3I9QA

Crystal structure of the triple mutant s19g-p20d-r21s of alpha spectrin sh3 domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
57
structure length
57
Chain Sequence
b'KELVLALYDYQEKGDSEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain
publication title The effect of a proline residue on the rate of growth and the space group of alpha-spectrin SH3-domain crystals.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 14
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2009-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3i9qA00
1OPKA 2JS0A 1X43A 1T3LA 2CH4W 2LJ1A 2J7IA 2L3QA 2YUOA 1PRMC 4X1VA 2L3PA 4FSSA 1JXOA 2DJQA 1X2QA 2DLPA 2D0NA 2HEQA 1MV3A 4Z8AA 1E7OA 1M3CA 3EG3A 3EHRA 5FW9A 2J06A 1CSKA 3H41A 1FYNA 4IIOA 1SRLA 3VS4A 1BB9A 3CQTA 5EC7A 2P4RA 2EVRA 1AD5A 2A36A 3O5ZA 3UATA 1CKAA 2AK5A 2BZYA 4J9HA 1MV0B 1SRMA 2SRCA 5IXFA 2RMOA 4LN2A 1AZEA 3RNJA 1YCSB 4JJCA 1W1FA 4DEYA 1G2BA 1KJWA 1I0CA 3VS7A 2LQWA 1QWEA 2OAWA 3I5RA 2RF0A 1X2KA 4RTWA 3VS6A 2JS2A 1WXTA 1JO8A 2KEAA 4OMPA 1UJYA 2EQIA 1K76A 1NG2A 3NHNA 1UFFA 2KR3A 2EGCA 1SPKA 5IHIA 1AWXA 2KE9A 3H0FA 1PRLC 3JV3A 2DX1A 1RUWA 2EYXA 2HCKA 2CT3A 2G6FX 4AG2C 2BTTA 2DL7A 2VVKA 3THKA 1WA7A 1UECA 3UA6A 1AZGB 1ABOA 1ZLMA 1U5SA 1QKXA 1Y57A 2FPFA 2EYYA 2J6OA 2DBMA 2K7AA 2VWFA 2AKKA 1I07A 1SEMA 3ZL7C 1VYUA 3SEMA 4CC7A 2DF6A 1J3TA 4RTVA 2K3BA 4Y92A 1XOVA 2K9GA 4JPBW 2PTKA 2O9VA 3EG0A 1WDXA 4RTZA 3QWXX 3I5SA 1BBZA 4Z89A 2CSQA 1UUEA 5I11A 1GCQA 2I0NA 4HVUA 1ZSGA 2FPDA 2KGTA 2ROTA 3ULRB 5I22A 2AZVA 2RQUA 4CC4B 2HDAA 2DRMA 1ZX6A 1JU5C 1JXMA 1UJ0A 2FRWA 1WI7A 2X3WD 1CKBA 2D8HA 2EGAA 2YDLA 3I9QA 4R0KA 4OMMA 4F14A 2MIOA 4RUGA 2YSQA 4OMNA 4Z88A 1H92A 1V1CA 4JZ3A 3VS0A 2W0ZA 2KXDA 1YWPA 1M30A 2RPNA 1H3HA 2A28A 3VRZA 1K0XA 2J6KA 5IHNA 3TSZA 2RQVA 2ED0A 5IH2A 4ESRA 1K4US 2DMOA 2J6FA 5FWCA 2HSPA 2JXBA 2M51A 1OEBA 2DRKA 1OPLA 2EPDA 2VKNA 1WLPB 2K6DA 4RTXA 3RBBB 1NYGA 2DL3A 3EG1A 4D8DA 1MUZA 2O9SA 2MOXA 2O88A 2MCNA 1VYTA 3KFVA 2BZXA 2O2OA 4J9GA 1X27A 4AG1C 4IIMA 3REBB 1YN8A 3NMZC 4J9DA 3H0IA 4LUDA 4OMQA 1SHFA 2ENMA 1T3SA 2L0AA 3PE0A 1QCFA 1X69A 1AVZC 3C0CA 1PHTA 1Z9QA 1GBRA 4CC3A 2YUPA 1HD3A 2L2PA 4KRTA 3M0QA 2K2MA 2NUZA 5IHKA 2FO0A 2GTOA 1VYVA 2D1XA 2EW3A 3NPFA 1HJDA 2K79A 2W10A 1TG0A 4JJBA 2EYZA 4HVWA 2YUNA 1QKWA 4WCIA 2F2XA 2DNUA 4AFSC 2LMJA 2A37A 1GBQA 1WX6A 1ABQA 2GQIA 2DL5A 1NM7A 1RI9A 2KNBB 2A08A 4D8KA 1M3BA 2RQRA 1YWOA 1GFDA 2F2WA 1M27C 1Y0MA 2KBTA 1UG1A 1QWFA 1VA7A 2JM8A 2E5KA 2DVJA 2HBWA 3GBQA 1TUCA 1GL5A 1EFNA 3UA7A 2OI3A 1PKTA 1UHCA 1AWOA 3EHQA 1A0NB 1RLPC 3IQLA 2JTEA 2V1QA 2CH4A 1NLPC 2SEMA 2EGEA 2YUQA 2LP5A 2FRYA 3M0UA 1JEGA 1WIEA 3U23A 1GRIA 2AZSA 2C0IA 4GBQA 3M0TA 1U3OA 4RTTA 2AKLA 2JMAA 2ECZA 3M0PA 2RN8A 4HCKA 2CUDA 3VS5A 1X6GA 3EG2A 1SSHA 1WXBA 2KRSA 1GCPA 4J9BA 2LX7A 1PKSA 1HSQA 1UTIA 3M0SA 2O31A 4EIKA 4AFQC 2CSIA 1WYXA 4J9IA 1PWTA 4CC2A 2DE0X 3FJ5A 4J9FA 2JMCA 4AFZC 2CDTA 4GLMA 4DEXA 1YP5A 1I1JA 4F17A 2PZ1A 1QLYA 2KRNA 3EGUA 1AWJA 2KROA 5HCKA 2DL4A 2DL8A 3H0HA 3PVLA 1N5ZA 2KYBA 1NEGA 2ED1A 2DBKA 2ESWA 5IXBA 1M8MA 1PNJA 1W6XA 3VS1A 1SHGA 2GNCA 4OMOA 1UGVA 4HVVA 2JW4A 2LNHB 1W70A 2LZ6B 3LH5A 4ZNXA 3TVTA 3REAB 2EKHA 1ZUYA 1GCQC 2BZ8A 4ORZA 3VRYA 1GFCA 2DILA 4J9CA 2LJ0A 2JM9A 2OJ2A 2B86A 4RTYA 5L23A 1U06A 1NYFA 2H8HA 1E6GA 2NWMA 4LNPA 2RNAA 2V1RA 1E6HA 2ROLA 2GBQA 4JJDA 4QT7A 1ARKA 4AFUC 2GGRA 3SHWA 3R6NA 3I35A 1M3AA 4RTUA 4E6RA 2LCSA 1TUDA 4LUEA 2CUBA 4JZ4A 4LE9A 2FG0A 2IIMA 1WXUA 1NLOC 2RQWA 2J05A 1LCKA 4J9EA 1T0HA 2X3XD 3TSWA 1NEBA 4K11A 2F2VA 2C0OA 2C0TA 5GJWB 1K1ZA 1B07A 2YT6A 1OOTA 2EBPA 2FEIA 2DA9A 5ECAA 1IO6A 1H8KA 2DM1A 3VS3A 1KSWA 2L3SA 5FWBA 1ZBJA 3VS2A 2KRMA 2EYWA 4M4ZA 1ZUUA 2D8JA 2LQNA 3A98A 2KT8A 2RQTA 1BU1A 3PVQA 1X6BA 2KT1A 1UHFA 2CT4A 1G83A 1UE9A 1B3QA 1AEYA 1AOJA 2QDLA 1AWWA 1ZUKA 2KXCA 2DYBA 1K0SA 3NGPA 2LJ3A 2PNIA 5GJVB 1K9AA 1UDLA 1BK2A 2M0YA 2XMFA 1JQQA 2ABLA 3QWYA 1KFZA 2GTJA 1FMKA 3M0RA 1KIKA 1S1NA 4F16A 2FPEA 1OV3A 4A63B 2JT4A 1T0JA 2CREA 1Z9ZA 1WFWA 1YNZA 4HXJA 2KYMA 4OMLA 1RLQC 3UF4A
chains in the Genus database with same CATH superfamily
3UT1A 5GAMg 1OPKA 1X43A 3TEEA 1OX9A 1IHVA 2ZPFB 1D1AA 1D0XA 1PRMC 3C12A 4F04B 2QEXA 4RKUE 2D0NA 2HEQA 4J6YA 1N9SA 2RHYA 3EGDA 1E7OA 1FWZA 2VASA 1VQ8T 5GAN3 4KUDK 1I5OB 2EVRA 3CCRQ 3M53A 2A36A 3O5ZA 2BZYA 4BY6C 4J9HA 1MV0B 1SRMA 2SRCA 5IXFA 3RNJA 1YCSB 1HYOA 2RJEA 1KJWA 3VS7A 2DZ9A 1R0CB 3RMQA 4DBQA 2VXFA 3EG9B 3O8VA 1YI2A 1AHJB 1OU8A 1D09B 4C0DC 3CCQA 2QG9B 2LC4A 1UGPB 1NG2A 2KR3A 4OVAA 3C94A 2Z0WA 1PD1A 1EZZB 2XD0A 1TU0B 2HCKA 4AG2C 2BTTA 5FRNA 2EQUA 1UECA 3X25B 1AZGB 4FL6A 2VUBA 1ABOA 2HKQB 5CKFA 1Y57A 2CS7A 2FPFA 3HSBA 2K7AA 2GFUA 3P8DA 4DQ2A 3OMCA 5GANe 1I07A 3CCRA 2XIDA 4CC7A 4BB7A 2GFAA 5GANf 1ZBXA 4Y92A 5A2QE 4RTZA 5GAN8 3JCMc 3BW1A 2DEUA 4Z89A 2XU8A 3MHXA 2KDSA 5I11A 3JAME 1WHHA 1M8VA 2DERA 1DJ7B 2KVQG 5I22A 4M7AA 3EGXB 2RQUA 4CC4B 2P84A 1UGQB 2IVWA 2FRWA 4M75D 4M7DA 4HA8A 2FZCB 2YDLA 3I9QA 4A54A 5LJ3e 3PT9A 2DXUA 4RUGA 1PD0A 3LX7A 3G7ZA 3CCSQ 3OYJA 4OMNA 3RMSA 4Z88A 3FJPA 1H92A 3P8HA 3VS0A 1Q82C 4C8QG 2QQ9A 3WXMB 5KYWA 3GNGA 2CZ6B 1Q86C 4OB2B 2X4YA 1K4US 4F7UA 4M78D 1N8RU 2JXBA 4IUQA 3HRSA 2VKNA 1K9MR 1BIBA 5AT1B 3RBBB 4AMCA 1Y96B 2MOXA 2MCNA 1VYTA 3TCJA 2O2OA 3DB4A 3F70A 1QCNA 1X27A 4AG1C 3PIOA 4OMQA 4J9DA 2MWOA 4QVZA 4N0AA 4B9WA 3PE0A 5KYUA 1X69A 2E3HA 2L2PA 3CXCA 3URGA 1KQSS 4M7AC 2COYA 2NUZA 3KXTA 1KC8U 2GTOA 3G6ET 4M7DC 2CGHA 4MDWA 1N6AA 2RK2A 2K79A 4ZN1A 2EAYA 2HAXA 2YUNA 4ANJA 2LMJA 2A37A 3OYLA 3CCSA 4XU3A 1PCXA 4BI4A 3OYGA 3JRZA 2QA4T 4EDUA 4BDYA 1BKBA 4ZTFA 4D8KA 2CP2A 1YJ9T 2FVUA 2QGGA 1YWOA 3X26B 5LJ3g 1Y0MA 1TSFA 1EX4A 4JDSA 1QWFA 3M4GA 2COZA 4D6WA 2DVJA 3OYNA 1GL5A 1YCYA 2QQSA 4FYWB 1IZ6A 1EFNA 2LT1A 2OI3A 3EHQA 3HKSA 2V8IA 2ZPIB 4N0AC 3FB9A 4DBHA 2K4YA 5HK0A 4XTZA 3SFMA 3V7SA 2R57A 1U3OA 1IGUA 4RTTA 3M0PA 4PJOC 2RN8A 1SSHA 3CPWA 1GCPA 4ZTJA 2EQJA 2LX7A 2E65A 1PSEA 2RK1A 3TREA 4M75A 2RM4A 2WACA 4J9IA 1MNEA 2CYZB 4J9FA 3UDCA 1VQMT 3HHTB 1RAAB 1YP5A 2NUTA 4EMKA 2OX7A 1TOVA 4F17A 2DL4A 2GCXA 5DLQE 1NEGA 1VQ4T 4M78A 3CBPA 5GAN2 4E47A 2LNVA 3VS1A 3E19A 2JW4A 3LH5A 2LZ6B 