3I9GH

Crystal structure of the lt1009 (sonepcizumab) antibody fab fragment in complex with sphingosine-1-phosphate
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
222
structure length
222
Chain Sequence
EVQLVQSGAEVKKPGESLKISCQSFGYIFIDHTIHWMRQMPGQGLEWMGAISPRHDITKYNEMFRGQVTISADKSSSTAYLQWSSLKASDTAMYFCARGGFYGSTIWFDFWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of sphingosine-1-phosphate in complex with a Fab fragment reveals metal bridging of an antibody and its antigen.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Sonepcizumab antibody Fab fragment, heavy chain
total genus 44
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2009-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3i9gH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3i9gH01
5C0CB 4PJGF 2A73A 1CGUA 5DXWA 3IJYB 5D1QA 1AD0B 3THMH 1IE5A 5DHVA 5JA8B 1HSBA 2Z91A 2XQYK 4Z7WB 4NGHH 4IRJC 5FHAH 2HH0L 2ADIA 3U82B 1MH5A 3WD5H 3MRPB 2OJZH 4X9IA 4OBSA 1N26A 4H20H 2VDMH 1PG7X 1V7NH 5LJYH 3CXDL 1KLUB 4I0PD 2D31B 5I30H 5IT2L 3T08A 3B9KC 2Y9RT 4Z0BH 1IAIL 3DMMD 4GXVH 1EXUA 2Y06H 1IM9D 2A1WL 2AJ3B 5K9QI 1XH3B 1B0GA 4PJGA 2GTZA 2MKLC 4A2MA 3PDOB 4H26B 3PWLB 3SBWC 4XNQB 4CNIB 3TT1H 1MRCH 2LV4A 2A9NH 4NZRL 4ZXBD 5ADPH 2OTWA 3CFDB 1U8NA 2PTTA 3REVB 4FQXC 3TBSA 4AM0B 2QKIA 1FNSH 3G5YB 3F6LA 2GJZB 3HLAB 2HWZL 3LPGA 4ZYKB 4ZO8A 3ZKMC 3B3IA 3IYLW 2VDQH 4L4VE 1FL3A 4PTUA 4HXAL 3MUY1 3S35L 4K94H 4LVHC 3HZVA 3AAZB 2AEPL 1HHKB 3TO4A 2IBBA 3TPUA 2X1OA 4OCSL 4PJEB 3TC9A 2FH6A 4GAJL 4XVSL 5DVKA 1NLBH 1INEL 4Q9QL 3C6LB 4ELKB 1EZVY 5SX4I 3X11A 4L4JA 2GW5A 2NCMA 1NKRA 4JCMA 4JKPL 4FZ8H 4PJ5D 4OZHA 1OTUC 3PHSA 3LZFL 2VRAA 4NQCA 1PX4A 2ATKA 4XXDB 4XCYB 3OAZH 2Q7YB 5EFIA 1KB5A 1AGBB 3RU8H 3QG7L 5FO9A 1A0QL 1FNSL 4QGYA 4ZFGL 4G9DB 3WNMA 2FRGP 3EFDL 2BJML 2J5LC 3H9HA 4RGNE 3VG9B 3X12B 2AJZA 4JR9H 5A2FA 3GSNA 5DD5L 5EBLB 5GISL 1T66C 1M05A 1ZT7A 5J13C 5DGQA 5D72L 5I1GH 4H1LB 1QOKA 4AJ0A 1I7UA 5KVDL 3BKMH 4DGYL 4Z0BL 3VXTB 2PYEB 2BJMH 4ELKA 3DSFH 1UCBH 1JGEA 2HFEA 4FXGB 1N59A 2LU7A 1T2QL 2KZWA 1OWRM 4YHNB 2A6DA 3VMOA 5CJQL 1T22B 1T04A 1W72A 2JIXB 1YEEH 5HGHB 4QTHA 5FHAL 1ZLSH 4D9LL 5F1SA 4Y19B 2XNAB 4XZUA 3IFLL 4NFCA 1GOFA 3ULUL 1NC2A 5SWSD 1GAFL 3ZZ1A 1TXKA 4PJCB 1QBAA 3BDBA 2NPLX 5DJXA 1SHMA 3X12A 3X17A 5FA3A 4G6KL 2PR4L 4RGND 1VGEH 3NABH 4PJDA 3W11D 3MRPA 5HDQH 1HQ4A 5D1XC 3UJIL 2XKNA 1JBJA 2EE9A 5D2LB 4PRAB 1K8DA 3IXAA 3RTQA 5CEXA 2AERT 2W65A 5TE7L 4Y7MA 3ZSSA 1SY6H 2BSTB 2G2RA 4F58H 4XXCC 1SJVA 2DLFL 1CL7L 4RRPG 2ESVE 5BMFL 1WCQA 2HG5A 5DJ0B 5FYLE 5C86A 1CG9B 4PV9B 3PGFH 4GG6E 4U1NB 4PRNB 5TFSH 1PDKA 2OSLA 2XNAA 2FZ3A 3TA3A 1RU9H 3QDME 3T4YA 2QKIB 1E6JL 1RUKL 4KDTC 4POYA 2IPUK 2W0FB 3CH1B 3PGDA 5GRVL 5KW9H 1PSKL 4P5TA 1JYVA 3NN8B 3FB7B 4LLVA 1LP9A 4NPYA 5JHDA 1MWAB 3ROOB 4NKOA 4UT6L 3QG7H 3CXDH 4YXHL 4MJID 1OP9A 4EUPA 1M7XA 2N56A 5J1SC 4G80A 2X4OA 1MEXL 4EDWL 4HMDA 4GRWE 3MGOA 1FFPA 1UKTA 2V2WB 1AQDA 1P7KA 4M1GL 1QACA 3H6JA 3W0WB 2JELH 3CFJA 5E70A 4HWEH 1DBMH 4L9DA 3LHPH 2OR9L 2VISA 3GKZA 1Y6NR 1G9MH 5I1IH 4YZFF 4S11A 3NFNB 3FHQA 1EH9A 2Z35A 2WUBL 2Y5TA 4U1LA 1IC7H 5F7HA 5GRUL 1TDQA 5FCUH 3MRFB 3LDBB 3BEVB 4XAWH 4OT1H 4JDZA 4PG2C 3RVUD 1IEAA 4RBPK 3QNZB 4GXUM 2AEQH 2DDQL 4Q2ZB 3HG1D 5IBTL 1T7VA 5C0JB 3DECA 1NCBL 1UXSB 4NOFA 3P73A 4JRYA 2YRPA 3T1FB 5B38A 3CX5K 4ELMB 4M6ML 1GGIH 3I2CL 1KULA 2P5WD 4P5KB 2Z91B 2Z4QB 3VA6A 3K8MA 2NY5C 1H3PL 1RZKL 1EVUA 2E5EA 3K8LA 3F5WA 5FGRA 5EOQL 3ZHDA 5H2BA 1NAMB 1OAKH 1W0WB 3MBEC 4LAJH 1XGTA 1ZLWH 4R4BB 3VE0B 5E99H 3WEXB 1IGML 4UIMB 2M26A 1YEJL 4DZ8A 2J88H 5EIVA 4JGMA 2BX5A 4OLEA 3WFCL 3U4EA 5DJDB 3V4VL 1CIDA 4LSQH 4R9HA 1LGVA 2QTEA 3P77A 3GK8H 3QA3B 4K3DL 3D3VB 3GI9H 3S6CA 4OT1L 2YPKA 2PN5A 1KIQB 2ICWI 1U8HA 3S37X 5CGTA 4EEEA 5JMRA 3QNYB 5F21B 2FX8L 5F96L 3KR3L 4HWZA 3O41A 3MR9A 5KSUA 2GT9A 2WUBH 4ZPVB 1IGYB 1BPVA 4GRLB 3EYVB 3LMJL 1WWWX 3P4NA 4NHCH 5J9PB 5GGSA 5I18H 3L3JA 4KRPD 3BX7C 1B4JL 2OM5A 15C8L 5LCVL 1ROWA 3HRZB 4MVBD 2R2EB 3LHPL 4KJQD 2VLLA 4F2MB 3MRDB 2D7NA 4DFIA 3ZTJH 1AXTH 1R5IB 4OZHF 2QSTA 3DYPA 5DJZA 3VD9A 4MDJB 4ZPTA 1KIRA 5E00B 2XG4A 2NTSP 3NACH 4YIQB 1ONQA 1NGYA 1HN1A 1TTFA 5JHLL 2R0WL 4AEEA 4LU5H 3MJ8B 3SKJL 3BP6A 5CMAA 2XA3A 1HOCA 1JZ8A 3LDBC 3K1KC 1F3JA 3HC0A 4HUXB 1J10A 1AQDB 2ZWLT 2XTJB 4QOKB 2MTPA 5IFHL 1MIML 2I24N 3OZ9L 5K9QG 4LPCA 3LD8C 3G9VA 4IMKC 4XPHL 1ZVHA 3AY4A 4RFEB 3QI9D 5JXED 3O3DB 5JW5B 3L3DA 3DV6A 2NY4B 4YHOL 4OV5B 12E8H 3DROB 2D03H 2A6KA 4KRNA 3IT8D 5D70H 2XRAH 4O00A 1T21B 4XMPL 3RPIA 2DLHA 4L4TB 3EO0A 4XMKL 2I60L 4UV7H 4L4VA 2Q87A 1MCDA 5D5MA 3HMXL 3V6ZB 4GW4B 5CLWA 4O02H 1R0AL 5F97E 5B39B 3I02A 4G8FB 4X0KB 1RZ7H 4I9WE 4ZNCD 1NUDA 2BVQB 4PJ8A 3NABL 3C09C 3Q2CA 1A4JA 1AFVH 1L0YA 1RUQL 5IM7B 1MHPH 2WIIA 3WIFA 1W8NA 4Y1AE 5GJTH 1I1RA 1A02N 4DUXA 2GITA 5MEQB 1F4WL 2ITCB 1ACYL 3T2NH 2OP4L 2KL6A 3RVTD 3VE0A 1UACH 4LCWB 5D71L 4RBPH 4X6CB 1MCRA 4OZFG 2PXYD 2AJYL 4HS8L 4KKBD 2QR0B 3PWUB 15C8H 5LCVH 4JO1L 4Y4HC 2RJMA 1BAFL 1MCPL 1C5CH 3O4OC 1BVLA 4OIAA 1IT9L 3U0PB 1S78C 1JWUB 3KR3H 1PEWA 4W6WB 4Y5YA 1I4FB 3CK0L 3KXFD 2M2DA 3OKLA 2SEBA 1OT2A 