJAA 4K5QA 4QJBA 3T61A 1SO8A 1L9XA 1MO4A 2BGJA 2RG1A 2Y2VA 1T4CA 3NMUF 5JRDS 3EVEA 4TSFA 1NW6A 4RD2A 3WGZA 3RRNA 5KPJA 1Z63A 2JK0A 3HHPA 2P9QA 1R66A 1U3TA 2P75A 5D00A 3DTVD 3LRXA 3QUAA 3NBYC 2W11A 3FKSA 3QUSA 4TS1A 3L07A 3U3DA 2DB3A 2QG4A 1GQOA 1GDDA 4X8LA 2NUTA 2OUIA 2XRYA 2Y3IA 2BN4A 3I6IA 2I3DA 2MSKA 4GPIB 3SR4A 2FSVC 2A4MA 3JQAD 3OX1A 5K0GA 1NMXA 3AU8A 1EFVA 2GJAA 1X2BA 2PZJA 3UYKA 4AUNA 2A5GA 2Z56A 3IIMA 2XMZA 4BO8A 3TRJA 3R41A 1U0HC 2FW8A 3KT8A 2JW5A 1NM5A 4MAAA 3QOXA 2QSYA 1JSXA 2LD4A 3DO8A 3FYCA 3PU6A 4YYZA 1XCJA 4AX8A 2RGNC 4XAQA 3AHEA 3CEPB 4QELA 4XX0A 3X0DA 5BR7A 3GZJA 2FW1A 2HUPA 2P91A 4F7WA 1F60A 2IYUA 3H1AA 1YR3A 3CMMA 1NGSA 1CJMA 1ZJYA 4XLZA 1E2LA 3IO3A 4JLUA 4C2AA 4FZ5A 2JGNA 2NZWA 2EP7A 1YQ9A 4RC9A 2GXUA 1NBMD 4KQFA 2CNWA 4ZXPA 2XRFA 3E81A 3R5KA 5AK5A 5DTJA 3UJNA 2VYQA 1OV6A 1XELA 3KZNA 3CZPA 5H16A 3V8EA 3QK7A 1QH0A 1YFZA 2PZAA 2R7AA 4JYMA 2F17A 1CT9A 1YQXA 1M73E 1QH8B 5IWCA 1KDPA 3MCVA 4W5NA 2P9CA 1YQGA 1QV7A 3ZV6A 3N8DA 3NQ41 2Q1WA 1U9IC 3G2QA 3EW7A 5D3KA 1ZOLA 3I5XA 2PH1A 3A6DA 1PJ2A 2PT5A 4W7IA 2Q6VA 5JT1A 5A0TA 1I30A 3JALB 4JC4A 1JQLB 1KXZA 4H16A 4BL5A 1J5PA 3FLAA 3HRIA 2YWHA 2VT3A 1K75A 5FLEX 4I1SA 3HBFA 3OFSA 1N0VC 3U26A 3RAJA 2SCUA 4NU5A 1Z36A 3CUTA 3BFJA 1LLCA 3H4TA 1GL7A 3JYOA 4UNPA 1ZA2A 3Q5GA 4RMHA 2C20A 3STYA 1Y1TA 2E3JA 1SCKA 2FWAA 1PE0A 2PT7A 1YNOA 5DTQA 3M6MD 3DEJA 3OZRA 1BXGA 3C3YA 4IHJF 1C14A 1MB9A 1APBA 2UXCB 5IVIA 2F3QA 3G79A 3GJ3A 1UDXA 3IKMB 5ESRA 3SE7A 2PKXA 5JZVA 5L4NA 2PU5A 1GA1A 1GN9A 1Z0DA 3DZCA 3EF1A 1MFZA 2J32A 2PL9A 3RTAA 1P29A 2I8AA 3ZW9A 4RKRA 4DLKA 5JJBA 3JQBA 4ARAA 1JE0A 1F51E 2HMAA 3L7CA 4KWEA 5LMNB 2PS3A 1E6EA 3H8WA 3G2IA 4IKEA 5CCDA 2Z83A 2HIMA 3D5QA 2IE0A 1ML3A 4JA0A 4KR6A 1VCNA 4CT5A 2BFFB 1A8QA 4YIHA 3BWDD 4G07A 4AKHA 1K4MA 1OYWA 1F5NA 1UK6A 4LG1A 3ZW7A 4N54A 2Q21A 1SNYA 4WJLA 1U99A 2EOAA 3HGQA 4N9QA 1SXGA 1ZNXA 2AJ8A 3CNBA 3E18A 2BEVB 1PZFA 1B73A 2Q9CA 1UDWA 2ZDHA 4JYPA 4CM1A 3GZTB 3MUFA 2Q29A 2FUEA 2JLCA 4I4NA 2V7XA 1Y4AE 1N0WA 3BM5A 5JU6A 1ZNZA 1FTQA 4KQCA 1LRLA 4OI2A 1S7GA 2HH9A 4JI0B 1ST3A 1G4HA 3NVDA 3O4FA 1CNEA 2D54A 4DEXA 3DLTA 3O93A 1KBZA 1YJXA 2H1HA 3VR5A 4JI3B 2WQ7A 5IYZF 2BFDB 3IHKA 4G1BA 1KAMA 2CMHA 3KM0A 5HS4A 2PKQP 2GUWA 3I4FA 5EIWA 1PJ3A 3N2NA 3W8NA 1EGVB 4D41A 3B5IA 5IF9A 3ON5A 4UVDA 4WEOA 5KX5A 1LBTA 1PLJA 1W9MA 3CCFA 3OCXA 4NOJA 1M7BA 3M34A 1SUSA 3GJ6A 5DFAA 1T6ZA 3M1LA 1Z08A 1D6NA 1VHDA 3NYRA 4S24A 1BTOA 1F2DA 3S28A 2AMYA 2HTEA 3SDSA 3WLMA 4DXHA 1OGIA 3SLKA 4L5IA 3ZLTA 5I7EA 3VO1A 4RULA 1P80A 2ZUWA 4PIVA 2P6MA 4JFAA 3UAZA 1ODFA 2CV1A 4D5GA 2DWUA 1E3WA 2D1SA 4S04A 3THYB 3PG5A 3VX3A 4JROA 5FH9A 1G55A 2Z2IA 3H9UA 5D51S 1Y63A 2YFYA 1XZIA 1T91A 5KYXB 1T0JB 3MWGA 1ZX1A 1G2IA 3ZIUA 4X6LA 4NZNA 1IUNA 1K7CA 2DQSA 13PKA 2HA3A 3DL0A 3LYLA 1WO8A 5EWMA 2O19A 2E2WA 3CUUA 3M6FA 1NU8A 2WPDD 3M6WA 1E2DA 2XUIA 3SNKA 3AIMA 3D5EA 4IZ6A 4P34A 3FA2A 3FVWA 3B6KA 3PR1A 1VLHA 2NNWB 1IAQA 3FI0A 3OHPA 1GTJ1 4LCEA 2WSYB 3TSWA 4PR0A 