4PJOE 5A0LA 3VRYA 2DTOA 2RD1A 2F5TX 2LCLA 1WZOA 5KYXB 3G6EQ 1JJ2P 3M58A 1ZQ1A 3M54A 1KQ1A 5L23A 4YTLA 4DOVA 1M90C 2NWMA 4PFZA 2JNGA 2RNAA 2ZAEA 2V1RA 5A0GA 4JS5A 4AFUC 4A4EA 4C92B 2QA4Q 4M75C 5HY6A 1YITQ 1BI3A 1TUDA 1YJ9Q 4X34A 4N4HA 2J05A 1PC0A 3ZBDA 4EMKC 1YIJT 1SKUB 2NYSA 4V2SA 1NZ9A 4M77B 3WVDB 1QVFA 2K5FA 4M7AG 5GJWB 3LLRA 3CC7T 3QG1A 1B07A 1OOTA 4M78C 2CZ1B 4M7DG 5LJ3j 5FRMA 2DA9A 5ECAA 1WJRA 3PIPA 2DM1A 1ZA1B 1KSWA 3QDFA 2KRMA 4M4ZA 2HBPA 2KT8A 3EG9A 2KT1A 2QQRA 3E9FA 1G83A 1UE9A 1AEYA 2QDLA 1QVPA 1W2BP 3G6EA 2HZYA 4J5YA 2DYBA 5GMKj 2FB7A 5GJVB 4EMGA 1RAEB 2M0YA 3OW2A 1VQLT 4A4KA 1JQQA 4PLIA 1KFZA 1FMKA 3PGGA 1S1NA 4IUVA 2LVMA 3VUZA 2DXBA 2QA4A 5KYUB 1YITA 1VQMQ 1M1KR 1WFWA 1M4ZA 1YNZA 4E7SA 2JS0A 3LGLA 3UPUA 3V7RA 1JJ2A 4JRPA 3M56A 4J6WA 2YUOA 2VYTA 3GPLA 2ZPGB 2OTJT 1JXOA 4PJOG 1X2QA 4JUVA 1MV3A 4XK8E 3EG3A 4BDZA 2MWPA 2E41A 4PJOF 4MDXA 3DB3A 2J06A 1CSKA 2Y4XA 1S72T 1FYNA 3MP6A 5CKDA 5D6WA 4NL2A 3BFMA 1TS9A 3J7AF 5KE3A 4OMFB 1D0ZA 2AT1B 4DEYA 2CKKA 2DVEA 4LDYA 1I0CA 4XTWA 2OAWA 3X24B 1X2KA 1OZ2A 2MPXC 3VS6A 3CCLQ 2DXCA 4E7ZA 2YLCA 1JO8A 1VQMA 1NJIC 2KEAA 3S6WA 2DIQA 3I55T 3NHNA 3CC7Q 2X4WA 4RG2A 1YHQT 3P8BB 1M2OA 1AWXA 2KE9A 3M4YA 1Y96A 3H0FA 4E7JA 3JV3A 5DY9A 2D6FA 2M02A 4CRIA 2DX1A 3OYFA 3ZFJA 2IG0A 4FT4A 3THKA 1QCOA 1JB0E 4DOWA 1IHWA 4B6MA 2LRQA 4M75G 1U5SA 5J26A 4N4GA 4C92D 2J6OA 5GAOq 2AKKA 4QQGA 3A8LB 3ZL7C 1J3TA 1TXQA 3L42A 2XK0A 2COWA 3QPHA 2BIVA 1XOVA 4CI0C 3GF5A 2O9VA 4PJLA 4WF2A 1WDXA 4NOYA 3CEYA 4M77D 2QTVA 2EJFA 2VB6A 4M78G 4ZN3A 3I5SA 1BBZA 5GAN5 1QP2A 3L2WA 3CC4T 4HVUA 1ZSGA 2FPDA 2LTOA 3CCLA 2AZVA 2DRMA 2RHZA 1JXMA 1UJ0A 4PL6A 1VQ5T 2K57A 3CC7A 1IRXA 2D8HA 3CD6T 4OMMA 3JCMX 1VQNT 4F14A 3GOXA 2YSQA 2XDPA 1K8AR 5D6XA 1V1CA 5D6YA 5KH6A 2KXDA 1YWPA 4P5NA 1ZSZB 1D1CA 3VRZA 3MEVA 3TSZA 4BUGA 1MMGA 5IH2A 4ESRA 1Q81U 4LD6A 2HSPA 4C8QE 3OS5A 2EPDA 1OPLA 1OQKA 4PFPA 2K6DA 3CCJT 4RTXA 3JCMh 1NPPA 4OP0A 1JJ2S 3EG1A 4FW1A 1K9MU 1YFNA 2BZXA 3RKWA 4J9GA 3NTIA 3N5BB 2QXFA 3LGFA 4IIMA 3REBB 1YN8A 3M57A 3NMZC 4LUDA 2QQBA 4DBFA 3BDUA 5CKEA 1QCFA 2XG8D 1AVZC 5GAN7 3CMAT 1Z9QA 1GBRA 4HKEA 3HFNA 2YUPA 1HD3A 3I55Q 3PTAA 2CP5A 2L89A 9ATCB 2KMTA 4FYVB 3OSSC 4ME7A 1WHMA 2RHIA 3G1JA 2D1XA 1HK9A 3A8OB 1Q7YU 4JRQA 6AT1B 1TG0A 2EYZA 4HVWA 2K3YA 2F2XA 2DNUA 4AFSC 3EFOB 1ABQA 1C0MA 4IKFA 2DL5A 3CXCP 1RI9A 5FU7B 2KNBB 4JRIA 3L2RA 3JCMd 5KYXA 2F2WA 1M27C 1M2VB 3OMGA 4QQ6A 1BI2A 2E3IA 2KBTA 1UG1A 1VA7A 2JM8A 1N9RA 1R8OB 1W2BS 2YRVA 5GAOm 1PKTA 2JVVA 1UHCA 1AWOA 1A0NB 4DBRA 1QVGA 4R55A 3SDZA 4C0GA 1IGQA 2SEMA 4C92A 2EGEA 4OF1A 3CC4Q 3M0UA 3HTRA 3PMTA 4GLKA 2ZZDA 2FZKB 3S3NA 2DAQA 5CVIA 5GAOl 2AKLA 3CD6Q 3QIIA 2ECZA 4KBMB 4M77A 2RJDA 3OYAA 1VQNQ 2EQKA 2X9HA 2BKDN 2LCCA 1X6GA 3EG2A 3VYGA 1Q82R 2V26A 2GQVA 5J39A 1QQJA 1PKSA 3JB9D 4L59A 1Q86R 1KD1C 1I8FA 1UTIA 2DIGA 5CQXA 1VQ8Q 2RI2A 4EIKA 5LJ3f 4OB3B 1Q81R 1WYXA 3PMIA 2E64A 4CC2A 3FJ5A 4C8QF 2JMCA 3CCJQ 4AFZC 3QJ6A 1V29B 1QLYA 3CPWP 2KRNA 5GMKe 1K73R 2YWWA 2V8JA 3L2VA 2DL8A 1U1TA 3L2QA 4ATOA 4XU0A 3CCET 1MMAA 2QAZA 2ED1A 2JTFA 2DZCA 1YBYA 4MZTA 3LWHA 1SHGA 2WSEE 1MMDA 3QYGB 3CC4A 2QDYB 2MF2A 4BI8B 1KK7A 4M77C 1Q7YR 5D7UA 1TWBA 1NYFA 2DFUA 3CD6A 1VQNA 2GBQA 3TQ7P 1EIFA 3CCUT 1ARKA 5DM7R 3CCMT 1BCMA 5GANh 3ZEHA 3OS0A 4XU2A 2RHXA 2LCSA 3V7CA 4FM4B 4GY5A 1FXXA 2PUKB 1VQ8A 4LE9A 1M1FA 2YXYA 2HKNA 2IIMA 2RQWA 2C06A 3RR6A 2Y90A 1NEBA 4K11A 4O6JA 3CCJA 4B9XA 3AHUA 4PNOA 1IREB 3JB9J 2E6ZA 2EBPA 1H641 2E70A 5FWBA 1ZBJA 4QVDA 4BACA 4M7AE 3M5AA 5IAYA 4M7DE 1UHFA 1TUGB 1V76A 3EH2A 1QVFP 1SG5A 2CT4A 2F69A 1PSFA 3MJXA 1AWWA 3G4ST 3OYYA 5C0MA 3OQ5A 4XTVA 3HRUA 2DTHA 1K0SA 3NGPA 2LJ3A 2LX9A 2PNIA 2MMPA 1BK2A 2BE9B 5GANd 2ABLA 3QWYA 4F7UE 3ER0A 1VQKT 1OV3A 3QUIA 3JCMQ 5KYNA 4II1A 4C5HA 4E7KA 4QW2A 1RABB 5KCOA 4C5IA 3MP8A 3OSVA 5I2SA 1M1KU 3QSUA 3OW2P 4UC4A 2D0QB 3CCEQ 2CH4W 3JCMJ 1N27A 2J7IA 5C6SA 4FSSA 2QK0A 1VUBA 1TH7A 1MGQA 2X35A 3OYIA 4QKUA 1VQ7T 3L2ZA 5FW9A 3MKDA 4A4HA 4KGXB 4IIOA 1SRLA 3X28B 3CQTA 5EC7A 3VJPA 2P4RA 1N8RC 1R0BG 3R6OA 2EQMA 5DLOA 3BDLA 1WQWA 3JSCA 4IUPA 4JJNK 1OI1A 3CCUQ 3CCMQ 4HCZA 1AZEA 3QKJA 3ME9A 4XTUA 4JJCA 1G2BA 3VV0A 3LW5E 3I56T 2LQWA 2QI2A 3JB9I 2YRDA 5GAN6 4X9CA 1ZSZA 3MPUB 3Q1JA 2H3JA 1WXTA 3MEAA 3CXCS 4KULA 2V8KA 4Y28E 1KC8C 4ELYC 1UFFA 1SPKA 5A0DA 2XKOC 1XNIA 1WQ7A 5IHIA 4M77G 4Y91A 3CCEA 4OGCA 1PRLC 2K3XA 5M9OA 2OTLT 1AT1B 1KG1A 4M7AF 1TTHB 3S3MA 2DL7A 2DYIA 1WA7A 4Z02A 3UA6A 3MO8A 1YJWT 4M7DF 2HNIA 1X75C 1ZLMA 3G4SQ 4MZMA 5CK9A 2EYYA 5KCHA 1WHLA 1VQPT 3CPFA 2KSSA 4F7UG 1VYUA 2DF6A 3D7SB 1HXDA 4M75E 2RI3A 3CCVT 2R58A 4RTVA 2K3BA 4FIBA 3CCUA 1VQKQ 2OAUA 4F7UF 3CCMA 3EG0A 1ZSZC 3MP1A 4EMHA 2XDDA 3EFOA 2FZGB 2CSQA 2DJZA 1UUEA 3ASKA 4N4IA 1GCQA 1IB8A 1G3YA 4RMOA 2ROTA 1YJ9A 2E6NA 4BE2A 1ZX6A 1LPLA 1M2VA 4M78E 1WI7A 2X3WD 4KH1B 2ZPBB 1VQ4Q 4IURA 5CQYA 3CPWS 4JZ3A 1VQ7Q 2XHCA 2W0ZA 1KHIA 3LYIA 1M30A 4X9DA 1K8AU 3MEUA 5LL6S 2HD0A 1YI2T 1K0XA 2RQVA 1U1SA 2ED0A 3CCQT 2DMOA 2FYKA 2I2LA 3EH1A 4C5EA 4A4GA 1M1KC 2P0QA 3G4SA 3GP8A 1JBMA 1OEBA 1WLPB 4XU1A 1O9SA 5J3BA 1NYGA 4D8DA 1MUZA 2O9SA 2O88A 2M0OA 2L8DA 3I56Q 1Y71A 3OYCA 2RO0A 1VQKA 1NPRA 3QZ5B 3CBMA 5CKHA 1SHFA 1T3SA 2K2VA 2EKOA 1YIJQ 2BUDA 2RH2A 4KRTA 2XICA 3M0QA 1M1GA 2K2MA 5IHKA 2CP3A 2DEQA 2RHUA 2XDBA 3UWNA 2EW3A 3NPFA 2O01E 4JJBA 3VUBA 1WGSA 3E1SA 1QKWA 4WCIA 3GLXA 2E4HA 3DKMA 3CBOA 1VQ4A 1WX6A 3RDVA 3SWNA 1YJWQ 1VQ7A 5I21A 3JCMe 1D1BA 4Q5WA 1WNLA 1Y7XA 4TVRA 1VQPQ 4EPCA 5CR2A 3JCMf 1BI0A 1GFDA 1OX8A 2E12A 3C95A 5FU6B 4JS4A 5GMKm 5IT9E 4QVCA 4LDUA 3INZA 2CZ0B 3OYMA 3CCVQ 2EJ9A 4JRKA 4PJMA 1QVFS 1VQLQ 2E5KA 4M75F 3RKYA 5LJ5h 1TUCA 2EWNA 4IUTA 2LQ8A 4XQ3A 2L3RA 3UA7A 2CP0A 1RLPC 2V1QA 3NTHA 2YHTA 3MCAB 3I56A 1NLPC 2YUQA 2LP5A 5GAOp 1WIEA 1F1BB 3U23A 2HL3A 1GRIA 2F5KA 2BE7D 3M0TA 1YIJA 4J83A 4M78F 2JMAA 4OB0B 4HCKA 1OZ3A 3VS5A 2OTJQ 3FRNA 4J6XA 1QVGP 4XTXA 3OW2S 1Q82U 2KAFA 1UGRB 3SD4A 3M0SA 1RAGB 3CCQQ 1Q86U 2PQWA 3OYBA 2ZPEB 1WPYA 4ZGEB 2CSIA 1YJWA 1S72Q 3FIFA 4AT1B 2DE0X 3EFRA 5GAMh 2RJCA 4KGZB 1PM3A 2K5LA 2YLBA 1XQHA 5LJ5d 1VQPA 2CP7A 1B7TA 1G3WA 3EGUA 3FC3A 1D3BA 2KROA 4IUUA 3CCVA 1N5ZA 2NUPB 5IN1A 2F1LA 2KYBA 3JCMg 