4OAWB 1IRAY 2X1WL 4IJ3C 2IADB 1ES0A 4NZTH 5GS2D 5IB3B 4QHUA 3UTPE 3MV8B 1FFOB 3QIUB 3UXFA 2OMBA 5FGCB 4WV1C 3T0EE 1SBSL 1F2XK 3GSXB 1HHJB 1FVDB 1MF2L 2M1KA 4M7ZC 5D7IA 2VLMD 1GH7A 3QUKB 4C4KT 2COQA 3SOBL 3U4BL 3QI9C 5JXEC 4KI1A 3MGOB 1OAQL 4HZLB 3WNPA 1PD6A 3GMRB 1RPQA 1YN7A 3VFRB 3BH8A 4KK9C 1S9YA 4HIEB 1PG7W 1PY9A 2EYTB 2MNUA 5DUPH 3L3JB 4HC1H 4QEGA 1KCRH 3I2CH 2ZKHH 2F19H 2VISB 2WP3O 4HXAH 3PHOB 5TDNB 4AEHL 2EXYD 4H5SB 4P2CG 3EO9L 3AVEA 1MIEL 5AZEL 4YDKH 1IBGL 1S5HA 4RMVA 4XP4L 4FQ1L 1GPOL 4ZPTB 4PJ9A 2IALA 2H8PA 3SO3B 4BKLB 4LAQH 2EDHA 1NCUA 4I18A 1AH1A 2A2QT 3RKDD 2CKBL 5CMAB 1KTDA 2D7OA 3AY4C 4JGUA 2QQQA 4P2OB 4KUCF 4PJFF 2YKLH 4XMKH 3LS5L 2PO6A 1PG7L 4G8GB 4LRNH 2VO5A 3C5SB 2EDWA 4D3CH 2MWCA 4ONHB 3FFDA 3KYOA 3GI9L 1U8QA 1FCGA 2X42A 2HMIC 2HJKA 5GPRA 1MJ8H 2HJLA 3F5WB 3LKPB 3Q6GL 1MI5A 4P23B 4YPJA 2P45B 4KVNL 2EYRB 5KTEH 2ESVB 1IEBA 3D25B 5F89B 1Z3GH 1WZ1H 5HYSB 1TJHL 4P2OC 3JSSA 1NC4D 1JMZA 5FA3B 4O5LH 2UWEF 1JN6A 2NXZC 4LEOA 1KG0A 2VQ1B 5M95B 3G6DH 3DO7B 3BWUC 3MXVH 5AWNL 4MD4B 4LSPL 1WAAA 1EEYA 5IQ7L 2ICWB 1QQDB 2VDKL 1HXMB 2EIBA 4IHOB 3WFEH 1Z2KA 2IH1B 5I73C 5CHNB 3BEWA 4FXKA 4XNXL 3O2WH 5IBLC 4TVSa 5A2KH 4DGIL 3RWFB 1GC1C 5SX5K 1TFHA 4YEEA 2YPLD 3RWDA 4A6YH 3K4AA 3MNWB 1J1OH 4HX1B 1C1EH 1PZ5B 3JV5A 3M17B 3GJFH 4M6OH 1K3IA 5C0BB 3S36H 3BPNC 3GO1L 2FO1A 5J4MA 5EBWB 4NNPH 3VGFA 1KT2B 4R97B 4A6YL 2CDGB 3WBDA 4IOFD 4X83A 4JFPB 1AC6A 4JO2H 4RQQB 2J6EA 1HK6A 1HKLH 5CSGA 4JHWL 3B43A 1YDPA 1FC1A 3LQMA 4X4MA 1RK1B 2AXFB 4QHNB 3ZSTA 1JWSB 2Z8WC 1CFVH 1UH3A 2DQTH 3RGVA 1OM3H 4TULH 4LCUA 1FL5B 4OLVH 3V4VH 3LN4B 1OP5H 1PBYA 2DTML 5HHXL 1DSFL 3D85A 4XHJC 1BWMA 1YEFL 5ISZD 1BJMA 1OPGH 1ZLSL 5KTEL 2DF3A 4ZS7H 4LVNB 4KKCD 4F80A 4JPKH 2ZSVB 4JZNA 5JQ6H 2AEWA 3EJYC 4GRWH 3T0EA 2ZPKH 3NBNA 4HIIB 4TVPH 3BGMA 2GKIA 1KJVA 4JM2A 5EO1B 1B0RA 1G7MA 1P7QA 4KI5E 3Q0HA 5C09B 3VH8A 4XX1G 2QHRL 4EN3B 4K3EL 5KSAC 3CLEL 3O3UN 4KUZL 4JKMA 4YK4C 3VXMD 5IVXF 4YAQA 1MHEA 3RPIB 1CFSA 4UV4H 2YD1A 1FIEA 1NCBH 1U8LA 2GAZA 5HYJB 2HLAB 4UB0L 4L3AA 4PRHA 4C56A 1A0QH 4U3CA 2H32H 4FA8A 3OKDA 4FQ1H 3PGFL 4QCIB 5CZXC 4WGWB 2P5EB 4D0BA 4MJIA 3MV7D 4UI2A 4R97C 3MMEB 1A6UH 2CUHA 2F58L 1I9IH 3RX7A 4Y5XC 2F19L 2AQ3A 2R1YB 5LWYL 3MV01 4JO4L 1LK2B 3VCLA 3B4NA 3FB8B 4TUJB 3RWIA 4PRIE 3T0ED 2EC9T 2W1NA 4HWEL 3T3PF 4YX2L 3OL2A 4AENA 5FUCC 2B7DT 1T5XB 4LARH 5BS0A 1M7IA 4JFZH 3O2VH 5HGBA 2DYPB 1X5AA 3ABZA 2XFXB 1QFWH 3EOTL 3LQZB 4OJFL 1D9KC 4U0QB 5I19L 5EIIB 3VXRB 3D9AH 1A7QH 4FN0A 4PJBE 3MV9E 5IFAH 1DEDA 1R3KB 3BIKB 3KPTA 4W4OA 4R96A 5MP6H 2ICEA 4MA8L 3LRGA 5ALBL 4LSRL 1KCSL 4JJ5A 4Q6IA 3NAAH 4ZPVA 4P9HH 1N5YL 2VUYA 3TO2A 5DRWB 5TE4H 3BKML 1H3VA 3GIVB 4BSVA 1UEMA 1IVLA 4DAGH 4MXVE 1AQKH 2ZOKB 3RUGB 3TNMB 4Q74A 1A47A 1C5CL 1DUYB 3DV4A 2Y72A 3SJVE 3VXNA 1I1YA 3P4MB 4LLWB 3NAAL 2IFFL 3H8NA 1A22B 1P4LA 4NNXB 3QIWA 4IOIA 3QT2A 3FFCB 1DN0A 4NBZB 1IZJA 2I07B 5EZJB 1AXSA 4F37K 4OV6F 3QHFL 1FYTD 2VITB 3BJ91 1GIGL 5TE7H 1A8JH 4MNQD 3VXSE 3BOVA 4YFDB 3M17A 4IDLA 3I6LE 3TBSB 4P2QD 3RY6A 1F3JB 3HC0B 5I19H 3BESR 1CT8A 4D0CA 4JFFB 4JFZL 1X9QA 5DD1H 4HUVB 3B9EA 3EGSB 1LE5B 3GRWA 4ZYKA 2P8MA 4OFYD 1GXEA 4PGDA 1EEZA 4MWFA 1X5XA 2J8OA 1OAYL 3TYGL 2ATKB 4NNYB 3OPZL 2HT4C 3PIQA 3DVNA 1GYAA 1P4IL 4OTXL 2P8PA 2IQAA 4D9LH 1K2DB 3KNBB 4L29A 5HYJE 1AO7E 3O6MH 4K7FA 4HEPG 2CLRA 3UYRL 1G9EA 1QP1A 4WENB 5F9JA 3ZE0F 1YMMA 3ARDC 3C6LA 5E8NA 5KAQF 2MPAH 3F58H 1VADB 3D85B 4JM2C 4N90E 2FX9L 1D5MA 3GI8L 5F9WB 1P84J 4YH6A 3BUYB 1P1ZA 4QXUL 4QHLA 3FCTA 1NCWH 2IANA 3EW3B 3H9SE 4YHKL 3F7RA 5FYKD 2A73B 2CK0L 4G8FA 4PV8A 4R8WL 3DRTA 3MRRB 4U1GC 2CUIA 3MFFA 3SE8H 3MMEA 3ALPA 4HW6A 2DKSA 3ESUF 3BXNA 4NCC1 3BQUD 1AHWA 1U91B 5KG9A 1G7PB 3F12A 2R1YA 3S37L 2O5ZH 2OTWB 5EZLA 3FRUB 1RV6X 3HCVA 1U8LB 2GAZB 5E08H 4HS3A 5D2LF 1NGPL 2VDRH 1N7MH 3CMOL 4CN1A 4CDGC 3NACL 5LGHH 4NYLB 2X2YA 2NY6C 5E2UH 4KROB 4YHNA 2QQKL 4NQED 3BKCL 5C6TL 2BNUA 3P9MB 4JY6A 3AXLA 4QRTB 1U8PA 4JB9L 4X6FB 3TM6A 4LPYA 1PZ5A 1E4XL 5I76B 1R3KA 35C8H 1GHFL 1F02I 3UZVB 4RMWA 3VXUD 1F11A 1A2YA 4MDIA 1YY9D 2VDNL 2X70A 4HBCH 1OAUL 1H8OA 2P8LA 5I1CH 1IILE 2OSLB 2VDQL 2EDYA 2AJXH 3QIUA 2R1WB 2K7QA 4WI4A 2CD0A 2ZUVA 1CBVH 4GRWF 2NXYC 4PJBB 4ACPA 5KSBF 1Z0MA 1QKZL 1JNHA 4O2FB 3WFBL 1RI8A 2NXZD 5F7LB 3TPUB 2APFA 5T3ZD 3U2SB 5EO9B 1MRDL 3DXAB 4D8PB 4U6TA 4QWWC 1LO2L 4QRTA 3UTPD 3QXWA 2LTQC 3M45A 5C0RH 2XQBL 1KFAH 3JWNC 1T1WA 3MV7E 4R0LC 5IQ7H 3NCCB 4GKNB 3RTQC 5I1LB 5DJAA 4X7SL 3HNTH 3EYFA 5F7YC 3QWQB 3K1DA 1T66D 4PJ8C 3DRQA 4I4WA 2WBJB 1QBLH 1HH6A 2A83A 4M7KL 1VA9A 1WGOA 4NGHL 1T7YA 1YUHB 4TQEH 2PYFA 4NO0D 1NL0L 1UWXK 3NZHH 5A1AA 2JIXD 2YPVH 3BO8B 3MZGB 5ILTL 3HC4H 4ESKA 4D8PA 4A2LA 4CVZA 4OZIF 3BEVA 5E8NB 2ZCLL 3HE7A 4P2RD 4D3CL 3W81A 3P4OB 4XPGL 1JZ4A 1QR1B 4P2RA 4DTGH 5D7JB 5LGJB 1FJ1B 3O8XD 5AYUL 4Y8AA 1X5JA 1K8DB 3IXAB 5CEXB 2MKWA 1F90L 3PV6A 3TT3L 5HYSG 3IFOB 3W5NA 1HHIA 5DURB 3P73B 2JJSA 3GIZL 4K9EL 4CADA 5IMOA 4OUUA 4X80H 2CLRB 1MLCB 1WZMA 4BK5A 3ZKMD 5ESAA 4JN2A 3OR7A 4G3YL 4WHTB 4JDZB 1G9NC 2DLEA 5A16B 5JPMB 4XVTL 5H8DA 3VD3A 3OKNA 3LKNA 4DK3A 5E08L 2FEEI 4P3DA 4MXWL 3QQNA 3I84A 