3I9QA

Crystal structure of the triple mutant s19g-p20d-r21s of alpha spectrin sh3 domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
57
structure length
57
Chain Sequence
KELVLALYDYQEKGDSEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The effect of a proline residue on the rate of growth and the space group of alpha-spectrin SH3-domain crystals.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
molecule keywords Spectrin alpha chain
total genus 14
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2009-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3i9qA00
2C0TA 1LCKA 2O9SA 5IH2A 1GRIA 1SRLA 1WYXA 5IXBA 1H3HA 1VYUA 2BZXA 1ZUUA 4QT7A 1SRMA 2HDAA 1E7OA 2ED0A 2E5KA 1SHGA 1MV3A 2EGEA 3QWXX 2O9VA 2DVJA 2KEAA 1QCFA 1OEBA 1QKXA 3I5SA 5HCKA 2X3XD 2K79A 2KRMA 5I22A 2YT6A 1WXBA 4OMOA 2RQVA 4RTZA 2AKKA 1NM7A 5FW9A 2YUOA 3PVQA 1WI7A 1WIEA 2CUDA 4J9DA 4HXJA 5IHIA 3M0SA 2LQWA 2H8HA 1KJWA 1SSHA 1K0SA 1KFZA 4CC3A 2RQUA 4OMMA 4IIOA 3THKA 2DNUA 3I35A 4HVUA 3UF4A 1AZGB 2LX7A 3O5ZA 2M51A 4RTTA 3ULRB 2KRSA 2LQNA 4JJDA 4WCIA 1BB9A 2RQWA 4RTVA 1CKAA 1M8MA 1NYGA 2BZYA 2EKHA 1K0XA 1RI9A 2V1QA 2EYYA 5ECAA 2KNBB 2J7IA 1T3LA 2EYZA 2L2PA 3TSWA 1Z9ZA 2FRWA 1J3TA 2PTKA 2AZVA 2OAWA 2F2VA 4J9FA 3EG1A 1G2BA 4HVWA 4K11A 2BTTA 3QWYA 4FSSA 2J6FA 1U3OA 2LMJA 1BK2A 2C0IA 1GL5A 2EW3A 1K4US 3H41A 2DRMA 2CT3A 1GBQA 4DEYA 4J9IA 4GLMA 4Z89A 2EVRA 1PRLC 2JS0A 2LZ6B 1JU5C 4AFUC 1WDXA 4Y92A 4J9CA 2YSQA 1EFNA 1FYNA 1UE9A 1YNZA 2KBTA 3PE0A 1TUCA 1GFDA 2O88A 2SEMA 1RLQC 2FO0A 1K76A 4A63B 1HSQA 2K9GA 2DL3A 1W70A 2B86A 3VS1A 2VWFA 1X69A 3REAB 2YUPA 2RNAA 4F14A 5L23A 2AK5A 4AG2C 2RF0A 2XMFA 2JM9A 2OI3A 4DEXA 1AWXA 2O31A 2LP5A 4LUEA 1HJDA 1AWJA 1I1JA 1VYVA 1AEYA 1M30A 3VRZA 4JPBW 4JJBA 2CSQA 2RQTA 1K9AA 1B3QA 2BZ8A 2KXCA 2DL8A 1JEGA 2NWMA 4ZNXA 1CKBA 1TG0A 3FJ5A 5FWBA 2LCSA 3UA6A 3TVTA 1GCQA 2MIOA 1ABQA 2LNHB 1ZBJA 3NPFA 2D8JA 2JTEA 2CDTA 2HSPA 1JXMA 3UA7A 2DLPA 2W0ZA 2J06A 4AG1C 1MUZA 2YUNA 1W1FA 2AZSA 2GGRA 1NEGA 1K1ZA 1T0JA 3I5RA 4AFZC 1ZSGA 1ZLMA 1UJYA 5EC7A 4OMQA 3A98A 1AOJA 3NGPA 3GBQA 1AZEA 1A0NB 4JZ3A 1ZUKA 2CH4A 3VS5A 5IHNA 2DA9A 2DL4A 2L3QA 1VYTA 3ZL7C 2MOXA 1UUEA 4CC2A 2JS2A 1GBRA 1OPKA 1OV3A 2OJ2A 2KR3A 3KFVA 4E6RA 1SPKA 2RPNA 2HEQA 1ABOA 4RTWA 2V1RA 4ORZA 2JW4A 1UJ0A 2EYXA 4LUDA 2NUZA 1NLPC 2JXBA 2ENMA 1WX6A 4LNPA 5IHKA 1U06A 1H92A 4ESRA 1NYFA 2JT4A 2DBMA 5FWCA 3TSZA 1PNJA 2J6KA 2LJ3A 2F2WA 3M0RA 3M0TA 2C0OA 4AFQC 1UGVA 2LJ0A 1X2KA 4OMLA 1QLYA 2DF6A 1TUDA 2KT8A 1KSWA 5IXFA 3JV3A 3H0FA 1T0HA 2L3SA 1PKTA 1OPLA 1PHTA 2KE9A 1I0CA 4M4ZA 1QWFA 2SRCA 1JXOA 2CUBA 2GBQA 2X3WD 3EHRA 1E6GA 4RTYA 3R6NA 3RBBB 2KT1A 1V1CA 2EGCA 2RN8A 2ROTA 4X1VA 2O2OA 2CH4W 3REBB 3RNJA 2K7AA 1IO6A 1NEBA 2RQRA 2FPDA 2J6OA 1CSKA 2ROLA 1U5SA 1ZUYA 2EBPA 4F17A 1JQQA 2FEIA 3H0HA 1VA7A 2LJ1A 2DM1A 2DMOA 4JZ4A 4D8DA 4IIMA 4LN2A 1SEMA 4R0KA 1RLPC 2EGAA 2KGTA 1E6HA 2IIMA 4D8KA 4RTXA 3SHWA 1AWOA 2DRKA 1X6GA 3UATA 4GBQA 2YUQA 3C0CA 2A37A 1FMKA 1BBZA 2A36A 1GFCA 1N5ZA 2MCNA 1UECA 2DE0X 1X2QA 1AWWA 3IQLA 4OMNA 2D0NA 2RMOA 4JJCA 2GTOA 1Z9QA 2QDLA 1WLPB 2FG0A 1I07A 5GJVB 4AFSC 4Z88A 1X43A 1UFFA 4J9BA 3EHQA 1X6BA 2GTJA 1M3BA 3M0QA 2A08A 1QWEA 2CT4A 1MV0B 3EG3A 1UHCA 1WXTA 2L0AA 1SHFA 1GCPA 2GQIA 3VRYA 2F2XA 1S1NA 2P4RA 1WA7A 1UG1A 2DILA 1UDLA 1WFWA 3VS6A 2AKLA 1ZX6A 1G83A 4EIKA 5GJWB 2EPDA 1BU1A 2JMCA 3VS2A 4CC7A 2M0YA 1M27C 1PKSA 1AD5A 1QKWA 4RTUA 2EYWA 1YCSB 3PVLA 1M3CA 2ABLA 2YDLA 1XOVA 4J9HA 2KXDA 4HCKA 1UTIA 2EQIA 3NHNA 5I11A 1JO8A 1ARKA 1UHFA 4CC4B 3M0PA 2K2MA 1YP5A 4KRTA 2HBWA 1X27A 2KRNA 2KYMA 2DX1A 1B07A 3EGUA 2W10A 2I0NA 3I9QA 3EG2A 2G6FX 1YWPA 2PNIA 2VKNA 4RUGA 2CREA 1PWTA 2D1XA 2GNCA 2DYBA 2ESWA 1W6XA 3EG0A 1WXUA 1Y57A 3CQTA 3M0UA 4OMPA 3VS7A 3SEMA 2CSIA 1H8KA 4Z8AA 1NG2A 3VS4A 3H0IA 1YWOA 2L3PA 2FPFA 2K6DA 2JMAA 2K3BA 1T3SA 2DBKA 2PZ1A 2HCKA 1Y0MA 2DJQA 1AVZC 2ECZA 1RUWA 1GCQC 1M3AA 2VVKA 3NMZC 3VS3A 1NLOC 1HD3A 1OOTA 2KROA 4HVVA 2FPEA 1KIKA 1YN8A 3U23A 2J05A 4F16A 2DL5A 2FRYA 3LH5A 4LE9A 2DL7A 4J9EA 2A28A 2D8HA 2JM8A 2ED1A 2KYBA 4J9GA 3VS0A 1PRMC
chains in the Genus database with same CATH superfamily
1XQHA 1MMAA 2FHDA 2O9SA 5IH2A 2FVUA 5IXBA 1Y07A 1Q82R 1ZUUA 3CXCP 3RKWA 2E12A 1SRMA 1YJ9Q 2EGEA 3QWXX 3RUXA 2O9VA 5KYYA 5DY9A 2KEAA 1ZSZA 2GQVA 3DKMA 2HQXA 3A8LB 2JNGA 1NM7A 3QZ5B 1G3WA 4FL6A 4FT2A 2L5QA 5GMKm 1WI7A 1M8VA 2R57A 2CP3A 4HXJA 3UPUA 2RA2A 1VQOQ 1VQKQ 3MP8A 4DBFA 1QVGS 2H8HA 1K0SA 1QVFP 1KFZA 4CC3A 4M7DB 1M1KU 2DNUA 5KYNA 4HVUA 4HA8A 4ME7A 2NYSA 3UF4A 2JVVA 2RK2A 1BCMA 2M51A 4MDWA 2E4HA 5LJ5h 4A4EA 1EX4A 3VUZA 2QGGA 1FX7A 2XI9A 1Y71A 3BDUA 2KNBB 4C8QG 2EYZA 3RESA 1Z9ZA 2QA4Q 2EQKA 5CAIA 1LPLA 4DBRA 4II1A 1K73R 2PVDB 4KH0B 1G8XA 2OAWA 3NTIA 3CCVT 2GFUA 5DLQE 1TWBA 2LRQA 4FSSA 2J6FA 3OBWA 1BK2A 5CR2A 2RD1A 3OW2A 3OYMA 2X9HA 5FROA 4Z89A 3M59A 2JS0A 4M7AF 3JCMV 5GAOl 2CP0A 5GMKe 1V29B 4JUVA 5GANg 5LL6S 1WDXA 2P0QA 3URGA 4N4GA 2DETA 3CCRA 2VUBA 2SEMA 3CC2Q 2FO0A 1K76A 4C5GA 4OGEA 3CC4T 2K9GA 1M90U 1IB8A 3JCMd 1W70A 2YHTA 3QYGB 2K5FA 1U8RA 2NUPA 1X69A 4F14A 3CC7Q 2DZ9A 3A8MB 4AT1B 3QJYA 2OI3A 1VQ7T 2OTJA 5GAN2 3VUBA 5GAMf 5FLXE 1M30A 4JPBW 3CCJT 1B3QA 1QW1A 2KXCA 5GAMh 4PFZA 3S3MA 2OTJT 3FJ5A 3VJPA 1HYOA 2CP6A 3MJXA 3L42A 1OZ2A 2EQJA 3MEVA 2CDTA 2QYZA 2DXBA 2RJFA 2DLPA 2QEXT 4M77G 1QVGP 1W1FA 3FEOA 4KGZB 2AZSA 3CC2A 2K5LA 2V26A 2LDMA 4ZGJB 1YFNA 3H6ZA 4ZN3A 1Y7XA 3I5RA 3OYFA 3CCST 4AFZC 1H3ZA 4N4HA 4PJOD 2EWNA 5EC7A 4PJNA 2LCLA 5A0LA 1BCOA 3D7SB 4E7KA 1YITA 4PLLA 1AZEA 1A0NB 4N0AA 5D6WA 1ZUKA 4J6XA 2EAYA 2KMTA 2L3QA 1VYTA 3JCMh 3JB9G 4KBMB 1IGQA 2K5IA 4B9WA 1KD1C 3ER0A 2XDDA 4EMKC 2PQWA 3OSSC 2FYKA 2BIVA 3EG9B 5AT1B 4E2FB 3ZFJA 2HEQA 1UJ0A 4F7UG 1NLPC 2NUZA 2FZKB 4E7HA 2ENMA 2WSEE 1DJ7B 4EMKA 2KVQG 2MF2A 3OBYA 3OMCA 5GAMg 2ZPHB 4BUGA 2DIGA 3MHXA 5HKCA 1X2KA 4PJJA 2A7YA 1TUDA 1QQJA 3S6WA 3JV3A 4M75C 3OYHA 2VXEA 1R0CB 3TQ7P 2DIQA 2EQUA 2X51A 2KE9A 1KQSP 1I0CA 3OS5A 5LJ3h 4RTYA 2NUTB 1VIEA 1PD0A 1VQPQ 1VQLA 2B8AA 3VKIA 5A0GA 2DO3A 3RIRA 1D0ZA 3CCSA 2K7AA 1VQ4A 1YJWT 4Q5WA 1OYXA 2ROLA 2XDBA 3CEYA 4C92A 2EBPA 4F17A 3CBOA 3G6EA 3CC4A 3TREA 5GAMj 3NTHA 4C8QF 2DMOA 4JZ4A 