3I9QA

Crystal structure of the triple mutant s19g-p20d-r21s of alpha spectrin sh3 domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
57
structure length
57
Chain Sequence
b'KELVLALYDYQEKGDSEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain
publication title The effect of a proline residue on the rate of growth and the space group of alpha-spectrin SH3-domain crystals.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 14
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2009-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3i9qA00
1ZUUA 2DL3A 2O9SA 4J9HA 3UA6A 2O9VA 2MIOA 2ED1A 3EG0A 1SRLA 2JM8A 3EG2A 1W70A 2LP5A 4AFSC 1MV3A 2V1RA 2LJ1A 4J9GA 4J9CA 4EIKA 1IO6A 1HSQA 1K0SA 2GNCA 1U3OA 2OJ2A 2RQRA 1PRLC 4Z89A 4ESRA 2AZVA 1AEYA 1UJYA 1J3TA 2JM9A 4RTUA 3VS6A 2RQUA 1BB9A 4RTWA 5EC7A 3TVTA 1LCKA 4RTVA 2M51A 2DBKA 2CREA 1ZUYA 2FO0A 2NUZA 1PRMC 2KNBB 2CSQA 1WXBA 2DJQA 2LJ0A 4KRTA 3PE0A 2ED0A 1NG2A 2DRKA 4HCKA 2A37A 4OMQA 2EW3A 2DNUA 4IIMA 3UF4A 4R0KA 1U5SA 4LN2A 4LUDA 1UECA 3GBQA 1H92A 1WI7A 4FSSA 2AKKA 2SRCA 3VRZA 1M3BA 1RLQC 2C0IA 2D8HA 2HSPA 3JV3A 1AWXA 2CSIA 2JTEA 2DL5A 1KIKA 1YWOA 1AWOA 1AWJA 2F2WA 1WDXA 2DVJA 4F14A 1AOJA 5I11A 5GJVB 2FPDA 2LMJA 1VYTA 1GL5A 2KROA 2AKLA 1UDLA 1UHCA 1WXTA 1T3LA 2HDAA 2PZ1A 2KRSA 3M0PA 2AK5A 2AZSA 2KGTA 2CDTA 1AWWA 2LQNA 1YWPA 1QWEA 3NGPA 1TUDA 2L2PA 5IXBA 1WYXA 4J9IA 4JPBW 2FPEA 2DL7A 2JMAA 3IQLA 1RUWA 2HEQA 3I35A 4LUEA 1MUZA 1YNZA 3VS3A 1JO8A 2ABLA 4DEXA 2RQTA 4J9FA 1M27C 2RN8A 4CC7A 1PKSA 1XOVA 2JS0A 3TSZA 3O5ZA 3H41A 3PVLA 1B3QA 2EQIA 2IIMA 1E6GA 2KT8A 2LCSA 2J6KA 4OMOA 1K1ZA 2VWFA 2DILA 1M3AA 1UG1A 2DMOA 1UUEA 2CUBA 5ECAA 1JEGA 2YT6A 2J6OA 4CC3A 2DX1A 3EHRA 1FYNA 1JQQA 1CKBA 1ZLMA 2YUQA 5IH2A 4OMLA 2OI3A 