5DUPL 2UZIH 4OFIA 3PF2A 4P3CH 5I1EL 1Q1JH 2DN7A 3M1BB 5CKGA 4CKVX 5EU4B 2ERJC 5IP4A 2DB8A 5KSAD 1CD1A 1FGVH 1SVZA 2EH8L 1YEKH 4JRXA 3O0RL 3B9DA 2VERN 3CVHA 5CEYA 1H3XA 4MA1C 1FYHB 4PJFB 2A0LC 2BMKB 4P0DA 1XF4A 1WFNA 2CMRH 1RAMA 5B4MD 4HPYL 3HMWL 4GMSL 1KJ3H 3RDTA 4GRLA 5TF1L 4KROD 3JVGC 4PGZA 4HCRA 3P40A 5GS3A 4PJBA 1F8TH 3NPSB 3DSNA 3LEXB 4L8BA 1T5WB 3OKKB 3D6GA 1I8KA 5I8EB 3Q3GA 4BFBD 2UWEB 4U6VL 1L4IA 3D3VA 4NQCD 4X4XA 4PB9L 1RZJL 4MDIB 3QPQC 4MSWB 2F15A 3IAQA 5IVZA 3RHWF 3CDFA 5DJ2B 1NQBA 4YZFE 5IEKB 3B9VA 2CQVA 1KEGL 1EA9C 2JB5H 1RIVH 4OZFA 5E6IA 4OM1H 2I9TA 1YNTB 3MRLB 3GHBH 2YPLA 3PL6D 4DVBA 1R3JA 3EOAA 2JB6B 5FXCH 1RVFL 3KPOA 4GAYA 4R7DB 3RVTC 4R90L 3UTTA 3MLPA 2Z92A 3C6SA 1E4XI 5HHQA 2V5TA 1FAIH 4XPFL 2DQEH 3GBNH 3QCUL 2IAND 3WFHB 1NSNH 1IARB 3D1MC 3QZWB 4NWTL 1FSKC 5E5RB 3TH4T 1I3VA 1XF2A 3LV3B 3QJHA 2I60H 3RGVC 4P4KD 3G04A 4DKFL 5CP3A 4PV8B 2WBJA 2R4SH 1HKFA 3LIZL 3BYYA 4KKNA 1WIUA 2R56L 2Z93A 1LEGB 2Q6WA 2H6PA 4WJ5A 3RWEB 2B2XL 5KSVA 2O61A 1ZVSA 4KHXH 3G08B 4HF5H 3FN3A 5JZ7C 2EO9A 2VB5A 3DURB 2QQLL 1VACB 4OLZH 3V6OA 3ZYIA 2PO6D 4KDTA 1SJEB 2Q8AL 4DEPC 4NDMB 1FORL 2IWGA 5BQ7A 3OZ9H 4NQEA 2A0LD 1NLBL 1F4YH 4ONFH 3TCXA 3NTCL 4WU5A 4OZGE 1OLZA 2MCG1 5HI5D 1X5YA 2AEPH 4BZ1H 4LU5L 3OXRB 4TTDD 2VWEC 5D93C 1WISA 2D7TL 4L4VD 5FB8A 3HPLA 5C08D 3P30L 1A7PL 4FQHB 3WNLA 3R06A 1ZANL 1U8HB 5CP7B 4JRXB 3G6JA 3A67L 3MRGA 2VXTL 3Q5OA 4OBRA 3FAXA 3VRJB 3BQUC 4X6DA 1I85A 4MAYA 3QCTH 3MLSL 3HR5B 4XMLL 1YPZA 5EOCL 3JV6A 4OCYL 1TZHB 5EWIL 1EO8H 5GSRB 1IQDB 5DJ6B 3VFGL 1D5IH 4OKDA 2P5WA 4O2CA 2DQJH 5CGMA 4H1LG 2X10A 2Y06L 1A9EB 1WSST 5D7KD 3WIIH 1G7HA 3MACL 5DF0A 5HSFA 1QRNE 4UDUA 4PJ5B 2KUTA 5ICYA 3BP7B 3GSUB 4NSKB 3LN9A 3GSQB 1JV5A 1G7IA 1I9RL 5I15L 2FB4L 2HYMA 3E6FA 4KU1A 4MNHA 4WI3A 3U30C 5AG9A 2VSCA 4PP2A 2XQYG 4Y2DD 1Q38A 4WO4B 5ECJE 4PJ7E 4U7SA 1WITA 4RA0C 4OFYA 5D2NB 4YFLI 2R39A 4WVRA 5F9OL 3BYTA 2YPLE 1VCAA 32C2B 3IDIB 3O9WD 4QYOB 5E7FA 1EFXD 1QFWM 3UTSB 4ORGB 1A9EA 1B88A 2XG5A 4S0SD 3NA9H 3QFJD 1I1FA 3OWEA 1LK3H 5IWLC 4Z76A 1QLRA 5KVFL 3ARFD 1KJ2B 3QIWC 5JIPA 1MCSA 4RX4A 4ONGH 1UKSA 3RNKB 2E9WA 2WUCH 2VABB 1MFCH 4M5ZL 1OTSD 5JORA 3GO1H 1D6VL 3VXQB 2C3HA 4PYGA 4P2QB 1X4YA 4HIJB 3P9LA 4NZJA 3W9EA 5DC9B 4JDVA 4DCQA 1KN4L 2O26U 3GMQA 2Y6SC 2HFEB 3L3OA 3EDFA 2FWOA 5E5MA 1OT1A 4RNRB 2VLRD 3QDJE 4R3SA 1TVBA 1XGYH 3DIFB 3K8KA 3TH2T 4EOWL 4ZFFA 3GRWL 1BVKB 3GMPB 2LAGB 2V5MA 4BKLA 4HIXL 3AU1A 3JXAA 4XWGH 4WY7H 3OR7B 1WCBB 4MA1B 4G6FB 1QA9A 4LCWE 4GRWB 3FRUA 2HT2C 3GJFB 4EUPG 1Q9OA 1WBZA 3CFCH 4Y5VA 1QBML 2XWJA 4TPRH 5T1KD 2HRPH 4X4ME 4FQ2L 2IH3A 2NY0D 5HI3D 2FB4H 4G9FE 4QRPA 4PGCB 5LAXB 3ARVA 3TYFB 1B0WA 3VWJC 3FB5B 3Q6GH 5I9QC 4KQ3L 1XF5A 4JGJA 2ZUUA 1YMMD 3BW9A 3UYOD 1TIUA 3GSOB 2I5YL 1J12A 2HT3C 1QPPA 2YS4A 3RQ3A 4N9OB 4TSBH 1PKQE 4JFYB 1MAJA 1SJEA 3HE7C 2LVCA 3I85A 1UGNA 1I7TB 5IHUL 3N50A 3WDHA 4AMKL 4HBQA 3RDTB 1MCQA 5ETUB 4XBPB 5EWIH 1Q9LB 4XRCA 4CJ1A 3SCMD 4XP6L 2F5AH 1U8MA 3QCVH 4HWBL 2CDGA 5CD3A 4Y4HA 1Q0XL 5FO7B 4MX7B 2FJHB 4PB0H 1JL8A 3IJHA 3DX6A 1MFNA 5BMFH 1UZ8B 3WO4C 4NQDB 4YLQT 3HZVB 5DJDA 4NWUL 2Q7NA 1IL1A 3C5ZD 1CG9A 2OYPA 4F57H 1MVUB 5HD8D 4JDTH 5C9JB 3ULVC 5CBEA 3SE3C 1PY4A 3N9GL 4OZFB 2FZ3B 4ZS6D 1CDIA 1QPXA 4NRYB 1MSPA 4RAUB 2MFNA 1KENL 5IQ9A 1YQVH 5GSRA 2GJJA 5DHYB 4ZNEE 3CPLB 1A6TA 2APBA 2JB6A 3UO1H 3EYVA 1UQSA 4X9BA 3MJ6A 1AHWC 4KFZC 1MI5D 3P0YH 4XPAL 5EH1A 2Q7YA 4HD9A 5EUKA 2P5WE 4M43L 4N8VG 5D93B 1P7QB 4EBQH 1IEBB 4YBQD 3DVIA 4UNUA 5CWSB 2VNCA 5CEZE 3LIZH 5F93C 1CFQB 4U2ZA 1NCTA 1D6EB 4PJXA 4E41A 3EJZC 4KY1L 3VD4A 3BISA 1FJ1A 4MVBC 4LKCA 2NMSA 2XZZA 3MLWH 1F5WA 4U3HA 5DUML 4U1IB 4BM7A 3SY0A 2K1MA 3ARYA 3EDJA 5DLMH 2AJUH 3OKEB 4CJ0A 2HVJB 2VR5A 3BDYH 5IIEB 3MODL 5ALCH 1JYXA 3BP4A 4ZFGH 3D39D 4HGWA 1NCNA 1AIFA 2NY4C 5HJ3B 1ZLVK 3MLZL 4TN9A 4Z7UF 3VDBA 2QADD 4P46B 4QXGL 5EOCJ 3PJSB 1QO3B 3P9LB 1VEMA 4P49A 1RK0B 2JKXA 4JFPA 5C3TA 1MREL 3L3OB 3BAEH 5E5MB 5E5UB 4BH7B 4J23A 4GAJH 4XVSH 3SY0B 3LKQA 3W5MA 1Q94B 2F53E 1T1XA 3ZKSD 3BIKA 1NGWB 4JN1H 5F7UA 3MOQA 5CBAB 4NOBA 3MRBA 3CZFA 1KLFA 4U05A 1R3HB 1IC4L 1BQSA 2IGFL 5IF0A 3NA4A 5ANMA 1VEPA 4MYWB 1SJXA 5D6CA 1X5FA 1NGXA 1XMWA 5EIIA 5AD0B 4YDVB 4OQTH 1HEZA 1UA6H 4LFHD 1CFTB 4PJ5A 4DK6A 2Q20A 4LASL 1OGAB 3ISWA 5L9DH 3G5ZA 3PWNB 4FQXD 3ARDB 2J8UE 3CNKA 1PVHA 5KBNC 3LN4A 2YN3A 3MLRL 2AABH 3HTLX 3MROB 3U0PA 5I16A 1UM6H 3L3GB 4KJQC 3ZE0E 2LAAA 4OLWH 4JFFA 4MB5A 5T33L 5EN2B 4GQPH 1WWCA 4G6MH 3TPKA 5DGRA 1P6AB 3AC0A 5KZCB 5D5ME 1FV1B 1A7BA 4RAVA 4K7PY 2DQUL 1E28B 3G9AB 4ZS6C 2B5IC 3GSNB 1Q72H 5EBLA 2W60A 4XCNB 4L5FL 4GKOA 1AC0A 5HI3C 1OGTB 5FYKL 5L0QC 3BHBA 2CR6A 4WUUA 3VXSA 4MNGA 1CN4A 1UYWL 4HUXA 3SKMB 2YC1B 1AGEB 1QFOA 5TQ0L 4C57C 5JZ7D 4XI5D 4OZ4A 3CGTA 5ERWB 4YQXL 1YN7B 3MLXL 2V2XB 2NX5D 1ED3A 1QLFB 5I0DA 1A7OL 1BD2A 1IGFH 1E4WL 2YRLA 4GJTB 2XFXA 3MLYH 1F13A 5FUCE 4UOW1 3GK8L 4LNVA 3K2UH 3QPXH 3QG6A 1K2DA 2NY7L 1MCKA 4U6HB 3EJJX 3OX8B 1UWGL 2DQIL 4XZUB 5HDBE 3U46B 4HKJA 2P24A 1TZGL 4UNVA 1LNUB 2R4RL 2ZJSL 8CGTA 4K7PL 4K9EC 5TGBA 3AM8A 2PXYB 4I0PC 1DBAH 1G7LB 5HJ3A 4LF3A 4P57B 3JV0A 4MB4A 2Y1VA 2AP2A 