2MWPA 4OP0A 4OB3B 1SEMA 3JSCA 5KYUB 2EGAA 4A4KA 1M4ZA 1YHQT 1K8AC 4FSXA 3OYKA 1IREB 4OMFB 3OYGA 4GBQA 2QA4T 1WNLA 2DJZA 1OU9A 1I4K1 3IQLA 3UWNA 4M7AG 2RMOA 3CCLA 1VQLQ 2QDLA 5CKBA 2HL3A 3E9FA 2I2LA 5GJVB 3LLRA 3MEAA 3CCSQ 2WSCE 3ZEHA 1MMNA 1VQLT 2E6NA 2R58A 3M0QA 2A08A 2CT4A 1MV0B 4L5GA 1WHMA 1WXTA 2L0AA 4AMCA 3VRYA 2F2XA 1S1NA 2P4RA 4Z02A 1UDLA 1ZSZC 2ZGWA 2AKLA 1G83A 1KD1R 5GJWB 2EPDA 2M0YA 3DB4A 3OW2S 3SWNC 3RERA 3PFSA 4J9HA 3JCMQ 3NFCA 3RKXA 2BE9B 2EQIA 2HKQB 2E3IA 5I11A 4E7LA 3CMEA 3OB9A 2K2MA 4ZN1A 4PJLA 2HBWA 1X27A 3V8LA 2H3JA 1WQWA 2G6FX 5GAOr 1N8RC 1SSFA 3R6OA 3OYLA 3G1JA 1YJ9A 1W6XA 3JB9I 3CPFA 3CD6T 3X28B 1NPRA 1WPYA 4OMPA 1VQ4T 1YJWA 2CSIA 1SKUB 3H0IA 5KYWB 3G71Q 2L3PA 2FPFA 2K3BA 2PZ1A 2Y90A 2DJQA 1AVZC 1O9SA 4JS4A 1RUWA 8AT1B 1NLOC 4O5VA 4LXCA 4HVVA 3QDFA 5GMKl 2E64A 4PLIA 3CMEQ 2DL5A 4M75E 1VQ6T 4PJMA 2X4JA 2JM8A 1PCXA 5CO7A 1PG5B 3VS0A 1PRMC 2BUDA 2EIFA 3JCMX 1R77A 2HDAA 2X4XA 1MV3A 2DVJA 2KSSA 2XHCA 5KYYB 1QCFA 1QKXA 3I5SA 2E10A 4M77E 5I22A 4NL3A 2YT6A 4F7UB 4OMOA 4FYVB 4BB7A 1VQNA 1C1AA 4M75B 3AT1B 4MDXA 1K73U 3LGFA 2HSEB 2V8JA 5IHIA 1IXDA 3M0SA 4M7AB 4E47A 2LQWA 4C92B 1KJWA 1M90C 3GLXA 1NJIC 2O4XA 3THKA 3WVEB 3I35A 1AZGB 1ZHIA 4FYXB 1M2OA 3QSUA 4F7UA 4JJNK 3ULRB 2KRSA 2JN0A 4WCIA 1VQMQ 2RQWA 4RTVA 1CKAA 1NYGA 2EKHA 3CCRQ 2X4WA 1WHGA 4EMGA 1T3LA 3V8JA 1OQKA 1KQ1A 3CCJQ 5CKHA 1Q86U 1M90R 5KH6A 3P8HA 3OYAA 3CC7A 1J3TA 2PTKA 2AZVA 3S3OA 1VQNQ 2F2VA 3J81E 2OTJQ 1G2BA 4FU6A 4HVWA 4C0FA 1NE8A 3QWYA 2DXCA 4EMKB 4M7AC 2AIRB 1U3OA 1K4US 1GL5A 2EW3A 1Q7YU 2CT3A 1GBQA 5C6SA 2EJFA 1PRLC 1RAGB 1S72A 4B6MA 4TVRA 1LOJA 4M77F 4J9CA 1VQMA 1ZSZB 2O88A 4E7IA 1RLQC 2HZYA 2XD0A 4X9DA 4A63B 1HSQA 2COZA 1S72T 2B86A 1KQSA 2JTFA 3VS1A 2VWFA 1OI1A 4C92E 3CCJA 1IHVA 3DLLA 3EH2A 2AK5A 1MMGA 2Y4YA 3DLMA 2XMFA 4M7DD 2JM9A 1KG1A 4DEXA 2O31A 2M0OA 4DOWA 4KUIA 4LUEA 1AWJA 1PSFA 5GMKj 4JJBA 3EFOB 5KYUA 1I5LA 1HXDA 2DL8A 1JEGA 4ZNXA 5FU7C 1IRXA 3GNGA 1TG0A 3UDCA 1XTDA 2LCSA 3AHUA 1M1KR 2DXTA 3MO8A 3NPFA 3JCMJ 2BE7D 2JTMA 3UA7A 2FL7A 2RJDA 1QP2A 4AG1C 1BYMA 2QTVA 2QXFA 1ZSGA 3OS0A 1UJYA 4CI0C 4R55A 3VU3C 4OMQA 2VXFA 3CPWP 1K9MC 1V76A 2GF7A 2E1HA 2K2VA 3OY9A 3VS5A 2DA9A 3RMSA 2DL4A 3CC2T 1Q86R 3ZL7C 2MOXA 5LJ5d 2HBPA 2JS2A 1OPKA 4BE0A 1VQPA 1MHNA 3QDRB 2V1RA 4LUDA 1EZZB 4EPCA 1K8AR 1D1BA 4EDUA 1WHKA 5IHKA 3M56A 2VYTA 1LJOA 1NYFA 3HL8A 4X34A 2JT4A 2DBMA 5FWCA 3SWNB 5GMKi 1PNJA 2J6KA 3FC3A 3C12A 1RAAB 1UGVA 1KK7A 3OW2P 4FYYB 4C92F 4LDXA 2LJ0A 4OMLA 3LX7A 3OA6A 2DF6A 2OTLQ 3OYJA 1KSWA 3QKJA 3E2UA 2DPPB 2NLUA 1T0HA 4NOYA 1OPLA 3QBYA 4C92C 4M4ZA 4KGVB 4FCYA 1E6GA 4FW1A 2LTOA 3PGGA 2KT1A 2ROTA 2RN8A 5D6YA 4JS5A 1H641 5LJ3d 4M78A 3L2RA 1IO6A 2QG9B 1BKBA 2RQRA 4A53A 3HKSA 2J6OA 2LC4A 1JQQA 2QAZA 1VA7A 2K4YA 3LGLA 3OSVA 1RAIB 1ZQ1A 3O8VA 3CCRT 1RLPC 1O75A 2L89A 2OTLA 2YUQA 2A37A 2YRVA 4C92D 3G4SA 2A36A 2JUFA 3PTAA 3L2WA 2EQMA 2COWA 1GFCA 1N5ZA 4UC4A 4BI3A 2YRCA 4OMNA 1BIBA 2D0NA 4JJCA 4J6YA 1UGQB 2KI7A 3E1SA 1WLPB 2CZ6B 3CD6Q 2FG0A 1I07A 3V7SA 4Z88A 1X6BA 3BDLA 5LJ5f 1M3BA 2RI3A 1YJNT 1N9SA 1UHCA 1VQOT 3C94A 3JCMe 2GQIA 2DILA 1WFWA 3VS6A 1K8AU 4XTXA 4EIKA 2KDSA 2A0FB 3M58A 1BU1A 1YJWQ 2O4XB 2QQBA 1M27C 1PKSA 1VQ8T 2RHZA 3META 3PVLA 1UGSB 3G71A 1M3CA 3X26B 5GANh 1YCYA 3G4SQ 4RG2A 3A8OB 5CCAA 4HCKA 3QIIA 1MNEA 5IN1A 3HHTB 1UGPB 1JO8A 1ARKA 2KQWA 1Q82C 1YHQQ 4YTLA 2PUKB 9ATCB 3CD6A 4HCBA 4CC4B 4CRIA 3V8KA 4LDUA 1FWZA 2KYMA 3SFMA 2KY9A 2W10A 2I0NA 6AT1B 4M7DG 3EG2A 2PNIA 1PWTA 3CCMQ 4DA4A 2ESWA 4M77A 5LJ3f 1BI3A 1C6VX 4M77B 3EG0A 1WXUA 5KE2A 3C4SA 3VS7A 3FLGA 4A54A 3SDZA 2K3XA 3EGXA 1NG2A 3VS4A 2K6DA 4OGCA 1T3SA 2DBKA 3EFRA 3M5AA 4M7DE 2KAFA 3LWHA 5J26A 3QXEB 1GCQC 1W4SA 2VVKA 3NMZC 4C5IA 3E9GA 4F04B 4J5YA 4HCZA 1VQ5Q 1QP3A 1YN8A 3U23A 4NL2A 4L6V5 1TUGB 2FRYA 3LH5A 4J9EA 5GANj 2D8HA 2KYBA 1HK9A 4J9GA 2VGMA 1AHJB 4XU0A 1AT1B 2X35A 3FRNA 1SRLA 1WYXA 2E3HA 3CCMA 4QT7A 4J7FA 3MEWA 3RMQA 1SHGA 3KXTA 3QG1A 2K79A 2KRMA 4XK8E 2HQEA 1KD1U 3OYCA 2AKKA 2ZPEB 1QVPA 2F5KA 1MNDA 5FW9A 2YUOA 4ELZC 1M1FA 1YI2Q 1M5Q1 3KUFA 3PVQA 2O01E 3PT9A 1RADB 1WIEA 5KYXA 2QQAA 2EJ9A 3FJPA 5FU7B 1R8OB 1VQ5A 3M54A 1SSHA 2RQUA 4OMMA 4BACA 4IIOA 2VGNA 1VQKT 1JJ2P 5CVIA 2BKDN 1S72Q 2LX7A 3CBPA 4IUTA 3JB9D 2PU9B 3O5ZA 2E5QA 5LJ5e 3CPWA 1Y96B 1D3BA 4P5NA 1M2VB 1BB9A 2COYA 4J6WA 4C8QB 4PK4A 3HRSA 1K0XA 4JLGA 1RI9A 1Q81C 5ECAA 5LJ5j 2J7IA 2L2PA 3TSWA 4OVAA 2IG0A 2FRWA 4N0AC 3GNFB 1PD1A 2VC8A 4MZMA 4NS5A 3EG1A 2QDYB 1BI1A 3JCMb 4J83A 4PL6A 4K11A 2BTTA 4QVDA 1B34A 4LD9K 2LMJA 4FYWB 2C0IA 3GP8A 4JRKA 5J39A 2DRMA 4J9IA 4GLMA 2RH2A 5L8RE 1JU5C 4HT9A 3HFNA 4VUBA 1XJWB 1W2BA 3J80E 4ZTFA 4Y92A 1G3YA 4JRQA 1JJ2S 4IUQA 4PKCC 4DOVA 4BI4A 1EFNA 3L1AA 3CXCS 1X01A 3CMAQ 1FYNA 1UE9A 1YNZA 2HMAA 1VQPT 1GFDA 1TUCA 4M75D 5LJ3e 1OZ3A 1Q81R 1N27A 2DL3A 5I2SA 3CBMA 3A5ZB 3MPUB 1VQ5T 4FT4A 2DTIA 3A1PA 3REAB 2RNAA 4A4GA 3LWIA 2QTXA 1X75C 2DKGA 5D7UA 2CZ7B 4WF2A 5LJ3j 2RF0A 4DBHA 1AWXA 1TSFA 3HRTA 2RO0A 3EG9A 3RR6A 1HJDA 1I1JA 3EGDA 1GXIE 2CSQA 4J7IA 1OX8A 2RI5A 2CS7A 3ASKA 1K9AA 2BZ8A 2NWMA 2Y4XA 2DYIA 4C5EA 1WHJA 3TVTA 4JDSA 1GCQA 3EAEA 2MIOA 1ABQA 4GY5A 2LNHB 2D8JA 1MMDA 3JCMf 1JXMA 5FRMA 1X6OA 2F5TX 2L3RA 1U1TA 2W0ZA 1MUZA 2YUNA 2GGRA 5GAN8 3SD4A 1T0JA 5FU6C 2F69A 3M9QA 3MP1A 4C5HA 3M4YA 3JB9J 5CIUA 1RACB 2CP5A 4PNOA 5CKEA 2RHXA 1I8FA 3NGPA 3GBQA 1RABB 3FIFA 2CH4A 3V7RA 5IHNA 2RB6A 2XICA 2P4TA 1F1BB 3A8HB 4IUUA 4M75G 4XTVA 1QVFA 1GBRA 1BI2A 1OV3A 2OJ2A 2KR3A 4Y28E 2CZ0B 5CQYA 2V8KA 1Q7YR 2RPNA 1ABOA 5GAMd 4RTWA 4J8OA 4ORZA 3VYGA 3JCMg 2EYXA 3GF5A 4MZPA 4XU1A 5GAOm 1XNIA 2D6FA 1WX6A 3BY7A 4LDWA 1U06A 2VB6A 1H92A 3TEEA 1QCNA 2E41A 5GAOp 4A4HA 2RM4A 5FU6B 1D1AA 3QYHB 2F2WA 2QGFB 3M0TA 4AFQC 2YRDA 1Q81U 1I81A 1BIAA 5IXFA 3H0FA 3I55T 3ME9A 2L3SA 4R56A 1PKTA 1PHTA 1C0MA 5I2MA 3CCEA 2SRCA 3HFOA 2GBQA 3EHRA 2QASA 1N9RA 2X3WD 1YIJQ 2RJCA 3GOXA 1V1CA 4X1VA 3X24B 2O2OA 4LDVA 5A2QE 3RNJA 1NEBA 1FMWA 3JCMW 3QUIA 2YLBA 2CZ1B 4E7SA 1ACMB 1U5SA 1ZUYA 4OB1B 4M77C 4GLKA 2LJ1A 4RCBA 2LVMA 4LN2A 2DVEA 2XK0A 3M57A 4BY6B 1VQNT 4R0KA 2LT4A 4PJOA 1E6HA 4D8KA 4LDYA 2YXYA 2QQSA 5I21A 2NUPB 3SHWA 5GANd 1AWOA 3LW5E 4DBQA 5KCOA 