1VQLA 1FMWA 1K73U 3CCST 1PG5B 3H9NA 3QBYA 1X01A 3KBGA 1K8AC 3META 3SB2A 4RG8A 1G3SA 1KQSA 4HVVA 1W70A 4ZNXA 3A8MB 2EKHA 2BZ8A 4XTYA 2DILA 4J9CA 2HL5C 1KQ2A 2OJ2A 3J80E 4LD9K 1GXIE 1YHQQ 2B86A 3J81E 4RTYA 2H8HA 2E5QA 4LNPA 1P92A 2ROLA 4JJDA 4J8OA 2OTJA 3S3OA 2GGRA 3SHWA 3R6NA 1VIEA 4QQDA 3JCMb 5GAMd 2WSCE 4PJOD 3A5ZB 4RTUA 2CUBA 2FG0A 3HPWA 1WJSA 1U8RA 1WXUA 1YJNT 1S72A 2ZCFB 5CO7A 1T0HA 3TSWA 2F2VA 3LWIA 4FCYA 4BD3A 3OB9A 1LJOA 1C6VX 1H8KA 3VS3A 4ZGJB 2L3SA 2XI9A 2EYWA 3A8HB 1ZUUA 2H3EB 2WSFE 1RACB 1RI0A 3A98A 3PFSA 5LJ5j 1X6BA 4HCCA 4RCBA 3M59A 3GIBA 4J7FA 1B3QA 1AOJA 4KGVB 4KH0B 2A0FB 5GAN4 1ZUKA 2KXCA 1VQ5Q 3I55A 2X4XA 1OU9A 1YHQA 1K9AA 1UDLA 1KD1R 2XMFA 1M9SA 3M0RA 1KIKA 2FPEA 2EFIA 1VQOT 2MAMA 3E9GA 4OGEA 1IXDA 3G71T 1ACMB 2KQWA 1T0JA 4NS5A 2O4XB 5GMKi 1Z9ZA 1LVKA 4HXJA 4OMLA 4E7IA 1T3LA 3OY9A 2LJ1A 5L8RE 2B8AA 3CC2T 2L3QA 2M16A 4C8QB 1VOMA 4X1VA 5GAMj 2L3PA 3V8KA 3OA6A 1G5VA 2DJQA 2DLPA 3AT1B 4C92C 4Z8AA 3SWNB 1MNDA 1M3CA 2LT4A 1ZHIA 3CMAQ 1WHKA 3EHRA 3H41A 2P4TA 1Y07A 3VKIA 1XTDA 1Q81C 3VS4A 3OS2A 1BB9A 1NE8A 1VIFA 1AD5A 1FMVA 1X6OA 3UATA 1CKAA 2AK5A 1M90U 2JUFA 3WVEB 1VQ6T 2PVGB 1VQ5A 2QGFB 3OYDA 1SSFA 2PVDB 2RMOA 4LN2A 1K73C 1K9MC 1XJWB 1W1FA 4BE1A 4DA4A 3QHSA 1QWEA 3I5RA 4NL3A 1QMCA 2DPPB 2RF0A 1YJNQ 5GANg 2K5IA 4RTWA 2CZ7B 3QO3A 2JS2A 2KI7A 5KYYB 4OMPA 1UJYA 4RCCA 2ATCB 2EQIA 5FLXE 2HQHA 5KE2A 2DK3A 1K76A 2EGCA 2HQEA 4PJOA 3FEOA 1RL2A 3V8LA 4C92E 4BY6B 2EYQA 1Q7YC 4PKCC 1ZA2B 3FDRA 1UGSB 1RUWA 2MK5A 2EYXA 2CT3A 3QYHB 2G6FX 4A53A 2QYZA 4C0FA 4HCBA 1YITT 3JCMP 2VVKA 3CMET 3QZ9B 4M77E 1B34A 3QJYA 5LJ3h 2E1HA 3CMAA 4C0DB 1UEBA 1QKXA 3M55A 2DBMA 2VWFA 5I2MA 1SEMA 3SEMA 1D3BB 2ZPHB 3JCMW 1VQOQ 3G71Q 2K9GA 1RAIB 3EGDB 4JPBW 2PTKA 1UB4A 4C0ZA 5GMKh 1MMNA 3QWXX 3BY7A 1QVGS 2AHJB 2JJ9A 5CKBA 2ZGWA 2I0NA 2G3RA 1FX7A 4J7IA 1YJNA 8AT1B 2KGTA 3X20B 4WTOB 3ULRB 2HDAA 4HT8A 1JU5C 3CC2Q 1CKBA 2EGAA 5HK3A 3OYEA 4BE0A 4R0KA 3L1AA 4FYXB 2M1HA 2D9TA 2MIOA 4L5GA 1RAFB 3M9QA 2X4JA 3L2UA 5LJ3d 1H3HA 1C1AA 2PVOB 2RPNA 3H8ZA 2DKGA 2A28A 1N8RR 4A4FA 3C4SA 2J6KA 2VGMA 5IHNA 2HMAA 1BI1A 1H3ZA 3EFSA 2J6FA 4FYYB 5FWCA 5CAIA 1VQ6Q 2M51A 1M90R 2DRKA 2EJGA 4VUBA 2DL3A 2MI6A 4JLIA 3H6ZA 3KFVA 2FL7A 1VQOA 1WJQA 1WHGA 3H0IA 3G71A 4C5GA 1QW1A 2ENMA 2X51A 2A7YA 2L0AA 3C0CA 1VQ9T 1PHTA 1G3TA 4CC3A 1KC8R 3OYHA 2RI5A 4C92G 1BCOA 4C8QD 2EIFA 1NJIU 3V8JA 2DETA 2FO0A 2DXTA 5FU6C 1BYMA 4MMLA 8ATCB 5GANj 4C92F 1VYVA 4R56A 1HJDA 3CC2A 2W10A 2NUPA 2PU9B 1GBQA 3KUFA 1Q95G 3CMEQ 3DLMA 3VYHB 1MHNA 2GQIA 4FT2A 4M77F 4LXCA 3TU4K 1NM7A 2HSEB 5GAOr 2A08A 1M3BA 2RQRA 3CCLT 4O5VA 4M7AB 2JTMA 2GF7A 2DD5A 2MYSA 2E10A 4M7DB 3BE3A 1VQ6A 2HQXA 2QTXA 2HBWA 3GBQA 2M9UA 5EG2A 3A1PA 1G8XA 1W4SA 4MZPA 3IQLA 3T9NA 2JTEA 2QEXT 1LOJA 2JOYA 2P0KA 2CH4A 1I81A 1OYXA 5KYWB 4PJJA 2FRYA 1JEGA 4F7UB 2AZSA 2C0IA 5FROA 4GBQA 1R77A 2P0PA 2CUDA 4KUIA 1WXBA 2KRSA 2R5MA 3MEWA 4J9BA 5GAOn 3LH0A 1HSQA 4LDVA 2PUOB 2O31A 4AFQC 3CMEA 1PWTA 5LJ5e 7AT1B 1SF9A 4DEXA 2CDTA 4GLMA 4KT0E 1I1JA 1LNXA 5LJ5f 2PZ1A 3NFCA 4FSXA 3RUXA 4PJOB 1I4K1 3GNFB 1AWJA 5HCKA 4PK4A 3H0HA 3PVLA 1RAHB 4OB1B 5CCAA 2RA2A 4BI3A 4E2FB 2DBKA 4PJNA 2ESWA 5IXBA 1VQ9Q 1M8MA 1PNJA 1W6XA 2GNCA 2KY9A 1UGVA 4OMOA 3HP9A 3TVTA 2LNHB 1NJIR 4HT9A 3HL8A 3REAB 1B34B 1ZUYA 2VGNA 1GCQC 4ORZA 1WHJA 2O4XA 3QXEB 1GFCA 5FU7C 4ZGDB 1RADB 2QQAA 2LJ0A 1NBEB 2JM9A 3OBWA 3EGXA 2R5AA 1U06A 1E6GA 3CCRT 2VV5A 1E6HA 4L6V5 4C8QA 4LDWA 2YRCA 5GAMe 2OTLQ 4QT7A 3RERA 1KQSP 3I35A 5CIUA 1M3AA 5GAMf 4E6RA 4LUEA 3RKXA 4JZ4A 4ELZC 1NLOC 1LCKA 4J9EA 2QASA 2X3XD 3E2UA 2C0OA 2Y4YA 4E7LA 2C0TA 2VXEA 2IPOB 2JZ2A 1W2BA 1K1ZA 3JB9G 4E7HA 2LQKA 3OYKA 2QEXQ 2YT6A 3HRTA 2RJFA 2FHDA 4JLGA 1JRIA 2FEIA 1IO6A 4FW2A 3NTKA 5LJ5g 5HKCA 3JB9F 3RIRA 3VS2A 4FU6A 2DD4A 4M75B 3OS1A 2D8JA 3JCMV 2LQNA 3FLGA 1VQ9A 4PFOA 2RQTA 2LDMA 3QDRB 1BU1A 2L5QA 3PVQA 3OBYA 1M5Q1 4LDXA 5GMKl 1BIAA 2JN0A 2NUTB 4EMKB 3VU3C 5KYYA 2VC8A 2A3LA 2AIRB 2CP6A 2DO3A 1QP3A 4PLLA 3PNWC 3RESA 4C8QC 3EAEA 4M78B 3DLLA 2GTJA 4M7AD 5AYFA 1KD1U 2RB6A 4F16A 2KK4A 4MMKA 1O75A 3SWNC 2OTLA 4A63B 1YI2Q 4M7DD 3JB9H 2DTIA 2JT4A 2NLUA 2CREA 1I5LA 1D0YA 3HFOA 3A8GB 2KYMA 1KHCA 1RLQC 1OULA 4XAXB 3UF4A
chains in the Genus database with same CATH topology
1OPKA 2JS0A 1X43A 1T3LA 2CH4W 2LJ1A 2J7IA 2L3QA 2YUOA 1PRMC 4X1VA 2L3PA 4FSSA 1JXOA 2DJQA 1X2QA 2DLPA 2D0NA 2HEQA 1MV3A 4Z8AA 1E7OA 1M3CA 3EG3A 3EHRA 5FW9A 2J06A 1CSKA 3H41A 1FYNA 4IIOA 1SRLA 3VS4A 1BB9A 3CQTA 5EC7A 2P4RA 2EVRA 1AD5A 2A36A 3O5ZA 3UATA 1CKAA 2AK5A 2BZYA 4J9HA 1MV0B 1SRMA 2SRCA 5IXFA 2RMOA 4LN2A 1AZEA 3RNJA 1YCSB 4JJCA 1W1FA 4DEYA 1G2BA 1KJWA 1I0CA 3VS7A 2LQWA 1QWEA 2OAWA 3I5RA 2RF0A 1X2KA 4RTWA 3VS6A 2JS2A 1WXTA 1JO8A 2KEAA 4OMPA 1UJYA 2EQIA 1K76A 1NG2A 3NHNA 1UFFA 2KR3A 2EGCA 1SPKA 5IHIA 1AWXA 2KE9A 3H0FA 1PRLC 3JV3A 2DX1A 1RUWA 2EYXA 2HCKA 2CT3A 2G6FX 4AG2C 2BTTA 2DL7A 2VVKA 3THKA 1WA7A 1UECA 3UA6A 1AZGB 1ABOA 1ZLMA 1U5SA 1QKXA 1Y57A 2FPFA 2EYYA 2J6OA 2DBMA 2K7AA 2VWFA 2AKKA 1I07A 1SEMA 3ZL7C 1VYUA 3SEMA 4CC7A 2DF6A 1J3TA 4RTVA 2K3BA 4Y92A 1XOVA 2K9GA 4JPBW 2PTKA 2O9VA 3EG0A 1WDXA 4RTZA 3QWXX 3I5SA 1BBZA 4Z89A 2CSQA 1UUEA 5I11A 1GCQA 2I0NA 4HVUA 1ZSGA 2FPDA 2KGTA 2ROTA 3ULRB 5I22A 2AZVA 2RQUA 4CC4B 2HDAA 2DRMA 1ZX6A 1JU5C 1JXMA 1UJ0A 2FRWA 1WI7A 2X3WD 1CKBA 2D8HA 2EGAA 2YDLA 3I9QA 4R0KA 4OMMA 4F14A 2MIOA 4RUGA 2YSQA 4OMNA 4Z88A 1H92A 1V1CA 4JZ3A 3VS0A 2W0ZA 2KXDA 1YWPA 1M30A 2RPNA 1H3HA 2A28A 3VRZA 1K0XA 2J6KA 5IHNA 3TSZA 2RQVA 2ED0A 5IH2A 4ESRA 1K4US 2DMOA 2J6FA 5FWCA 2HSPA 2JXBA 2M51A 1OEBA 2DRKA 1OPLA 2EPDA 2VKNA 1WLPB 2K6DA 4RTXA 3RBBB 1NYGA 2DL3A 3EG1A 4D8DA 1MUZA 2O9SA 2MOXA 2O88A 2MCNA 1VYTA 3KFVA 2BZXA 2O2OA 4J9GA 1X27A 4AG1C 4IIMA 3REBB 1YN8A 3NMZC 4J9DA 3H0IA 4LUDA 4OMQA 1SHFA 2ENMA 1T3SA 2L0AA 3PE0A 1QCFA 1X69A 1AVZC 3C0CA 1PHTA 1Z9QA 1GBRA 4CC3A 2YUPA 1HD3A 2L2PA 4KRTA 3M0QA 2K2MA 2NUZA 5IHKA 2FO0A 2GTOA 1VYVA 2D1XA 2EW3A 3NPFA 1HJDA 2K79A 2W10A 1TG0A 4JJBA 2EYZA 4HVWA 2YUNA 1QKWA 4WCIA 2F2XA 2DNUA 4AFSC 2LMJA 2A37A 1GBQA 1WX6A 1ABQA 2GQIA 2DL5A 1NM7A 1RI9A 2KNBB 2A08A 4D8KA 1M3BA 2RQRA 1YWOA 1GFDA 2F2WA 1M27C 1Y0MA 2KBTA 1UG1A 1QWFA 1VA7A 