1K4US 2I0NA 2FG0A 4CC2A 2KYMA 3EHQA 2DF6A 3ULRB 2L0AA 1PHTA 2F2XA 4D8KA 1TG0A 3RBBB 4JJBA 2L3QA 1SEMA 1QCFA 3KFVA 1ZX6A 1UGVA 1VYVA 2D1XA 2EYXA 2C0OA 4J9BA 2RQWA 3ZL7C 1H3HA 2JT4A 2DL8A 3SHWA 3PVQA 2KYBA 4GBQA 2KRMA 1UTIA 2M0YA 2HBWA 1OV3A 4LNPA 2RMOA 2KRNA 1X6GA 1X27A 1X69A 1BK2A 2YUOA 1UHFA 1ABQA 1HJDA 1G83A 1GFDA 3I5RA 4HVVA 2DA9A 4AFUC 3M0QA 3I5SA 4DEYA 4AG2C 3NHNA 1I1JA 2BZXA 3QWXX 3VS0A 4E6RA 1M3CA 3VRYA 1CSKA 1HD3A 2LZ6B 2X3WD 2A36A 2B86A 5IHNA 2KEAA 2JMCA 1EFNA 4QT7A 1SSHA 1OOTA 2CT4A 1NEGA 3U23A 2FEIA 4HVWA 2V1QA 2GQIA 4F16A 1AZEA 2DE0X 4OMPA 4Z88A 2YUNA 1AVZC 2DBMA 1YN8A 1GFCA 1QKXA 3UATA 3QWYA 1X6BA 3R6NA 3VS1A 1SHFA 1WIEA 5IXFA 4A63B 2J7IA 2VKNA 4ZNXA 1M30A 4M4ZA 2LQWA 2EYZA 3I9QA 1QLYA 2G6FX 3M0TA 4JZ4A 1WA7A 4F17A 4OMNA 1PKTA 3M0UA 2LJ3A 4J9DA 4J9EA 3EGUA 1K76A 3VS7A 1WFWA 2KT1A 2W10A 1K9AA 1I07A 4RUGA 3EG3A 1YP5A 5IHKA 3RNJA 4AFZC 5FW9A 1Z9QA 1QKWA 4OMMA 2A08A 1Y0MA 3VS4A 2FPFA 2P4RA 2LNHB 2J06A 4D8DA 4RTZA 2JW4A 2KBTA 3EG1A 2FRYA 4AFQC 1KJWA 2O2OA 1GRIA 2RNAA 1NYFA 2K9GA 3REAB 1NLOC 2DM1A 3H0IA 1BBZA 2GTOA 2EYWA 1OEBA 1K0XA 1N5ZA 2EVRA 3A98A 1UE9A 4CC4B 2K6DA 2D8JA 2OAWA 1JU5C 1UJ0A 1M8MA 2O31A 1U06A 1E7OA 4LE9A 4JZ3A 1AZGB 2KXCA 1MV0B 5IHIA 4ORZA 2PTKA 2J6FA 1W6XA 2FRWA 5GJWB 2A28A 2EBPA 4RTYA 2MOXA 4RTTA 2L3SA 1VYUA 2K2MA 4WCIA 4K11A 3C0CA 1NEBA 1G2BA 2CUDA 1SPKA 2EYYA 1WLPB 2DRMA 3TSWA 2C0TA 1BU1A 3VS2A 1RLPC 1AD5A 4Y92A 1GCPA 2RQVA 1W1FA 2YSQA 3NMZC 1QWFA 4HVUA 3VS5A 1ZUKA 5HCKA 1V1CA 1X2KA 1T0HA 1FMKA 1TUCA 1RI9A 3UA7A 3H0FA 2EPDA 1YCSB 1CKAA 2LX7A 1PNJA 2JXBA 2CT3A 2F2VA 1JXMA 1GBQA 2RF0A 2SEMA 2X3XD 2L3PA 1OPKA 2BZYA 2YDLA 4GLMA 2YUPA 2DLPA 5L23A 2K79A 2EKHA 4AG1C 4JJCA 2EGCA 1GCQC 1KSWA 2XMFA 5FWCA 1GCQA 4JJDA 1NM7A 2GBQA 1VA7A 2ECZA 