1QMCA 1SF9A 4M78F 1BBZA 3H8ZA 4IKFA 3QZ9B 3M53A 4ATOA 2DE0X 3CCEQ 1AWWA 1NZ9A 2IPOB 2QEXQ 8ATCB 1PM3A 1YIJA 1YHQA 4PFPA 2DAQA 1Z9QA 2JJ9A 3CCET 4AFSC 1ZA1B 3EHQA 1IGUA 3CCQQ 2M1HA 2CGHA 3I56Q 5GAN3 1QWEA 3CXCA 2RK1A 3EG3A 4WTOB 1SHFA 1JJ2A 1UB4A 2HD0A 4PFOA 4PJOG 3I56T 1KC8R 3JCMP 1JBMA 4M78B 1WA7A 4BY6C 2RHUA 2P0KA 1ZX6A 3VS2A 2JMCA 1AD5A 5GAMe 4OB2B 1N8RR 2PVGB 2EYWA 1YCSB 3RDVA 5KCHA 2ABLA 1TH7A 2L8DA 4Y91A 1VQMT 2XU8A 2MWOA 1Y96A 2YLCA 2KK4A 3M4GA 4QKUA 3VV0A 2NUTA 3NHNA 3V7CA 1WJRA 4BI8B 3HP9A 7AT1B 1YP5A 2KRNA 3CCQA 4M7DA 1B07A 3EGUA 2MK5A 4MZTA 3I56A 2K57A 4RUGA 5HK0A 2G3RA 2ZPIB 2PUOB 2GNCA 5IT9E 4OF1A 4C92G 1EIFA 2K3YA 3M0UA 3QO3A 1QCOA 4E7JA 5J3BA 4Z8AA 3WVDB 5CK9A 2M16A 2DD4A 1YWOA 1B7TA 2HCKA 2RI2A 2XDPA 3OS1A 1YI2A 2P84A 1Y0MA 3OS2A 5IAYA 3CMET 1M3AA 1RI0A 4KT0E 1RAFB 2GCXA 3OYYA 3PMTA 1VQ6Q 3I55A 3L2VA 5GAN5 2J05A 4KH1B 2DL7A 1IZ6A 2A28A 3WXMB 1WHLA 3OYDA 4C0DC 3L2ZA 5HK3A 2D9TA 2GFAA 2LX9A 3GPLA 1OU8A 1M1KC 3OYBA 2C0TA 1LCKA 1I5OB 1GRIA 1M1GA 2DEQA 1H3HA 1VYUA 2BZXA 3CCLT 1E7OA 2ED0A 2E5KA 1UEBA 1N6AA 3PIPA 1Q7YC 1NPPA 5CQXA 1OEBA 3C95A 1YITT 5HCKA 2X3XD 4XU2A 1WXBA 2F1LA 2RQVA 1RAEB 4MMLA 4RTZA 3MKDA 2JOYA 3BW1A 2QI2A 1MGQA 3HRUA 1QVGA 5GANe 2CUDA 1N8RU 2ZAEA 3X25B 4J9DA 1TOVA 1VQ6A 4O6JA 1KHIA 3I55Q 4BE1A 4PJOC 3HPWA 5DLOA 2QK0A 4RG8A 4C0DB 4ZGEB 5C0MA 4PJOF 1IHWA 2DFUA 5DM7R 4M77D 3P8BB 2RHIA 4RTTA 2DEUA 1Q82U 2LQNA 4JJDA 1M2VA 5LJ5g 1M8MA 3CMAA 2E6ZA 2BZYA 2V1QA 1VQ8A 5GAOn 2EYYA 4BDYA 5KYXB 1K9MU 2HAXA 3MP6A 2X4YA 2LQ8A 2ATCB 3QJ6A 4J9FA 4ZGDB 1VOMA 3EFOA 1PSEA 1YJ9T 2EYQA 3RKYA 4PJOB 1VQOA 3H9NA 1VQKA 1OULA 3H41A 2H3EB 1Q95G 2RJEA 3E19A 4DEYA 2ZPGB 2EVRA 3CCUT 2LZ6B 1D09B 4A4FA 3NTKA 2DZCA 4C8QC 4AFUC 4BD3A 3SB2A 2YSQA 4OB0B 2R5MA 2KBTA 3PE0A 2FB7A 1VQ8Q 1PC0A 2RHYA 2CP7A 2IVWA 1NBEB 4C8QA 3T9NA 3FDRA 2QA4A 4IURA 2YUPA 5L23A 4AG2C 3OQ5A 1D0XA 4ANJA 4M7AA 4M75F 2LP5A 1WHHA 1NJIR 2C06A 1BI0A 4C0GA 1VYVA 2QQ9A 1AEYA 4JRPA 1KQSS 2LT1A 2MPXC 3VRZA 2HNIA 2E70A 4MMKA 2RQTA 4QVZA 4C8QD 2FZCB 5KE3A 3VYHB 1CKBA 5EG2A 4XU3A 2YWWA 5FWBA 3UA6A 2ZCFB 3KBGA 4RKUE 3X20B 5CKFA 1ZBJA 2JTEA 4KUDK 2HSPA 3INZA 4HT8A 4RCCA 2J06A 3F70A 4F7UE 1QVFS 1NEGA 1K1ZA 3JCMc 2ZPBB 1D0YA 2LCCA 3JB9H 3QHSA 4D6WA 2DD5A 3G7ZA 2DTHA 3EGDB 1LNXA 5GAN6 1ZLMA 3JAME 1YIJT 3A98A 1SG5A 1AOJA 2LQKA 4JZ3A 4ZTJA 1ZA2B 5GANf 1Q86C 1UUEA 4CC2A 2P0PA 3N5BB 3J7AF 3KFVA 4V2SA 3CC7T 1G5VA 3JB9F 4E6RA 3QPHA 1SPKA 2CKKA 2JW4A 2JXBA 5GAN4 1TTHB 4IUVA 4M78C 4LNPA 4M78G 4ESRA 1TS9A 2R5AA 3MEUA 3TSZA 4KGXB 2LJ3A 3M0RA 2C0OA 3PMIA 3FB9A 1YI2T 3S3NA 1QLYA 4IUPA 2KT8A 1YITQ 3Q1JA 5M9OA 3CCMT 2OX7A 2MYSA 4QW2A 1K73C 1UGRB 2M9UA 2OTLT 1VUBA 1QWFA 1JXOA 1WJQA 3R6NA 2CUBA 2QEXA 2PVOB 5LJ3g 2VASA 3RBBB 2EGCA 1G3TA 1OX9A 1YJNA 1NJIU 4XQ3A 2CH4W 2MAMA 3REBB 3EGXB 2MI6A 4M78E 4N4IA 1W2BP 4QQDA 4KULA 2FPDA 3BFMA 1CSKA 2FEIA 2V8IA 1KC8C 3H0HA 4XTWA 2DM1A 4D8DA 4IIMA 4C8QE 1VQ9A 1KC8U 2KGTA 3CCVQ 4QQGA 1VQ7A 2IIMA 4EMHA 4RTXA 2DRKA 1X6GA 4QQ6A 3UATA 1WGSA 4HKEA 3OYNA 3C0CA 4XTYA 2XIDA 1FMKA 2OAUA 1WJSA 5AYFA 5KYWA 2MCNA 3OYEA 1UECA 2HQHA 1X2QA 3JRZA 1G3SA 4HCCA 3EH1A 4XTUA 1YJNQ 2GTOA 2HL5C 3LYIA 1RL2A 3OYIA 1X43A 1UFFA 4FIBA 5D6XA 3CPWS 4PJOE 2FZGB 4J9BA 1VQ4Q 1U1SA 1M9SA 2GTJA 3CCUQ 3ZBDA 4BE2A 2AHJB 3G71T 2DTOA 3G6EQ 1GCPA 3A8GB 1RAHB 3CC4Q 4X9CA 1VQ9T 3HSBA 2VV5A 1JRIA 2CP2A 1KHCA 1UG1A 2ZZDA 3G6ET 1ZBXA 1VQ9Q 3HTRA 2EJGA 4CC7A 3DB3A 1R0BG 3CCVA 1QKWA 5HY6A 5A0DA 4RTUA 2DXUA 1VQ7Q 3GIBA 4M7AE 4FW2A 2YDLA 1XOVA 4FM4B 4DQ2A 5GMKh 1FXXA 1K9MR 2MMPA 2Z0WA 3L2QA 1TU0B 2KXDA 1UTIA 3LH0A 1VIFA 2A3LA 4M75A 3PNWC 5CKDA 2LNVA 2E65A 3G4ST 2DK3A 2XKOC 3SWNA 1KQ2A 3TU4K 3L2UA 4B9XA 3UT1A 4E7ZA 1WQ7A 1UHFA 2ZPFB 3CCLQ 3BE3A 3M0PA 4KRTA 3PIOA 4L59A 3P8DA 4ELYC 2DX1A 2D0QB 3TCJA 1FMVA 3I9QA 3CCUA 4M7AD 3EFSA 3OMGA 1YWPA 2VKNA 2CREA 2WSFE 1WZOA 2D1XA 1B34B 4BDZA 2DYBA 2EKOA 1TXQA 3MCAB 4F7UF 4M7DF 1Y57A 1LVKA 2AT1B 2XG8D 3CQTA 1YBYA 2QQRA 4XAXB 3SEMA 3CCQT 2HKNA 4RMOA 1H8KA 1JB0E 1W2BS 4C0ZA 2JMAA 4QVCA 5GAN7 3CMAT 2WACA 4XTZA 2ECZA 2M02A 2CYZB 3VS3A 5FRNA 3M55A 1HD3A 1OOTA 2JZ2A 2KROA 2FPEA 1KIKA 1D3BB 4JLIA 4F16A 5GAOq 2EFIA 4JRIA 4LE9A 4M7DC 4M78D 2ED1A 1P92A 4LD6A 2DERA 1D1CA
chains in the Genus database with same CATH topology
2C0TA 1LCKA 2O9SA 5IH2A 1GRIA 1SRLA 1WYXA 5IXBA 1H3HA 1VYUA 2BZXA 1ZUUA 4QT7A 1SRMA 2HDAA 1E7OA 2ED0A 2E5KA 1SHGA 1MV3A 2EGEA 3QWXX 2O9VA 2DVJA 2KEAA 1QCFA 1OEBA 1QKXA 3I5SA 5HCKA 2X3XD 2K79A 2KRMA 5I22A 2YT6A 1WXBA 4OMOA 2RQVA 4RTZA 2AKKA 1NM7A 5FW9A 2YUOA 3PVQA 1WI7A 1WIEA 2CUDA 4J9DA 4HXJA 5IHIA 3M0SA 2LQWA 2H8HA 1KJWA 1SSHA 1K0SA 1KFZA 4CC3A 2RQUA 4OMMA 4IIOA 3THKA 2DNUA 3I35A 4HVUA 3UF4A 1AZGB 2LX7A 3O5ZA 2M51A 4RTTA 3ULRB 2KRSA 2LQNA 4JJDA 4WCIA 1BB9A 2RQWA 4RTVA 1CKAA 1M8MA 1NYGA 2BZYA 2EKHA 1K0XA 1RI9A 2V1QA 2EYYA 5ECAA 2KNBB 2J7IA 1T3LA 2EYZA 2L2PA 3TSWA 1Z9ZA 2FRWA 1J3TA 2PTKA 2AZVA 2OAWA 2F2VA 4J9FA 3EG1A 1G2BA 4HVWA 4K11A 2BTTA 3QWYA 4FSSA 2J6FA 1U3OA 2LMJA 1BK2A 2C0IA 1GL5A 2EW3A 1K4US 3H41A 2DRMA 2CT3A 1GBQA 4DEYA 4J9IA 4GLMA 4Z89A 2EVRA 1PRLC 2JS0A 2LZ6B 1JU5C 4AFUC 1WDXA 4Y92A 4J9CA 2YSQA 1EFNA 1FYNA 1UE9A 1YNZA 2KBTA 3PE0A 1TUCA 1GFDA 2O88A 2SEMA 1RLQC 2FO0A 1K76A 4A63B 1HSQA 2K9GA 2DL3A 1W70A 2B86A 3VS1A 2VWFA 1X69A 3REAB 2YUPA 2RNAA 4F14A 5L23A 2AK5A 4AG2C 2RF0A 2XMFA 2JM9A 2OI3A 4DEXA 1AWXA 2O31A 2LP5A 4LUEA 1HJDA 1AWJA 1I1JA 1VYVA 1AEYA 1M30A 3VRZA 4JPBW 4JJBA 2CSQA 2RQTA 1K9AA 1B3QA 2BZ8A 2KXCA 2DL8A 1JEGA 2NWMA 4ZNXA 1CKBA 1TG0A 3FJ5A 5FWBA 2LCSA 3UA6A 3TVTA 1GCQA 2MIOA 1ABQA 2LNHB 1ZBJA 3NPFA 2D8JA 2JTEA 2CDTA 2HSPA 1JXMA 3UA7A 2DLPA 2W0ZA 2J06A 4AG1C 1MUZA 2YUNA 1W1FA 2AZSA 2GGRA 1NEGA 1K1ZA 1T0JA 3I5RA 4AFZC 1ZSGA 1ZLMA 1UJYA 5EC7A 4OMQA 3A98A 1AOJA 3NGPA 3GBQA 1AZEA 1A0NB 4JZ3A 1ZUKA 2CH4A 3VS5A 5IHNA 2DA9A 2DL4A 2L3QA 1VYTA 3ZL7C 2MOXA 1UUEA 4CC2A 2JS2A 1GBRA 1OPKA 1OV3A 2OJ2A 2KR3A 3KFVA 4E6RA 1SPKA 2RPNA 2HEQA 1ABOA 4RTWA 2V1RA 4ORZA 2JW4A 1UJ0A 2EYXA 4LUDA 2NUZA 1NLPC 2JXBA 2ENMA 1WX6A 4LNPA 5IHKA 1U06A 1H92A 4ESRA 1NYFA 2JT4A 2DBMA 5FWCA 3TSZA 1PNJA 2J6KA 2LJ3A 2F2WA 3M0RA 3M0TA 2C0OA 4AFQC 1UGVA 2LJ0A 1X2KA 4OMLA 1QLYA 