4C5AA 4U9IS 2FI1A 2JKZA 3N3BC 3GOHA 4V1CB 4RV4A 3I45A 4GKVA 3L6RA 5HZGA 3MTBA 1MENA 3T4EA 4C01A 3FNBA 3Q7QA 3PDWA 1HL7A 4DKXA 3IHTA 3NDJA 4RNCA 1ZCAA 3PC4A 3WIOA 2CXTA 3BTVA 1Y6JA 2PL5A 1XMOB 4JC8A 4UM9B 3F8WA 3K4QA 4KVAA 3PNVA 3PWSA 3CSSA 4BNKA 3PJGA 5JH7F 4LHVA 4OLHA 4BU0A 3EPPA 4J91A 4IICA 3ZDBA 1TYAE 4KNYA 1NMZA 1Z2PX 2A35A 3FPFA 1TT7A 5FADA 3WGVA 4QTZA 5D8DA 1MRSA 5IU6A 4LJ8A 4ND4A 4OHKA 3X2SA 3Q41A 4Q1VA 4LEIA 1TLTA 1VIVA 1GZSA 5LA6F 2QMYA 2JIQA 1R0WA 1PV4A 1E0SA 2NXNA 3L77A 4LHYA 2JEYA 1PL7A 3RT9A 4AJKA 3BXOA 1J0EA 5E3HA 3OQHA 4UHEA 2AEMA 5DEIA 3ZWBA 4UW9A 3V4RA 1SMKA 2ZT7A 2XVAA 1PJ8A 4OXRA 4NBSA 4DJJA 1E1RD 1RXSA 3L4KA 3L40A 1GPJA 3IBSA 4Q9IA 1E7QA 1VHJA 1IUOA 2VP3A 2YHIA 4UVGA 3NAGA 2VP4A 1ZCZA 2DKOA 3FMGA 1H42A 1L8XA 3PC2A 5G0WA 5TXGA 3F6PA 4H7FA 4I6EA 3AFGA 4UD2A 5LBUA 1GITA 3TIIA 3OTHA 4M7PA 5FPYA 4YLYA 3A70A 4RKEA 2OBYA 1BGVA 1XJ0A 2OV3A 4C05A 4LZAA 2FQQA 5JADA 1ZMRA 1XJWA 1Z0FA 1OOEA 2FUG1 3TIVA 3UXEA 1EM6A 4CQNA 4ZCPA 1H4TA 1BS1A 3HG7A 4D0GA 1TMYA 2NAPA 3BDIA 3L46A 1YTLA 4BX2A 3BXZA 3L93A 4WJZA 1DGQA 3SKXA 1DINA 2RGYA 5E4TA 5JNLA 3E7WA 1NMSA 4ZXFA 1SQSA 2XE6A 4F3YA 2V0GA 1QO7A 4P53A 4E3ZA 3U40A 3EUFA 1ZOPA 5AKHA 2Z6QA 1OAAA 2BFBB 3MBOA 1LI4A 3CEJA 4MKRA 4AN1A 3GAAA 4CM4B 1DX4A 1FTNA 3SY8A 1E9DA 2M32A 5ALKA 4BCDA 2D1QA 3ELDA 4N0EA 3KG2A 5IZ4A 3E2MA 5I9BA 2HDWA 4A0HA 4PR3A 3CRRA 4JNCA 2NGRA 1RPTA 1PFUA 3W2IA 1K7FB 2ZPUA 3W9YA 1GEGA 1KFBB 4BZXA 1FXWA 1SH7A 1FP7A 2WSSD 3TLAA 3EPHA 2WWYA 4QDZA 4B6RA 1CXZA 2HBRA 4PYOA 1JA1A 2FK8A 2IUYA 2XB6A 2ZXEA 4YFVA 3RREA 1I94B 2K87A 3NKFA 1ECJA 1Q84A 1ENYA 2G9ZA 3DBVO 5FA8A 1RI4A 5K9ZA 1UKVY 1KERA 2O1XA 3NPAA 4R6XA 2WJHA 1M76A 3NB0A 5B7PA 3BSYA 3INYA 1FFDA 3FOCA 1JMYA 4ND8B 1EJ0A 2ZWVA 1GZ5A 3C5HA 4MQBA 4LF7B 4K86A 3I2YX 3E15A 4L16A 1I8TA 4AMBA 4CQMB 1E59A 3P9SA 3MWYW 1H2BA 5DZSA 1TD1A 1HK7A 5FWYB 1ESDA 1SG6A 1CJBA 4Q3OA 1UKCA 4O4JA 5AVOA 2HF8A 5F5XA 4QQFA 1GSOA 3KOOA 5EY5B 1FRNA 5HOQA 5J47A 1YQTA 2V96A 4HWTA 3IVCA 2AN3A 4DLWA 5C3UA 1FJ2A 1KIMA 3PGXA 1JI0A 5IPFA 5J2TA 1XMJA 4LHWA 1SN7A 2WF5A 3L02A 3OICA 3GAMA 3HM9A 4RF2A 2BUAA 2P4SA 3E9QA 3SHTA 1U0TA 3MQ4A 2Q07A 3EW9A 621PA 4NC9A 1M6NA 4BFTA 3JSXA 1T3TA 3ICOA 2UU9B 3UJBA 3ZWNA 4ZVQA 3R0QA 3WYDA 1I3CA 1FYEA 2B4KA 1HY3A 3N0WA 3RUEA 1H22A 3LJKA 4CU2A 9LDBA 3HGTA 1ZJZA 4BMCA 3R6TA 3JPYA 1QU3A 4D92A 3JR3A 4BFXA 1Y9AA 2IUSA 2W6OA 1CIPA 4ZT3A 1DAIA 4UD6A 4YS6A 2GYUA 1USVA 4GPD1 1VL0A 4URFA 1RAFA 1XEXA 2VOEA 3DAYA 3AI7A 5C7YA 3PGA1 4ZZ3A 3ZHUA 3P27A 3RYIB 1GGEA 1T5OA 2DHEA 3C6BA 1JKFA 1NN3A 4XCQA 4XM2A 2D2FA 3DE6X 1U9ZA 5KAMA 1D6SA 4TS9A 3QWAA 3DHYA 4HRAA 3ZNOA 3DE1X 1GRVA 1YZNA 2I7TA 1TK3A 3EVBA 1GGHA 4MA4A 1C7RA 4ZMRA 1XHLA 3FKQA 3PNBA 1OA0A 2P69A 1BD3A 2GD1O 5HX7A 2XLCA 2FW9A 1C7JA 3W8RA 4EG5A 3NWPA 4L4UA 4P4SA 5I7HA 1KK0A 4PWYA 3PUHA 4PZLA 3TSOA 3AL0C 3BVPA 4F2HA 4K28A 4ETIA 2RFLA 1SBNE 3BZBA 1E1CA 1UBJS 4NR0A 3A4NA 4MQ4A 3SD7A 5A3QA 2PO5A 3CF4G 3DMRA 4DWVA 1VI6A 2TECE 3VFDA 1T3GA 