2JM8A 2E5KA 2DVJA 2HBWA 3GBQA 1TUCA 1GL5A 1EFNA 3UA7A 2OI3A 1PKTA 1UHCA 1AWOA 3EHQA 1A0NB 1RLPC 3IQLA 2JTEA 2V1QA 2CH4A 1NLPC 2SEMA 2EGEA 2YUQA 2LP5A 2FRYA 3M0UA 1JEGA 1WIEA 3U23A 1GRIA 2AZSA 2C0IA 4GBQA 3M0TA 1U3OA 4RTTA 2AKLA 2JMAA 2ECZA 3M0PA 2RN8A 4HCKA 2CUDA 3VS5A 1X6GA 3EG2A 1SSHA 1WXBA 2KRSA 1GCPA 4J9BA 2LX7A 1PKSA 1HSQA 1UTIA 3M0SA 2O31A 4EIKA 4AFQC 2CSIA 1WYXA 4J9IA 1PWTA 4CC2A 2DE0X 3FJ5A 4J9FA 2JMCA 4AFZC 2CDTA 4GLMA 4DEXA 1YP5A 1I1JA 4F17A 2PZ1A 1QLYA 2KRNA 3EGUA 1AWJA 2KROA 5HCKA 2DL4A 2DL8A 3H0HA 3PVLA 1N5ZA 2KYBA 1NEGA 2ED1A 2DBKA 2ESWA 5IXBA 1M8MA 1PNJA 1W6XA 3VS1A 1SHGA 2GNCA 4OMOA 1UGVA 4HVVA 2JW4A 2LNHB 1W70A 2LZ6B 3LH5A 4ZNXA 3TVTA 3REAB 2EKHA 1ZUYA 1GCQC 2BZ8A 4ORZA 3VRYA 1GFCA 2DILA 4J9CA 2LJ0A 2JM9A 2OJ2A 2B86A 4RTYA 5L23A 1U06A 1NYFA 2H8HA 1E6GA 2NWMA 4LNPA 2RNAA 2V1RA 1E6HA 2ROLA 2GBQA 4JJDA 4QT7A 1ARKA 4AFUC 2GGRA 3SHWA 3R6NA 3I35A 1M3AA 4RTUA 4E6RA 2LCSA 1TUDA 4LUEA 2CUBA 4JZ4A 4LE9A 2FG0A 2IIMA 1WXUA 1NLOC 2RQWA 2J05A 1LCKA 4J9EA 1T0HA 2X3XD 3TSWA 1NEBA 4K11A 2F2VA 2C0OA 2C0TA 5GJWB 1K1ZA 1B07A 2YT6A 1OOTA 2EBPA 2FEIA 2DA9A 5ECAA 1IO6A 1H8KA 2DM1A 3VS3A 1KSWA 2L3SA 5FWBA 1ZBJA 3VS2A 2KRMA 2EYWA 4M4ZA 1ZUUA 2D8JA 2LQNA 3A98A 2KT8A 2RQTA 1BU1A 3PVQA 1X6BA 2KT1A 1UHFA 2CT4A 1G83A 1UE9A 1B3QA 1AEYA 1AOJA 2QDLA 1AWWA 1ZUKA 2KXCA 2DYBA 1K0SA 3NGPA 2LJ3A 2PNIA 5GJVB 1K9AA 1UDLA 1BK2A 2M0YA 2XMFA 1JQQA 2ABLA 3QWYA 1KFZA 2GTJA 1FMKA 3M0RA 1KIKA 1S1NA 4F16A 2FPEA 1OV3A 4A63B 2JT4A 1T0JA 2CREA 1Z9ZA 1WFWA 1YNZA 4HXJA 2KYMA 4OMLA 1RLQC 3UF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OPK A;  2JS0 A;  1X43 A;  1T3L A;  2CH4 W;  2LJ1 A;  2J7I A;  2L3Q A;  2YUO A;  1PRM C;  4X1V A;  2L3P A;  4FSS A;  1JXO A;  2DJQ A;  1X2Q A;  2DLP A;  2D0N A;  2HEQ A;  1MV3 A;  4Z8A A;  1E7O A;  1M3C A;  3EG3 A;  3EHR A;  5FW9 A;  2J06 A;  1CSK A;  3H41 A;  1FYN A;  4IIO A;  1SRL A;  3VS4 A;  1BB9 A;  3CQT A;  5EC7 A;  2P4R A;  2EVR A;  1AD5 A;  2A36 A;  3O5Z A;  3UAT A;  1CKA A;  2AK5 A;  2BZY A;  4J9H A;  1MV0 B;  1SRM A;  2SRC A;  5IXF A;  2RMO A;  4LN2 A;  1AZE A;  3RNJ A;  1YCS B;  4JJC A;  1W1F A;  4DEY A;  1G2B A;  1KJW A;  1I0C A;  3VS7 A;  2LQW A;  1QWE A;  2OAW A;  3I5R A;  2RF0 A;  1X2K A;  4RTW A;  3VS6 A;  2JS2 A;  1WXT A;  1JO8 A;  2KEA A;  4OMP A;  1UJY A;  2EQI A;  1K76 A;  1NG2 A;  3NHN A;  1UFF A;  2KR3 A;  2EGC A;  1SPK A;  5IHI A;  1AWX A;  2KE9 A;  3H0F A;  1PRL C;  3JV3 A;  2DX1 A;  1RUW A;  2EYX A;  2HCK A;  2CT3 A;  2G6F X;  4AG2 C;  2BTT A;  2DL7 A;  2VVK A;  3THK A;  1WA7 A;  1UEC A;  3UA6 A;  1AZG B;  1ABO A;  1ZLM A;  1U5S A;  1QKX A;  1Y57 A;  2FPF A;  2EYY A;  2J6O A;  2DBM A;  2K7A A;  2VWF A;  2AKK A;  1I07 A;  1SEM A;  3ZL7 C;  1VYU A;  3SEM A;  4CC7 A;  2DF6 A;  1J3T A;  4RTV A;  2K3B A;  4Y92 A;  1XOV A;  2K9G A;  4JPB W;  2PTK A;  2O9V A;  3EG0 A;  1WDX A;  4RTZ A;  3QWX X;  3I5S A;  1BBZ A;  4Z89 A;  2CSQ A;  1UUE A;  5I11 A;  1GCQ A;  2I0N A;  4HVU A;  1ZSG A;  2FPD A;  2KGT A;  2ROT A;  3ULR B;  5I22 A;  2AZV A;  2RQU A;  4CC4 B;  2HDA A;  2DRM A;  1ZX6 A;  1JU5 C;  1JXM A;  1UJ0 A;  2FRW A;  1WI7 A;  2X3W D;  1CKB A;  2D8H A;  2EGA A;  2YDL A;  3I9Q A;  4R0K A;  4OMM A;  4F14 A;  2MIO A;  4RUG A;  2YSQ A;  4OMN A;  4Z88 A;  1H92 A;  1V1C A;  4JZ3 A;  3VS0 A;  2W0Z A;  2KXD A;  1YWP A;  1M30 A;  2RPN A;  1H3H A;  2A28 A;  3VRZ A;  1K0X A;  2J6K A;  5IHN A;  3TSZ A;  2RQV A;  2ED0 A;  5IH2 A;  4ESR A;  1K4U S;  2DMO A;  2J6F A;  5FWC A;  2HSP A;  2JXB A;  2M51 A;  1OEB A;  2DRK A;  1OPL A;  2EPD A;  2VKN A;  1WLP B;  2K6D A;  4RTX A;  3RBB B;  1NYG A;  2DL3 A;  3EG1 A;  4D8D A;  1MUZ A;  2O9S A;  2MOX A;  2O88 A;  2MCN A;  1VYT A;  3KFV A;  2BZX A;  2O2O A;  4J9G A;  1X27 A;  4AG1 C;  4IIM A;  3REB B;  1YN8 A;  3NMZ C;  4J9D A;  3H0I A;  4LUD A;  4OMQ A;  1SHF A;  2ENM A;  1T3S A;  2L0A A;  3PE0 A;  1QCF A;  1X69 A;  1AVZ C;  3C0C A;  1PHT A;  1Z9Q A;  1GBR A;  4CC3 A;  2YUP A;  1HD3 A;  2L2P A;  4KRT A;  3M0Q A;  2K2M A;  2NUZ A;  5IHK A;  2FO0 A;  2GTO A;  1VYV A;  2D1X A;  2EW3 A;  3NPF A;  1HJD A;  2K79 A;  2W10 A;  1TG0 A;  4JJB A;  2EYZ A;  4HVW A;  2YUN A;  1QKW A;  4WCI A;  2F2X A;  2DNU A;  4AFS C;  2LMJ A;  2A37 A;  1GBQ A;  1WX6 A;  1ABQ A;  2GQI A;  2DL5 A;  1NM7 A;  1RI9 A;  2KNB B;  2A08 A;  4D8K A;  1M3B A;  2RQR A;  1YWO A;  1GFD A;  2F2W A;  1M27 C;  1Y0M A;  2KBT A;  1UG1 A;  1QWF A;  1VA7 A;  2JM8 A;  2E5K A;  2DVJ A;  2HBW A;  3GBQ A;  1TUC A;  1GL5 A;  1EFN A;  3UA7 A;  2OI3 A;  1PKT A;  1UHC A;  1AWO A;  3EHQ A;  1A0N B;  1RLP C;  3IQL A;  2JTE A;  2V1Q A;  2CH4 A;  1NLP C;  2SEM A;  2EGE A;  2YUQ A;  2LP5 A;  2FRY A;  3M0U A;  1JEG A;  1WIE A;  3U23 A;  1GRI A;  2AZS A;  2C0I A;  4GBQ A;  3M0T A;  1U3O A;  4RTT A;  2AKL A;  2JMA A;  2ECZ A;  3M0P A;  2RN8 A;  4HCK A;  2CUD A;  3VS5 A;  1X6G A;  3EG2 A;  1SSH A;  1WXB A;  2KRS A;  1GCP A;  4J9B A;  2LX7 A;  1PKS A;  1HSQ A;  1UTI A;  3M0S A;  2O31 A;  4EIK A;  4AFQ C;  2CSI A;  1WYX A;  4J9I A;  1PWT A;  4CC2 A;  2DE0 X;  3FJ5 A;  4J9F A;  2JMC A;  4AFZ C;  2CDT A;  4GLM A;  4DEX A;  1YP5 A;  1I1J A;  4F17 A;  2PZ1 A;  1QLY A;  2KRN A;  3EGU A;  1AWJ A;  2KRO A;  5HCK A;  2DL4 A;  2DL8 A;  3H0H A;  3PVL A;  1N5Z A;  2KYB A;  1NEG A;  2ED1 A;  2DBK A;  2ESW A;  5IXB A;  1M8M A;  1PNJ A;  1W6X A;  3VS1 A;  1SHG A;  2GNC A;  4OMO A;  1UGV A;  4HVV A;  2JW4 A;  2LNH B;  1W70 A;  2LZ6 B;  3LH5 A;  4ZNX A;  3TVT A;  3REA B;  2EKH A;  1ZUY A;  1GCQ C;  2BZ8 A;  4ORZ A;  3VRY A;  1GFC A;  2DIL A;  4J9C A;  2LJ0 A;  2JM9 A;  2OJ2 A;  2B86 A;  4RTY A;  5L23 A;  1U06 A;  1NYF A;  2H8H A;  1E6G A;  2NWM A;  4LNP A;  2RNA A;  2V1R A;  1E6H A;  2ROL A;  2GBQ A;  4JJD A;  4QT7 A;  1ARK A;  4AFU C;  2GGR A;  3SHW A;  3R6N A;  3I35 A;  1M3A A;  4RTU A;  4E6R A;  2LCS A;  1TUD A;  4LUE A;  2CUB A;  4JZ4 A;  4LE9 A;  2FG0 A;  2IIM A;  1WXU A;  1NLO C;  2RQW A;  2J05 A;  1LCK A;  4J9E A;  1T0H A;  2X3X D;  3TSW A;  1NEB A;  4K11 A;  2F2V A;  2C0O A;  2C0T A;  5GJW B;  1K1Z A;  1B07 A;  2YT6 A;  1OOT A;  2EBP A;  2FEI A;  2DA9 A;  5ECA A;  1IO6 A;  1H8K A;  2DM1 A;  3VS3 A;  1KSW A;  2L3S A;  5FWB A;  1ZBJ A;  3VS2 A;  2KRM A;  2EYW A;  4M4Z A;  1ZUU A;  2D8J A;  2LQN A;  3A98 A;  2KT8 A;  2RQT A;  1BU1 A;  3PVQ A;  1X6B A;  2KT1 A;  1UHF A;  2CT4 A;  1G83 A;  1UE9 A;  1B3Q A;  1AEY A;  1AOJ A;  2QDL A;  1AWW A;  1ZUK A;  2KXC A;  2DYB A;  1K0S A;  3NGP A;  2LJ3 A;  2PNI A;  5GJV B;  1K9A A;  1UDL A;  1BK2 A;  2M0Y A;  2XMF A;  1JQQ A;  2ABL A;  3QWY A;  1KFZ A;  2GTJ A;  1FMK A;  3M0R A;  1KIK A;  1S1N A;  4F16 A;  2FPE A;  1OV3 A;  4A63 B;  2JT4 A;  1T0J A;  2CRE A;  1Z9Z A;  1WFW A;  1YNZ A;  4HXJ A;  2KYM A;  4OML A;  1RLQ C;  3UF4 A; 