2HT4D 2LQRA 3NCEB 5ELIA 5DRZB 4F7CB 4V1DD 3FT3A 4PPTA 5FV1L 5C6WH 3SKMA 5BRZD 1ITCA 2O5YH 1U58A 1A9BB 4EI5A 3OB0H 2EEAA 4HWUA 5KN5A 2KKQA 1X4XA 3FFCA 1E6OH 3LOWA 5ENWB 2HFGL 4L9LA 5SV4A 5GS1B 5EZIL 5GS0L 3TV3H 2CIIA 3HI5L 4JRWA 5H94A 4QT5B 3QDMA 3GUTA 2BC4A 4XBGA 1IGJA 4JPIB 1VFOA 3L7EB 4PRPA 2ITCA 5KSAA 2ZOKA 3RUGA 5T3ZL 4LLQB 1OP3H 1ETZA 1U93A 2P8LB 3VDAA 4YE4L 2HTLC 5C0AB 5F7NC 3ZYZA 5BVJB 4ODTL 1LP9F 4NN6B 3MNZB 3VU2A 3TO4D 3QO1A 4KRMB 4G9FD 4LIQE 1PEZA 1CICC 4JFFE 3HNSH 1X7QB 2R4RH 1E4XH 3RVXD 3TP4A 5JPNB 1LO4L 1HQRA 1OTSC 5B3JF 2W9DL 4L29B 4XP5H 2OL3H 1YMME 4HAFA 3UC0H 3LPWA 3S3PA 1NCCH 4NRYA 4JZOA 1R24B 4PP2B 5GRJL 3EGSA 4PJGE 5IQ9B 5FYLL 4W4OC 1RZJC 5JOEA 4X4YA 4MD5A 3V4PL 3DBXA 5C0ND 43C9B 5ANMB 1IGJB 1OTUD 2OTUB 2AKRA 3KPNB 4FFYL 5FUOL 1XR8B 4MWFB 4PG9A 1EFQA 7FABL 4KMQA 1TQCB 4XVJH 5E8OB 5I8CB 2VDOL 3DNKA 3MFFB 4PJ9D 3DXAA 4QXWA 1Q72L 5DYOB 4I2XA 1FDLL 5FKPA 4AT6A 1O7SA 2DS4A 3PE9A 5LXGH 4R26L 1GC1H 4YC2B 3ULVE 1URLA 3GM8A 2XYCA 1BJ1H 4L3EA 1E4KC 4EXKA 2X09A 2OZ4A 2WQRA 4QRUA 5DD3H 4AEFA 4MCZB 1MNUH 2CIKA 4U1GB 1GZQB 1CDUA 3U7YL 5J13B 1X3DA 4CADB 4PJXF 2YMXH 1LILA 4ZO7A 5D7LD 5I2IB 3FN0L 4MA7L 4YUEH 4ZSOB 3HAEG 3L5IA 4E0RA 2G75B 3WV0A 1CXIA 5IK3B 2IAMC 4LBEB 4HJGA 4S1RL 5LGJA 4IRSD 5F88B 2F8OA 3V8OA 1XR9A 1QRND 4L9LC 1U2CA 5DSCB 4KKAC 1WC7A 1HIML 3PV6B 3CUPA 1MAMH 1FYTE 4I5BB 4JN1L 1FLRL 3X3GH 4FHBD 3BZEB 1M7DB 3SGEI 4FRWA 1ZWIB 1TPXB 4YHZH 4TNWK 1IKNC 2E7MA 5I1AA 2ADJA 3BN3B 1AO7B 5C8JA 3EYQD 3B8YA 4ZD3L 3T3MF 4XC3H 4ENED 3FO1A 2OQJB 3LKRB 3IU4H 4JPIA 4LVHB 5J0BA 5I1LA 4MXQC 1UKQA 4XX1E 5D72H 3C08H 4GBXC 5DVOA 4CRPA 2XY1A 4MAUL 1HXMA 3OAUL 4MX7A 1HILA 4QY8B 1SMAA 1EXUB 4YPGA 4IIQA 4PRDA 4S1DC 4GMTL 1RZFL 1UM5H 5DZOA 4D9QD 1B0GB 4PJGB 3MYJA 3MV9D 3R1GL 2AI0H 3VXRA 4NO0B 3RAJL 1HSAA 5IG7B 1ZLVH 2BVOB 3SDXF 4U33A 3ZDXF 1EAPB 2EDTA 1A14H 1BJ8A 3D18B 5IMLB 1BZ7A 1VGKB 4S10A 2QQNL 3BD3A 2GTWB 2W91A 1A6TB 4M3KB 2WWKT 4P2RB 4HIEA 1WTLA 5BVJA 5JUEH 1K4DA 1QEWB 1PYWA 4YX2H 1IEHA 4OCNC 5MEOA 4RA3A 2R8SL 2Z0BA 3RPKA 2F74B 4Z8FL 5BW7C 4JVUA 2APXA 3DV6B 4GQ9H 5E4EC 1BBDL 1G6RA 4UTAH 2BVTA 4Z7VE 4ZFOA 1JWSA 1IQWL 3VFWB 3VG0L 2IF7A 5FGCE 2ITDA 4X6BB 2YC1A 5T3XE 4NKDB 1FZKA 1RMFH 2ZG3A 1JK8B 1F4XL 5D5MF 3QISA 1U8KA 2RHEA 5EU6A 4WV1B 5MENB 3QWRD 5DHVH 5CINH 4PJDF 5IGXL 1S3KL 3TT1L 1A1OB 5T1LB 1N59B 1NBYA 2Y07H 1J7VR 1JNJA 1B0RB 1G7MB 2VC2H 4ZUWB 2EDLA 2FLRT 2E6PA 4WW2A 4I2XB 1AIFB 4N1CA 5BZWB 1RULH 3V6OC 4K71C 3SDAD 2LVEA 4BQBA 1EMTL 1KBGH 3AM8C 1OCWL 1VFMA 2X4UA 3OKYA 1F6AB 4E9LA 2VZ1A 4Z18A 4JQXA 5DDHA 4JPKL 4ELMF 1MCEA 2VXSH 4AG4H 4MQ7A 1NFDE 2VQ1A 4DN3H 3FZUC 3STBA 5E7BA 2P5EE 2P44B 4PLKD 1KSRA 5CFHA 5IW6B 5I74B 1DLFL 5IW1A 5EUOA 5TDOB 5TPWL 3MO1A 1SMOA 3THML 4XGZB 2E9IA 3GSVB 4S2SB 5E9DD 5KVMC 4ZO6A 3MBXL 3NCYP 4XVUC 1KTLA 1M4KA 3G08A 1H5BC 4YFLF 5IJVA 4LLUA 1UVQB 3OKLB 3U0TA 3RL2A 4UT9L 1UFUA 4P2QE 3JWDC 4KRPB 5IV2A 3VJ6B 5C7XH 1RZIA 4O51A 3HA0A 2UUDK 3WJLA 1WF5A 3FONA 4NQXA 1TCRB 1AD9A 3C60A 2ZUWA 4ZUUB 1OARH 5I66B 3KS0J 4PP1D 4JG1L 1XGTB 1NFIA 2IQ9L 4PTUB 5D2LA 1CLZL 4LKXA 4OFVA 4RWYL 5E2WH 5K9JH 4EJ1C 1T4KA 5ADOH 2PTUA 3BZFA 1A7NH 1MCIA 4M7LT 3KYMA 3QIWB 3C6SB 3HB3D 4LNRB 1HI6B 1BM3L 5IEKA 1KTLB 4KHTL 2EIEA 3PQYE 4RWHA 4J3WA 4CGTA 5K9KA 4GBXA 3MNVA 2VKXA 1AI1H 3CDCA 5TDNA 1IQDA 5DJ6A 4DWHA 3GBML 4YGVA 4OCRH 1KCVL 1DUYA 5IROA 3G6AA 4CMMA 5JXAL 5KSBA 3MV8E 3TIDA 4PGEA 2DWEA 4X8JA 1Z3GL 1HWGB 3SPVA 1FO0B 1KPRB 5I73B 2V5SA 4X8XA 1WIOA 2O61B 4G9FA 4MLIA 5LG1A 2R29H 5EU6E 2R1XA 1QSED 3LQAL 2OXHA 1GJIA 3N0PB 5L6YH 4AEIL 1KPVB 2FGZA 1BECA 2FGWH 3MRFA 2NY2B 4WUUD 5IESH 4HULB 3G5XB 1YECH 3MJ9L 3LQAC 3G04B 3WHE0 1LE5A 2HRLA 3LS5H 1KELL 4NUJA 4DGVL 4OZIB 3QR2A 5GJSL 2RIKA 4HMCA 4F37F 4YR6A 4R4ND 1FNGB 3KPQA 1LEGA 4FOMA 1KTRL 3FJTA 4JG0H 4LDEB 4LCCC 1YNLL 2R2BA 4ZXBA 2VXVH 3RWGA 2EYRA 4TYUA 4OLXH 4M8QA 1WFOA 4EN3C 4CVUA 2J1KA 2PYFB 3L5WB 3MA9H 4G5ZL 4CVXB 4LF3B 3OTTA 1RZKC 1YY8B 2FNBA 2EH7L 5E2TH 3FO0L 2G60L 1BMGA 3GFUA 5A2LH 4WW2C 2DIAA 4HC1L 4F7EB 2NY5H 4ODWA 4QHLB 3MZTA 1MY7A 3W9EB 1MI5E 3OAZK 4Y4KC 4JLRA 3HZKB 2NLJA 3BEWB 3IFPA 3SO3C 4OLUH 1JPGA 3BZEA 2VAJA 3UP1A 3PUCA 2ZCHH 4KVCH 3TZVB 1RJYA 3VWJD 1BGXH 3U0WH 3JUYA 4QXTB 1WEJH 5CJOL 4GW4A 3IFOA 5I1KH 2VDLH 2EC8A 3QWOB 3JBG7 5KS9A 4Y1AA 1OSZA 4JHBA 2EIZB 4YWGH 4FABL 4PJEE 3AS1A 3FQTB 1L6XA 1MPAL 1SBBA 4ZTPH 3ZDYF 1INQB 4MNHB 1I7TA 3GM0A 4V1DE 3UTTE 3WIHH 2ADIB 2GI7A 2GT9B 4QHMB 3JUZA 5AUMB 4K55A 4TRPL 1QSFB 3L7FA 4N5ED 2VR4A 3P11H 1WAAF 4UDUB 1NCDH 25C8H 3BPCA 2AXFA 2AV7A 1ADQA 3HUJE 3PQYB 4XC1H 1RURL 3PWPE 1CXLA 5JOFB 4K23H 5CJ5A 1G7IB 3BDXA 2CKBA 1DN0B 4WU7A 4CUCA 5L7XL 2RR3A 5FKAA 3MRJB 4N0YH 1DQML 2AI0L 1HINL 1KJ2L 3WSQH 1ZLUH 3QJFA 4WCYL 1QNZL 2HKFH 1KPUB 1XIWD 2D4FA 4WEBL 4UQ2B 2OP4H 4APQC 4FTVD 4L8SA 2WLYA 3QUXB 3TVMA 1WBYB 4HHAB 5INDB 3J8F7 4IRZH 5EO0A 5C0IA 1JRHL 5BJTB 2FJHA 3QCUH 3SQOH 3TBWA 4HKZB 4Q7DA 4RCAA 4YHIA 5GGRB 5DC4B 5EOTA 4DVRL 1ZT4B 4S1DD 3VI4E 3RWJB 3U1SH 1T5WA 2J4WL 3LKSB 1ZS8B 3BN9D 4BQ9A 1GGCL 4I3SL 3ULUE 1EVTC 2BVEA 3PXHA 3UAJD 4NO5B 3G5XA 2DQHL 4PP1C 2HFFA 3EUUA 4KK6C 2B20A 4CMMB 1NBVH 