4KPEC 3R24A 3PEYA 1I1NA 2MTBA 2FB9A 4S2UA 3RDPA 2JGJA 5JOQA 5LJLA 3VVBA 5MGBA 4DUYB 4RL4A 4PX9A 2GTPA 1U7ZA 4O63O 1SQFA 2ZT5A 3HCDA 1XLTC 5AKZA 2HV9A 1AS3A 3AHJA 1BWPA 4EAAA 1QF9A 2HK9A 1A82A 4W5RA 2VLBA 5H4HA 4U1RA 1JZTA 3SHQA 4BNJA 2PWAA 3AXTA 4X90A 3M3DA 5JS7A 5K8IA 2B1GA 5KQPA 1GZ6A 1C29B 4TOIA 2K7FA 3KKPA 1NF9A 5IEJA 1A8IA 4KNVA 3I9OA 1M0SA 4HVTA 4M1YA 4WWHA 1KTIA 2O8BA 4QGAA 3KR1A 1KMHB 1U1IA 1Q6YA 1WLYA 1GVNB 1YZYA 2RGXA 2YZ2A 3DT9A 2ZAOA 2XQIA 4FEEA 5IN5A 4IMIB 4K9QA 1MA0A 1MD9A 3GL9A 2YH2A 4IDOA 1KJWA 2HU7A 2JFHA 3BHMA 1MBZA 3LPAA 1BJKA 1J21A 3PA8A 5F64A 4FB4A 2BDEA 1ZGAA 1AD2A 5DT2A 4Y2GA 4PO8A 3N2ZB 4LWOA 4WOKA 4BQFA 1W6UA 1JEQB 1OWOA 3H2GA 1QZTA 4NBVA 3FZYA 2VUTA 2XQGA 4GAEA 2QRMA 3C24A 3BCUA 4B4OA 1N33B 3B6JA 2ZQZA 4XFJA 3HXQA 2PWZA 5FRDA 1IBLB 1IN6A 5EJIA 2L17A 4YROA 4CLDA 1G5IA 5CNIA 3MJHA 2W6ID 5EE0A 4DCMA 2W2LA 4EMBA 1XB2A 2D13A 4KDFA 3BWEA 4KPUA 3IEPA 5DI3B 4FILA 1BEUB 2P6OA 2GN0A 2QAGC 1P9OA 3P32A 3JVIA 1JWLA 3MT9A 1YUNA 2YWXA 1H69A 4AF7A 1CZKA 5EXXA 1KP2A 2BV3A 3IAS6 5T8KC 1NVTA 2IU4A 1UPCA 3DONA 3BMOB 5K0NA 4P2GA 4ZDWA 4PNEA 1HYGA 3QFCA 3IDOA 1WXXA 4MJXA 4KP7A 1YZQA 4XRRA 2IYPA 3GDWA 3TLCA 5C18A 5LFAA 4D9HA 4P3NA 2WA2A 4YAJA 1SQ0A 3SFVA 1YKSA 2OO3A 3MJCA 1E7SA 4M7RA 2XPCA 4ZHSA 5IJ9A 4B0PA 1L4UA 1DLJA 4A10A 2I33A 2BISA 3H2ZA 2UZ4A 4RK4A 4U8GA 4K40A 2JIZA 3GGCA 3PFIA 4YQEA 3K2EA 4YDRA 5DMXA 1VJGA 2IYYA 4HSGA 4Q47A 5AUQA 1MX9A 5C4GB 1NJ8A 2HU2A 3CPSA 3KB1A 4YUYA 2G3YA 1ECLA 1MQSA 5CA1F 1H9CA 2DUUA 4XQ0A 2VHWA 3IDSA 2IOYA 1CP2A 5CG2A 1KJQA 4Q1BA 2PUJA 2OC9A 4UBMA 4YBRA 1U8UA 1C3JA 1R6AA 3I92A 2XA9A 2QSZA 1YFLA 5KNDA 5TLSA 1E6MA 3ETCA 2CB9A 2IU3A 4Q4HB 2XTAA 1X77A 1NE7A 2PGXA 3VOTA 1OIVA 4AJHA 2FJPA 1WNFA 4Y1FA 5LQDA 1J2JA 3RYHA 1ZUNB 3AVUA 2OCDA 5T6BA 3NETA 3G0GA 1WQ1R 1Y1KE 2P68A 3N58A 5CYFA 3TS1A 2ZAIA 1T34A 1X1QA 4TROA 1E62A 5CXUA 2H1SA 1UP7A 3HB9A 1CQPA 1SU7A 1T0UA 5AW5A 2FEMA 1TLLA 3FNFA 4M53A 4AJJA 4NBTA 4EB6B 2RD2A 3SF8B 3PXAA 3DD5A 1KH2A 3HYSA 3V3KA 1VLVA 1M1YB 1I7NA 1ILWA 3PTLA 4OGWA 6NULA 4FHDA 1XZHA 1U1CA 4D9JA 1M2JA 2GEUA 5HK8A 3V46A 1Z4KA 3RCBA 4FW9A 4AUKA 1E5QA 5CVUA 3DFIA 2OENG 4NU6A 4W9MC 1ZRNA 4L75A 4AXBA 1GWNA 2FFQA 3SZLA 4HG2A 4E3WA 4YRGA 2FQ1A 2LR0A 2HQRA 2V6JA 4FEGA 1ZAKA 3ILYA 4RHEA 3LUGA 3UJ7A 1Y1LA 1ZCFA 4F97A 1LS6A 3HU5A 2YJZA 3PVSA 2DY1A 4KYUA 3I3SR 4R9VA 2EWVA 3KOWA 2VYVD 3TUIC 4BVKA 1ZSNA 2KBFA 2WWVD 2QTZA 4EF5A 5AKXA 4E13A 2XADA 3A11A 5B2ZA 1I3OA 1AO3A 1V9SA 2O5RA 2NQTA 2VRBA 3IVAA 4PNPA 4L3VA 2X2OA 5GV8A 3WBBA 5AW0A 3AJ8A 3OCVA 2OGUA 4NE7A 2RGAA 1JJ7A 3AVQA 3UT5A 1XYYA 3ZDYB 3ZD7A 1EUZA 5ALHA 1F48A 5ETJA 3DPSA 3VRHA 1MO6A 1KI4A 2PGJA 1UOEA 1FRZA 2YS7A 4AMGA 1WU8A 3GXOA 3AONB 1XCLA 4RDCA 2DOKA 1CS0B 2WM3A 5JNTA 1TKRA 5AK4A 4WK4B 4YAOA 1XTPA 1COZA 1K06A 2DR0A 5LQNA 2EEZA 1IIRA 1RYEA 1EJ6A 2BBOA 1ZMOA 4MUGA 4QDUA 5JYDA 5LU9A 2WFLB 1QZXA 3RUAA 3GWGA 1GSHA 3KYCA 1EEHA 3HXOA 5EXTA 4M1EA 4IJMA 3MFYA 3KLBA 3Q3IA 2P7HA 4XIJA 5E6SB 4C0BA 4HJXA 