#chains in the Genus database with same CATH topology
 3UT1 A;  5GAM g;  1OPK A;  1X43 A;  3TEE A;  1OX9 A;  1IHV A;  2ZPF B;  1D1A A;  1D0X A;  1PRM C;  3C12 A;  4F04 B;  2QEX A;  4RKU E;  2D0N A;  2HEQ A;  4J6Y A;  1N9S A;  2RHY A;  3EGD A;  1E7O A;  1FWZ A;  2VAS A;  1VQ8 T;  5GAN 3;  4KUD K;  1I5O B;  2EVR A;  3CCR Q;  3M53 A;  2A36 A;  3O5Z A;  2BZY A;  4BY6 C;  4J9H A;  1MV0 B;  1SRM A;  2SRC A;  5IXF A;  3RNJ A;  1YCS B;  1HYO A;  2RJE A;  1KJW A;  3VS7 A;  2DZ9 A;  1R0C B;  3RMQ A;  4DBQ A;  2VXF A;  3EG9 B;  3O8V A;  1YI2 A;  1AHJ B;  1OU8 A;  1D09 B;  4C0D C;  3CCQ A;  2QG9 B;  2LC4 A;  1UGP B;  1NG2 A;  2KR3 A;  4OVA A;  3C94 A;  2Z0W A;  1PD1 A;  1EZZ B;  2XD0 A;  1TU0 B;  2HCK A;  4AG2 C;  2BTT A;  5FRN A;  2EQU A;  1UEC A;  3X25 B;  1AZG B;  4FL6 A;  2VUB A;  1ABO A;  2HKQ B;  5CKF A;  1Y57 A;  2CS7 A;  2FPF A;  3HSB A;  2K7A A;  2GFU A;  3P8D A;  4DQ2 A;  3OMC A;  5GAN e;  1I07 A;  3CCR A;  2XID A;  4CC7 A;  4BB7 A;  2GFA A;  5GAN f;  1ZBX A;  4Y92 A;  5A2Q E;  4RTZ A;  5GAN 8;  3JCM c;  3BW1 A;  2DEU A;  4Z89 A;  2XU8 A;  3MHX A;  2KDS A;  5I11 A;  3JAM E;  1WHH A;  1M8V A;  2DER A;  1DJ7 B;  2KVQ G;  5I22 A;  4M7A A;  3EGX B;  2RQU A;  4CC4 B;  2P84 A;  1UGQ B;  2IVW A;  2FRW A;  4M75 D;  4M7D A;  4HA8 A;  2FZC B;  2YDL A;  3I9Q A;  4A54 A;  5LJ3 e;  3PT9 A;  2DXU A;  4RUG A;  1PD0 A;  3LX7 A;  3G7Z A;  3CCS Q;  3OYJ A;  4OMN A;  3RMS A;  4Z88 A;  3FJP A;  1H92 A;  3P8H A;  3VS0 A;  1Q82 C;  4C8Q G;  2QQ9 A;  3WXM B;  5KYW A;  3GNG A;  2CZ6 B;  1Q86 C;  4OB2 B;  2X4Y A;  1K4U S;  4F7U A;  4M78 D;  1N8R U;  2JXB A;  4IUQ A;  3HRS A;  2VKN A;  1K9M R;  1BIB A;  5AT1 B;  3RBB B;  4AMC A;  1Y96 B;  2MOX A;  2MCN A;  1VYT A;  3TCJ A;  2O2O A;  3DB4 A;  3F70 A;  1QCN A;  1X27 A;  4AG1 C;  3PIO A;  4OMQ A;  4J9D A;  2MWO A;  4QVZ A;  4N0A A;  4B9W A;  3PE0 A;  5KYU A;  1X69 A;  2E3H A;  2L2P A;  3CXC A;  3URG A;  1KQS S;  4M7A C;  2COY A;  2NUZ A;  3KXT A;  1KC8 U;  2GTO A;  3G6E T;  4M7D C;  2CGH A;  4MDW A;  1N6A A;  2RK2 A;  2K79 A;  4ZN1 A;  2EAY A;  2HAX A;  2YUN A;  4ANJ A;  2LMJ A;  2A37 A;  3OYL A;  3CCS A;  4XU3 A;  1PCX A;  4BI4 A;  3OYG A;  3JRZ A;  2QA4 T;  4EDU A;  4BDY A;  1BKB A;  4ZTF A;  4D8K A;  2CP2 A;  1YJ9 T;  2FVU A;  2QGG A;  1YWO A;  3X26 B;  5LJ3 g;  1Y0M A;  1TSF A;  1EX4 A;  4JDS A;  1QWF A;  3M4G A;  2COZ A;  4D6W A;  2DVJ A;  3OYN A;  1GL5 A;  1YCY A;  2QQS A;  4FYW B;  1IZ6 A;  1EFN A;  2LT1 A;  2OI3 A;  3EHQ A;  3HKS A;  2V8I A;  2ZPI B;  4N0A C;  3FB9 A;  4DBH A;  2K4Y A;  5HK0 A;  4XTZ A;  3SFM A;  3V7S A;  2R57 A;  1U3O A;  1IGU A;  4RTT A;  3M0P A;  4PJO C;  2RN8 A;  1SSH A;  3CPW A;  1GCP A;  4ZTJ A;  2EQJ A;  2LX7 A;  2E65 A;  1PSE A;  2RK1 A;  3TRE A;  4M75 A;  2RM4 A;  2WAC A;  4J9I A;  1MNE A;  2CYZ B;  4J9F A;  3UDC A;  1VQM T;  3HHT B;  1RAA B;  1YP5 A;  2NUT A;  4EMK A;  2OX7 A;  1TOV A;  4F17 A;  2DL4 A;  2GCX A;  5DLQ E;  1NEG A;  1VQ4 T;  4M78 A;  3CBP A;  5GAN 2;  4E47 A;  2LNV A;  3VS1 A;  3E19 A;  2JW4 A;  3LH5 A;  2LZ6 B;  4PJO E;  5A0L A;  3VRY A;  2DTO A;  2RD1 A;  2F5T X;  2LCL A;  1WZO A;  5KYX B;  3G6E Q;  1JJ2 P;  3M58 A;  1ZQ1 A;  3M54 A;  1KQ1 A;  5L23 A;  4YTL A;  4DOV A;  1M90 C;  2NWM A;  4PFZ A;  2JNG A;  2RNA A;  2ZAE A;  2V1R A;  5A0G A;  4JS5 A;  4AFU C;  4A4E A;  4C92 B;  2QA4 Q;  4M75 C;  5HY6 A;  1YIT Q;  1BI3 A;  1TUD A;  1YJ9 Q;  4X34 A;  4N4H A;  2J05 A;  1PC0 A;  3ZBD A;  4EMK C;  1YIJ T;  1SKU B;  2NYS A;  4V2S A;  1NZ9 A;  4M77 B;  3WVD B;  1QVF A;  2K5F A;  4M7A G;  5GJW B;  3LLR A;  3CC7 T;  3QG1 A;  1B07 A;  1OOT A;  4M78 C;  2CZ1 B;  4M7D G;  5LJ3 j;  5FRM A;  2DA9 A;  5ECA A;  1WJR A;  3PIP A;  2DM1 A;  1ZA1 B;  1KSW A;  3QDF A;  2KRM A;  4M4Z A;  2HBP A;  2KT8 A;  3EG9 A;  2KT1 A;  2QQR A;  3E9F A;  1G83 A;  1UE9 A;  1AEY A;  2QDL A;  1QVP A;  1W2B P;  3G6E A;  2HZY A;  4J5Y A;  2DYB A;  5GMK j;  2FB7 A;  5GJV B;  4EMG A;  1RAE B;  2M0Y A;  3OW2 A;  1VQL T;  4A4K A;  1JQQ A;  4PLI A;  1KFZ A;  1FMK A;  3PGG A;  1S1N A;  4IUV A;  2LVM A;  3VUZ A;  2DXB A;  2QA4 A;  5KYU B;  1YIT A;  1VQM Q;  1M1K R;  1WFW A;  1M4Z A;  1YNZ A;  4E7S A;  2JS0 A;  3LGL A;  3UPU A;  3V7R A;  1JJ2 A;  4JRP A;  3M56 A;  4J6W A;  2YUO A;  2VYT A;  3GPL A;  2ZPG B;  2OTJ T;  1JXO A;  4PJO G;  1X2Q A;  4JUV A;  1MV3 A;  4XK8 E;  3EG3 A;  4BDZ A;  2MWP A;  2E41 A;  4PJO F;  4MDX A;  3DB3 A;  2J06 A;  1CSK A;  2Y4X A;  1S72 T;  1FYN A;  3MP6 A;  5CKD A;  5D6W A;  4NL2 A;  3BFM A;  1TS9 A;  3J7A F;  5KE3 A;  4OMF B;  1D0Z A;  2AT1 B;  4DEY A;  2CKK A;  2DVE A;  4LDY A;  1I0C A;  4XTW A;  2OAW A;  3X24 B;  1X2K A;  1OZ2 A;  2MPX C;  3VS6 A;  3CCL Q;  2DXC A;  4E7Z A;  2YLC A;  1JO8 A;  1VQM A;  1NJI C;  2KEA A;  3S6W A;  2DIQ A;  3I55 T;  3NHN A;  3CC7 Q;  2X4W A;  4RG2 A;  1YHQ T;  3P8B B;  1M2O A;  1AWX A;  2KE9 A;  3M4Y A;  1Y96 A;  3H0F A;  4E7J A;  3JV3 A;  5DY9 A;  2D6F A;  2M02 A;  4CRI A;  2DX1 A;  3OYF A;  3ZFJ A;  2IG0 A;  4FT4 A;  3THK A;  1QCO A;  1JB0 E;  4DOW A;  1IHW A;  4B6M A;  2LRQ A;  4M75 G;  1U5S A;  5J26 A;  4N4G A;  4C92 D;  2J6O A;  5GAO q;  2AKK A;  4QQG A;  3A8L B;  3ZL7 C;  1J3T A;  1TXQ A;  3L42 A;  2XK0 A;  2COW A;  3QPH A;  2BIV A;  1XOV A;  4CI0 C;  3GF5 A;  2O9V A;  4PJL A;  4WF2 A;  1WDX A;  4NOY A;  3CEY A;  4M77 D;  2QTV A;  2EJF A;  2VB6 A;  4M78 G;  4ZN3 A;  3I5S A;  1BBZ A;  5GAN 5;  1QP2 A;  3L2W