3REBB 1PWTA 2ENMA 3LH5A 2BZ8A 1NLPC 3NPFA 1A0NB 1OPLA 2GTJA 2J05A 1X43A 1ZSGA 4Z8AA 5I22A 1T3SA 1B07A 1GBRA 2QDLA 1ARKA 2CH4A 3CQTA 2MCNA 4HXJA 2K7AA 1WXUA 1Z9ZA 2CH4W 2D0NA 3M0SA 2ROLA 1UFFA 2H8HA 1Y57A 4IIOA 1I0CA 2O88A 1H8KA 1JXOA 2RPNA 3M0RA 1S1NA 2KR3A 4RTXA 2K3BA 3H0HA 2VVKA 1KFZA 2ROTA 1NYGA 2E5KA 3FJ5A 1WX6A 2HCKA 1ABOA 2JS2A 2NWMA 2PNIA 3SEMA 2KXDA 2DYBA 4X1VA 2DL4A 1T0JA 2BTTA 2EGEA 2GGRA 5FWBA 1E6HA 3THKA 1SHGA 2KE9A 2EGAA 2ESWA 1ZBJA 2W0ZA 1SRMA 1X2QA
chains in the Genus database with same CATH superfamily
3ME9A 5GANh 3OYCA 1VQ7T 1KC8C 3M53A 3TEEA 1KG1A 3MP6A 1SRLA 2JM8A 2QQRA 2VUBA 3P8BB 4Y28E 3WXMB 3MEVA 4AFSC 2LJ1A 5J26A 2P4TA 3CCRQ 1K0SA 4XTUA 4R55A 1WQ7A 4M7DD 2EYQA 1M90U 1M1FA 5J39A 2XIDA 1AEYA 2OTLQ 2XI9A 1FMWA 3MO8A 4RTUA 4C5HA 3KBGA 4RTWA 5EC7A 2ZPEB 3TVTA 4D6WA 1LCKA 4RTVA 2M51A 3EH1A 2YRVA 4OB2B 4LDWA 2CSQA 1SG5A 4E7HA 1WXBA 2LJ0A 1WHKA 5A0GA 3PE0A 4J5YA 2FB7A 3BFMA 2DRKA 3GOXA 2OX7A 5LJ5h 1UGSB 3CBPA 4IIMA 1QVFP 1WI7A 1VOMA 1NJIC 5HY6A 5GMKh 3CXCS 4ZTJA 3E9FA 1YWOA 1AWOA 1WDXA 2WSFE 5KH6A 3AT1B 5I11A 2FPDA 4XTYA 2KROA 4ZGEB 2AKLA 2G3RA 2IG0A 2RI5A 1UHCA 3HPWA 1Q86U 2B8AA 5GAMj 3M0PA 3S3MA 1YJWA 8AT1B 2QGFB 4OMFB 1X01A 1QCNA 1QP2A 4XU2A 2ATCB 1YITQ 2CZ1B 2L2PA 5IXBA 5FU6C 3FIFA 3UWNA 3MPUB 1QVGP 2FPEA 3EGXA 3I35A 5I2SA 4LUEA 1JO8A 2E6ZA 2ABLA 4DEXA 2MK5A 2RN8A 1XOVA 4BY6B 4CRIA 2DAQA 4OB1B 1E6GA 3X20B 2CP6A 2J6KA 1ACMB 3CC7Q 1V76A 2QQAA 1K9MR 1UUEA 4EDUA 4CC3A 3EGXB 3EHRA 4YTLA 3OMGA 1N9SA 1JQQA 2QK0A 1ZLMA 4OMLA 4M78B 2I0NA 2DZCA 1PC0A 4ZN3A 2PU9B 5FROA 4A4FA 3RBBB 2L3QA 1VQNT 1YHQT 4RCCA 2EYXA 3A8OB 2RQWA 3ZL7C 3MEWA 5GAMg 3OYMA 1IRXA 4C8QE 2JN0A 1K73R 3PVQA 4M77G 4BI8B 2HBWA 4LNPA 2RMOA 1X69A 1BK2A 3OBWA 1ABQA 3NTHA 3I5RA 3BW1A 