5KMGB 4TYQA 3EGVA 4PO3X 3ZY2A 5KYKA 1XG5A 3WSVA 1Z2CA 2N42A 1ZD5A 1SWWA 1W581 2GPSA 2EZ4A 3MOSA 3LQ1A 3WLHA 2AZDA 1VG9B 4U7FA 3TQTA 3O90A 4UVHA 1J2YA 1C0KA 3GGSA 3ZGZA 1G6Q1 1Q57A 3AEKA 1W1WA 5IH7A 1NP6A 1ZA1A 3D6HA 1Q20A 3QW4B 4FFMA 4JB3A 4PX3A 1RJ9B 1AK9A 2FX3A 3CUSA 4M7OA 2C7PA 2YR0A 4KQKA 5DK6A 2EGGA 2H4HA 2OXEA 1Y8QB 1IHOA 1N5JA 3AZPA 1KKLA 1GUAA 2FPPA 4H9GA 1NNUA 2QNBA 1DPGA 1U02A 2H57A 3F2VA 3FPCA 1V3VA 1T5DX 3QKRB 4MINA 5KHAA 5HHTA 5IVKA 2PR2A 3ZTTA 4DL9A 4PWZA 2P30A 4FSHA 4CQLB 3DLPX 4F2WA 1OC4A 1QPGA 1XKTA 2X5XA 5TQ2B 4MR7A 1DIGA 4MIYA 3T1TA 4RD0A 3UGTA 4KI7A 4H60A 4AJIA 1HLFA 2C5AA 1AGRA 1QU2A 4R83A 4L5AA 1ML4A 4QHSA 4TYWA 1QHEA 4YJ2B 2VK4A 3BMQA 4P4UA 1CQXA 4HAYA 3K5HA 4QAJA 1G8FA 5DPMA 1L5VA 2O50A 1DAMA 2DWCA 4KBGA 4MR9B 1JSRA 2WZQA 5EHIA 5CDTA 4X64B 1ZJJA 4E6PA 5B2EA 2UXBB 1KVUA 1F2UA 3C48A 3C43A 3ET4A 3S8MA 1YU6A 2QJWA 3AR2A 4LBYA 4PPFA 5C7OO 1UPBA 1XTZA 3CH6A 4FS8A 4ZO7A 4GICA 5IKOA 3O9VA 4ES6A 1ICEA 2GAIA 3BB3A 5ECDA 1NUPA 2QX6A 1FMTA 3IODA 3DSRA 1S89A 3TAHA 4G36A 2TMYA 2FVYA 4EHDA 1FOEB 3B1VA 3HBLA 1UKYA 4EK9A 3JRXA 1NJ5A 3OE4A 4WJKB 3CWZA 3V00A 4HR7A 2BY4A 3WMFA 2XKBA 5DHRA 3ZWPA 2Q6IA 3VO8A 1RIIA 1D07A 1DAKA 2J1LA 3QQPA 4DABA 3TRFA 2OMEA 3L8DA 5C8DA 3MQ2A 2ZDQA 4B6GA 3WZMA 4YJGA 3OFVA 1DRVA 2DPLA 1KR2A 3V1MA 1ZWLA 3H65A 4F04A 3D8RA 5EYPB 4BKQA 2RAUA 3NHSA 3S27A 4XUEA 3JQ8A 4NMXB 3LYAA 1B43A 1J5EB 4E11A 5A4IS 2GQ0A 3CBQA 3MMPA 2ZLBA 5A2GA 1N6HA 3KR9A 3U3OA 3ONFA 3RWMB 2WYIA 2BZ0A 3YASA 5MF6A 2R8YA 2WJYA 4Q19A 1GAWA 2R96A 2J0UB 4R3WA 2NVBA 3W2TA 2CD7A 1Q19A 2ZRLA 3IKVA 4M8SA 1U63A 4R31A 1UPAA 3ZE9A 1E1LA 4KWTA 5LD2C 3PFCA 3UMJA 5CB4F 1DQPA 3OIGA 2DYKA 5I5EA 1T4GA 1OASA 3ZDXB 1X1AA 1RLTA 4DYDA 5KNDD 2QBYA 1YIAA 3WYFA 2GD2A 3DV0A 3FUUA 4G1FA 1KMQA 5EGSA 5I01A 4NV1A 1H8ED 3HKEB 4ZZIA 2W6JD 2XAAA 1UM9B 2NU9B 3EPRA 2JARA 3N9IA 2WT9A 2J5KA 4F5EA 5HRCA 5ALSA 3NHRA 4EG7A 1HNNA 3NDIA 4FYVA 1JIUA 4MVJM 2BCEA 5A3RA 5H4GA 4ZOAA 5FNVB 4ZKEA 2GT1A 4MTCA 4QTTB 2D1RA 2B4RO 2GN4A 3UA4A 3RU7A 4BFSA 5A4AA 1KARA 2HKIA 4QGBA 3WIUA 2XYRA 4KXWA 4FOSA 3L9WA 1JLKA 2YBDA 3N8IA 1I3NA 3AFMA 3O91A 2MHCA 4DZTA 4P80A 2ZI7A 3EF3A 4YRCA 2E87A 4RSHA 4A8JB 1NMYA 5MFZA 2PK3A 3FBWA 2Y1XA 2ID8A 2WJ6A 4LNUB 1VJ1A 1ISRA 3AUUA 3ESXA 5D01A 4MA5A 1JILA 1TK9A 3A27A 3CPJB 3GUYA 4LHSA 4WNAB 4CDMA 5ISMA 1FNNA 1JNXX 1N9GB 2WIBA 4N3NA 3H0CA 4IQ0A 5FO0A 5JWHA 1VSUA 2F8MA 3OOEA 4F9TA 3T8YA 3TI9A 4KE8A 4N0DA 2BSXA 4LPSA 4RK7A 3G82C 2ISSD 2X6QA 4F3RA 2YJ5A 3KCNA 4GMDA 4KXQA 4MWDA 3WJ1A 5C8YF 4IXMA 2JIOA 1ES9A 5HYVA 1G6HA 4LX8A 2PD6A 4M9QA 2O5EA 1OLSB 2Q3JA 3D4LA 4YDSA 1D2GA 2ZPAA 2M1XA 5LP6A 3KJGA 3PYMA 1RC0A 1VKHA 3F73A 2HK8A 3ZNQA 1RNLA 3TRKA 4C7XA 4GOMD 1FSPA 1O6GA 2VDLB 5U1PA 2XTJA 4RVOA 1Y5MA 4AY3A 3DG9A 2O8FB 1E60A 2CYAA 5TQJA 4B85A 4IIGA 2MWMA 1MIOA 3R3UA 2XCIA 3SYKA 1B1CA 1KZ1A 5A7GA 2ZWMA 3BRWA 4GWLA 4QOJA 2CMDA 4ZVTA 2WMOB 4V0OA 3WDMA 4HK4A 1EGQA 1SKYE 5K0ZA 2I6QA 4P5EA 4OGGA 4WINA 4JJ7A 1AG9A 4ZAZA 4M83A 