4L3ED 4AQOA 4XNUL 2GUOA 2K3TA 2R2HA 3UTZB 1GGTA 1NC4B 2OZ4H 3ZKQD 3VXUA 4LIQH 2GJ6D 4MA7H 4PY8I 4YUEL 4ZUSB 5FECB 4PTTA 3Q1SH 5E8PB 3H0TB 1M6OA 3IU3A 2FSEA 2XWJB 4LPWA 4QHKJ 5IFHH 3VFTB 3ZDZF 5E9DA 4LEXL 1EAJA 3TJEH 5E94B 5HVWA 4OI7A 3U4EB 3CSPA 4BZ2H 4JM4H 2AJVH 3L3HB 4FQCH 1U8JA 1KYOJ 1Q0YH 2P42B 2NY6D 2N4IA 3C5SA 2KDGA 1CLYL 4LCYA 1QD0A 5BXFB 4XB7A 5F6HI 5I1AB 2HN7B 1ORQB 1BFOB 1WUNT 3LD8B 4KQ4L 5CJOH 1W0YT 3VD7A 5C0GA 3JVGA 1INDH 4Q0XL 3ULSB 3VGAC 1JP5A 3FONB 1I85C 1LDSA 2F5BH 3SGEH 1AXIB 2VLKE 4GLRH 3IFNL 3H3KA 1CXHA 4LSTL 5I1EH 4POZD 5BO1H 5IF0B 1OTTC 5IW3A 3IDYB 3O3BB 5DR5H 1NAMH 4M02A 3WO4B 5FYKE 1IM3A 4PRPD 5KJRH 5HYQA 1JMXA 1OF2B 3OKKA 3V5KA 3IKCB 5F1IA 1PLGH 5DQJB 1EJOH 5FYJL 5JDSB 4BELD 5EC2A 3HE7D 4PRBA 2CJUL 4F33A 4FMFA 4YHML 4QHUB 1PZUB 2BRRH 4OFPA 2R0KL 5DJAB 4OFKA 3INUH 5B22A 3ARBB 5DT1L 2BY1A 4PRID 5L2KA 3BPLB 4GAGH 3PWJB 1A7RH 4JRXE 5B8CB 5L6YL 3TVMB 4JPVH 4RAVB 3RVXC 5BS0D 4NRXA 4TUOA 4YHIB 4P4RB 3OSKA 1OSPH 3BO8A 3CLFH 2CRZA 2UUDH 4KAQL 3U6RA 5IOPA 1LEIB 2DMBA 2R23A 2GYSA 3NIGE 3BH9B 2DAVA 1VEOA 5I1JL 5GIRB 4O4YL 4PYHA 1NUNB 5J11B 1X5KA 1EHLL 4HJJL 1U6AL 4XP1L 5IB5A 4MXQD 1FVEA 1S7UB 4XCYA 3DRTB 3HB3C 3MPCA 4JFFD 2XQBH 5A3ID 3B2VL 3CSBA 1UH2A 2VLJB 3IXTB 3MOAH 3V95A 1S5IL 2Y36L 3VRLF 3A6CL 2J3SA 1LDPH 4JHAH 4FQJL 2CUMA 4UIKL 2ZJSH 4N1HB 5T3ZE 3DX9A 1KB9J 1A1MB 3WFBH 5B4MC 3LRSB 4YDJB 4MQ7B 3MRBB 4KJYB 3QEHB 3RWHA 1OY3B 3CFKA 3MRKA 2EZ0C 2ADGA 3QBTB 3QUYB 1VSCA 4G8GA 1Z9SA 4JLRB 2YSSB 5TDOA 2WMPA 3FFDB 3KYOB 5GRZA 4OM0H 5ITBL 2QL1A 2YD2A 4P2YA 5FYJD 3ZHKA 2H6PB 1FL6A 5HYIA 1T04B 1W72B 2AK4E 5GGTL 4LCYB 1OW0C 2XACC 1JWMB 1LO3L 4NKIL 4Y16D 4P2OD 2EDRA 5T5NG 3RBGA 5D2NC 3MUJA 1E27A 3FZUD 3I6KB 2B1HH 1G7QA 4J4PA 3MV7A 4G7YL 2FCBA 3MGTB 2BP3A 3QDGE 1DZBA 1YEGL 4KKLC 3SDXA 2BOCA 1RUKH 2J8UF 4ALAH 3HI6H 1DFBH 4B7LA 4PY8J 3FN9A 1ZTXL 2W0KA 2OBGA 1NMAL 2O5ZL 4MGXA 4KKLD 1OAZL 4IMKA 5EU3A 4NC2B 1TTGA 2IPKA 4WO4D 3RWDB 1CICD 3CFIC 3GMRA 5LBSL 1R3LB 1FNFA 1K8IA 3GSOA 1CD0A 5DK2B 1UZ6F 4YC2C 4Z7NE 2UWEE 3LKOA 3SGJA 2Z31B 4XCFL 4KTDL 4LGPB 3OG4B 3X11B 1EGJH 3RA7H 3G6AB 5KSBB 1ED3B 1QLFA 2P47B 4RMRA 4H1LH 3GIVA 3V4UL 3O3BA 5L0QB 2AXGA 4L8SC 2BERA 1UJ3B 2VZUA 4OZHB 3B2UC 4PJEF 3RVWC 2BZDA 3L3IA 3SJVA 1JHKH 2IMNA 3QDHA 2E6QA 4MZ3A 4R2GB 1ZT4A 4MB3A 4OCXL 1EPFA 1HQRB 3TZVC 5HYQB 3D85D 3QEUB 1MLBB 3E3QE 1BZ9B 2J8UB 4IRJD 4Z7OE 1AY1L 1U95A 4P4RA 3F7VA 2AQ2A 5D1XB 3U36B 3KWWB 2BVYA 2VIRB 2NW2B 2DKMA 4KK6D 5ESQB 3ZTNL 2JCCA 5KVDH 1OD9A 3FB6B 1CF8H 3LN5B 4OGYH 3S96B 4LRIA 3PGCB 5E4IA 4HH8A 1KC5H 5FOBB 5D8JH 2NR6C 1J8KA 2I9LA 5JW4N 2HKFL 3B83A 3MLZH 1YC7A 1U8OA 1MFBL 4P2RE 5CGYD 1QLRB 5B3JE 2NY0B 2BXYA 4XPTH 1FO0H 3SDDA 3D0VA 1G9NH 4YAQB 2WINB 4NJAH 3CVIH 5GGRY 2J8UA 5JW3H 5E94A 1YMMB 5SWSE 3RY6C 1HZHH 4PRHB 2XZCH 1I7RB 4BH8B 5TE4L 1WICA 1PQZB 3VFPB 5GS1C 2CDFB 3X14B 1JTPA 5F7FA 2EECA 4MA8H 4NQUA 4OCSH 2YD3A 1GGBL 5JPNA 3FOLA 1V3JA 1V05A 5GGQL 3SCMB 1TVHB 5DQDH 3DARA 3P0VL 4WTZG 4PJCA 4YDJA 1JHLL 1FQ9C 1NGQL 1QFWL 4P46C 4N8VB 1F3RB 1IKFL 2A77L 5DC0A 2P5ED 3C5JA 2FO4A 2FL5B 2NXZB 4LCCA 4LRIC 4S1RH 2DYPA 1DR9A 1N4XH 4YO0B 2ZUYA 1YN6B 4XBEH 1RHHB 3WLWD 4JO4H 5FO7A 1X5HA 1G7HB 1YYLH 2EDOA 4GG8A 4JHAL 4ZOCA 4IOIB 5EPMA 2XZCL 2VQTA 4U3XA 4M48L 5LBSH 1BD2E 3A6BL 3ZT7A 4EUPB 1G7QB 5MERB 4KKAD 3DBXB 1RSFA 5EU5A 1FFRA 3FO9B 3L9RA 3T4YB 1NMAH 1JGUH 1FZOB 2C3VA 1UH4A 3PP4H 3QCVL 3PDGA 3PWPA 3BP5B 2B4CC 1VB9A 1EZVX 4BFIA 3WD5L 4BQ6A 3NMEA 3K4DA 4UINL 5MEOB 4AH2A 2BFVH 5GS2H 5F9DC 3LB6C 1D9KA 4HFWB 2EDEA 1BF2A 3WFZA 5DVLA 1KNOB 2WW8A 3UMTA 2C26A 4OF6A 3D18A 2APWA 1BZ7B 5FCSH 1AJ7L 3EAKA 3O45A 4U6XA 4XB8A 3VW3H 2PYED 5FYJU 2PO6C 3CCHB 3U7WL 3BFOA 3QXAA 4HT1L 4JVWA 4NUGH 1JPTH 1MCWW 5J11C 4JY4A 2RCSH 1I8LA 5IMMA 4NN5B 4LPTA 3IGAA 2ZUTA 3UC0L 1DBJL 4HFUH 3QQ4B 4XH2B 1ZHLB 3QULA 5TE6L 2V7HB 3CXHJ 5DJXB 2D7QA 1ZA6A 1SM3H 4G6AC 4J3SA 3KWWA 4ETYA 3O6FA 3GKWL 4KZDH 5KS9E 5ESQA 1UXWA 1MJ7L 4PGJA 2NQCA 4HXBH 3J7HA 1DBKH 4PBWD 1U8JB 4P2OA 4NP4H 5ADOL 5DMGD 3WUZA 5IW6A 3MRRA 3HI5H 1T0MA 3KPSB 1XF5B 4S2SA 1P5VA 5DK0A 4KTEL 3U7WH 3BKJH 4Y5YC 4JFDE 3O8XA 1B2WH 4ZSOE 1R3IH 5A3IC 1IC5L 1OAXH 1ZGLA 1FH5H 1UB6B 1V7ML 4OSUL 3WFDL 4BUGA 1R3HA 3BKYL 1NGZB 5DT1H 3IDYC 2R1WA 3MCKB 2DBJA 4W4NA 3ZDXE 3WNKA 4HUWA 1J8HA 4KMTL 5BVPH 3EJZD 4KK8C 3X14A 1DDHA 1ZGLM 3F7YB 3RIFK 2OI9B 2F53D 3DO3A 1EEQA 3FT2B 2ARJA 4WHCA 4YDLB 3LKQB 1H3GA 5JOPE 1QVOA 4AG4L 3QUZD 3A0OA 3B9KA 3QNXA 5JLZB 3MX0A 1AGFB 3CSYB 5E2JA 1IFHL 1XEDA 3VDCA 1KN2L 1PKQB 1OTTD 1RULL 2EIDA 4KDVA 1DBBH 1ZT1A 3F65A 5DEFA 4PJXE 2VXUL 5DMIH 5DFTA 1HCFX 4RAUA 5K9KB 4JFDA 3BVNB 3KHOA 5DR5L 3W39A 1CGSH 5C0BA 4AM0A 5HHPB 5B8CA 3QEGL 4O2FA 1S3KH 5IHZA 2X1QA 4U1HA 4XMLH 4ZFOB 3UJJL 1J1PL 2UVFA 2W38A 1U41A 2AJ3A 1KIRB 5E00A 3TWCL 1AGDA 2VXTH 4NKMA 1L6ZA 1MCOH 4CNIA 3D0LB 2VIRA 1FPTH 1ZSDB 2XKUA 1CLYH 3LEYL 2VLKB 3QRFM 1S9WB 1TENA 3S5LB 4MNGB 5T33H 5FM8A 3DUHA 5HGDB 3MOBH 5FK9B 4J1UB 2J2ZA 4Y19D 4LEXH 4FMKA 4GAGL 4KJWC 3V6ZA 3IETB 4RRPA 1BOGB 3L3DB 1XCTB 4K23L 3IJYA 5K59E 3DX9B 5DD0H 1BQHB 1YJDL 1Z6JT 3IDXH 4FP8L 4JCLA 4TVPD 1UA6L 1U0QA 2Z92B 1EFXB 