2DF6A 1TUDA 2KT8A 1KSWA 5IXFA 3JV3A 3H0FA 1T0HA 2L3SA 1PKTA 1OPLA 1PHTA 2KE9A 1I0CA 4M4ZA 1QWFA 2SRCA 1JXOA 2CUBA 2GBQA 2X3WD 3EHRA 1E6GA 4RTYA 3R6NA 3RBBB 2KT1A 1V1CA 2EGCA 2RN8A 2ROTA 4X1VA 2O2OA 2CH4W 3REBB 3RNJA 2K7AA 1IO6A 1NEBA 2RQRA 2FPDA 2J6OA 1CSKA 2ROLA 1U5SA 1ZUYA 2EBPA 4F17A 1JQQA 2FEIA 3H0HA 1VA7A 2LJ1A 2DM1A 2DMOA 4JZ4A 4D8DA 4IIMA 4LN2A 1SEMA 4R0KA 1RLPC 2EGAA 2KGTA 1E6HA 2IIMA 4D8KA 4RTXA 3SHWA 1AWOA 2DRKA 1X6GA 3UATA 4GBQA 2YUQA 3C0CA 2A37A 1FMKA 1BBZA 2A36A 1GFCA 1N5ZA 2MCNA 1UECA 2DE0X 1X2QA 1AWWA 3IQLA 4OMNA 2D0NA 2RMOA 4JJCA 2GTOA 1Z9QA 2QDLA 1WLPB 2FG0A 1I07A 5GJVB 4AFSC 4Z88A 1X43A 1UFFA 4J9BA 3EHQA 1X6BA 2GTJA 1M3BA 3M0QA 2A08A 1QWEA 2CT4A 1MV0B 3EG3A 1UHCA 1WXTA 2L0AA 1SHFA 1GCPA 2GQIA 3VRYA 2F2XA 1S1NA 2P4RA 1WA7A 1UG1A 2DILA 1UDLA 1WFWA 3VS6A 2AKLA 1ZX6A 1G83A 4EIKA 5GJWB 2EPDA 1BU1A 2JMCA 3VS2A 4CC7A 2M0YA 1M27C 1PKSA 1AD5A 1QKWA 4RTUA 2EYWA 1YCSB 3PVLA 1M3CA 2ABLA 2YDLA 1XOVA 4J9HA 2KXDA 4HCKA 1UTIA 2EQIA 3NHNA 5I11A 1JO8A 1ARKA 1UHFA 4CC4B 3M0PA 2K2MA 1YP5A 4KRTA 2HBWA 1X27A 2KRNA 2KYMA 2DX1A 1B07A 3EGUA 2W10A 2I0NA 3I9QA 3EG2A 2G6FX 1YWPA 2PNIA 2VKNA 4RUGA 2CREA 1PWTA 2D1XA 2GNCA 2DYBA 2ESWA 1W6XA 3EG0A 1WXUA 1Y57A 3CQTA 3M0UA 4OMPA 3VS7A 3SEMA 2CSIA 1H8KA 4Z8AA 1NG2A 3VS4A 3H0IA 1YWOA 2L3PA 2FPFA 2K6DA 2JMAA 2K3BA 1T3SA 2DBKA 2PZ1A 2HCKA 1Y0MA 2DJQA 1AVZC 2ECZA 1RUWA 1GCQC 1M3AA 2VVKA 3NMZC 3VS3A 1NLOC 1HD3A 1OOTA 2KROA 4HVVA 2FPEA 1KIKA 1YN8A 3U23A 2J05A 4F16A 2DL5A 2FRYA 3LH5A 4LE9A 2DL7A 4J9EA 2A28A 2D8HA 2JM8A 2ED1A 2KYBA 4J9GA 3VS0A 1PRMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C0T A;  1LCK A;  2O9S A;  5IH2 A;  1GRI A;  1SRL A;  1WYX A;  5IXB A;  1H3H A;  1VYU A;  2BZX A;  1ZUU A;  4QT7 A;  1SRM A;  2HDA A;  1E7O A;  2ED0 A;  2E5K A;  1SHG A;  1MV3 A;  2EGE A;  3QWX X;  2O9V A;  2DVJ A;  2KEA A;  1QCF A;  1OEB A;  1QKX A;  3I5S A;  5HCK A;  2X3X D;  2K79 A;  2KRM A;  5I22 A;  2YT6 A;  1WXB A;  4OMO A;  2RQV A;  4RTZ A;  2AKK A;  1NM7 A;  5FW9 A;  2YUO A;  3PVQ A;  1WI7 A;  1WIE A;  2CUD A;  4J9D A;  4HXJ A;  5IHI A;  3M0S A;  2LQW A;  2H8H A;  1KJW A;  1SSH A;  1K0S A;  1KFZ A;  4CC3 A;  2RQU A;  4OMM A;  4IIO A;  3THK A;  2DNU A;  3I35 A;  4HVU A;  3UF4 A;  1AZG B;  2LX7 A;  3O5Z A;  2M51 A;  4RTT A;  3ULR B;  2KRS A;  2LQN A;  4JJD A;  4WCI A;  1BB9 A;  2RQW A;  4RTV A;  1CKA A;  1M8M A;  1NYG A;  2BZY A;  2EKH A;  1K0X A;  1RI9 A;  2V1Q A;  2EYY A;  5ECA A;  2KNB B;  2J7I A;  1T3L A;  2EYZ A;  2L2P A;  3TSW A;  1Z9Z A;  2FRW A;  1J3T A;  2PTK A;  2AZV A;  2OAW A;  2F2V A;  4J9F A;  3EG1 A;  1G2B A;  4HVW A;  4K11 A;  2BTT A;  3QWY A;  4FSS A;  2J6F A;  1U3O A;  2LMJ A;  1BK2 A;  2C0I A;  1GL5 A;  2EW3 A;  1K4U S;  3H41 A;  2DRM A;  2CT3 A;  1GBQ A;  4DEY A;  4J9I A;  4GLM A;  4Z89 A;  2EVR A;  1PRL C;  2JS0 A;  2LZ6 B;  1JU5 C;  4AFU C;  1WDX A;  4Y92 A;  4J9C A;  2YSQ A;  1EFN A;  1FYN A;  1UE9 A;  1YNZ A;  2KBT A;  3PE0 A;  1TUC A;  1GFD A;  2O88 A;  2SEM A;  1RLQ C;  2FO0 A;  1K76 A;  4A63 B;  1HSQ A;  2K9G A;  2DL3 A;  1W70 A;  2B86 A;  3VS1 A;  2VWF A;  1X69 A;  3REA B;  2YUP A;  2RNA A;  4F14 A;  5L23 A;  2AK5 A;  4AG2 C;  2RF0 A;  2XMF A;  2JM9 A;  2OI3 A;  4DEX A;  1AWX A;  2O31 A;  2LP5 A;  4LUE A;  1HJD A;  1AWJ A;  1I1J A;  1VYV A;  1AEY A;  1M30 A;  3VRZ A;  4JPB W;  4JJB A;  2CSQ A;  2RQT A;  1K9A A;  1B3Q A;  2BZ8 A;  2KXC A;  2DL8 A;  1JEG A;  2NWM A;  4ZNX A;  1CKB A;  1TG0 A;  3FJ5 A;  5FWB A;  2LCS A;  3UA6 A;  3TVT A;  1GCQ A;  2MIO A;  1ABQ A;  2LNH B;  1ZBJ A;  3NPF A;  2D8J A;  2JTE A;  2CDT A;  2HSP A;  1JXM A;  3UA7 A;  2DLP A;  2W0Z A;  2J06 A;  4AG1 C;  1MUZ A;  2YUN A;  1W1F A;  2AZS A;  2GGR A;  1NEG A;  1K1Z A;  1T0J A;  3I5R A;  4AFZ C;  1ZSG A;  1ZLM A;  1UJY A;  5EC7 A;  4OMQ A;  3A98 A;  1AOJ A;  3NGP A;  3GBQ A;  1AZE A;  1A0N B;  4JZ3 A;  1ZUK A;  2CH4 A;  3VS5 A;  5IHN A;  2DA9 A;  2DL4 A;  2L3Q A;  1VYT A;  3ZL7 C;  2MOX A;  1UUE A;  4CC2 A;  2JS2 A;  1GBR A;  1OPK A;  1OV3 A;  2OJ2 A;  2KR3 A;  3KFV A;  4E6R A;  1SPK A;  2RPN A;  2HEQ A;  1ABO A;  4RTW A;  2V1R A;  4ORZ A;  2JW4 A;  1UJ0 A;  2EYX A;  4LUD A;  2NUZ A;  1NLP C;  2JXB A;  2ENM A;  1WX6 A;  4LNP A;  5IHK A;  1U06 A;  1H92 A;  4ESR A;  1NYF A;  2JT4 A;  2DBM A;  5FWC A;  3TSZ A;  1PNJ A;  2J6K A;  2LJ3 A;  2F2W A;  3M0R A;  3M0T A;  2C0O A;  4AFQ C;  1UGV A;  2LJ0 A;  1X2K A;  4OML A;  1QLY A;  2DF6 A;  1TUD A;  2KT8 A;  1KSW A;  5IXF A;  3JV3 A;  3H0F A;  1T0H A;  2L3S A;  1PKT A;  1OPL A;  1PHT A;  2KE9 A;  1I0C A;  4M4Z A;  1QWF A;  2SRC A;  1JXO A;  2CUB A;  2GBQ A;  2X3W D;  3EHR A;  1E6G A;  4RTY A;  3R6N A;  3RBB B;  2KT1 A;  1V1C A;  2EGC A;  2RN8 A;  2ROT A;  4X1V A;  2O2O A;  2CH4 W;  3REB B;  3RNJ A;  2K7A A;  1IO6 A;  1NEB A;  2RQR A;  2FPD A;  2J6O A;  1CSK A;  2ROL A;  1U5S A;  1ZUY A;  2EBP A;  4F17 A;  1JQQ A;  2FEI A;  3H0H A;  1VA7 A;  2LJ1 A;  2DM1 A;  2DMO A;  4JZ4 A;  4D8D A;  4IIM A;  4LN2 A;  1SEM A;  4R0K A;  1RLP C;  2EGA A;  2KGT A;  1E6H A;  2IIM A;  4D8K A;  4RTX A;  3SHW A;  1AWO A;  2DRK A;  1X6G A;  3UAT A;  4GBQ A;  2YUQ A;  3C0C A;  2A37 A;  1FMK A;  1BBZ A;  2A36 A;  1GFC A;  1N5Z A;  2MCN A;  1UEC A;  2DE0 X;  1X2Q A;  1AWW A;  3IQL A;  4OMN A;  2D0N A;  2RMO A;  4JJC A;  2GTO A;  1Z9Q A;  2QDL A;  1WLP B;  2FG0 A;  1I07 A;  5GJV B;  4AFS C;  4Z88 A;  1X43 A;  1UFF A;  4J9B A;  3EHQ A;  1X6B A;  2GTJ A;  1M3B A;  3M0Q A;  2A08 A;  1QWE A;  2CT4 A;  1MV0 B;  3EG3 A;  1UHC A;  1WXT A;  2L0A A;  1SHF A;  1GCP A;  2GQI A;  3VRY A;  2F2X A;  1S1N A;  2P4R A;  1WA7 A;  1UG1 A;  2DIL A;  1UDL A;  1WFW A;  3VS6 A;  2AKL A;  1ZX6 A;  1G83 A;  4EIK A;  5GJW B;  2EPD A;  1BU1 A;  2JMC A;  3VS2 A;  4CC7 A;  2M0Y A;  1M27 C;  1PKS A;  1AD5 A;  1QKW A;  4RTU A;  2EYW A;  1YCS B;  3PVL A;  1M3C A;  2ABL A;  2YDL A;  1XOV A;  4J9H A;  2KXD A;  4HCK A;  1UTI A;  2EQI A;  3NHN A;  5I11 A;  1JO8 A;  1ARK A;  1UHF A;  4CC4 B;  3M0P A;  2K2M A;  1YP5 A;  4KRT A;  2HBW A;  1X27 A;  2KRN A;  2KYM A;  2DX1 A;  1B07 A;  3EGU A;  2W10 A;  2I0N A;  3I9Q A;  3EG2 A;  2G6F X;  1YWP A;  2PNI A;  2VKN A;  4RUG A;  2CRE A;  1PWT A;  2D1X A;  2GNC A;  2DYB A;  2ESW A;  1W6X A;  3EG0 A;  1WXU A;  1Y57 A;  3CQT A;  3M0U A;  4OMP A;  3VS7 A;  3SEM A;  2CSI A;  1H8K A;  4Z8A A;  1NG2 A;  3VS4 A;  3H0I A;  1YWO A;  2L3P A;  2FPF A;  2K6D A;  2JMA A;  2K3B A;  1T3S A;  2DBK A;  2PZ1 A;  2HCK A;  1Y0M A;  2DJQ A;  1AVZ C;  2ECZ A;  1RUW A;  1GCQ C;  1M3A A;  2VVK A;  3NMZ C;  3VS3 A;  1NLO C;  1HD3 A;  1OOT A;  2KRO A;  4HVV A;  2FPE A;  1KIK A;  1YN8 A;  3U23 A;  2J05 A;  4F16 A;  2DL5 A;  2FRY A;  3LH5 A;  4LE9 A;  2DL7 A;  4J9E A;  2A28 A;  2D8H A;  2JM8 A;  2ED1 A;  2KYB A;  4J9G A;  3VS0 A;  1PRM C; 