4BO5A 4J1TA 1I7SB 4KBYA 2X23A 4DCGA 3RRBA 4F6RB 2C9YA 1F1JA 2DTXA 2HZBA 1CB0A 3F78A 3DOJA 2GFQA 4HTFB 3KETA 4YUZA 3SJ7A 1D7AA 1GPBA 3F90A 4XKJA 1GCIA 3FMFA 3OY7A 1G5HA 2GYWA 2Q45A 1KJ8A 2P1ZA 4TXJA 4UM7A 1CQJB 1UEIA 4LW8A 5TGDA 3VJKA 3ZVRA 1YMVA 2VOJA 4NCAA 2HJHA 3FVQA 1JLSA 1GPYA 2Z3ZA 4BV2A 3DMFA 4EJSB 4DDTA 3SVLA 1PW5A 2IHNA 4JY7A 1OFUA 1QLWA 4TMFA 3D0RA 5L95A 2YQ4A 3HB7A 1Q16A 4EARA 3F1LA 4YCBA 4J7UA 3WJ2A 3VPGA 5EMJA 1Y1RA 1KETA 3HB1A 2RC6A 4HSEA 5TPWA 2EQAA 4W8HA 2MSLA 5GJCA 2BGMA 3L18A 4BTLA 2ERCA 2YKGA 1CD5A 2E0IA 3U4HA 3D43A 1WZNA 3PL1A 2GBPA 3E2IA 3JZAA 2JLBA 3PXUA 5IXYA 3UHAA 1GAJA 1O8BA 4JB8A 4LAFA 5GIPE 4DPKA 2QRVA 3FGZA 4O29A 1NQTA 2VIIA 3LHIA 4W63A 5FOSA 4OB6A 4EY4A 1KS2A 1O94A 2A8YA 1EE2A 1P9LA 1V8BA 5LYYA 3DDSA 3O1LA 3AFNA 5EGNA 5IULC 2PBRA 4NPHA 5AJWA 1K97A 3EXHC 3UPUA 2WTBA 2QD5A 1LSSA 1ZM2A 2XMQA 5EKTA 1P1JA 2VG8A 1O3YA 4JODA 2ICAA 1SHLA 2XRMA 1DWPA 2CF6A 3GFQA 5DNUA 4P1ZA 3AF5A 1JKJA 1T2EA 4H15A 2VP5A 3DF9A 3L0DA 4GI2A 5B3JC 1QMGA 2BKLA 1BFKA 1ENZA 1RP1A 4P54A 5HJ5A 1HDRA 1G60A 2WWRA 4OJNA 3JATA 1ENPA 1XQVA 3T5CA 3ZU3A 3EC7A 1KI8A 1Q0QA 5C5EA 4H0CA 1YZUA 3GW8A 2VCEA 2E4XA 2V7UA 2G04A 1H0HA 1K8ZB 2PMCA 1X6VA 3AINA 3KJEA 5DXFA 3ZI0A 3RTCA 4RKQA 4CL3A 1A9TA 4IDQA 2W9XA 3G8DA 1F1BA 2C2YA 2C9DA 2W5UA 1E5DA 1A27A 2BZ1A 3V48A 4QLOA 4TTAA 1QWSA 1ORVA 4DY6A 2WMNB 1JYEA 221PA 3S3TA 2V97A 1OZFA 3W5VA 3E0QA 1N5KA 3VI3B 4HRVA 3TZHA 1ZH8A 3L0ZA 4DUGD 4C0KA 1SBIA 2HDHA 4HLDA 5JJ5A 1IJFA 3EDYA 1XCPA 5TY0A 1VLLA 1Z4JA 3OJFA 1QG2A 5CVEA 4DQUA 4XQ9A 2V6FA 3OZIA 4RH0A 1WHSA 4FGJA 2Z2KA 1HLGA 3DVRX 3EZ9A 1ISSA 5IZCC 3SJBA 1STOA 3C7AA 5CK5A 2RGGA 1BA3A 3KQVA 4TWRA 4KPFC 3UJPA 4ALJA 4M8IA 1KPHA 2DSNA 2VJQA 4BFWA 4DDUA 2O14A 3BK1A 4BVEA 2WF8A 4ZREA 3SIXA 1M2KA 1SUPA 3H6KA 2R8ZA 2FPOA 5KYNA 5JNSA 1OKKA 2NSJA 1XTTA 4D7AA 3NOOA 4I4TB 4PSUA 3U4QA 2KB0A 2IXGA 1WM1A 3OZWA 2FPIA 4R7TA 3GIWA 3HH8A 3N2LA 1E1DA 4U2GA 4KR2A 3O38A 4DPMA 5BVHB 2PKQO 3HKDA 1DFHA 4HWOA 4KFRA 5GM1A 1DP4A 1U6KA 2QRKA 2PKRA 2R5FA 5AW3A 2PRIA 1A8PA 2C8JA 3NG1A 4M99A 2IIBA 2M98A 1X19A 2Z98A 3IQEA 1Z0SA 4K0RA 1G9TA 5HRAA 5F2NA 5CAEB 1H2HA 1WXHA 3V4OA 2ZZKA 3M6AA 4HADA 1FP6A 3TTTA 3I0MA 3K73O 3Q8KA 2I6SA 1N1DA 2AQKA 3A0UA 2GRJA 1LJ8A 3MS2A 4PGAA 1N9ZA 1Z0ZA 2CXOA 3LSYA 4K03A 3O4VA 4YP1A 3P20A 4RY2A 2PD3A 3TEMA 5J2UB 4EQ6A 4UTNA 4P3XA 4GKJB 2J30A 3HCPA 4YAIA 1KOJA 2GCGA 1CY6A 5LP1A 2W6CX 5LKAA 2KWIA 4BP8A 3R7WA 4QUDA 2NU7B 5L3ZA 2YXPX 4Z54A 3DMHA 1O4VA 3CMCO 3WFJA 3AFIA 1WHTB 4GRIA 4PFSA 4UTZA 1V4BA 4EA9A 3AUYA 2CXXA 1PG5A 5AHOA 2QTTA 5HW0A 5ELXA 3GEDA 1Z88A 2BFPA 3DKKA 3EWSA 4QDOA 1ODIA 3NNNA 1PYOA 5IBPA 2YFKA 3W6UA 1W9HA 4EY8A 1O0CA 1CIVA 1UAGA 1EDBA 1AN0A 1EVIA 1T3HA 2F3RA 1BSVA 4G2NA 4UAJA 1AZLA 3NBFA 4LC0A 1R10A 1K3TA 2HNAA 4R16A 4WPGA 4XSHA 4YB8A 1Y48E 5M34A 4MAFA 2PA3A 4BMNA 2A0WA 1QM5A 1IMOA 1X70A 3I76A 2FSFA 1W85B 3FIUA 2CFRA 1NI4B 3H3XA 4IP0A 1J0DA 2EFGA 1L4FA 2GLTA 4HY3A 3COZA 3ZW8A 4X24A 1X8XA 3AOEA 3LFUA 