3CCST 2RHZA 4AG2C 4AT1B 3NHNA 3JCMV 1I8FA 3CBMA 3BDUA 3QWXX 3M57A 4BI4A 3JB9F 1M9SA 4PJOG 4QVDA 3FDRA 4QVZA 3JCMJ 3OW2A 1HD3A 2IPOB 1G3TA 3CCRT 2L5QA 4KGVB 1O9SA 2QEXT 1EZZB 3QDRB 4QT7A 5GAOp 1OOTA 1OYXA 2ZPBB 2OTLT 4II1A 3TU4K 3U23A 1Q7YC 2RHYA 3CPFA 2FHDA 3L2RA 5CQYA 2K5IA 4KGXB 4HCZA 1WIEA 2ZPIB 3DKMA 5CK9A 2YXYA 1D0XA 1RABB 4M4ZA 4CI0C 5GAN5 3G7ZA 3ASKA 4OMNA 2QGGA 4IUTA 2LJ3A 4J9DA 3EGUA 3MEUA 4KH1B 5CAIA 1MMNA 1K9AA 5GAMe 3HFNA 2D6FA 3RNJA 4L5GA 1Z9QA 2LQKA 2QAZA 2L89A 2A08A 2WACA 3VS4A 2LNHB 2EQKA 5GAN3 1PSFA 4C8QC 2XDDA 2FRYA 4XU1A 4C8QA 4AFQC 3JB9I 3L1AA 2O2OA 4FU6A 4N0AA 1GRIA 4M7AE 1M2VA 2RHXA 2ZGWA 1NLOC 2DM1A 3H0IA 3OYJA 1K0XA 2EYWA 1OEBA 2VB6A 1YITT 5KCHA 3EFOA 5KYUA 5FRNA 4XAXB 1M4ZA 4LD9K 1I5OB 3G4SA 2BE9B 2OAUA 1MGQA 1Y07A 1W2BA 1AZGB 5IHIA 3PFSA 3KXTA 1MNEA 1UGQB 1W4SA 5GANj 4FYYB 3CC7T 4F7UG 1VYUA 1BYMA 3C0CA 1WJRA 2DRMA 1VQ4T 1BU1A 1RLPC 4PFOA 1LPLA 2E41A 2DXUA 1QVPA 3M55A 3NMZC 1D3BA 3KUFA 2QXFA 4FYVB 1V1CA 2JTMA 2V8KA 3X24B 3V8JA 4C8QF 1M1KU 3I56Q 1WJSA 1PNJA 3FC3A 3MHXA 4M7DE 3A8LB 3NFCA 1G8XA 5GAMd 1WJQA 5D6WA 4BUGA 1YJWQ 4XK8E 1OI1A 5CKEA 3SWNB 1BI1A 4F04B 3JCMQ 2YUPA 5LJ5j 4AG1C 1Y96B 2XMFA 4NL2A 1MHNA 2XICA 4LDYA 2H3EB 1VA7A 3REBB 5KYWA 3CPWA 3LH5A 4PL6A 1A0NB 3V7SA 2J05A 1ZSGA 5GMKj 1FXXA 1Q81U 3CCJQ 1ARKA 2CH4A 3CQTA 3CC2A 2DPPB 1Z9ZA 2D0NA 1JJ2P 2ROLA 3QZ9B 4M7AC 1N8RU 1JJ2S 4M7AA 2LTOA 4MMKA 3LH0A 2O88A 1VQ5T 2RPNA 2F69A 4E7LA 2K3BA 1RI0A 4BE1A 1KFZA 3OW2P 1NYGA 4J6XA 4C8QD 1VQMA 1WX6A 4JRIA 1BCOA 2PNIA 2KXDA 4JRQA 4BDZA 2QQBA 5FLXE 3P8DA 1KQ2A 4UC4A 2KMTA 3CCVA 2RJEA 2KE9A 4O6JA 1WHGA 1KD1C 1ZUUA 2O9SA 2MIOA 5CKFA 2Z0WA 4M77B 2MYSA 3CCQA 3D7SB 1W70A 3OBYA 1MV3A 2V1RA 2FYKA 2DTIA 1HSQA 2GNCA 4MMLA 4M7AF 4GY5A 5FU7B 2AZVA 4M7DC 1QW1A 4PLLA 4M7DA 1UJYA 3UDCA 4KH0B 5LJ3f 2CKKA 5HK3A 3META 4PJOB 2VC8A 5A0DA 1BIBA 3HRUA 2FO0A 2CREA 1JRIA 4PNOA 1PRMC 5D6XA 2KNBB 5GANe 3MKDA 2V8IA 2DJQA 2K2VA 3AHUA 2DIQA 4JDSA 5CKBA 3M56A 1U1TA 1KQSA 4R0KA 1U5SA 4LN2A 4LUDA 4EMHA 1UECA 4PFPA 3QUIA 1K9MU 2AKKA 2SRCA 1M3BA 2RI3A 3QDFA 4QQ6A 2C0IA 2EQMA 4GLKA 3C4SA 2JTEA 2P84A 1KIKA 2E3HA 2L3RA 3QYGB 4OF1A 1AWJA 2GQVA 1OULA 4J6YA 2DVJA 1AOJA 3VYHB 1XNIA 5EG2A 1WXTA 4N4IA 2KRSA 4M7AD 3QIIA 4EMKC 4M7DF 1VQKQ 2AK5A 1SKUB 3EFSA 3OMCA 1QWEA 5L8RE 3NGPA 2DD4A 2BKDN 1TUDA 5LJ5e 4NOYA 4ZTFA 2F1LA 4PFZA 4V2SA 2COZA 2DL7A 2JMAA 2HEQA 4HCCA 2E6NA 1Y7XA 1YJWT 3VYGA 3OY9A 2KK4A 4PJJA 4E2FB 5KCOA 3OS1A 1PKSA 3VKIA 3H41A 3MCAB 2NUPA 4XTZA 1WNLA 4JRPA 4C0DB 2P0KA 1K1ZA 2VWFA 2DMOA 2OTJA 1KC8R 2CUBA 1JEGA 1PD1A 1YJ9A 1LJOA 3G4SQ 1VQPQ 4E7IA 3P8HA 5IH2A 3HHTB 5GANd 2NUPB 2FG0A 2MWPA 4M78E 3EFRA 3CPWP 3JCMf 3CPWS 2DF6A 5DLQE 1D1BA 2L0AA 4FYWB 4HT9A 2F2XA 4F7UB 1TG0A 1QCFA 1G3SA 4JS5A 1VQOA 2R5MA 2D1XA 1H3HA 3A5ZB 5LL6S 2JT4A 4KT0E 2D0QB 4M75G 2CS7A 2KYBA 2KRMA 1VQ9A 2DO3A 2KRNA 1X27A 3QJYA 2YUOA 1UHFA 3PIPA 1HJDA 1Q81C 1FX7A 1N6AA 4AFUC 3SD4A 3QG1A 2M1HA 1RAIB 1N8RC 3PMIA 1NJIR 5LJ5d 1YJNA 2YRCA 3CCUA 1QVFS 2RJDA 2LZ6B 4VUBA 1WGSA 4C92E 3Q1JA 3QJ6A 2B86A 1C0MA 3BE3A 2KEAA 2L8DA 1QQJA 1LOJA 5CKDA 3EAEA 3QHSA 1JB0E 1ZBXA 3I56A 2FEIA 3CC2Q 2GQIA 3QKJA 5GAOl 4OMPA 3OQ5A 4HKEA 2F5TX 1QKXA 1WHHA 4BY6C 1SHFA 4DOWA 4JRKA 3G6EA 5M9OA 4A63B 2LQWA 2EYZA 4Z02A 3E2UA 2G6FX 2QQSA 1VQMQ 4JZ4A 4F17A 3M9QA 3FEOA 1QVGS 2M16A 3VJPA 2PQWA 4J9EA 2RA2A 3H6ZA 2XKOC 3CCJA 2W10A 4MDWA 2KI7A 4M78A 3CCVQ 4RUGA 1OX9A 1YP5A 3CBOA 5IHKA 3R6OA 3TREA 4AFZC 1R8OB 1KQSP 5GAN2 1Y0MA 5CVIA 5KE2A 2DXBA 4D8DA 3QYHB 2JW4A 2QI2A 3X25B 3CCQQ 2LX9A 2VXFA 3RDVA 2DXTA 