#chains in the Genus database with same CATH topology
 1XQH A;  1MMA A;  2FHD A;  2O9S A;  5IH2 A;  2FVU A;  5IXB A;  1Y07 A;  1Q82 R;  1ZUU A;  3CXC P;  3RKW A;  2E12 A;  1SRM A;  1YJ9 Q;  2EGE A;  3QWX X;  3RUX A;  2O9V A;  5KYY A;  5DY9 A;  2KEA A;  1ZSZ A;  2GQV A;  3DKM A;  2HQX A;  3A8L B;  2JNG A;  1NM7 A;  3QZ5 B;  1G3W A;  4FL6 A;  4FT2 A;  2L5Q A;  5GMK m;  1WI7 A;  1M8V A;  2R57 A;  2CP3 A;  4HXJ A;  3UPU A;  2RA2 A;  1VQO Q;  1VQK Q;  3MP8 A;  4DBF A;  1QVG S;  2H8H A;  1K0S A;  1QVF P;  1KFZ A;  4CC3 A;  4M7D B;  1M1K U;  2DNU A;  5KYN A;  4HVU A;  4HA8 A;  4ME7 A;  2NYS A;  3UF4 A;  2JVV A;  2RK2 A;  1BCM A;  2M51 A;  4MDW A;  2E4H A;  5LJ5 h;  4A4E A;  1EX4 A;  3VUZ A;  2QGG A;  1FX7 A;  2XI9 A;  1Y71 A;  3BDU A;  2KNB B;  4C8Q G;  2EYZ A;  3RES A;  1Z9Z A;  2QA4 Q;  2EQK A;  5CAI A;  1LPL A;  4DBR A;  4II1 A;  1K73 R;  2PVD B;  4KH0 B;  1G8X A;  2OAW A;  3NTI A;  3CCV T;  2GFU A;  5DLQ E;  1TWB A;  2LRQ A;  4FSS A;  2J6F A;  3OBW A;  1BK2 A;  5CR2 A;  2RD1 A;  3OW2 A;  3OYM A;  2X9H A;  5FRO A;  4Z89 A;  3M59 A;  2JS0 A;  4M7A F;  3JCM V;  5GAO l;  2CP0 A;  5GMK e;  1V29 B;  4JUV A;  5GAN g;  5LL6 S;  1WDX A;  2P0Q A;  3URG A;  4N4G A;  2DET A;  3CCR A;  2VUB A;  2SEM A;  3CC2 Q;  2FO0 A;  1K76 A;  4C5G A;  4OGE A;  3CC4 T;  2K9G A;  1M90 U;  1IB8 A;  3JCM d;  1W70 A;  2YHT A;  3QYG B;  2K5F A;  1U8R A;  2NUP A;  1X69 A;  4F14 A;  3CC7 Q;  2DZ9 A;  3A8M B;  4AT1 B;  3QJY A;  2OI3 A;  1VQ7 T;  2OTJ A;  5GAN 2;  3VUB A;  5GAM f;  5FLX E;  1M30 A;  4JPB W;  3CCJ T;  1B3Q A;  1QW1 A;  2KXC A;  5GAM h;  4PFZ A;  3S3M A;  2OTJ T;  3FJ5 A;  3VJP A;  1HYO A;  2CP6 A;  3MJX A;  3L42 A;  1OZ2 A;  2EQJ A;  3MEV A;  2CDT A;  2QYZ A;  2DXB A;  2RJF A;  2DLP A;  2QEX T;  4M77 G;  1QVG P;  1W1F A;  3FEO A;  4KGZ B;  2AZS A;  3CC2 A;  2K5L A;  2V26 A;  2LDM A;  4ZGJ B;  1YFN A;  3H6Z A;  4ZN3 A;  1Y7X A;  3I5R A;  3OYF A;  3CCS T;  4AFZ C;  1H3Z A;  4N4H A;  4PJO D;  2EWN A;  5EC7 A;  4PJN A;  2LCL A;  5A0L A;  1BCO A;  3D7S B;  4E7K A;  1YIT A;  4PLL A;  1AZE A;  1A0N B;  4N0A A;  5D6W A;  1ZUK A;  4J6X A;  2EAY A;  2KMT A;  2L3Q A;  1VYT A;  3JCM h;  3JB9 G;  4KBM B;  1IGQ A;  2K5I A;  4B9W A;  1KD1 C;  3ER0 A;  2XDD A;  4EMK C;  2PQW A;  3OSS C;  2FYK A;  2BIV A;  3EG9 B;  5AT1 B;  4E2F B;  3ZFJ A;  2HEQ A;  1UJ0 A;  4F7U G;  1NLP C;  2NUZ A;  2FZK B;  4E7H A;  2ENM A;  2WSE E;  1DJ7 B;  4EMK A;  2KVQ G;  2MF2 A;  3OBY A;  3OMC A;  5GAM g;  2ZPH B;  4BUG A;  2DIG A;  3MHX A;  5HKC A;  1X2K A;  4PJJ A;  2A7Y A;  1TUD A;  1QQJ A;  3S6W A;  3JV3 A;  4M75 C;  3OYH A;  2VXE A;  1R0C B;  3TQ7 P;  2DIQ A;  2EQU A;  2X51 A;  2KE9 A;  1KQS P;  1I0C A;  3OS5 A;  5LJ3 h;  4RTY A;  2NUT B;  1VIE A;  1PD0 A;  1VQP Q;  1VQL A;  2B8A A;  3VKI A;  5A0G A;  2DO3 A;  3RIR A;  1D0Z A;  3CCS A;  2K7A A;  1VQ4 A;  1YJW T;  4Q5W A;  1OYX A;  2ROL A;  2XDB A;  3CEY A;  4C92 A;  2EBP A;  4F17 A;  3CBO A;  3G6E A;  3CC4 A;  3TRE A;  5GAM j;  3NTH A;  4C8Q F;  2DMO A;  4JZ4 A;  2MWP A;  4OP0 A;  4OB3 B;  1SEM A;  3JSC A;  5KYU B;  2EGA A;  4A4K A;  1M4Z A;  1YHQ T;  1K8A C;  4FSX A;  3OYK A;  1IRE B;  4OMF B;  3OYG A;  4GBQ A;  2QA4 T;  1WNL A;  2DJZ A;  1OU9 A;  1I4K 1;  3IQL A;  3UWN A;  4M7A G;  2RMO A;  3CCL A;  1VQL Q;  2QDL A;  5CKB A;  2HL3 A;  3E9F A;  2I2L A;  5GJV B;  3LLR A;  3MEA A;  3CCS Q;  2WSC E;  3ZEH A;  1MMN A;  1VQL T;  2E6N A;  2R58 A;  3M0Q A;  2A08 A;  2CT4 A;  1MV0 B;  4L5G A;  1WHM A;  1WXT A;  2L0A A;  4AMC A;  3VRY A;  2F2X A;  1S1N A;  2P4R A;  4Z02 A;  1UDL A;  1ZSZ C;  2ZGW A;  2AKL A;  1G83 A;  1KD1 R;  5GJW B;  2EPD A;  2M0Y A;  3DB4 A;  3OW2 S;  3SWN C;  3RER A;  3PFS A;  4J9H A;  3JCM Q;  3NFC A;  3RKX A;  2BE9 B;  2EQI A;  2HKQ B;  2E3I A;  5I11 A;  4E7L A;  3CME A;  3OB9 A;  2K2M A;  4ZN1 A;  4PJL A;  2HBW A;  1X27 A;  3V8L A;  2H3J A;  1WQW A;  2G6F X;  5GAO r;  1N8R C;  1SSF A;  3R6O A;  3OYL A;  3G1J A;  1YJ9 A;  1W6X A;  3JB9 I;  3CPF A;  3CD6 T;  3X28 B;  1NPR A;  1WPY A;  4OMP A;  1VQ4 T;  1YJW A;  2CSI A;  1SKU B;  3H0I A;  5KYW B;  3G71 Q;  2L3P A;  2FPF A;  2K3B A;  2PZ1 A;  2Y90 A;  2DJQ A;  1AVZ C;  1O9S A;  4JS4 A;  1RUW A;  8AT1 B;  1NLO C;  4O5V A;  4LXC A;  4HVV A;  3QDF A;  5GMK l;  2E64 A;  4PLI A;  3CME Q;  2DL5 A;  4M75 E;  1VQ6 T;  4PJM A;  2X4J A;  2JM8 A;  1PCX A;  5CO7 A;  1PG5 B;  3VS0 A;  1PRM C;  2BUD A;  2EIF A;  3JCM X;  1R77 A;  2HDA A;  2X4X A;  1MV3 A;  2DVJ A;  2KSS A;  2XHC A;  5KYY B;  1QCF A;  1QKX A;  3I5S A;  2E10 A;  4M77 E;  5I22 A;  4NL3 A;  2YT6 A;  4F7U B;  4OMO A;  4FYV B;  4BB7 A;  1VQN A;  1C1A A;  4M75 B;  3AT1 B;  4MDX A;  1K73 U;  3LGF A;  2HSE B;  2V8J A;  5IHI A;  1IXD A;  3M0S A;  4M7A B;  4E47 A;  2LQW A;  4C92 B;  1KJW A;  1M90 C;  3GLX A;  1NJI C;  2O4X A;  3THK A;  3WVE B;  3I35 A;  1AZG B;  1ZHI A;  4FYX B;  1M2O A;  3QSU A;  4F7U A;  4JJN K;  3ULR B;  2KRS A;  2JN0 A;  4WCI A;  1VQM Q;  2RQW A;  4RTV A;  1CKA A;  1NYG A;  2EKH A;  3CCR Q;  2X4W A;  1WHG A;  4EMG A;  1T3L A;  3V8J A;  1OQK A;  1KQ1 A;  3CCJ Q;  5CKH A;  1Q86 U;  1M90 R;  5KH6 A;  3P8H A;  3OYA A;  3CC7 A;  1J3T A;  2PTK A;  2AZV A;  3S3O A;  1VQN Q;  2F2V A;  3J81 E;  2OTJ Q;  1G2B A;  4FU6 A;  4HVW A;  4C0F A;  1NE8 A;  3QWY A;  2DXC A;  4EMK B;  4M7A C;  2AIR B;  1U3O A;  1K4U S;  1GL5 A;  2EW3 A;  1Q7Y U;  2CT3 A;  1GBQ A;  5C6S A;  2EJF A;  