5HI5C 4Z9KB 4N0UA 5CJBA 4NKMB 1DL7H 1QYGL 1Z0NA 5IMKB 4AIOA 1J18A 1H8SA 1SY6A 3E2HB 2BNRA 1D7FA 4HS6A 2H9GB 1UG9A 5D8JL 1KB5H 3KPRB 4H88H 3IFPB 5CD5C 1U58B 2Q3ZA 2P5EA 4D0BB 3QUZA 3QULB 1W0VA 2DRUA 3ALXA 1QHOA 1BAFH 5CUSH 4P3WA 1LD9B 4R4NC 5FUZL 4C56D 1YY8A 4PREA 3FQRB 5CEZL 4KTYA 5F1OB 3CZFB 2WQ8A 3H7BA 1J0JA 1J88A 1DQQA 1IAKA 3RZWA 1Q9WA 4E0RB 4LCWA 1C08A 2VSDA 1CGSL 4EI5C 1DQLL 1RHHA 3BN9C 1K6QH 1QSFA 4HUWB 4FFZH 1XF1A 1A21A 3WUWG 4HCRH 4JM4L 3ULUF 2ESVD 3UPRA 1I9JH 3ARGD 2A9ML 3TJEL 1K8IB 2VXVL 4X6EB 3DGGA 2BSTA 2G2RB 4FNLL 5IROC 3K2MC 4DW2L 1FIGL 1NEUA 2ATPA 1L9NA 3T65B 1U93B 1S7RB 4QOKA 1ES0B 5IB4B 1CLOH 4MQXD 4YBQC 3NIDE 4POZC 4LIQL 3TIDB 3V6FA 1HH9A 4UDTA 5IVXA 1F4HA 4NBXB 4N90D 5C07B 3ZYOA 4LSSL 4ELME 2VJXA 4GLRI 3SPVB 4UTBL 3H7BB 1OOAA 3BSZH 4KZEL 1T0NB 3FT4B 4KUCD 3BD4A 1FV1A 1J5OH 2DM4A 3QDGA 4NZUH 3O11A 2EXWD 4F9PA 2HFTA 1H15B 4LLVB 1ZEAL 3FO2A 4MA3B 2NY1B 2N7BA 1CGYA 3TCLA 1TCMA 3AREA 4JZOB 4Z77A 3DHJA 3T0DA 1V5JA 2OXGA 1I1AD 4LKCB 2CO6B 4WIQA 1T3FB 1TJIL 2AEIT 3QZWA 2AK4A 4GO6B 3FB6A 4GW1A 3QQ3B 3IRZA 1LO3H 4NKIH 4EDXB 4JY4B 3S5LG 5I8OH 3VXTA 2E7LC 4XVJL 1DQDL 5EORH 5FOBA 2Q3AA 1MJ7H 4D9RD 1UT9A 4W68A 4PJHF 1J8HD 1YC8A 5I75C 2GUOB 4RFNC 5IM7A 3WIHA 2XN9B 4QHKI 1KB5L 5CILH 3VFVA 1ZXQA 4QXTA 3H9HB 2KPNA 4X6CE 4F7MB 3QUZC 4ODXB 4LLMB 3SCMC 1MI5B 2VDPH 5D7LA 3KJ4B 4PTTB 4U1MB 3V52L 5J6HA 1B90A 1FZJA 4PS4L 1TPXC 4J2XA 2PW1A 3E0GA 3C8KA 2V9RA 3RGVD 1YNLH 4FFWC 1DLHA 1DN2A 4KV5F 4LCWD 2HFFB 4KJPC 1JVKA 4IM8A 5E56A 2AK4B 3WS3B 2NYYD 4WGVB 3TZVA 1MFEL 1JGLL 5KVGL 3FQXB 4ENEC 1QSEA 3P11L 2YWZA 5KSVB 3ARFC 4GSDL 1T1XB 4CU6A 1IM9B 4GKZB 1I4FA 4F7TB 4X7CC 2FWOB 4K3GA 5EU7C 5A2JH 4Q9RL 5CIPA 4JQIH 3IJSA 2PETA 1BJ1J 2XY2A 4ZUWA 3TH3T 4GFTB 1BVKA 1JGLH 3V0WL 5CP3H 3RZCD 2EDFA 5FM4A 1F97A 1REIA 5IB1B 5EZLB 2HRPL 1KT2A 1FBIH 3K81A 2Z8SA 5HVHC 1WBYA 2AV7B 4HHAA 2ARJB 5INDA 5FB8B 3I6GB 2UYLB 3PWNA 5LQBH 4DKAA 3VA2C 4QRRA 2M8XA 3WS6C 3VWKC 4NKOB 1FNAA 2XTJD 2EE3A 3RVVD 4X6FA 1JZ7A 4OCWL 4XPBL 1SYVB 3GMLB 1DQDH 4LCUB 4N0CC 1S9XA 4Y19E 3RL2B 2X9YA 5SWZA 4FQLH 3GMMB 3P0GB 2ED8A 3VRLE 1NCAH 2EDJA 5GSVB 4NQXB 1KGCD 2Q86A 1MFCL 3FMGL 3CDGA 5GGSB 2Q8BL 3HE6B 3TESA 1RD6A 4GW5A 1XGUB 3H9SA 5CSBA 4ZQKA 1BD2D 2D0FA 2P43B 1HSAB 5IG7A 2NX5A 2DWDB 2DIJA 5FF6B 5BO1L 5GGQH 1JV5B 5FKPB 3QIBD 3D87B 4OIIH 4D94A 4LSSH 3LCYA 4LNRA 4Z77B 1N64H 4M62H 3C8DA 4YBLB 1SYSB 2R0LL 2VABA 1GSMA 4B7IA 3O2DA 4XCCL 2G5BA 2YN5A 5HYJA 1T20B 3GSWA 4GW1B 4UINH 1N5AA 4X7DC 4URTB 4U1JB 3MFGB 4DN3L 3FOMA 1JIBA 1WT5A 3FMGH 1A6AA 1BFSA 2A83B 5IVXE 5C1MB 4N5UA 2ZUXA 4O2EA 1ZA6B 1NLDL 4MDJA 2PXYA 4EN3A 2FSEB 2DLGA 2W9LA 3RUGE 5BRZA 3ZLQC 1I7ZB 3MRIB 3ARRA 5IBUB 1DQJA 2VH5L 1A1MA 1KEML 3OBAA 1Z5LB 2DLIA 3QXTA 2E27H 4OGYL 4QRRE 3EYSL 4Z5RB 2D7MA 2D7PA 5I8KL 3FFCE 1BWWA 5C71A 1E6JH 2BHZA 1LQSR 3OXRA 3OJMB 2EDDA 2IH3B 4L4TA 3MLSH 4OQTL 4P59H 2YUWA 3QDMD 2A74B 3LS4H 2DM7A 3UTQB 1PAMA 3IDUA 2YK1H 4M6NH 2W9EL 4JY5H 5J1AA 5C0CA 1HHIB 5DMYA 1OARL 3EYQC 1QA9B 4IMLA 4Q9BA 1AD0A 4NQSA 4K2UH 5EZOH 4ERSL 1VENA 3C8HA 4GQ9L 4XHJD 4HGWB 4L3CA 1LO0L 3C8KB 1RZ8A 2W9EH 4JY5L 3TYGH 5C0DA 4ODSL 1C08B 4OF5A 4NYLA 3MGTA 2AK4D 2K9UA 1F6FB 4JPWH 1MREH 4PJIF 4EI5D 4IRZL 3RI5K 3HHRB 3C9NA 3T0WA 1WWAX 2E27L 5JLZA 4TSCH 3NCMA 4AQ1B 2DL2A 5IV2B 1RZGB 2NR6D 4MXVF 1ZE3C 5F9WC 3D2UA 3RZCB 1MVUA 5FGSA 2AS5M 43C9A 2EDXA 4N0YL 4GKSB 4I13B 3VRIA 3ARBC 1MCFA 3WN5B 5D1ZC 3NIDF 4KXZH 2C3XA 3P3YA 4QYOA 4QHMA 1MCJA 3O11B 3D39E 6FABL 4TRPH 3DVNB 5D7JD 3MSPA 4EQ3A 3VFSA 3D0LA 4HV8A 3UJJH 3OR6A 3RDTD 1HHKA 3TO4B 5HHMB 2NX5B 2NY3B 3QHZL 3CFEB 3HPJB 3ARUA 2AV1B 5F9JB 3BRFA 2FEDC 2Z31A 4JHZA 1IKFH 3MV11 5F3BB 3WXVH 1NBZB 1VKXB 5FK9A 1T21A 4IDJL 3TBTA 1A4KB 4Y2DA 3QUYD 2X44D 1J86A 3ZKND 3HUJB 5CEZD 1GGBH 3PIQB 3GMPA 1YJDC 1AR1C 3CU7A 3WHXA 3S96A 4RFEA 1FG2B 4MAYD 2W9DH 4H5SA 4ODBD 3C2AL 3QFDA 5C0EA 1DJSA 5F7DB 1MVFA 4GH7B 1I8LC 3WDIA 3MBEA 4PJ9B 4S1QL 2H8PB 3PV7A 4FNLH 1S9YB 1I1AC 1M05B 4JFOA 1TQCC 3B2VH 3KLDA 9CGTA 2OS7A 3UTTD 4HUUA 4AYFA 5BW7A 5A2IH 3H9YA 1G84A 4IOSD 1ZA3A 1JPST 3PHOA 1EO7A 3TBTB 2W07A 1IM9A 4GKZA 2XTJE 4P5TC 3MRHB 3UAJC 2MSPA 4TUKH 4LMQE 1YEGH 4DOHE 4KAQH 1SEQL 4ETQA 4HK3J 1MUJA 5J12B 5CEZH 1AKJB 3QG6B 2B0SH 4HK0B 4Z7OF 2PYEE 3BQUA 4YJZL 4KV5E 2DM2A 4E41E 1TVHA 3N85H 4HPOH 4HKJB 4X5WB 2EIZA 4TSBL 4I3RL 4ZUVA 1A7RL 1Q9WB 2MJWA 3VWKB 1J9CT 4NDMA 1KIUA 2EICA 4LEOB 1X5LA 3MLTA 4XWOD 3T3ME 3V7MA 1P2CB 1MFEH 2NZIA 5FUOH 3VFPA 1G9MC 5KSBE 2UV3A 1C5BH 2HH0H 3QO0B 3BJLA 4HUUB 4AY0A 4K2UL 5EU3B 1G7JA 5EZOL 1UWEL 2H26A 2MHAB 4ZUTA 4QRPD 2PTVA 1QRNB 1U8PB 3MCLH 1FVDA 4YHPB 1XIWB 4PBXA 3DX8A 1MJJA 4RMUA 4TPRL 2IANE 3O6KH 4HGMA 3QPXL 4PS4H 1QYGH 1XF4B 3MQIA 3L3KA 1N6QL 4WI7A 1EGJL 2P8MB 5CCKH 1FHGA 2WK2A 3OGOE 1NKOA 3GRWH 3L3GA 5I8KH 1GOHA 3NGBB 5DD0L 5F9AC 4CU8A 5I6XB 5KSAB 1EEYB 2ZCLH 2BHUA 2H3NA 4YXKL 1JJUA 4OB5L 1HEZB 1J0IA 4PJBF 4LSTH 3HC4L 3QDGB 3PGCA 4MMXC 4JFEE 3FO2B 4OGXL 3V7AE 4ZNEA 3SDCB 1CLZH 1S7XA 3RGHA 2YA0A 4AL8L 5CZVL 3RJDA 5I1DA 2LU3A 3NZ8A 4JZJC 3ILQD 2MCPL 4G43B 2VLRE 2HFGH 5HPMB 4IOFC 1A6PA 2GSIA 4RMSA 2ZCKL 3HS0A 4GKNA 1ITBB 2FR4A 