1N5ZA 2MI6A 4FIBA 2AIRB 4ZGJB 3L2ZA 5GAN7 1UE9A 2EFIA 3QSUA 1KQ1A 5I21A 1RAAB 1UJ0A 2EJ9A 2O31A 2HMAA 4LE9A 3CMEA 2DYIA 8ATCB 3GIBA 3RIRA 3E9GA 1UGPB 4DQ2A 4C0ZA 4A4EA 1W6XA 2KY9A 1ZSZB 2A28A 1MNDA 2EBPA 4PJLA 3CC4Q 4C92A 2MOXA 4JLGA 2K2MA 2X4XA 2YLCA 4K11A 4WCIA 4EMGA 1G2BA 2CUDA 1SSFA 1WLPB 3G4ST 3TSWA 1K8AU 1NBEB 1AD5A 3A8HB 3OYEA 1GCPA 3MEAA 1G3WA 1W1FA 2YSQA 1AT1B 1F1BB 1QWFA 4L6V5 1ZUKA 4OVAA 2FZGB 2JOYA 4C92B 2CZ0B 1X2KA 2A3LA 3E1SA 2JUFA 1FMKA 1P92A 1Q7YR 1Q82U 2FL7A 4J7IA 3OS2A 1RACB 2EPDA 1CKAA 3DB4A 4E7SA 4C0GA 1IXDA 4AMCA 2F2VA 1JXMA 2NYSA 5GAN8 2L3PA 2RO0A 5CKHA 2CP7A 3OYYA 1G5VA 2EGCA 3M59A 4DBFA 2VXEA 3BDLA 1XJWB 4JJDA 2C06A 2PVDB 2LDMA 1PWTA 2ENMA 1NLPC 3LX7A 1OPLA 2GTJA 3JCMc 1X43A 4QVCA 5I22A 1B07A 1HK9A 2R57A 2QDLA 2FVUA 3O8VA 3PGGA 3ZEHA 4HXJA 5GAOm 3SDZA 4M78D 2K7AA 1EX4A 3H9NA 1UFFA 1M90C 2H8HA 2BUDA 1Y57A 3OYNA 2OTJQ 1VQKA 1H8KA 1YJ9Q 1X6OA 3M58A 3M0RA 2KR3A 4RTXA 2ZZDA 3M4GA 2E5KA 2HCKA 1ABOA 1JBMA 2DEQA 3HSBA 2JS2A 4ANJA 2NWMA 1D0ZA 4JJNK 4N0AC 4LXCA 3H8ZA 2DL4A 2DIGA 4ELYC 2E65A 2LT4A 2EGEA 1ZQ1A 3E19A 5A2QE 1VQOQ 3THKA 3OS0A 3OYKA 1SHGA 5CQXA 1VQMT 1X2QA 4E7KA 2IVWA 3RKWA 3QXEB 3V8KA 2O9VA 1VQ9Q 3JCMP 3LGFA 4A4KA 4M75B 1VQPA 4C92D 3EG0A 3S6WA 4M77E 3EG2A 2LP5A 3CCVT 3L2WA 4EIKA 1U3OA 1Q86C 5GAN6 2KDSA 3EGDB 4Z89A 4ESRA 1IGQA 4X34A 2BIVA 1YJNQ 1J3TA 3CCUQ 3VS6A 3JCMg 4RG8A 2RQUA 2NLUA 2K57A 4C0FA 3J81E 4LD6A 4PJOE 2X51A 3SWNA 5IAYA 2DBKA 1YIJA 2NUZA 1TWBA 2DK3A 2CZ6B 1Y96A 4RG2A 3ZBDA 3QPHA 4KRTA 2ED0A 2O4XB 2EW3A 4MZPA 2DTHA 2DNUA 1RADB 3DLMA 3UF4A 2RHIA 2K3XA 4OB3B 1H92A 1Q95G 3M5AA 4HA8A 3G6EQ 1OQKA 1RLQC 2XDBA 2HSPA 1AWXA 2CSIA 2EIFA 2COWA 2VV5A 4ME7A 2HL3A 3ER0A 4F14A 1GL5A 3LW5E 4FYXB 1VQ8A 3OYLA 2PZ1A 2E70A 3A8GB 4OP0A 3INZA 