1PRL C;  1RAG B;  1S72 A;  4B6M A;  4TVR A;  1LOJ A;  4M77 F;  4J9C A;  1VQM A;  1ZSZ B;  2O88 A;  4E7I A;  1RLQ C;  2HZY A;  2XD0 A;  4X9D A;  4A63 B;  1HSQ A;  2COZ A;  1S72 T;  2B86 A;  1KQS A;  2JTF A;  3VS1 A;  2VWF A;  1OI1 A;  4C92 E;  3CCJ A;  1IHV A;  3DLL A;  3EH2 A;  2AK5 A;  1MMG A;  2Y4Y A;  3DLM A;  2XMF A;  4M7D D;  2JM9 A;  1KG1 A;  4DEX A;  2O31 A;  2M0O A;  4DOW A;  4KUI A;  4LUE A;  1AWJ A;  1PSF A;  5GMK j;  4JJB A;  3EFO B;  5KYU A;  1I5L A;  1HXD A;  2DL8 A;  1JEG A;  4ZNX A;  5FU7 C;  1IRX A;  3GNG A;  1TG0 A;  3UDC A;  1XTD A;  2LCS A;  3AHU A;  1M1K R;  2DXT A;  3MO8 A;  3NPF A;  3JCM J;  2BE7 D;  2JTM A;  3UA7 A;  2FL7 A;  2RJD A;  1QP2 A;  4AG1 C;  1BYM A;  2QTV A;  2QXF A;  1ZSG A;  3OS0 A;  1UJY A;  4CI0 C;  4R55 A;  3VU3 C;  4OMQ A;  2VXF A;  3CPW P;  1K9M C;  1V76 A;  2GF7 A;  2E1H A;  2K2V A;  3OY9 A;  3VS5 A;  2DA9 A;  3RMS A;  2DL4 A;  3CC2 T;  1Q86 R;  3ZL7 C;  2MOX A;  5LJ5 d;  2HBP A;  2JS2 A;  1OPK A;  4BE0 A;  1VQP A;  1MHN A;  3QDR B;  2V1R A;  4LUD A;  1EZZ B;  4EPC A;  1K8A R;  1D1B A;  4EDU A;  1WHK A;  5IHK A;  3M56 A;  2VYT A;  1LJO A;  1NYF A;  3HL8 A;  4X34 A;  2JT4 A;  2DBM A;  5FWC A;  3SWN B;  5GMK i;  1PNJ A;  2J6K A;  3FC3 A;  3C12 A;  1RAA B;  1UGV A;  1KK7 A;  3OW2 P;  4FYY B;  4C92 F;  4LDX A;  2LJ0 A;  4OML A;  3LX7 A;  3OA6 A;  2DF6 A;  2OTL Q;  3OYJ A;  1KSW A;  3QKJ A;  3E2U A;  2DPP B;  2NLU A;  1T0H A;  4NOY A;  1OPL A;  3QBY A;  4C92 C;  4M4Z A;  4KGV B;  4FCY A;  1E6G A;  4FW1 A;  2LTO A;  3PGG A;  2KT1 A;  2ROT A;  2RN8 A;  5D6Y A;  4JS5 A;  1H64 1;  5LJ3 d;  4M78 A;  3L2R A;  1IO6 A;  2QG9 B;  1BKB A;  2RQR A;  4A53 A;  3HKS A;  2J6O A;  2LC4 A;  1JQQ A;  2QAZ A;  1VA7 A;  2K4Y A;  3LGL A;  3OSV A;  1RAI B;  1ZQ1 A;  3O8V A;  3CCR T;  1RLP C;  1O75 A;  2L89 A;  2OTL A;  2YUQ A;  2A37 A;  2YRV A;  4C92 D;  3G4S A;  2A36 A;  2JUF A;  3PTA A;  3L2W A;  2EQM A;  2COW A;  1GFC A;  1N5Z A;  4UC4 A;  4BI3 A;  2YRC A;  4OMN A;  1BIB A;  2D0N A;  4JJC A;  4J6Y A;  1UGQ B;  2KI7 A;  3E1S A;  1WLP B;  2CZ6 B;  3CD6 Q;  2FG0 A;  1I07 A;  3V7S A;  4Z88 A;  1X6B A;  3BDL A;  5LJ5 f;  1M3B A;  2RI3 A;  1YJN T;  1N9S A;  1UHC A;  1VQO T;  3C94 A;  3JCM e;  2GQI A;  2DIL A;  1WFW A;  3VS6 A;  1K8A U;  4XTX A;  4EIK A;  2KDS A;  2A0F B;  3M58 A;  1BU1 A;  1YJW Q;  2O4X B;  2QQB A;  1M27 C;  1PKS A;  1VQ8 T;  2RHZ A;  3MET A;  3PVL A;  1UGS B;  3G71 A;  1M3C A;  3X26 B;  5GAN h;  1YCY A;  3G4S Q;  4RG2 A;  3A8O B;  5CCA A;  4HCK A;  3QII A;  1MNE A;  5IN1 A;  3HHT B;  1UGP B;  1JO8 A;  1ARK A;  2KQW A;  1Q82 C;  1YHQ Q;  4YTL A;  2PUK B;  9ATC B;  3CD6 A;  4HCB A;  4CC4 B;  4CRI A;  3V8K A;  4LDU A;  1FWZ A;  2KYM A;  3SFM A;  2KY9 A;  2W10 A;  2I0N A;  6AT1 B;  4M7D G;  3EG2 A;  2PNI A;  1PWT A;  3CCM Q;  4DA4 A;  2ESW A;  4M77 A;  5LJ3 f;  1BI3 A;  1C6V X;  4M77 B;  3EG0 A;  1WXU A;  5KE2 A;  3C4S A;  3VS7 A;  3FLG A;  4A54 A;  3SDZ A;  2K3X A;  3EGX A;  1NG2 A;  3VS4 A;  2K6D A;  4OGC A;  1T3S A;  2DBK A;  3EFR A;  3M5A A;  4M7D E;  2KAF A;  3LWH A;  5J26 A;  3QXE B;  1GCQ C;  1W4S A;  2VVK A;  3NMZ C;  4C5I A;  3E9G A;  4F04 B;  4J5Y A;  4HCZ A;  1VQ5 Q;  1QP3 A;  1YN8 A;  3U23 A;  4NL2 A;  4L6V 5;  1TUG B;  2FRY A;  3LH5 A;  4J9E A;  5GAN j;  2D8H A;  2KYB A;  1HK9 A;  4J9G A;  2VGM A;  1AHJ B;  4XU0 A;  1AT1 B;  2X35 A;  3FRN A;  1SRL A;  1WYX A;  2E3H A;  3CCM A;  4QT7 A;  4J7F A;  3MEW A;  3RMQ A;  1SHG A;  3KXT A;  3QG1 A;  2K79 A;  2KRM A;  4XK8 E;  2HQE A;  1KD1 U;  3OYC A;  2AKK A;  2ZPE B;  1QVP A;  2F5K A;  1MND A;  5FW9 A;  2YUO A;  4ELZ C;  1M1F A;  1YI2 Q;  1M5Q 1;  3KUF A;  3PVQ A;  2O01 E;  3PT9 A;  1RAD B;  1WIE A;  5KYX A;  2QQA A;  2EJ9 A;  3FJP A;  5FU7 B;  1R8O B;  1VQ5 A;  3M54 A;  1SSH A;  2RQU A;  4OMM A;  4BAC A;  4IIO A;  2VGN A;  1VQK T;  1JJ2 P;  5CVI A;  2BKD N;  1S72 Q;  2LX7 A;  3CBP A;  4IUT A;  3JB9 D;  2PU9 B;  3O5Z A;  2E5Q A;  5LJ5 e;  3CPW A;  1Y96 B;  1D3B A;  4P5N A;  1M2V B;  1BB9 A;  2COY A;  4J6W A;  4C8Q B;  4PK4 A;  3HRS A;  1K0X A;  4JLG A;  1RI9 A;  1Q81 C;  5ECA A;  5LJ5 j;  2J7I A;  2L2P A;  3TSW A;  4OVA A;  2IG0 A;  2FRW A;  4N0A C;  3GNF B;  1PD1 A;  2VC8 A;  4MZM A;  4NS5 A;  3EG1 A;  2QDY B;  1BI1 A;  3JCM b;  4J83 A;  4PL6 A;  4K11 A;  2BTT A;  4QVD A;  1B34 A;  4LD9 K;  2LMJ A;  4FYW B;  2C0I A;  3GP8 A;  4JRK A;  5J39 A;  2DRM A;  4J9I A;  4GLM A;  2RH2 A;  5L8R E;  1JU5 C;  4HT9 A;  3HFN A;  4VUB A;  1XJW B;  1W2B A;  3J80 E;  4ZTF A;  4Y92 A;  1G3Y A;  4JRQ A;  1JJ2 S;  4IUQ A;  4PKC C;  4DOV A;  4BI4 A;  1EFN A;  3L1A A;  3CXC S;  1X01 A;  3CMA Q;  1FYN A;  1UE9 A;  1YNZ A;  2HMA A;  1VQP T;  1GFD A;  1TUC A;  4M75 D;  5LJ3 e;  1OZ3 A;  1Q81 R;  1N27 A;  2DL3 A;  5I2S A;  3CBM A;  3A5Z B;  3MPU B;  1VQ5 T;  4FT4 A;  2DTI A;  3A1P A;  3REA B;  2RNA A;  4A4G A;  3LWI A;  2QTX A;  1X75 C;  2DKG A;  5D7U A;  2CZ7 B;  4WF2 A;  5LJ3 j;  2RF0 A;  4DBH A;  1AWX A;  1TSF A;  3HRT A;  2RO0 A;  3EG9 A;  3RR6 A;  1HJD A;  1I1J A;  3EGD A;  1GXI E;  2CSQ A;  4J7I A;  1OX8 A;  2RI5 A;  2CS7 A;  3ASK A;  1K9A A;  2BZ8 A;  2NWM A;  2Y4X A;  2DYI A;  4C5E A;  1WHJ A;  3TVT A;  4JDS A;  1GCQ A;  3EAE A;  2MIO A;  1ABQ A;  4GY5 A;  2LNH B;  2D8J A;  1MMD A;  3JCM f;  1JXM A;  5FRM A;  1X6O A;  2F5T X;  2L3R A;  1U1T A;  2W0Z A;  1MUZ A;  2YUN A;  2GGR A;  5GAN 8;  3SD4 A;  1T0J A;  5FU6 C;  2F69 A;  3M9Q A;  3MP1 A;  4C5H A;  3M4Y A;  3JB9 J;  5CIU A;  1RAC B;  2CP5 A;  4PNO A;  5CKE A;  2RHX A;  1I8F A;  3NGP A;  3GBQ A;  1RAB B;  3FIF A;  2CH4 A;  3V7R A;  5IHN A;  2RB6 A;  2XIC A;  2P4T A;  1F1B B;  3A8H B;  4IUU A;  4M75 G;  4XTV A;  1QVF A;  1GBR A;  1BI2 A;  1OV3 A;  2OJ2 A;  2KR3 A;  4Y28 E;  2CZ0 B;  5CQY A;  2V8K A;  1Q7Y R;  2RPN A;  1ABO A;  5GAM d;  4RTW A;  4J8O A;  4ORZ A;  3VYG A;  3JCM g;  2EYX A;  3GF5 A;  4MZP A;  4XU1 A;  5GAO m;  1XNI A;  2D6F A;  1WX6 A;  3BY7 A;  4LDW A;  1U06 A;  2VB6 A;  1H92 A;  3TEE A;  1QCN A;  2E41 A;  5GAO p;  4A4H A;  2RM4 A;  5FU6 B;  1D1A A;  3QYH B;  2F2W A;  2QGF B;  3M0T A;  4AFQ C;  2YRD A;  1Q81 U;  1I81 A;  1BIA A;  5IXF A;  3H0F A;  3I55 T;  3ME9 A;  2L3S A;  4R56 A;  1PKT A;  1PHT A;  1C0M A;  5I2M A;  3CCE A;  2SRC A;  3HFO A;  2GBQ A;  3EHR A;  2QAS A;  1N9R A;  2X3W D;  1YIJ Q;  2RJC A;  3GOX A;  1V1C A;  4X1V A;  3X24 B;  2O2O A;  4LDV A;  5A2Q E;  3RNJ A;  1NEB A;  1FMW A;  3JCM W;  3QUI A;  2YLB A;  2CZ1 B;  4E7S A;  1ACM B;  1U5S A;  1ZUY A;  4OB1 B;  4M77 C;  4GLK A;  2LJ1 A;  4RCB A;  2LVM A;  4LN2 A;  2DVE A;  2XK0 A;  3M57 A;  4BY6 B;  1VQN T;  4R0K A;  2LT4 A;  4PJO A;  1E6H A;  4D8K A;  4LDY A;  2YXY A;  2QQS A;  5I21 A;  2NUP B;  3SHW A;  5GAN d;  1AWO A;  3LW5 E;  4DBQ A;  5KCO A;  1QMC A;  1SF9 A;  4M78 F;  1BBZ A;  3H8Z A;  4IKF A;  3QZ9 B;  3M53 A;  4ATO A;  2DE0 X;  3CCE Q;  1AWW A;  1NZ9 A;  2IPO B;  2QEX Q;  8ATC B;  1PM3 A;  1YIJ A;  1YHQ A;  4PFP A;  2DAQ A;  1Z9Q A;  2JJ9 A;  3CCE T;  4AFS C;  1ZA1 B;  3EHQ A;  1IGU A;  3CCQ Q;  2M1H A;  2CGH A;  3I56 Q;  5GAN 3;  1QWE A;  3CXC A;  2RK1 A;  3EG3 A;  4WTO B;  1SHF A;  1JJ2 A;  1UB4 A;  2HD0 A;  4PFO A;  4PJO G;  3I56 T;  1KC8 R;  3JCM P;  1JBM A;  4M78 B;  1WA7 A;  4BY6 C;  2RHU A;  2P0K A;  1ZX6 A;  3VS2 A;  2JMC A;  1AD5 A;  5GAM e;  4OB2 B;  1N8R R;  2PVG B;  2EYW A;  1YCS B;  3RDV A;  5KCH A;  2ABL A;  1TH7 A;  2L8D A;  4Y91 A;  1VQM T;  2XU8 A;  2MWO A;  1Y96 A;  2YLC A;  2KK4 A;  3M4G A;  4QKU A;  3VV0 A;  2NUT A;  3NHN A;  3V7C A;  1WJR A;  4BI8 B;  3HP9 A;  7AT1 B;  1YP5 A;  2KRN A;  3CCQ A;  4M7D A;  1B07 A;  3EGU A;  2MK5 A;  4MZT A;  3I56 A;  2K57 A;  4RUG A;  5HK0 A;  2G3R A;  2ZPI B;  2PUO B;  2GNC A;  5IT9 E;  4OF1 A;  4C92 G;  1EIF A;  2K3Y A;  3M0U A;  3QO3 A;  1QCO A;  4E7J A;  5J3B A;  4Z8A A;  3WVD B;  5CK9 A;  2M16 A;  2DD4 A;  1YWO A;  1B7T A;  2HCK A;  2RI2 A;  2XDP A;  3OS1 A;  1YI2 A;  2P84 A;  1Y0M A;  3OS2 A;  5IAY A;  3CME T;  1M3A A;  1RI0 A;  4KT0 E;  1RAF B;  2GCX A;  3OYY A;  3PMT A;  1VQ6 Q;  3I55 A;  3L2V A;  5GAN 5;  2J05 A;  4KH1 B;  2DL7 A;  1IZ6 A;  2A28 A;  3WXM B;  1WHL A;  3OYD A;  4C0D C;  3L2Z A;  5HK3 A;  2D9T A;  2GFA A;  2LX9 A;  3GPL A;  1OU8 A;  1M1K C;  3OYB A;  2C0T A;  1LCK A;  1I5O B;  1GRI A;  1M1G A;  2DEQ A;  1H3H A;  1VYU A;  2BZX A;  3CCL T;  1E7O A;  2ED0 A;  2E5K A;  1UEB A;  1N6A A;  3PIP A;  1Q7Y C;  1NPP A;  5CQX A;  1OEB A;  3C95 A;  1YIT T;  5HCK A;  2X3X D;  4XU2 A;  1WXB A;  2F1L A;  2RQV A;  1RAE B;  4MML A;  4RTZ A;  3MKD A;  2JOY A;  3BW1 A;  2QI2 A;  1MGQ A;  3HRU A;  1QVG A;  5GAN e;  2CUD A;  1N8R U;  2ZAE A;  3X25 B;  4J9D A;  1TOV A;  1VQ6 A;  4O6J A;  1KHI A;  3I55 Q;  4BE1 A;  4PJO C;  3HPW A;  5DLO A;  2QK0 A;  4RG8 A;  4C0D B;  4ZGE B;  5C0M A;  4PJO F;  1IHW A;  2DFU A;  5DM7 R;  4M77 D;  3P8B B;  2RHI A;  4RTT A;  2DEU A;  1Q82 U;  2LQN A;  4JJD A;  1M2V A;  5LJ5 g;  1M8M A;  3CMA A;  2E6Z A;  2BZY A;  2V1Q A;  1VQ8 A;  5GAO n;  2EYY A;  4BDY A;  5KYX B;  1K9M U;  2HAX A;  3MP6 A;  2X4Y A;  2LQ8 A;  2ATC B;  3QJ6 A;  4J9F A;  4ZGD B;  1VOM A;  3EFO A;  1PSE A;  1YJ9 T;  2EYQ A;  3RKY A;  4PJO B;  1VQO A;  3H9N A;  1VQK A;  1OUL A;  3H41 A;  2H3E B;  1Q95 G;  2RJE A;  3E19 A;  4DEY A;  2ZPG B;  2EVR A;  3CCU T;  2LZ6 B;  1D09 B;  4A4F A;  3NTK A;  2DZC A;  4C8Q C;  4AFU C;  4BD3 A;  3SB2 A;  2YSQ A;  4OB0 B;  2R5M A;  2KBT A;  3PE0 A;  2FB7 A;  1VQ8 Q;  1PC0 A;  2RHY A;  2CP7 A;  2IVW A;  1NBE B;  4C8Q A;  3T9N A;  3FDR A;  2QA4 A;  4IUR A;  2YUP A;  5L23 A;  4AG2 C;  3OQ5 A;  1D0X A;  4ANJ A;  4M7A A;  4M75 F;  2LP5 A;  1WHH A;  1NJI R;  2C06 A;  1BI0 A;  4C0G A;  1VYV A;  2QQ9 A;  1AEY A;  4JRP A;  1KQS S;  2LT1 A;  2MPX C;  3VRZ A;  2HNI A;  2E70 A;  4MMK A;  2RQT A;  4QVZ A;  4C8Q D;  2FZC B;  5KE3 A;  3VYH B;  1CKB A;  5EG2 A;  4XU3 A;  2YWW A;  5FWB A;  3UA6 A;  2ZCF B;  3KBG A;  4RKU E;  3X20 B;  5CKF A;  1ZBJ A;  2JTE A;  4KUD K;  2HSP A;  3INZ A;  4HT8 A;  4RCC A;  2J06 A;  3F70 A;  4F7U E;  1QVF S;  1NEG A;  1K1Z A;  3JCM c;  2ZPB B;  1D0Y A;  2LCC A;  3JB9 H;  3QHS A;  4D6W A;  2DD5 A;  3G7Z A;  2DTH A;  3EGD B;  1LNX A;  5GAN 6;  1ZLM A;  3JAM E;  1YIJ T;  3A98 A;  1SG5 A;  1AOJ A;  2LQK A;  4JZ3 A;  4ZTJ A;  1ZA2 B;  5GAN f;  1Q86 C;  1UUE A;  4CC2 A;  2P0P A;  3N5B B;  3J7A F;  3KFV A;  4V2S A;  3CC7 T;  1G5V A;  3JB9 F;  4E6R A;  3QPH A;  1SPK A;  2CKK A;  2JW4 A;  2JXB A;  5GAN 4;  1TTH B;  4IUV A;  4M78 C;  4LNP A;  4M78 G;  4ESR A;  1TS9 A;  2R5A A;  3MEU A;  3TSZ A;  4KGX B;  2LJ3 A;  3M0R A;  2C0O A;  3PMI A;  3FB9 A;  1YI2 T;  3S3N A;  1QLY A;  4IUP A;  2KT8 A;  1YIT Q;  3Q1J A;  5M9O A;  3CCM T;  2OX7 A;  2MYS A;  4QW2 A;  1K73 C;  1UGR B;  2M9U A;  2OTL T;  1VUB A;  1QWF A;  1JXO A;  1WJQ A;  3R6N A;  2CUB A;  2QEX A;  2PVO B;  5LJ3 g;  2VAS A;  3RBB B;  2EGC A;  1G3T A;  1OX9 A;  1YJN A;  1NJI U;  4XQ3 A;  2CH4 W;  2MAM A;  3REB B;  3EGX B;  2MI6 A;  4M78 E;  4N4I A;  1W2B P;  4QQD A;  4KUL A;  2FPD A;  3BFM A;  1CSK A;  2FEI A;  2V8I A;  1KC8 C;  3H0H A;  4XTW A;  2DM1 A;  4D8D A;  4IIM A;  4C8Q E;  1VQ9 A;  1KC8 U;  2KGT A;  3CCV Q;  4QQG A;  1VQ7 A;  2IIM A;  4EMH A;  4RTX A;  2DRK A;  1X6G A;  4QQ6 A;  3UAT A;  1WGS A;  4HKE A;  3OYN A;  3C0C A;  4XTY A;  2XID A;  1FMK A;  2OAU A;  1WJS A;  5AYF A;  5KYW A;  2MCN A;  3OYE A;  1UEC A;  2HQH A;  1X2Q A;  3JRZ A;  1G3S A;  4HCC A;  3EH1 A;  4XTU A;  1YJN Q;  2GTO A;  2HL5 C;  3LYI A;  1RL2 A;  3OYI A;  1X43 A;  1UFF A;  4FIB A;  5D6X A;  3CPW S;  4PJO E;  2FZG B;  4J9B A;  1VQ4 Q;  1U1S A;  1M9S A;  2GTJ A;  3CCU Q;  3ZBD A;  4BE2 A;  2AHJ B;  3G71 T;  2DTO A;  3G6E Q;  1GCP A;  3A8G B;  1RAH B;  3CC4 Q;  4X9C A;  1VQ9 T;  3HSB A;  2VV5 A;  1JRI A;  2CP2 A;  1KHC A;  1UG1 A;  2ZZD A;  3G6E T;  1ZBX A;  1VQ9 Q;  3HTR A;  2EJG A;  4CC7 A;  3DB3 A;  1R0B G;  3CCV A;  1QKW A;  5HY6 A;  5A0D A;  4RTU A;  2DXU A;  1VQ7 Q;  3GIB A;  4M7A E;  4FW2 A;  2YDL A;  1XOV A;  4FM4 B;  4DQ2 A;  5GMK h;  1FXX A;  1K9M R;  2MMP A;  2Z0W A;  3L2Q A;  1TU0 B;  2KXD A;  1UTI A;  3LH0 A;  1VIF A;  2A3L A;  4M75 A;  3PNW C;  5CKD A;  2LNV A;  2E65 A;  3G4S T;  2DK3 A;  2XKO C;  3SWN A;  1KQ2 A;  3TU4 K;  3L2U A;  4B9X A;  3UT1 A;  4E7Z A;  1WQ7 A;  1UHF A;  2ZPF B;  3CCL Q;  3BE3 A;  3M0P A;  4KRT A;  3PIO A;  4L59 A;  3P8D A;  4ELY C;  2DX1 A;  2D0Q B;  3TCJ A;  1FMV A;  3I9Q A;  3CCU A;  4M7A D;  3EFS A;  3OMG A;  1YWP A;  2VKN A;  2CRE A;  2WSF E;  1WZO A;  2D1X A;  1B34 B;  4BDZ A;  2DYB A;  2EKO A;  1TXQ A;  3MCA B;  4F7U F;  4M7D F;  1Y57 A;  1LVK A;  2AT1 B;  2XG8 D;  3CQT A;  1YBY A;  2QQR A;  4XAX B;  3SEM A;  3CCQ T;  2HKN A;  4RMO A;  1H8K A;  1JB0 E;  1W2B S;  4C0Z A;  2JMA A;  4QVC A;  5GAN 7;  3CMA T;  2WAC A;  4XTZ A;  2ECZ A;  2M02 A;  2CYZ B;  3VS3 A;  5FRN A;  3M55 A;  1HD3 A;  1OOT A;  2JZ2 A;  2KRO A;  2FPE A;  1KIK A;  1D3B B;  4JLI A;  4F16 A;  5GAO q;  2EFI A;  4JRI A;  4LE9 A;  4M7D C;  4M78 D;  2ED1 A;  1P92 A;  4LD6 A;  2DER A;  1D1C A; 