5DS8B 3T0XA 5CZVH 1WIPA 5CSZB 4M7JL 3SO5A 3BSZL 4KZEH 2PO6B 5EUOE 2FIKB 3SDDC 4Y4FB 2R69H 1J0HA 2ZSVA 4JZNB 5D2NA 3QYCA 5LVEA 5B38G 1YA5A 3V5HA 4MNQE 3VXSD 3T0EB 4M5YL 2J7LA 5D1QB 1YEHL 3G6JF 2CGRL 4W6YB 1I7ZA 3NFNA 3PHQB 1XZ0A 1HSBB 5E1AA 3K2UL 2FD6L 4NRZB 1FSKB 3OKOA 3SE4A 3U6RB 2V2XA 3PL6B 1YEIH 3MLUH 2YD8A 1NBVL 3MACH 4DOHB 4BH7A 1L7TL 3HS0B 1SVCP 1K3ZA 3SE9H 5C07E 5GIRA 1JRHI 1ODAA 5CKAA 4NQVB 3NH7H 1I1AA 1GHFH 1CD1B 4ODUA 3DMMC 1WLHA 4ODTH 4YNYA 1QFHA 3ECBB 5FECA 5T1MA 4RNRA 1P5UA 1CTOA 2GTZB 5GHWL 5HD8C 1IGCH 4I3RH 5DA0B 1NDGB 3ILPB 1EBAA 2B8OT 3OKNB 1GVIA 4QNPF 4I18C 3I50H 2FBJH 3L6FA 2WAHA 4POUB 5EZIH 5GS0H 2V7NA 1MAKA 1ZVYA 2NW3B 4ZXBC 1FYTB 1JCKA 1IGTB 4OLWL 3L7FB 3U83A 2YSSA 1T0MB 1AGCA 4PRAA 1HINH 4RMQA 4L8BB 2O5XL 3R4DA 2W65B 4A6YA 1QSVA 3P77B 3GNMH 3INUL 3V5KB 2BC4B 4PRIB 1XGPB 3U9PH 3BGFB 1Q9KA 1DBAL 2VZSA 5CCKL 1MRFH 4WW1A 3O45B 3I6LD 3KPLB 1J11A 2IG2L 5EA0L 4AENB 4UAOB 1C5DA 3GSNL 3QNYA 1HH6B 3ZTNH 4ZFZA 3RY5A 1XGRA 5B8CC 2FX9H 1JYNA 5HDOA 3O6KL 3ULVH 2JJWA 2YPLB 3CDYA 5KJRL 1D5XB 1U8MB 3IVKA 4BSWA 4ERSH 3MTRA 3QQ4A 3KYKH 4MS8C 3FKUS 3VXMA 1UZ8A 4G42A 3VH8B 2XZQH 3GBNL 1ZT1B 4PJ8D 4YGAB 5GZND 3ARQA 4GT7A 1CU4H 3WUWA 4DVRH 4OLUL 2V2TA 1T89A 3BZDA 4J3VA 4R90H 2LU4A 4YHZL 1INDL 4Q0XH 4X7EC 5FGBA 2DQUH 1KB5B 4TSAH 1MAML 2AXGB 2EH7H 2OK0H 5FHBH 2IBZX 3ARZA 2GSGA 3S4SB 4S1SL 3UPCA 1G7LA 1DQMH 5JW5A 3IDNB 2Y5TB 3PHQA 4U1LB 4CW1A 2HTKC 3DHMA 1OB1B 5K9OB 4ZSOA 5F1KC 1OP5K 3IDXL 5DO2C 2YMXL 1H5BA 3QIBB 3STZB 2A74A 4CN4A 4PR5A 1F8TL 5JMOC 2FIKA 5DD6B 2J5LB 3TBYB 3VG9C 3QB7C 4X9HA 3S34H 2R69L 4KY1H 5CEYB 3CC5A 5M7QA 5IESL 3RNQB 5D1QD 3QDAA 1N4XL 5C92A 4JVPA 4Y1AB 3BT2H 3ARFB 1VFBB 3LQAH 4S0TD 3QUZB 4JFXB 3QUML 3VCLB 1TITA 4NQEE 1FG9C 4DEPB 3MRGB 1U8OB 4KK5C 1JUFA 4PBVC 4RFNB 4LPUA 4JFDD 2BNQD 1G7PA 2F8VA 1S8DA 5DRWA 3VXME 3BZ4B 1W0WA 2WINA 5HYFA 2GITB 2RB8A 2BOCB 3FCTB 3D39A 3CH1A 5L2KD 2H9GA 1IAIM 3BGFC 4MMZC 1RJZB 3DMMA 1RFDL 1HILB 3BAEL 1XIWA 4QY8A 3QQ9C 2UZIL 4NC1C 3EOBA 5D7SH 4JFEA 1JI1A 1J1XL 1ZWIA 3HFMH 3MRJA 5LGKA 2L7UA 3GSVA 3TJHD 3QA3A 5DTFA 2X4NB 5HHNB 5LQBL 1DEEA 4K7PX 3DVFA 1DP0A 4XPTL 4NT6B 5AAMA 1NCCL 1EHLH 3ULVL 5JIIA 2ATPB 5T3XH 2UZYB 4HKBA 4KRLB 5I1JH 4JG1H 1N8ZA 3S35X 3HNSL 4IIQB 3RX5A 4LLDB 2F54B 3VFSB 4NM8L 2NY2D 1F42A 3HNVL 2OJEA 1RJZA 4FQIL 3GSXA 2IQAB 1RQ5A 4XP9H 1Y18A 3EFFB 4OSUH 2PXYC 3EDEA 1V7MH 4KKBC 3PQYD 3DJ9A 4GRLD 3JV4B 1FFPB 3IS0X 3KXFB 2WP3T 3OGCB 1LO0H 3RHWK 2B0SL 5MERA 4C58B 2YR3A 3HZYA 3T77B 2V2TB 5EU5B 4LMQI 1JFQL 3FFCD 3N1MC 2VDLL 4NN7C 5GGUA 1NDMA 4OD2B 2EEBA 4M7ZB 3U0WL 3D2UD 1CD8A 43CAA 3UBXG 4Y16A 1PFCA 4C4KO 3UO1L 1MLBA 4NP4L 1KBGL 1S7QB 4D2NA 3DIFA 2VDPL 2F54A 4RIRB 1P9MC 4X6BA 3MREB 2HMID 5BOZG 5FA4A 3F12B 4E41B 4CL7A 1T7XA 4HH9B 4M48H 2W59A 4NHUA 1ADQH 2HAZA 5C09E 1U3JA 4APQA 1J1XH 1SM3L 1D5IL 5A40E 3VXQA 5FGBC 5EORL 2J8HA 4U1IA 1DLHB 1JHTA 4X7TA 5MI0B 4I2XE 1A3LL 3VXOB 3VXPB 3WL9B 4RGMC 4NUJB 5JIKA 3O4OB 4OLXL 5F8QC 1J1OL 2J12B 3TF7C 2F5AL 4OQTA 4KQ4H 4WW2B 2VOTA 4PRNA 4RZCA 1LD9A 4XVUD 4U1MA 1CDHA 3BPOB 4Q6IC 4P23A 5TQ0H 4DGVH 3V0WH 1TQBC 4I1NB 4EQ2A 5DMKB 1F11B 1F6AA 2LFGA 4PJCE 5J6GA 1DQQB 1IAKB 3CMGA 5I6XC 4XNMB 4R4FL 3WFDH 5DRXB 3E1F1 1LWRA 3VFMA 3MGAA 3RVUC 4XNZC 3HKFA 3RIAK 4LCCB 5E6ZA 4FQIH 4MD0A 1QLEL 5ICYB 4N8CH 1NGPH 3IJHB 4KHXL 2MCPH 3ARTA 1H15A 2VZVA 4QRRB 1MJ8L 2NY2C 1NAKH 4X6CF 1IL1B 4RISL 3PDOA 2L7JA 5T3XL 5K59F 5IB4A 4NO3A 5H94B 1PYWB 1JGDB 3EZ8A 1K6QL 3V6FB 1MQ8A 3GHEH 4OCWH 2PTTB 3REVA 2VC2L 1V3LA 4NT6A 4EIGB 5L2KB 1AE6L 1ZKAA 4FQXA 2VL5A 1NGXB 3VFGH 2D9CA 3BGAA 3MRQA 1H3UA 4PJ7F 1LMKA 1N8ZB 1GCFA 5ACZA 4LGRB 3U2SA 3T8XA 1VPOH 1CFBA 3GI8H 5FUZH 3QFJB 3BRGC 3RTQB 1UZ6E 1D9KB 1DDHB 4HFWA 1XGUA 2FJFB 1KNOA 3ET9F 3SQOL 5IKCB 1FBIL 1BZ9A 1CK0L 1NFDF 1TJIH 1RVFH 4P5MA 3TBVB 4IBLT 5DTFB 4OF8A 3X3GL 4WFHD 5CWSA 1CLCA 1FL5A 4HLJA 1GGYA 3NA9L 2XV6B 5ISZE 3VW3L 2F54E 2X4SA 1RUML 4HG4K 4L1HA 5KOVC 1QSEE 2ENYA 2YK1L 3NTCH 3BVNA 3VFUA 5IFJA 5L2JA 3QUXA 3E8UL 2HT2D 2VL4A 3DWTA 1RY7B 3L95B 1OGTA 4WFHE 5BJTA 1EIBA 5E8OA 4O2EB 2Q76B 1A14L 4TUKL 4Y89A 2VH5H 1MY5A 4JN2B 1MNUL 3OGCA 4F7PB 2VXSL 1H5BB 3QIBA 3STZA 2R56H 3WS3A 2QEJA 3WIHL 4J6RH 3V52H 5HHOB 5C0NC 2CLZB 2DICA 3DSFL 1TQBB 4EKXA 4KROC 4DVBB 5E6ID 4FQQB 4UBDD 3OKEA 3OKDB 1XCQA 2OK0L 4XAKD 3SKOA 1UENA 2EDKA 1I75A 3ALWA 3SKNA 1CE1H 4XPFH 2EH8H 5E6IC 1BOGA 1X5GA 3MRIA 3MR9B 4LSRH 1XCTA 1CDYA 1LE9B 4Z7VF 5GHWH 4WFGD 2ESVA 3DURA 1EHAA 3WN5C 2JF1A 4UUJA 4OAWA 1CE1L 1ZGLB 1XF2B 5D9SB 4FFYH 4ODHH 3T4AB 2ZUQC 1ZEAH 2I27N 3UDWA 1JPGB 4XPAH 3EOBB 3NOIA 5HBBA 3KG5A 2Q8BH 1YEIL 3MLUL 1HHHB 2GCYB 4EZMA 5ENWA 1AFVL 2XXMB 1KXQE 5HTSA 3E6HA 4MLSA 5E2VL 1KENH 8FABB 2HN7A 3L7EA 3GSNH 1BF8A 3DUUB 2E7LA 3G5YA 3G6JB 1C7SA 4R0LA 2VMFA 4LLQA 1NMBH 4UU9A 4ZFZB 3T04D 3S35H 1KJMA 4LCIL 1I3RB 5IJKA 3FQRA 1FVCA 1A6UL 3NPZB 3CVIL 4ZAKB 3WLBB 2DD8H 4G8IA 1BEYH 3FT2A 1XF3B 2C1PA 1Q0XH 1NANH 2E8YA 1VFAA 1CTNA 4F9LC 5F6IB 3K3QA 4YHOH 2OR8A 4FXLA 4HJ0C 3TV3L 4FTVA 4ALAL 4BSJA 3X13B 3BE1H 1GGCH 3ME0A 1D6EA 4I3SH 2D9QB 4PJXB 1OF2A 5FOJA 2VLME 3VRJA 3C08L 3EO0B 4P5MB 1MIMH 5E8DL 