4DV3B 1CFZA 2DLDA 2MCFA 2QX7A 4ZOQI 3RUPA 4UE6A 1SA0B 3MYRA 5UKDA 2J3DA 4I50A 3TX2A 5HOEA 5AK0A 3P2EA 1ITZA 4X95A 1PNQA 3U37A 1MVOA 5DSTA 4MPPA 3AF2A 4JNKA 1U3GA 2VAPA 3JWPA 1N1EA 5DYGA 3ZZ1A 3WWZA 1OSNA 2CJYA 5FB3A 4KR3A 4MYCA 5EP1A 3QGMA 3MSCA 1Z5UA 4MWZA 3NYQA 1ORWA 4NYMQ 5EZ6B 1MX5A 2I4OA 1DO0A 4GX1A 4HX9A 2VYFA 2O0JA 5DEOA 2XWBF 1QP8A 4BLUA 4KXMA 1DPFA 4M1ZA 3QEMB 5I9SA 1Q7CA 4L5CA 4GVPA 4BVFA 5AW4A 4DS3A 1B6SA 4W5TA 2WY2D 1NVVQ 3L92A 5DOZA 1A1SA 1GNPA 3OLYA 1C1XB 3S81A 4QG7A 4OYHA 4DBLC 1RJEA 3NBUA 2BTOA 1UC9A 3KXLA 4DSZA 1KY5A 3HR4A 3ZVKA 1Q1NA 1G9SA 2BI4A 1O1YA 2HV8A 3HWSA 4RA9B 4BUJA 4F46A 1Y4ZA 1S1CA 2QXTA 2IHJA 3LL7A 1NNSA 2PGOA 4OUDB 1XF1A 4WVLA 5YASA 2D7JA 2IHBA 1QQAA 3SS9X 1Z5WA 5HILA 1T25A 3DM5A 3KBOA 1Y1PA 3D59A 5AXAA 3AETA 3BE4A 3SFTA 4GL2A 3WGYA 2QR5A 2QX4A 4HEHA 4ANFA 5TF0A 1XZNA 3BF7A 4Q4AA 3DTYA 3JXEA 4D4HA 1IYZA 1JEJA 1XMPA 3MRTA 1YS2X 3U16A 4EUEA 4FGUA 2AUMA 4M3NA 2WWHA 2OECA 4I9FA 2FPXA 1JHXA 2H8GA 5CVJA 3G8BA 1R8XA 1NVBA 4JJIA 3S1AA 2NO1A 4TTVA 4DIEA 1N5DA 1OPRA 1FLVA 2FN8A 3L8MA 3K0AB 1NV9A 1KOLA 4ZDJA 1Y80A 4S1NA 5JAZA 1ETUA 4I9NA 7ADHA 2YFHA 3VSDA 4NXNB 1AGNA 2DFPA 3IP7A 2OGWA 1V5GA 1AXGA 4NBRA 4G4SP 4GD3Q 2FY8A 2FKAA 3ND6A 4B3FX 3D6VA 3B1WA 2XUAA 2VHZA 3AJDA 1QQ6A 1RWXA 5CT5A 5EHGA 2PRJA 2YIDA 5F98A 4HQRA 4V2IA 4NHOA 3QXXA 1QIFA 3Q12A 5CH8A 3U4DA 4CKWA 4QUHA 4EPYA 4K26A 2IIQA 4YWHA 1YQWA 4Y2VA 3WL3A 3QEKA 3DB2A 4YHBA 5EXEA 5IM4A 1XZAA 1CFJA 1F17A 2ZTVA 3MMNA 2VL7A 3FSJX 1AK1A 4DYVA 4I1OA 4GMFA 4JQCA 2EWWA 4TV9B 1G2QA 2VSYA 3H9BA 2W98A 2AOTA 4QNRA 4Y2HA 5TS3A 5FNZA 4UNSA 1NQOA 3P9IA 2C95A 4IDCA 2HD4A 2AF3C 3PJEA 4JXKA 4OQLA 3U62A 3VTFA 5KHOC 1U3WA 1D1SA 1E6CA 3HWWA 2FPGA 3UH1A 4D8WA 4A91A 3LUDA 1ZN9A 2CEAA 3OA0A 4J2HA 5ITZA 1NP3A 1PJQA 3UPDA 5AXDA 1KO8A 1WMEA 5JNWA 5GGYA 3QOYA 4Z1OA 4CL2A 3HXLA 2HAEA 3ASYA 4J4BA 3DYVA 3LYHA 4FI3C 4LMPA 2VSXA 3W3AH 5IXSA 1YA6A 4XH9B 3I2HA 3ZHTA 1JW9B 2XB9A 3C4QA 4RGQA 1LV7A 2IE8A 3QXGA 4L57A 4TTRA 1QCCA 2WB4A 4O33A 3M5PA 1NUQA 4KQ2A 5D7BA 3PGKA 2HBQA 5DGDA 4BZQA 4JI4B 1Y9EA 3QKSB 5K3CA 4AO8A 4MUIA 2BGUA 3CWCA 1U7XA 2D1YA 4UHFA 3Q0EA 1AGYA 1JBEA 1KDRA 5JXJA 2QJRA 1IVSA 2ZBFA 3TSAA 2XOKA 4ACAA 4H7IA 1GXSA 1BAPA 1J39A 1RRMA 2DWPA 1F14A 3ITKA 3PDJA 3IVRA 4B87A 4EX6A 2XUJA 1F0YA 4GM4A 4NTZA 1YBHA 2VYNA 1QZUA 4TWBA 3HWRA 1RIFA 1TVCA 3OX4A 3IMGA 3LZCA 1XD9A 4GGPA 1GG9A 3MSXA 4EPWA 4EUSA 2CMKA 4R7GA 4RHUA 4RE6A 1Z8DA 2GCNA 2H0RA 3V7UA 3K9CA 3RIEA 4ALMA 1MFPA 1S3SA 4WLFA 4R1QA 4RW0A 4YUVA 1GPLA 3T7JA 3TL6A 3VYVA 1NQWA 1QRSA 3GJSA 4ZRDA 4B83A 3L6DA 4RMGA 5T4BA 1DNPA 3E5MA 2ZRHA 3CWQA 1Z0IA 5KVVA 4CHTA 3ADBA 1S2NA 4NENA 4KXYA 4QFMA 2AQ8A 1E9AA 3RJZA 3QBJA 4BNYA 1FEZA 1X9IA 3JD0A 3CURA 3PNKA 5B3KA 4H1HA 4PS0A 2Z5FA 4P83A 3WRVA 4QXMA 3G8AA 1KKUA 1Q7GA 1DTSA 1M2GA 3OTWA 3AY7A 1H2XA 3I09A 3DEKA 3U1BA 1UXGA 4R1SA 1NJFA 2JCBA 1I7LA 2P6UA 1CR1A 3HDYA 2SCUB 4IJVA 2A5YB 4LX0A 3GB9A 4B84A 5A4MS 1T9CA 2OG2A 1REQA 2OORC 1RC8A 3W5AA 1X1EA 2AFIB 