A;  3CC4 T;  4HVU A;  1ZSG A;  2FPD A;  2LTO A;  3CCL A;  2AZV A;  2DRM A;  2RHZ A;  1JXM A;  1UJ0 A;  4PL6 A;  1VQ5 T;  2K57 A;  3CC7 A;  1IRX A;  2D8H A;  3CD6 T;  4OMM A;  3JCM X;  1VQN T;  4F14 A;  3GOX A;  2YSQ A;  2XDP A;  1K8A R;  5D6X A;  1V1C A;  5D6Y A;  5KH6 A;  2KXD A;  1YWP A;  4P5N A;  1ZSZ B;  1D1C A;  3VRZ A;  3MEV A;  3TSZ A;  4BUG A;  1MMG A;  5IH2 A;  4ESR A;  1Q81 U;  4LD6 A;  2HSP A;  4C8Q E;  3OS5 A;  2EPD A;  1OPL A;  1OQK A;  4PFP A;  2K6D A;  3CCJ T;  4RTX A;  3JCM h;  1NPP A;  4OP0 A;  1JJ2 S;  3EG1 A;  4FW1 A;  1K9M U;  1YFN A;  2BZX A;  3RKW A;  4J9G A;  3NTI A;  3N5B B;  2QXF A;  3LGF A;  4IIM A;  3REB B;  1YN8 A;  3M57 A;  3NMZ C;  4LUD A;  2QQB A;  4DBF A;  3BDU A;  5CKE A;  1QCF A;  2XG8 D;  1AVZ C;  5GAN 7;  3CMA T;  1Z9Q A;  1GBR A;  4HKE A;  3HFN A;  2YUP A;  1HD3 A;  3I55 Q;  3PTA A;  2CP5 A;  2L89 A;  9ATC B;  2KMT A;  4FYV B;  3OSS C;  4ME7 A;  1WHM A;  2RHI A;  3G1J A;  2D1X A;  1HK9 A;  3A8O B;  1Q7Y U;  4JRQ A;  6AT1 B;  1TG0 A;  2EYZ A;  4HVW A;  2K3Y A;  2F2X A;  2DNU A;  4AFS C;  3EFO B;  1ABQ A;  1C0M A;  4IKF A;  2DL5 A;  3CXC P;  1RI9 A;  5FU7 B;  2KNB B;  4JRI A;  3L2R A;  3JCM d;  5KYX A;  2F2W A;  1M27 C;  1M2V B;  3OMG A;  4QQ6 A;  1BI2 A;  2E3I A;  2KBT A;  1UG1 A;  1VA7 A;  2JM8 A;  1N9R A;  1R8O B;  1W2B S;  2YRV A;  5GAO m;  1PKT A;  2JVV A;  1UHC A;  1AWO A;  1A0N B;  4DBR A;  1QVG A;  4R55 A;  3SDZ A;  4C0G A;  1IGQ A;  2SEM A;  4C92 A;  2EGE A;  4OF1 A;  3CC4 Q;  3M0U A;  3HTR A;  3PMT A;  4GLK A;  2ZZD A;  2FZK B;  3S3N A;  2DAQ A;  5CVI A;  5GAO l;  2AKL A;  3CD6 Q;  3QII A;  2ECZ A;  4KBM B;  4M77 A;  2RJD A;  3OYA A;  1VQN Q;  2EQK A;  2X9H A;  2BKD N;  2LCC A;  1X6G A;  3EG2 A;  3VYG A;  1Q82 R;  2V26 A;  2GQV A;  5J39 A;  1QQJ A;  1PKS A;  3JB9 D;  4L59 A;  1Q86 R;  1KD1 C;  1I8F A;  1UTI A;  2DIG A;  5CQX A;  1VQ8 Q;  2RI2 A;  4EIK A;  5LJ3 f;  4OB3 B;  1Q81 R;  1WYX A;  3PMI A;  2E64 A;  4CC2 A;  3FJ5 A;  4C8Q F;  2JMC A;  3CCJ Q;  4AFZ C;  3QJ6 A;  1V29 B;  1QLY A;  3CPW P;  2KRN A;  5GMK e;  1K73 R;  2YWW A;  2V8J A;  3L2V A;  2DL8 A;  1U1T A;  3L2Q A;  4ATO A;  4XU0 A;  3CCE T;  1MMA A;  2QAZ A;  2ED1 A;  2JTF A;  2DZC A;  1YBY A;  4MZT A;  3LWH A;  1SHG A;  2WSE E;  1MMD A;  3QYG B;  3CC4 A;  2QDY B;  2MF2 A;  4BI8 B;  1KK7 A;  4M77 C;  1Q7Y R;  5D7U A;  1TWB A;  1NYF A;  2DFU A;  3CD6 A;  1VQN A;  2GBQ A;  3TQ7 P;  1EIF A;  3CCU T;  1ARK A;  5DM7 R;  3CCM T;  1BCM A;  5GAN h;  3ZEH A;  3OS0 A;  4XU2 A;  2RHX A;  2LCS A;  3V7C A;  4FM4 B;  4GY5 A;  1FXX A;  2PUK B;  1VQ8 A;  4LE9 A;  1M1F A;  2YXY A;  2HKN A;  2IIM A;  2RQW A;  2C06 A;  3RR6 A;  2Y90 A;  1NEB A;  4K11 A;  4O6J A;  3CCJ A;  4B9X A;  3AHU A;  4PNO A;  1IRE B;  3JB9 J;  2E6Z A;  2EBP A;  1H64 1;  2E70 A;  5FWB A;  1ZBJ A;  4QVD A;  4BAC A;  4M7A E;  3M5A A;  5IAY A;  4M7D E;  1UHF A;  1TUG B;  1V76 A;  3EH2 A;  1QVF P;  1SG5 A;  2CT4 A;  2F69 A;  1PSF A;  3MJX A;  1AWW A;  3G4S T;  3OYY A;  5C0M A;  3OQ5 A;  4XTV A;  3HRU A;  2DTH A;  1K0S A;  3NGP A;  2LJ3 A;  2LX9 A;  2PNI A;  2MMP A;  1BK2 A;  2BE9 B;  5GAN d;  2ABL A;  3QWY A;  4F7U E;  3ER0 A;  1VQK T;  1OV3 A;  3QUI A;  3JCM Q;  5KYN A;  4II1 A;  4C5H A;  4E7K A;  4QW2 A;  1RAB B;  5KCO A;  4C5I A;  3MP8 A;  3OSV A;  5I2S A;  1M1K U;  3QSU A;  3OW2 P;  4UC4 A;  2D0Q B;  3CCE Q;  2CH4 W;  3JCM J;  1N27 A;  2J7I A;  5C6S A;  4FSS A;  2QK0 A;  1VUB A;  1TH7 A;  1MGQ A;  2X35 A;  3OYI A;  4QKU A;  1VQ7 T;  3L2Z A;  5FW9 A;  3MKD A;  4A4H A;  4KGX B;  4IIO A;  1SRL A;  3X28 B;  3CQT A;  5EC7 A;  3VJP A;  2P4R A;  1N8R C;  1R0B G;  3R6O A;  2EQM A;  5DLO A;  3BDL A;  1WQW A;  3JSC A;  4IUP A;  4JJN K;  1OI1 A;  3CCU Q;  3CCM Q;  4HCZ A;  1AZE A;  3QKJ A;  3ME9 A;  4XTU A;  4JJC A;  1G2B A;  3VV0 A;  3LW5 E;  3I56 T;  2LQW A;  2QI2 A;  3JB9 I;  2YRD A;  5GAN 6;  4X9C A;  1ZSZ A;  3MPU B;  3Q1J A;  2H3J A;  1WXT A;  3MEA A;  3CXC S;  4KUL A;  2V8K A;  4Y28 E;  1KC8 C;  4ELY C;  1UFF A;  1SPK A;  5A0D A;  2XKO C;  1XNI A;  1WQ7 A;  5IHI A;  4M77 G;  4Y91 A;  3CCE A;  4OGC A;  1PRL C;  2K3X A;  5M9O A;  2OTL T;  1AT1 B;  1KG1 A;  4M7A F;  1TTH B;  3S3M A;  2DL7 A;  2DYI A;  1WA7 A;  4Z02 A;  3UA6 A;  3MO8 A;  1YJW T;  4M7D F;  2HNI A;  1X75 C;  1ZLM A;  3G4S Q;  4MZM A;  5CK9 A;  2EYY A;  5KCH A;  1WHL A;  1VQP T;  3CPF A;  2KSS A;  4F7U G;  1VYU A;  2DF6 A;  3D7S B;  1HXD A;  4M75 E;  2RI3 A;  3CCV T;  2R58 A;  4RTV A;  2K3B A;  4FIB A;  3CCU A;  1VQK Q;  2OAU A;  4F7U F;  3CCM A;  3EG0 A;  1ZSZ C;  3MP1 A;  4EMH A;  2XDD A;  3EFO A;  2FZG B;  2CSQ A;  2DJZ A;  1UUE A;  3ASK A;  4N4I A;  1GCQ A;  1IB8 A;  1G3Y A;  4RMO A;  2ROT A;  1YJ9 A;  2E6N A;  4BE2 A;  1ZX6 A;  1LPL A;  1M2V A;  4M78 E;  1WI7 A;  2X3W D;  4KH1 B;  2ZPB B;  1VQ4 Q;  4IUR A;  5CQY A;  3CPW S;  4JZ3 A;  1VQ7 Q;  2XHC A;  2W0Z A;  1KHI A;  3LYI A;  1M30 A;  4X9D A;  1K8A U;  3MEU A;  5LL6 S;  2HD0 A;  1YI2 T;  1K0X A;  2RQV A;  1U1S A;  2ED0 A;  3CCQ T;  2DMO A;  2FYK A;  2I2L A;  3EH1 A;  4C5E A;  4A4G A;  1M1K C;  2P0Q A;  3G4S A;  3GP8 A;  1JBM A;  1OEB A;  1WLP B;  4XU1 A;  1O9S A;  5J3B A;  1NYG A;  4D8D A;  1MUZ A;  2O9S A;  2O88 A;  2M0O A;  2L8D A;  3I56 Q;  1Y71 A;  3OYC A;  2RO0 A;  1VQK A;  1NPR A;  3QZ5 B;  3CBM A;  5CKH A;  1SHF A;  1T3S A;  2K2V A;  2EKO A;  1YIJ Q;  2BUD A;  2RH2 A;  4KRT A;  2XIC A;  3M0Q A;  1M1G A;  2K2M A;  5IHK A;  2CP3 A;  2DEQ A;  2RHU A;  2XDB A;  3UWN A;  2EW3 A;  3NPF A;  2O01 E;  4JJB A;  3VUB A;  1WGS A;  3E1S A;  1QKW A;  4WCI A;  3GLX A;  2E4H A;  3DKM A;  3CBO A;  1VQ4 A;  1WX6 A;  3RDV A;  3SWN A;  1YJW Q;  1VQ7 A;  5I21 A;  3JCM e;  1D1B A;  4Q5W A;  1WNL A;  1Y7X A;  4TVR A;  1VQP Q;  4EPC A;  5CR2 A;  3JCM f;  1BI0 A;  1GFD A;  1OX8 A;  2E12 A;  3C95 A;  5FU6 B;  4JS4 A;  5GMK m;  5IT9 E;  4QVC A;  4LDU A;  3INZ A;  2CZ0 B;  3OYM A;  3CCV Q;  2EJ9 A;  4JRK A;  4PJM A;  1QVF S;  1VQL Q;  2E5K A;  4M75 F;  3RKY A;  5LJ5 h;  1TUC A;  2EWN A;  4IUT A;  2LQ8 A;  4XQ3 A;  2L3R A;  3UA7 A;  2CP0 A;  1RLP C;  2V1Q A;  