2FBJL 1KCVH 3LKSA 5DQJA 4OCRL 1U8IA 4U6XB 3TWCH 1F00I 2VDOH 2I25N 2L0DA 4XI5C 3DX7A 4Q9RH 1Q1JL 2ZSWA 4O9HH 2C1OB 3EHBC 2R0WH 2F9BT 4K07A 1AY1H 3UTQA 5FO9B 5KVGH 3TBWB 2DQFA 4NBYB 3RTQD 1FLRH 4LQ1A 4LFHG 1AE6H 1UADC 1OPGL 2BNRE 2W60B 4IRSB 4U7MA 1B4RA 2DTMH 1XF3A 2C1PB 2APVA 2VXUH 3DVGA 5H35A 1UWGH 1B6DA 2DQIH 3SDAA 5HYSA 5ISZB 3GIZH 4K9EH 3E6FB 3OG6B 1AGEA 5KANI 3LV3A 3QJHB 2YEZA 4QF1B 2GQHA 5EBMB 4AIZB 5EA0H 4ZODA 4HSQA 1E4WH 1DVFD 4YBLC 3DTXA 4N8CL 1JK8A 3U9PL 2FDBP 3TJHC 1S5IH 2WM0A 4C56B 3WO3B 2IANB 2DIBA 1MHHB 3OXSA 4MQTB 3ZE1F 4FXKB 3EBAA 4GMSH 3V0VA 5JHDD 2F5BL 3HE6C 4J4PD 1FZMA 1EFXA 4M03A 1MPAH 3FAWA 4LP4A 1U9KA 4ODXA 5EG6C 4PD4K 2FL5A 3KHQA 1IEAB 5AUMA 4AZ8A 4X5LA 2NX5E 4UUJB 5IVOA 3O0RH 1W8OA 2Z9TA 4PGBA 4AL8H 4IHOA 5EBMA 4ZDHA 1XFPA 1JGUL 1P2CA 3HPLB 3KLSA 1IGCL 4OGXH 3QUKA 4I0KA 1F3DH 2GFBB 2KQMA 3MNZA 2OI9C 3QEQB 3N1PC 4J3XA 1P9MA 4OD3H 5D5MB 1JNNH 5C0GB 4I9WD 3ULVD 3NH7L 3A6OA 3VFRA 3UDWC 3I02B 4D9RE 3BQUB 2Y07L 3W0WE 4Z7UE 5JOPD 2A6JA 1LE9A 4X6EA 2NXYD 1CGWA 5I76A 4Y1AD 1CI5A 3RUGF 5F1NB 3VGGA 5TE6H 4I48A 3M07A 1N6QH 1F4XH 2NY6B 5KZCD 5BZDB 4JFDB 3W39B 1NJ9A 2OL3L 4HKZA 3OHXA 2NNAB 5GGRA 3MCLL 3TYFA 1S7VA 3W0WD 1KCLA 2Z31C 3DLQR 3DV4B 1FFQA 1NGQH 3EOYG 3WLBA 1YEHH 2JJVA 1BHGA 3DETD 5AYQA 3UEZA 3I6GA 4K71B 4NRXB 4G80B 1KTDB 1S7XB 2J4WH 1OAYH 4Z7WE 4FFVC 3SDAC 4YIQA 4UU9B 1NGYB 1A4KA 2G5RA 3C5ZC 3GMNA 2LTQB 4HPOL 1IBGH 4ZO9A 4P9ML 1FVCB 1NL0H 3NZHL 3ULUD 4XXDA 4MJ6B 4QXGH 1AGBA 3BE1L 2X89A 4KGJA 3SQBA 5JW3L 3MRDA 2ICES 2YHGA 1G9NL 1I1FB 1WAAE 3FHAA 3PP4L 5DJZB 2JJTA 4N0FA 2DD8L 1X5ZA 5HXMA 1N6UA 2AABL 4LLMA 1FRGL 5IR1A 4YXKH 5SWSB 1LO2H 2Q1EA 5L9DL 1RURH 5D7LE 3DUSA 5GQBA 3QEHA 4EDXA 1V8HA 4JFHE 1YYLL 1T5XA 1D5MB 4K7PH 3AB0C 5HGBB 1CL7I 1UQSB 5F3HA 2ICCA 2VZ3A 4L4VB 1T1ZB 3UCRA 5C0AE 3VFVB 3LN5A 1AKJA 5BCAA 4YNYB 1NC2B 4BFGA 4X5XB 1NFDB 4HLZH 4MQXC 5D1ZD 3I3BA 4D0DA 4XNMA 3FTGA 3WEXA 2WIIB 4OCXH 3KXFE 1RIUH 4YFEA 2VN7A 1CK0H 1WEJL 4CVXA 3OV6A 1IGIH 2VLRB 5MEQA 4GUPA 1OGAD 2PR4H 1J05B 1ZV5A 3N85L 4ZOAA 3BKCH 4F7EA 4I5BA 3B5TA 2JLLA 1MFDL 4FG6C 1QVOB 1R6VA 1RUPH 3DX8B 4KDWA 1HNGA 1M7DA 5T3XD 5HVGB 2BVQA 5D7KE 3NCJL 4FS0A 4QWWD 4WEBH 5E2TL 4TTGA 1CE6B 1RIVL 1J0YA 4JJ5B 4NWUH 4KKCC 4J6RL 3LKOB 3PG2A 4QRSA 4CU7A 3MODH 5ALCL 3ILQC 5ID0B 5FHBL 3O9WC 4JE4B 1BQLL 1P84K 3HMXH 1DCLA 4QRPE 3T8XB 4GS7C 5I1DB 5EZJA 4U1SB 3BKYH 2WBKA 3SDDD 1NH6A 3TVMC 4R4FH 4KI5F 4EVNB 1H0DB 4AIXA 1IAII 1R3IL 4LHUD 1GOGA 1IC4H 1RUMH 2GTWA 2BSRA 3MNWA 4OZIE 3U36A 4IDJH 3W0WA 4ODHL 1SYSA 4P99A 5C0BD 4JFHD 5TJWK 5BZDA 5DUBA 4GKSA 1YEKL 4RX4D 5JXAH 2NNAA 4OLVL 4Q58C 1N5AB 4N5EC 1HNFA 3GBMH 3WJLC 1A3LH 3LS4L 2QHLA 2E3VA 3ARDA 1TZIA 5IB2B 3BP4B 2YBRB 1Y6MR 1CR9L 3L1OH 3O4LD 4F57L 5FDWB 4HV8B 5J6HB 4AIZA 2C5DC 4Q2ZA 3CFEA 2G5BB 3QHFH 3ZL4L 5T1KB 3GGWB 5DZNA 3MJ7A 2DYPD 3KLAA 1PX3A 3WJJA 1QR1A 1KJ2H 4JRYB 1MFBH 1YZZA 2BY2A 2CXGA 1EX0A 4HWBH 3GBLA 1VKXA 5L7XH 1D5BA 3MO1B 1ZHKA 1ORSA 2CLVB 1CF8L 2X9WA 5BZWA 4XCNA 1TNNA 5DUMH 3E8UH 1JF6A 3VGBA 3EHBD 1TZIB 5CBAA 1OQOA 4DZ8B 3C09B 2YBRA 3FTGB 5ITFA 3MRNA 1MH5B 4GXUN 2X1PA 3O6FB 3OF6D 4Z7UB 4P4KB 5TPWH 1DVFA 5DRZA 1U8QB 3HRPA 4QGTA 5INCA 3SGJC 1AXSB 3P0YL 1I9RH 4Z0XB 3WE6B 1MCOL 2QADB 4CMHC 1YPZE 1RJCA 3G5ZB 1NFDA 3HNTL 5SX4H 4PRHD 1M71B 2KBGA 5I17A 5IHLB 1JUFB 1CDGA 4XNQA 2VZTA 3H9ZA 4L3CB 5C0RL 2P1YA 1K4CB 1RZ8B 2DQGL 1S8DB 3O3EB 4XCFH 4DZBA 4PJFA 3C5JB 5C0DB 4HK0A 1RJLB 2FO4B 2NY5L 5ESVB 1HH9B 4UDTB 5IVXB 4JO2L 2YKLL 3QUXC 2XZAL 4PJAA 4QO1A 3HRZA 1UB6A 1I1CA 1HYSD 2D31A 2VE6B 3AB0B 1NGZA 2D0GA 2P48B 1NLDH 1U36A 4R7NA 4K3JH 1XGQB 4ZAKC 2ZOLA 4J8RB 1IM3B 3F7PC 2UWEA 3HI6L 2FIRT 1IZKA 5GZOD 2CO7B 2DJUA 3WUWB 1DEEB 1JHLH 5MI0C 1OB1A 1QFWI 5K9OA 2C3VB 1BBDH 5BVPL 4L4TD 3VRIB 1DVFC 3DOSA 2QSCL 3S3SA 5T1LD 2FJGA 4RQQA 1FFNA 4XTRC 5GGTA 1FL3B 1IC5H 4PJAB 4N8PA 5JUEL 5GGUB 4KQ3H 5EOTB 4F7MA 1WFTA 1KLGB 2YD9A 4O5LL 1A6AB 3SDDB 1HXYA 4J3OC 3TIEA 5I8CA 2WIMA 3C60D 3GEWB 5HHQB 5DYOA 1F3DJ 2YEZB 4NFDA 4N9GA 2BSSA 3ES6A 4U7KA 3CCHA 4Y2DB 5JO5A 4ZOBA 4P3DB 2DQHH 3R8BB 2BNRD 5KW9L 1FLTX 1MELA 4OI8A 3EIFA 5C6PB 4FXGA 3QIBC 2AK1H 4Y2DC 5EO1A 3U0TB 5IGXH 1MOEA 1D5BB 1IT9H 1NSNL 2OL3B 5D7SL 2VQUA 3UYPA 1U92A 1RZIB 4K3HA 5I8OL 1CU4L 1FGNH 1JN6B 3VFOB 5TFSL 1S7SB 1KG0B 3V7AG 4HH9A 3F6IA 4Y19A 2OLDA 1HHGB 3S3JA 4HUKB 1MIEH 4PRPB 5I2IA 5E8EB 5T1KA 3KPSE 3RI5F 3TNNA 3CFKB 4U1KA 2D7TH 5FO8A 5F88A 1CZ8H 4JFEB 4M8VA 3QUMH 1J5OL 3LQZA 4PGCA 3CVHB 4HGKC 5JW4Q 5MEPB 3MBXH 4ETQB 2CIIB 3U4BH 4QT5A 4LOUC 1NMCB 3L5JA 3FO9A 1OVZA 3CSYA 2CJUH 2EXYC 2FEEL 1U91A 3O6FD 4JKWA 3HZYB 5E2VH 3EDKA 1KPUA 3S8WA 3IF1A 3RP1A 4XBPA 4UQ2A 2W0FA 1CFNB 2V9QA 4OD2A 2OJEB 4ZTPL 4U1KB 3V2AR 2E8ZA 4P5TB 5I0ZA 2HTKD 5FF6A 2VUOA 3B9KB 4R96B 4WU7B 2PW2A 1BP3B 4PV9A 2FJFA 3LRHA 3LH2H 3B9AA 1FDLH 3RX8A 1MFDH 5HY9B 3DGGB 1JNLL 1ZS8A 2OTUA 3AMLA 5K93A 1OP3K 2FR4B 3JTTB 1N6VA 1WBXA 1JZ5A 1NBZA 1UACL 1LP9E 3LH2L 4WTZA 5JHDE 1IGIL 1KTKE 2ARJQ 4YDKL 5AZEH 5DHYA 3CFJB 3BGMB 2CDEB 1XAUA 3D9AL 3O6FC 1F4WH 5ITBH 2Z93B 2GK0A 3PABA 3AS2A 3V4PH 3MYJB 5DQDL 4NZUL 4P23D 1DBBL 4PJCF 4NO0A 4F15B 2ZNWA 3BT2L 4W