1GZ4A 4O2AB 2UYGA 3GA0A 3CR3C 1MC8A 4CKXA 3ZLVA 4R8SA 4FWTA 4XX1A 1S1MA 3DH0A 1J2EA 3GIDA 4PC2A 1JEEA 3L4EA 2V98A 1N3YA 4HEA6 5IF3A 1MPTA 3JARA 3GRZA 1BXGB 4RFVA 1DJOA 1MMFB 3H5OA 1AT1A 2ATVA 3BE8A 2OVFA 3GT3A 2P9JA 3UB3A 3ZJUA 2CD9A 3G1WA 2QG6A 3A1FA 3I8XA 1ORIA 1UEXC 3G23A 3OSUA 3UCXA 3STWA 3WNZA 1T5TA 4M21A 4UPDA 5G4KA 3CF4A 3ROQA 3ZCXA 1PGJA 2J3LA 2ABWA 3NBXX 4HN4B 2I8CA 3D6UA 2Q3MA 4CI0B 2RCNA 4BUZA 2XDWA 3F4LA 1G2PA 4DMFA 2FV8A 3ZEIA 5F2KA 1RVV1 3N2YA 2OHVA 4CI9A 5KOHA 3Q4GA 1I2CA 3K9QO 3JU3A 5FPTA 3WMWA 1H4SA 4IV0A 3AHFA 1Q7BA 1KIAA 2IOHA 2A2ZA 3FSEA 1Q77A 2CKMA 4RWEA 3VR3A 1FDUA 2IHUA 2L2QA 2R65A 4M1TA 2VPPA 5DXJA 3OF5A 5CFZA 2QOEA 3S7TA 2FGKA 1ZR2A 2ZDGA 3ASUA 3UAWA 3LBFA 4HLNA 5C81A 3QU2A 4LWQA 5D3ZA 3SN6A 4ZMBA 4YX9A 3BIWA 1BN7A 1TIKA 4YPFA 1JE1A 2IYOA 3LE8A 2J41A 4CDRA 2PUCA 2BGNA 1FDVA 5ERXA 3S2EA 1NULA 5HM8A 1EHCA 4N8EA 2HA0A 1KI3A 1QQTA 1F8YA 3NV7A 4RPGA 3WNVA 5IS2A 1SXQA 2DVMA 2G7ZA 3ADKA 3K0FA 2CT8A 3RT7A 3HCWA 3EIWA 1G16A 2GK4A 2JGLA 1VI5A 3FLBA 4I1VA 3BGDA 4XZ3A 4D46A 4ZHQB 4TVKA 4Q24A 4Y2RA 3RRZA 4Y2QA 4WT7A 3U7EB 5CFOA 1IU9A 4XVUA 3AO0B 1JEYA 3G8YA 2QTRA 1Y8CA 5DO9A 2XGGA 3WGHA 4EUKA 2PWPA 5E3JA 4L6CA 2BGWA 5BOSA 2XZLA 1JFLA 4PX5A 4OXNA 5K3EA 4G56A 4Z51A 2HOQA 4R2MA 1QB7A 2GA8A 2I2WA 3JQ6A 4WV3A 1NRXA 2I1WA 2B8WA 2REBA 1FX1A 3N2GB 4MVJF 4KAXA 1AN9A 1I0LA 2E21A 1EZ4A 1NVXQ 2OZVA 2WIAA 4F4FA 1XZGA 4F1JA 1JG4A 2LCIA 2B9VA 2BBSA 2G1AA 2JJ1D 3QVGA 1YHYA 4BQRA 1H0KA 1JVSA 1RMQA 5DI9A 4B8YA 4MB6A 1IBKB 3G02A 1BS2A 4UHKA 1GUBA 4RGBA 1EXWA 5KJCA 3FHTA 2W2PA 3EIEA 1ECBA 1XZEA 2JLRA 1QFJA 1EX1A 4CTNA 4R8KA 2KLBA 3I1JA 1PSDA 1YASA 3NBMA 3O73A 3TPFA 5KZMB 4V0KA 3CB2A 1LLUA 4G5HA 3W6OA 3DBIA 3WHLA 2GWRA 4J0IA 1YFJA 1U3VA 1G21A 1YRWA 4KNWA 4UM9D 4UOQA 4ZCQA 1SK9A 4PG5A 4AZVA 1I1OA 3NVMB 3RAFC 1CHNA 5BSTA 4BIMA 1U7OA 4MHTA 3L7MA 1D2MA 4MQFB 3T4UA 1OX6A 1QGZA 4WOCA 3HN2A 4ENRA 2FSGA 2NSHA 3B85A 4UTRA 3FMPB 4MWSA 5GGXA 2FX2A 4OMCA 5EWLA 3A31A 3DOEA 1YDMA 1T5LA 4WKPA 1PD1A 3O7WA 4NG4A 2G1JA 2IP2A 4KLAA 3JPWA 2RJ3A 1H2RS 1P0IA 2G40A 4DDVA 4L08A 4O4HA 4XB2A 4BMOB 4TV8F 3QFFA 1QC5A 2WV9A 1L1FA 1KAOA 1BE1A 2Z1DA 4YRLA 3WHPA 5LXTF 2KLHA 4YMTA 3HJNA 3N2KB 3TTWA 1HDXA 4KDRA 3ISTA 5EESA 1IFXA 2JKVA 1R9JA 4N1AA 3U3ZA 3X1XA 1FUKA 4EZBA 4MH0R 4Z2AA 1GQFA 2G88A 5A9SA 2AC2A 4NV0A 2AVNA 4DMCA 2YHIB 5ENDA 1T8UA 4B9AA 2AN1A 3D3JA 2BH2A 2IPAB 1ZJ6A 2JJMA 1G3MA 4YMLA 4RHFA 5CB0A 3UHOA 1OY1A 2ZSDA 1J5XA 1ZXXA 1IXZA 2WMDA 3ACCA 3HU1A 2ZBEA 4LJAA 4XVQA 5AKLA 1SJ9A 3QF4A 5TQ0B 3VZRA 2EZ8A 2ODBA 4PO1A 5E9JA 3UJ8A 1KYZA 1CUVA 3WADA 4JSYA 1VFPA 3JQ7A 3Q7RA 3DNMA 3WB9A 4WA7A 4KBFA 3B8EA 4N9WA 5EKSA 2JG3A 1X7WA 2O2DA 1N78A 2CJPA 2R8EA 2CLIB 1X1RA 1ZNWA 2IYSA 3ISVA 3KUDA 3FHJA 4BEVA 3IP6A 2C58A 3KCQA 2LCFA 5HJEA 2TSYB 1BXRA 3PFGA 4D4LA 2G77B 1R3UA 3K0CA 2XDYA 3AF4A 3LCMA 2PD4A 2EJTA 3DMNA 1TZJA 4G1CA 3WQHA 5L6MB 3TO5A 3OQBA 4ISCA 5IAAA 5K3SA 3USCS 3WTBA 1QCDA 1BOFA 1E3IA 3BMNB 4P22A 5EOVA 4Z9XA 3FROA 