3NTH A;  2YHT A;  3MCA B;  3I56 A;  1NLP C;  2YUQ A;  2LP5 A;  5GAO p;  1WIE A;  1F1B B;  3U23 A;  2HL3 A;  1GRI A;  2F5K A;  2BE7 D;  3M0T A;  1YIJ A;  4J83 A;  4M78 F;  2JMA A;  4OB0 B;  4HCK A;  1OZ3 A;  3VS5 A;  2OTJ Q;  3FRN A;  4J6X A;  1QVG P;  4XTX A;  3OW2 S;  1Q82 U;  2KAF A;  1UGR B;  3SD4 A;  3M0S A;  1RAG B;  3CCQ Q;  1Q86 U;  2PQW A;  3OYB A;  2ZPE B;  1WPY A;  4ZGE B;  2CSI A;  1YJW A;  1S72 Q;  3FIF A;  4AT1 B;  2DE0 X;  3EFR A;  5GAM h;  2RJC A;  4KGZ B;  1PM3 A;  2K5L A;  2YLB A;  1XQH A;  5LJ5 d;  1VQP A;  2CP7 A;  1B7T A;  1G3W A;  3EGU A;  3FC3 A;  1D3B A;  2KRO A;  4IUU A;  3CCV A;  1N5Z A;  2NUP B;  5IN1 A;  2F1L A;  2KYB A;  3JCM g;  1VQL A;  1FMW A;  1K73 U;  3CCS T;  1PG5 B;  3H9N A;  3QBY A;  1X01 A;  3KBG A;  1K8A C;  3MET A;  3SB2 A;  4RG8 A;  1G3S A;  1KQS A;  4HVV A;  1W70 A;  4ZNX A;  3A8M B;  2EKH A;  2BZ8 A;  4XTY A;  2DIL A;  4J9C A;  2HL5 C;  1KQ2 A;  2OJ2 A;  3J80 E;  4LD9 K;  1GXI E;  1YHQ Q;  2B86 A;  3J81 E;  4RTY A;  2H8H A;  2E5Q A;  4LNP A;  1P92 A;  2ROL A;  4JJD A;  4J8O A;  2OTJ A;  3S3O A;  2GGR A;  3SHW A;  3R6N A;  1VIE A;  4QQD A;  3JCM b;  5GAM d;  2WSC E;  4PJO D;  3A5Z B;  4RTU A;  2CUB A;  2FG0 A;  3HPW A;  1WJS A;  1U8R A;  1WXU A;  1YJN T;  1S72 A;  2ZCF B;  5CO7 A;  1T0H A;  3TSW A;  2F2V A;  3LWI A;  4FCY A;  4BD3 A;  3OB9 A;  1LJO A;  1C6V X;  1H8K A;  3VS3 A;  4ZGJ B;  2L3S A;  2XI9 A;  2EYW A;  3A8H B;  1ZUU A;  2H3E B;  2WSF E;  1RAC B;  1RI0 A;  3A98 A;  3PFS A;  5LJ5 j;  1X6B A;  4HCC A;  4RCB A;  3M59 A;  3GIB A;  4J7F A;  1B3Q A;  1AOJ A;  4KGV B;  4KH0 B;  2A0F B;  5GAN 4;  1ZUK A;  2KXC A;  1VQ5 Q;  3I55 A;  2X4X A;  1OU9 A;  1YHQ A;  1K9A A;  1UDL A;  1KD1 R;  2XMF A;  1M9S A;  3M0R A;  1KIK A;  2FPE A;  2EFI A;  1VQO T;  2MAM A;  3E9G A;  4OGE A;  1IXD A;  3G71 T;  1ACM B;  2KQW A;  1T0J A;  4NS5 A;  2O4X B;  5GMK i;  1Z9Z A;  1LVK A;  4HXJ A;  4OML A;  4E7I A;  1T3L A;  3OY9 A;  2LJ1 A;  5L8R E;  2B8A A;  3CC2 T;  2L3Q A;  2M16 A;  4C8Q B;  1VOM A;  4X1V A;  5GAM j;  2L3P A;  3V8K A;  3OA6 A;  1G5V A;  2DJQ A;  2DLP A;  3AT1 B;  4C92 C;  4Z8A A;  3SWN B;  1MND A;  1M3C A;  2LT4 A;  1ZHI A;  3CMA Q;  1WHK A;  3EHR A;  3H41 A;  2P4T A;  1Y07 A;  3VKI A;  1XTD A;  1Q81 C;  3VS4 A;  3OS2 A;  1BB9 A;  1NE8 A;  1VIF A;  1AD5 A;  1FMV A;  1X6O A;  3UAT A;  1CKA A;  2AK5 A;  1M90 U;  2JUF A;  3WVE B;  1VQ6 T;  2PVG B;  1VQ5 A;  2QGF B;  3OYD A;  1SSF A;  2PVD B;  2RMO A;  4LN2 A;  1K73 C;  1K9M C;  1XJW B;  1W1F A;  4BE1 A;  4DA4 A;  3QHS A;  1QWE A;  3I5R A;  4NL3 A;  1QMC A;  2DPP B;  2RF0 A;  1YJN Q;  5GAN g;  2K5I A;  4RTW A;  2CZ7 B;  3QO3 A;  2JS2 A;  2KI7 A;  5KYY B;  4OMP A;  1UJY A;  4RCC A;  2ATC B;  2EQI A;  5FLX E;  2HQH A;  5KE2 A;  2DK3 A;  1K76 A;  2EGC A;  2HQE A;  4PJO A;  3FEO A;  1RL2 A;  3V8L A;  4C92 E;  4BY6 B;  2EYQ A;  1Q7Y C;  4PKC C;  1ZA2 B;  3FDR A;  1UGS B;  1RUW A;  2MK5 A;  2EYX A;  2CT3 A;  3QYH B;  2G6F X;  4A53 A;  2QYZ A;  4C0F A;  4HCB A;  1YIT T;  3JCM P;  2VVK A;  3CME T;  3QZ9 B;  4M77 E;  1B34 A;  3QJY A;  5LJ3 h;  2E1H A;  3CMA A;  4C0D B;  1UEB A;  1QKX A;  3M55 A;  2DBM A;  2VWF A;  5I2M A;  1SEM A;  3SEM A;  1D3B B;  2ZPH B;  3JCM W;  1VQO Q;  3G71 Q;  2K9G A;  1RAI B;  3EGD B;  4JPB W;  2PTK A;  1UB4 A;  4C0Z A;  5GMK h;  1MMN A;  3QWX X;  3BY7 A;  1QVG S;  2AHJ B;  2JJ9 A;  5CKB A;  2ZGW A;  2I0N A;  2G3R A;  1FX7 A;  4J7I A;  1YJN A;  8AT1 B;  2KGT A;  3X20 B;  4WTO B;  3ULR B;  2HDA A;  4HT8 A;  1JU5 C;  3CC2 Q;  1CKB A;  2EGA A;  5HK3 A;  3OYE A;  4BE0 A;  4R0K A;  3L1A A;  4FYX B;  2M1H A;  2D9T A;  2MIO A;  4L5G A;  1RAF B;  3M9Q A;  2X4J A;  3L2U A;  5LJ3 d;  1H3H A;  1C1A A;  2PVO B;  2RPN A;  3H8Z A;  2DKG A;  2A28 A;  1N8R R;  4A4F A;  3C4S A;  2J6K A;  2VGM A;  5IHN A;  2HMA A;  1BI1 A;  1H3Z A;  3EFS A;  2J6F A;  4FYY B;  5FWC A;  5CAI A;  1VQ6 Q;  2M51 A;  1M90 R;  2DRK A;  2EJG A;  4VUB A;  2DL3 A;  2MI6 A;  4JLI A;  3H6Z A;  3KFV A;  2FL7 A;  1VQO A;  1WJQ A;  1WHG A;  3H0I A;  3G71 A;  4C5G A;  1QW1 A;  2ENM A;  2X51 A;  2A7Y A;  2L0A A;  3C0C A;  1VQ9 T;  1PHT A;  1G3T A;  4CC3 A;  1KC8 R;  3OYH A;  2RI5 A;  4C92 G;  1BCO A;  4C8Q D;  2EIF A;  1NJI U;  3V8J A;  2DET A;  2FO0 A;  2DXT A;  5FU6 C;  1BYM A;  4MML A;  8ATC B;  5GAN j;  4C92 F;  1VYV A;  4R56 A;  1HJD A;  3CC2 A;  2W10 A;  2NUP A;  2PU9 B;  1GBQ A;  3KUF A;  1Q95 G;  3CME Q;  3DLM A;  3VYH B;  1MHN A;  2GQI A;  4FT2 A;  4M77 F;  4LXC A;  3TU4 K;  1NM7 A;  2HSE B;  5GAO r;  2A08 A;  1M3B A;  2RQR A;  3CCL T;  4O5V A;  4M7A B;  2JTM A;  2GF7 A;  2DD5 A;  2MYS A;  2E10 A;  4M7D B;  3BE3 A;  1VQ6 A;  2HQX A;  2QTX A;  2HBW A;  3GBQ A;  2M9U A;  5EG2 A;  3A1P A;  1G8X A;  1W4S A;  4MZP A;  3IQL A;  3T9N A;  2JTE A;  2QEX T;  1LOJ A;  2JOY A;  2P0K A;  2CH4 A;  1I81 A;  1OYX A;  5KYW B;  4PJJ A;  2FRY A;  1JEG A;  4F7U B;  2AZS A;  2C0I A;  5FRO A;  4GBQ A;  1R77 A;  2P0P A;  2CUD A;  4KUI A;  1WXB A;  2KRS A;  2R5M A;  3MEW A;  4J9B A;  5GAO n;  3LH0 A;  1HSQ A;  4LDV A;  2PUO B;  2O31 A;  4AFQ C;  3CME A;  1PWT A;  5LJ5 e;  7AT1 B;  1SF9 A;  4DEX A;  2CDT A;  4GLM A;  4KT0 E;  1I1J A;  1LNX A;  5LJ5 f;  2PZ1 A;  3NFC A;  4FSX A;  3RUX A;  4PJO B;  1I4K 1;  3GNF B;  1AWJ A;  5HCK A;  4PK4 A;  3H0H A;  3PVL A;  1RAH B;  4OB1 B;  5CCA A;  2RA2 A;  4BI3 A;  4E2F B;  2DBK A;  4PJN A;  2ESW A;  5IXB A;  1VQ9 Q;  1M8M A;  1PNJ A;  1W6X A;  2GNC A;  2KY9 A;  1UGV A;  4OMO A;  3HP9 A;  3TVT A;  2LNH B;  1NJI R;  4HT9 A;  3HL8 A;  3REA B;  1B34 B;  1ZUY A;  2VGN A;  1GCQ C;  4ORZ A;  1WHJ A;  2O4X A;  3QXE B;  1GFC A;  5FU7 C;  4ZGD B;  1RAD B;  2QQA A;  2LJ0 A;  1NBE B;  2JM9 A;  3OBW A;  3EGX A;  2R5A A;  1U06 A;  1E6G A;  3CCR T;  2VV5 A;  1E6H A;  4L6V 5;  4C8Q A;  4LDW A;  2YRC A;  5GAM e;  2OTL Q;  4QT7 A;  3RER A;  1KQS P;  3I35 A;  5CIU A;  1M3A A;  5GAM f;  4E6R A;  4LUE A;  3RKX A;  4JZ4 A;  4ELZ C;  1NLO C;  1LCK A;  4J9E A;  2QAS A;  2X3X D;  3E2U A;  2C0O A;  2Y4Y A;  4E7L A;  2C0T A;  2VXE A;  2IPO B;  2JZ2 A;  1W2B A;  1K1Z A;  3JB9 G;  4E7H A;  2LQK A;  3OYK A;  2QEX Q;  2YT6 A;  3HRT A;  2RJF A;  2FHD A;  4JLG A;  1JRI A;  2FEI A;  1IO6 A;  4FW2 A;  3NTK A;  5LJ5 g;  5HKC A;  3JB9 F;  3RIR A;  3VS2 A;  4FU6 A;  2DD4 A;  4M75 B;  3OS1 A;  2D8J A;  3JCM V;  2LQN A;  3FLG A;  1VQ9 A;  4PFO A;  2RQT A;  2LDM A;  3QDR B;  1BU1 A;  2L5Q A;  3PVQ A;  3OBY A;  1M5Q 1;  4LDX A;  5GMK l;  1BIA A;  2JN0 A;  2NUT B;  4EMK B;  3VU3 C;  5KYY A;  2VC8 A;  2A3L A;  2AIR B;  2CP6 A;  2DO3 A;  1QP3 A;  4PLL A;  3PNW C;  3RES A;  4C8Q C;  3EAE A;  4M78 B;  3DLL A;  2GTJ A;  4M7A D;  5AYF A;  1KD1 U;  2RB6 A;  4F16 A;  2KK4 A;  4MMK A;  1O75 A;  3SWN C;  2OTL A;  4A63 B;  1YI2 Q;  4M7D D;  3JB9 H;  2DTI A;  2JT4 A;  2NLU A;  2CRE A;  1I5L A;  1D0Y A;  3HFO A;  3A8G B;  2KYM A;  1KHC A;  1RLQ C;  1OUL A;  4XAX B;  3UF4 A; 