#chains in the Genus database with same CATH homology
 2C0T A;  1LCK A;  2O9S A;  5IH2 A;  1GRI A;  1SRL A;  1WYX A;  5IXB A;  1H3H A;  1VYU A;  2BZX A;  1ZUU A;  4QT7 A;  1SRM A;  2HDA A;  1E7O A;  2ED0 A;  2E5K A;  1SHG A;  1MV3 A;  2EGE A;  3QWX X;  2O9V A;  2DVJ A;  2KEA A;  1QCF A;  1OEB A;  1QKX A;  3I5S A;  5HCK A;  2X3X D;  2K79 A;  2KRM A;  5I22 A;  2YT6 A;  1WXB A;  4OMO A;  2RQV A;  4RTZ A;  2AKK A;  1NM7 A;  5FW9 A;  2YUO A;  3PVQ A;  1WI7 A;  1WIE A;  2CUD A;  4J9D A;  4HXJ A;  5IHI A;  3M0S A;  2LQW A;  2H8H A;  1KJW A;  1SSH A;  1K0S A;  1KFZ A;  4CC3 A;  2RQU A;  4OMM A;  4IIO A;  3THK A;  2DNU A;  3I35 A;  4HVU A;  3UF4 A;  1AZG B;  2LX7 A;  3O5Z A;  2M51 A;  4RTT A;  3ULR B;  2KRS A;  2LQN A;  4JJD A;  4WCI A;  1BB9 A;  2RQW A;  4RTV A;  1CKA A;  1M8M A;  1NYG A;  2BZY A;  2EKH A;  1K0X A;  1RI9 A;  2V1Q A;  2EYY A;  5ECA A;  2KNB B;  2J7I A;  1T3L A;  2EYZ A;  2L2P A;  3TSW A;  1Z9Z A;  2FRW A;  1J3T A;  2PTK A;  2AZV A;  2OAW A;  2F2V A;  4J9F A;  3EG1 A;  1G2B A;  4HVW A;  4K11 A;  2BTT A;  3QWY A;  4FSS A;  2J6F A;  1U3O A;  2LMJ A;  1BK2 A;  2C0I A;  1GL5 A;  2EW3 A;  1K4U S;  3H41 A;  2DRM A;  2CT3 A;  1GBQ A;  4DEY A;  4J9I A;  4GLM A;  4Z89 A;  2EVR A;  1PRL C;  2JS0 A;  2LZ6 B;  1JU5 C;  4AFU C;  1WDX A;  4Y92 A;  4J9C A;  2YSQ A;  1EFN A;  1FYN A;  1UE9 A;  1YNZ A;  2KBT A;  3PE0 A;  1TUC A;  1GFD A;  2O88 A;  2SEM A;  1RLQ C;  2FO0 A;  1K76 A;  4A63 B;  1HSQ A;  2K9G A;  2DL3 A;  1W70 A;  2B86 A;  3VS1 A;  2VWF A;  1X69 A;  3REA B;  2YUP A;  2RNA A;  4F14 A;  5L23 A;  2AK5 A;  4AG2 C;  2RF0 A;  2XMF A;  2JM9 A;  2OI3 A;  4DEX A;  1AWX A;  2O31 A;  2LP5 A;  4LUE A;  1HJD A;  1AWJ A;  1I1J A;  1VYV A;  1AEY A;  1M30 A;  3VRZ A;  4JPB W;  4JJB A;  2CSQ A;  2RQT A;  1K9A A;  1B3Q A;  2BZ8 A;  2KXC A;  2DL8 A;  1JEG A;  2NWM A;  4ZNX A;  1CKB A;  1TG0 A;  3FJ5 A;  5FWB A;  2LCS A;  3UA6 A;  3TVT A;  1GCQ A;  2MIO A;  1ABQ A;  2LNH B;  1ZBJ A;  3NPF A;  2D8J A;  2JTE A;  2CDT A;  2HSP A;  1JXM A;  3UA7 A;  2DLP A;  2W0Z A;  2J06 A;  4AG1 C;  1MUZ A;  2YUN A;  1W1F A;  2AZS A;  2GGR A;  1NEG A;  1K1Z A;  1T0J A;  3I5R A;  4AFZ C;  1ZSG A;  1ZLM A;  1UJY A;  5EC7 A;  4OMQ A;  3A98 A;  1AOJ A;  3NGP A;  3GBQ A;  1AZE A;  1A0N B;  4JZ3 A;  1ZUK A;  2CH4 A;  3VS5 A;  5IHN A;  2DA9 A;  2DL4 A;  2L3Q A;  1VYT A;  3ZL7 C;  2MOX A;  1UUE A;  4CC2 A;  2JS2 A;  1GBR A;  1OPK A;  1OV3 A;  2OJ2 A;  2KR3 A;  3KFV A;  4E6R A;  1SPK A;  2RPN A;  2HEQ A;  1ABO A;  4RTW A;  2V1R A;  4ORZ A;  2JW4 A;  1UJ0 A;  2EYX A;  4LUD A;  2NUZ A;  1NLP C;  2JXB A;  2ENM A;  1WX6 A;  4LNP A;  5IHK A;  1U06 A;  1H92 A;  4ESR A;  1NYF A;  2JT4 A;  2DBM A;  5FWC A;  3TSZ A;  1PNJ A;  2J6K A;  2LJ3 A;  2F2W A;  3M0R A;  3M0T A;  2C0O A;  4AFQ C;  1UGV A;  2LJ0 A;  1X2K A;  4OML A;  1QLY A;  2DF6 A;  1TUD A;  2KT8 A;  1KSW A;  5IXF A;  3JV3 A;  3H0F A;  1T0H A;  2L3S A;  1PKT A;  1OPL A;  1PHT A;  2KE9 A;  1I0C A;  4M4Z A;  1QWF A;  2SRC A;  1JXO A;  2CUB A;  2GBQ A;  2X3W D;  3EHR A;  1E6G A;  4RTY A;  3R6N A;  3RBB B;  2KT1 A;  1V1C A;  2EGC A;  2RN8 A;  2ROT A;  4X1V A;  2O2O A;  2CH4 W;  3REB B;  3RNJ A;  2K7A A;  1IO6 A;  1NEB A;  2RQR A;  2FPD A;  2J6O A;  1CSK A;  2ROL A;  1U5S A;  1ZUY A;  2EBP A;  4F17 A;  1JQQ A;  2FEI A;  3H0H A;  1VA7 A;  2LJ1 A;  2DM1 A;  2DMO A;  4JZ4 A;  4D8D A;  4IIM A;  4LN2 A;  1SEM A;  4R0K A;  1RLP C;  2EGA A;  2KGT A;  1E6H A;  2IIM A;  4D8K A;  4RTX A;  3SHW A;  1AWO A;  2DRK A;  1X6G A;  3UAT A;  4GBQ A;  2YUQ A;  3C0C A;  2A37 A;  1FMK A;  1BBZ A;  2A36 A;  1GFC A;  1N5Z A;  2MCN A;  1UEC A;  2DE0 X;  1X2Q A;  1AWW A;  3IQL A;  4OMN A;  2D0N A;  2RMO A;  4JJC A;  2GTO A;  1Z9Q A;  2QDL A;  1WLP B;  2FG0 A;  1I07 A;  5GJV B;  4AFS C;  4Z88 A;  1X43 A;  1UFF A;  4J9B A;  3EHQ A;  1X6B A;  2GTJ A;  1M3B A;  3M0Q A;  2A08 A;  1QWE A;  2CT4 A;  1MV0 B;  3EG3 A;  1UHC A;  1WXT A;  2L0A A;  1SHF A;  1GCP A;  2GQI A;  3VRY A;  2F2X A;  1S1N A;  2P4R A;  1WA7 A;  1UG1 A;  2DIL A;  1UDL A;  1WFW A;  3VS6 A;  2AKL A;  1ZX6 A;  1G83 A;  4EIK A;  5GJW B;  2EPD A;  1BU1 A;  2JMC A;  3VS2 A;  4CC7 A;  2M0Y A;  1M27 C;  1PKS A;  1AD5 A;  1QKW A;  4RTU A;  2EYW A;  1YCS B;  3PVL A;  1M3C A;  2ABL A;  2YDL A;  1XOV A;  4J9H A;  2KXD A;  4HCK A;  1UTI A;  2EQI A;  3NHN A;  5I11 A;  1JO8 A;  1ARK A;  1UHF A;  4CC4 B;  3M0P A;  2K2M A;  1YP5 A;  4KRT A;  2HBW A;  1X27 A;  2KRN A;  2KYM A;  2DX1 A;  1B07 A;  3EGU A;  2W10 A;  2I0N A;  3I9Q A;  3EG2 A;  2G6F X;  1YWP A;  2PNI A;  2VKN A;  4RUG A;  2CRE A;  1PWT A;  2D1X A;  2GNC A;  2DYB A;  2ESW A;  1W6X A;  3EG0 A;  1WXU A;  1Y57 A;  3CQT A;  3M0U A;  4OMP A;  3VS7 A;  3SEM A;  2CSI A;  1H8K A;  4Z8A A;  1NG2 A;  3VS4 A;  3H0I A;  1YWO A;  2L3P A;  2FPF A;  2K6D A;  2JMA A;  2K3B A;  1T3S A;  2DBK A;  2PZ1 A;  2HCK A;  1Y0M A;  2DJQ A;  1AVZ C;  2ECZ A;  1RUW A;  1GCQ C;  1M3A A;  2VVK A;  3NMZ C;  3VS3 A;  1NLO C;  1HD3 A;  1OOT A;  2KRO A;  4HVV A;  2FPE A;  1KIK A;  1YN8 A;  3U23 A;  2J05 A;  4F16 A;  2DL5 A;  2FRY A;  3LH5 A;  4LE9 A;  2DL7 A;  4J9E A;  2A28 A;  2D8H A;  2JM8 A;  2ED1 A;  2KYB A;  4J9G A;  3VS0 A;  1PRM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...