4AJ2A 4N7RA 4AQYB 4AC9A 1RHMA 1UQRA 1LQUA 5K3FB 3FCOA 4PLZA 3CUWA 1V3TA 2QUZA 3ASVA 3NFYA 4Y6LA 1GV1A 2PVSA 3ODGA 1OPXA 3KXIA 2AJCA 1YL6A 4ZGBA 3FPBA 1UUFA 1QRUA 2WWGA 4O4IF 2CNBA 1DC5A 3USES 4HN9A 3ES9A 4FR5A 1KYWA 3GR6A 4F2PA 5BURA 4CQMD 4BVBA 1BFDA 4CTKA 2GN8A 1KH1A 2C8VA 1SBQA 1VXOA 5CTAA 4K1LA 2NACA 1FW6A 1EX7A 2ZB7A 3K2IA 3M6XA 5IUKC 3F5MA 3FGPA 5H1YA 1KZHA 4QRIA 4HLUA 2FZCA 5SV2A 4FNMA 3M9WA 4Z49A 2FPRA 4C0JA 4JYZA 1DIBA 3FBGA 3ITDA 5BQOA 1ADGA 3KJXA 3SXJA 3MB8A 3CRMA 4BWGA 2J8ZA 2JIDA 2NG1A 4J07A 3PIDA 1B4DA 1FUUA 1XA0A 2H4JA 2OWDA 2QN2A 1W0JA 3JAKA 4IUDS 4TYYA 1TLFA 3KKNA 1USKA 4E30A 3EVZA 2YVUA 5BN5A 4I5DA 4B0OA 2N75A 4TMWA 3LXRA 1D9XA 1WD7A 3HZOA 2AFRA 3ENKA 5DBIA 3V1LA 2VTKA 2DBVO 2Q5FA 3DZDA 3RS4A 4BAUA 1FTSA 4PNZA 2AJTA 5FPQA 5IX8A 1CZNA 3PNQA 1ISGA 1WL8A 3EIXA 2C5EA 5CDUA 3KKOA 3SYTA 4ZGWA 1MLDA 1Y7HA 4DA4A 3TL3A 1ANKA 5TC4A 1JNYA 4YAFA 5KWIA 5G02A 3LZ6A 2XZOA 3EBPA 2F67A 3FDZA 2BMVA 2XUQA 4O1IA 2VHXA 2X9VA 1B93A 1XEXB 3F49S 4BRZA 4IZOA 4Y0AA 3SHOA 5GM2A 4QM7A 1V6SA 3A6PC 2GPJA 4MW1A 4FI3F 1D6MA 1S2GA 2PUAA 2WG0A 1LW6E 1AB5A 4GPEA 4Y7CA 4JEHA 4I3FA 4B8WA 1I9GA 3B89A 1W48A 1UWLA 4HYQA 4ACBA 4E5KA 4EHBA 2O3SA 3HYTA 2XMBA 4MITA 5AR1A 4DIOA 4F9FA 4LOIA 4WESB 3ZWVA 2WP8J 4Q34A 4IDEA 1PEAA 1SCQA 2YYAA 3OZUA 4IIEA 4X9XA 2GK7A 4P4SB 1K6IA 4KL8S 1ZCJA 5ENVA 5HP4A 2H2GA 3B1KA 5DLEA 1E1YA 1QHIA 3AGQA 4UZEA 4UVEA 2V4ZA 3X44A 3LVQE 1VPEA 4RQBA 4XASA 2I7CA 1Q0HA 1NX9A 3CSUA 1FS6A 1SVWA 2FRXA 3DFFA 3EFOA 3JS5A 3A28A 2E37A 2HK7A 2GDJA 2NQ8A 1T15A 4N0MA 3Q88A 3LC0A 3WGNA 2JGIA 2J9XB 5LL6P 4MUYA 3KO8A 1QYXA 2WJAA 2DERA 1WJGA 5LMCA 1DTWA 3OJLA 4P38A 1II8A 2X6RA 3ROFA 3Q8WA 4URUR 4LMBA 3D8TA 3PQ5A 4UJ5A 1N25A 4H31A 1HZZA 4NCJA 4V0NA 4Z9BA 5HFNA 3AM1A 4MMZB 4F0JA 2ZU6A 3ORHA 3O8BA 1FB5A 4MV6A 5CT8A 4FNAA 1C1DB 3A2KA 5JCXA 3ANLA 2JPDA 3NC4A 5P21A 3C98A 1ACLA 4FE3A 2AWOA 2O8BB 3R5SA 1LDNA 1UAYA 1SEVA 3RYFA 1X7ZA 4Q39A 5FULA 4LPKA 5D1NA 3VPFA 3ZQJA 4L51A 1KGSA 4TLMB 5DLDA 4A27A 4Z0HO 2LPMA 1AOXA 2V7TA 4MGHA 4BLRA 3CFYA 5JFGA 4FEAA 3IQDB 4BECA 3DVLA 1KO1A 1BQ4A 5AOAA 2X8JA 5K3OA 2QNRA 1UMKA 3B3FA 2PBFA 3H2KA 4D9BA 3KHSA 4L72A 1W47A 2QUHA 4BDTA 1W4RA 5H70A 3DHEA 5CVTA 1FU8A 3PIIA 1TL7C 3IKLA 3OFND 1DELA 4TMXA 1X2EA 2UVDA 1K5HA 3MWFA 1N2XA 2VF7A 2WU8A 2PX3A 4KPUB 5DN9A 4C6RA 2AEFA 2WVJA 5CM2Z 1SU4A 1QZ3A 1UBRS 1XX6A 3CJRA 3HJUA 3OM1A 2IUTA 1UWKA 3NTLA 2X0FA 1J0XO 4YJKA 1UMBA 3QBTA 4AN0A 1ACJA 3LWBA 2F8TA 4LXHA 4DA8A 1VGQA 4F4DA 1ZOSA 2G83A 4FMCB 2Q3BA 3VZPA 4IG9A 3DNPA 2ZR9A 1RRVA 3EXFA 1RVDA 3G17A 3O3NB 1SOUA 1TZBA 3Q7SA 2NP7A 2C42A 3PHHA 5CNMA 3I62A 3QVXA 2JFXA 5M7EA 1T2CA 3PHGA 4JGIA 3EXG2 4JZKA 4QQKA 4RMJA 2E6KA 4RTSA 3H13A 4RZQA 3TGLA 1RYFA 4E1AA 3GP8A 2SECE 3WNCA 1B0ZA 1DC3A 4OA8A 3U19A 3B3QA 4TXNA 3PGVA 4OCZA 3QTBA 3GHHA 3KDAA 4HS4A 4F9EA 5JQGB 2BFEA 4PTYA 1MJHA 2GBIA 4HPXB 1B23P 3IEUA 4N7MA 4ZAGA 2R6CA 1D0VA 2FE1A 1YK1A 2UYOA 4RL6A 5A7HA 2JB9A 4W82A 1YE3A 3KJHA 5EE9A 1DEOA 2QIPA 2VDUE