#chains in the Genus database with same CATH homology
 1OPK A;  2JS0 A;  1X43 A;  1T3L A;  2CH4 W;  2LJ1 A;  2J7I A;  2L3Q A;  2YUO A;  1PRM C;  4X1V A;  2L3P A;  4FSS A;  1JXO A;  2DJQ A;  1X2Q A;  2DLP A;  2D0N A;  2HEQ A;  1MV3 A;  4Z8A A;  1E7O A;  1M3C A;  3EG3 A;  3EHR A;  5FW9 A;  2J06 A;  1CSK A;  3H41 A;  1FYN A;  4IIO A;  1SRL A;  3VS4 A;  1BB9 A;  3CQT A;  5EC7 A;  2P4R A;  2EVR A;  1AD5 A;  2A36 A;  3O5Z A;  3UAT A;  1CKA A;  2AK5 A;  2BZY A;  4J9H A;  1MV0 B;  1SRM A;  2SRC A;  5IXF A;  2RMO A;  4LN2 A;  1AZE A;  3RNJ A;  1YCS B;  4JJC A;  1W1F A;  4DEY A;  1G2B A;  1KJW A;  1I0C A;  3VS7 A;  2LQW A;  1QWE A;  2OAW A;  3I5R A;  2RF0 A;  1X2K A;  4RTW A;  3VS6 A;  2JS2 A;  1WXT A;  1JO8 A;  2KEA A;  4OMP A;  1UJY A;  2EQI A;  1K76 A;  1NG2 A;  3NHN A;  1UFF A;  2KR3 A;  2EGC A;  1SPK A;  5IHI A;  1AWX A;  2KE9 A;  3H0F A;  1PRL C;  3JV3 A;  2DX1 A;  1RUW A;  2EYX A;  2HCK A;  2CT3 A;  2G6F X;  4AG2 C;  2BTT A;  2DL7 A;  2VVK A;  3THK A;  1WA7 A;  1UEC A;  3UA6 A;  1AZG B;  1ABO A;  1ZLM A;  1U5S A;  1QKX A;  1Y57 A;  2FPF A;  2EYY A;  2J6O A;  2DBM A;  2K7A A;  2VWF A;  2AKK A;  1I07 A;  1SEM A;  3ZL7 C;  1VYU A;  3SEM A;  4CC7 A;  2DF6 A;  1J3T A;  4RTV A;  2K3B A;  4Y92 A;  1XOV A;  2K9G A;  4JPB W;  2PTK A;  2O9V A;  3EG0 A;  1WDX A;  4RTZ A;  3QWX X;  3I5S A;  1BBZ A;  4Z89 A;  2CSQ A;  1UUE A;  5I11 A;  1GCQ A;  2I0N A;  4HVU A;  1ZSG A;  2FPD A;  2KGT A;  2ROT A;  3ULR B;  5I22 A;  2AZV A;  2RQU A;  4CC4 B;  2HDA A;  2DRM A;  1ZX6 A;  1JU5 C;  1JXM A;  1UJ0 A;  2FRW A;  1WI7 A;  2X3W D;  1CKB A;  2D8H A;  2EGA A;  2YDL A;  3I9Q A;  4R0K A;  4OMM A;  4F14 A;  2MIO A;  4RUG A;  2YSQ A;  4OMN A;  4Z88 A;  1H92 A;  1V1C A;  4JZ3 A;  3VS0 A;  2W0Z A;  2KXD A;  1YWP A;  1M30 A;  2RPN A;  1H3H A;  2A28 A;  3VRZ A;  1K0X A;  2J6K A;  5IHN A;  3TSZ A;  2RQV A;  2ED0 A;  5IH2 A;  4ESR A;  1K4U S;  2DMO A;  2J6F A;  5FWC A;  2HSP A;  2JXB A;  2M51 A;  1OEB A;  2DRK A;  1OPL A;  2EPD A;  2VKN A;  1WLP B;  2K6D A;  4RTX A;  3RBB B;  1NYG A;  2DL3 A;  3EG1 A;  4D8D A;  1MUZ A;  2O9S A;  2MOX A;  2O88 A;  2MCN A;  1VYT A;  3KFV A;  2BZX A;  2O2O A;  4J9G A;  1X27 A;  4AG1 C;  4IIM A;  3REB B;  1YN8 A;  3NMZ C;  4J9D A;  3H0I A;  4LUD A;  4OMQ A;  1SHF A;  2ENM A;  1T3S A;  2L0A A;  3PE0 A;  1QCF A;  1X69 A;  1AVZ C;  3C0C A;  1PHT A;  1Z9Q A;  1GBR A;  4CC3 A;  2YUP A;  1HD3 A;  2L2P A;  4KRT A;  3M0Q A;  2K2M A;  2NUZ A;  5IHK A;  2FO0 A;  2GTO A;  1VYV A;  2D1X A;  2EW3 A;  3NPF A;  1HJD A;  2K79 A;  2W10 A;  1TG0 A;  4JJB A;  2EYZ A;  4HVW A;  2YUN A;  1QKW A;  4WCI A;  2F2X A;  2DNU A;  4AFS C;  2LMJ A;  2A37 A;  1GBQ A;  1WX6 A;  1ABQ A;  2GQI A;  2DL5 A;  1NM7 A;  1RI9 A;  2KNB B;  2A08 A;  4D8K A;  1M3B A;  2RQR A;  1YWO A;  1GFD A;  2F2W A;  1M27 C;  1Y0M A;  2KBT A;  1UG1 A;  1QWF A;  1VA7 A;  2JM8 A;  2E5K A;  2DVJ A;  2HBW A;  3GBQ A;  1TUC A;  1GL5 A;  1EFN A;  3UA7 A;  2OI3 A;  1PKT A;  1UHC A;  1AWO A;  3EHQ A;  1A0N B;  1RLP C;  3IQL A;  2JTE A;  2V1Q A;  2CH4 A;  1NLP C;  2SEM A;  2EGE A;  2YUQ A;  2LP5 A;  2FRY A;  3M0U A;  1JEG A;  1WIE A;  3U23 A;  1GRI A;  2AZS A;  2C0I A;  4GBQ A;  3M0T A;  1U3O A;  4RTT A;  2AKL A;  2JMA A;  2ECZ A;  3M0P A;  2RN8 A;  4HCK A;  2CUD A;  3VS5 A;  1X6G A;  3EG2 A;  1SSH A;  1WXB A;  2KRS A;  1GCP A;  4J9B A;  2LX7 A;  1PKS A;  1HSQ A;  1UTI A;  3M0S A;  2O31 A;  4EIK A;  4AFQ C;  2CSI A;  1WYX A;  4J9I A;  1PWT A;  4CC2 A;  2DE0 X;  3FJ5 A;  4J9F A;  2JMC A;  4AFZ C;  2CDT A;  4GLM A;  4DEX A;  1YP5 A;  1I1J A;  4F17 A;  2PZ1 A;  1QLY A;  2KRN A;  3EGU A;  1AWJ A;  2KRO A;  5HCK A;  2DL4 A;  2DL8 A;  3H0H A;  3PVL A;  1N5Z A;  2KYB A;  1NEG A;  2ED1 A;  2DBK A;  2ESW A;  5IXB A;  1M8M A;  1PNJ A;  1W6X A;  3VS1 A;  1SHG A;  2GNC A;  4OMO A;  1UGV A;  4HVV A;  2JW4 A;  2LNH B;  1W70 A;  2LZ6 B;  3LH5 A;  4ZNX A;  3TVT A;  3REA B;  2EKH A;  1ZUY A;  1GCQ C;  2BZ8 A;  4ORZ A;  3VRY A;  1GFC A;  2DIL A;  4J9C A;  2LJ0 A;  2JM9 A;  2OJ2 A;  2B86 A;  4RTY A;  5L23 A;  1U06 A;  1NYF A;  2H8H A;  1E6G A;  2NWM A;  4LNP A;  2RNA A;  2V1R A;  1E6H A;  2ROL A;  2GBQ A;  4JJD A;  4QT7 A;  1ARK A;  4AFU C;  2GGR A;  3SHW A;  3R6N A;  3I35 A;  1M3A A;  4RTU A;  4E6R A;  2LCS A;  1TUD A;  4LUE A;  2CUB A;  4JZ4 A;  4LE9 A;  2FG0 A;  2IIM A;  1WXU A;  1NLO C;  2RQW A;  2J05 A;  1LCK A;  4J9E A;  1T0H A;  2X3X D;  3TSW A;  1NEB A;  4K11 A;  2F2V A;  2C0O A;  2C0T A;  5GJW B;  1K1Z A;  1B07 A;  2YT6 A;  1OOT A;  2EBP A;  2FEI A;  2DA9 A;  5ECA A;  1IO6 A;  1H8K A;  2DM1 A;  3VS3 A;  1KSW A;  2L3S A;  5FWB A;  1ZBJ A;  3VS2 A;  2KRM A;  2EYW A;  4M4Z A;  1ZUU A;  2D8J A;  2LQN A;  3A98 A;  2KT8 A;  2RQT A;  1BU1 A;  3PVQ A;  1X6B A;  2KT1 A;  1UHF A;  2CT4 A;  1G83 A;  1UE9 A;  1B3Q A;  1AEY A;  1AOJ A;  2QDL A;  1AWW A;  1ZUK A;  2KXC A;  2DYB A;  1K0S A;  3NGP A;  2LJ3 A;  2PNI A;  5GJV B;  1K9A A;  1UDL A;  1BK2 A;  2M0Y A;  2XMF A;  1JQQ A;  2ABL A;  3QWY A;  1KFZ A;  2GTJ A;  1FMK A;  3M0R A;  1KIK A;  1S1N A;  4F16 A;  2FPE A;  1OV3 A;  4A63 B;  2JT4 A;  1T0J A;  2CRE A;  1Z9Z A;  1WFW A;  1YNZ A;  4HXJ A;  2KYM A;  4OML A;  1RLQ C;  3UF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...