1H641 3BY7A 2AZSA 2CP0A 4L59A 2JJ9A 5GAOr 2LQNA 1M2OA 2E1HA 1D1CA 2MF2A 3OYAA 3LWIA 4XQ3A 1ZHIA 1WYXA 4J9IA 5LJ3h 3OSVA 2PVOB 4OB0B 3TCJA 2EJFA 1YCYA 3OW2S 3V8LA 1MUZA 1YNZA 1VQ7Q 3VS3A 4M75D 4J9FA 4CC7A 2HL5C 3TSZA 3O5ZA 1IGUA 1K8AC 2X4WA 4M77C 2IIMA 4M77A 2LCSA 3GNFB 2JTFA 1C6VX 1OZ2A 4ZN1A 2QTVA 1KD1R 1M3AA 3OYHA 5ECAA 2CGHA 2YT6A 2J6OA 2DX1A 1WZOA 3CCLA 3CMEQ 5GMKl 2DTOA 4XTWA 2M9UA 1N9RA 5FU7C 1Q82C 5GAMf 2OI3A 1K4US 2QTXA 4B6MA 4CC2A 2QASA 3GF5A 5IN1A 1BI2A 4DOVA 2X4JA 4PJOC 1YFNA 2OTJT 2HBPA 4PJOA 3ULRB 1YJ9T 5D6YA 1PHTA 4JJBA 1SEMA 3NTIA 4F7UE 3KFVA 1ZX6A 2X4YA 1SF9A 3CXCA 1BIAA 5IT9E 4IUQA 4J9BA 7AT1B 2PUOB 1QP3A 1TTHB 2K5LA 3SHWA 1OV3A 2FZCB 2DEUA 1VQ6A 1TSFA 3JB9G 1G83A 4XU3A 1VQOT 1GFDA 4QKUA 3CC4A 3HL8A 2AHJB 4BB7A 2YLBA 4M77F 3M0QA 1RAGB 4BI3A 5GAOn 4X9CA 1I1JA 4E7JA 2XU8A 1VQ9T 2RJFA 2HSEB 3WVDB 4E6RA 3VUBA 1M3CA 1UEBA 3CD6A 2X3WD 1IREB 4E47A 2KAFA 4IUVA 5IHNA 1W2BP 1EFNA 3URGA 1W2BS 4PJOF 1SSHA 1YJNT 3VUZA 5HK0A 1WHMA 1C1AA 4WF2A 3EG9B 3JCMh 3CCUT 4F16A 1AZEA 2DE0X 4Z88A 2CZ7B 2MPXC 2YUNA 1AVZC 1YN8A 1GFCA 2NUTA 1OU9A 3UATA 1OZ3A 4XU0A 1X6BA 3VS1A 5CO7A 3FB9A 1DJ7B 2LCCA 3SB2A 3I56T 2QA4A 2Y90A 2J7IA 4C0DC 4ZNXA 1VQ5A 1M30A 1QLYA 1AHJB 4NL3A 1K73U 3SFMA 1PKTA 4NS5A 3M0UA 4FW2A 2NUTB 1K76A 2LCLA 4M77D 3VS7A 3T9NA 1WFWA 2YHTA 2KT1A 4BE0A 4N4HA 3G6ET 4MZTA 1I07A 4O5VA 2DD5A 2M0OA 5FW9A 1QKWA 4OMMA 4B9WA 4F7UA 1RAHB 4C5IA 3PMTA 2FPFA 2P4RA 4N4GA 3I55A 2RK1A 2J06A 4EMKB 3CCJT 1M1KC 4PJOD 1HYOA 1Q7YU 1NYFA 1BI0A 3REAB 1S72A 1IHWA 2FZKB 2XDPA 1EIFA 2EVRA 4XTVA 3RUXA 3VV0A 4DBHA 3S3NA 3VU3C 4CC4B 3CCEA 2D8JA 4FSXA 2OAWA 2RM4A 2AT1B 2XK0A 3JB9H 2JNGA 5GMKm 1B34B 4JZ3A 1M5Q1 2EAYA 5KYYB 1Q81R 4DBRA 4IUUA 1YIJQ 2QYZA 5GJWB 2HQXA 1YI2A 2KQWA 2A0FB 1N8RR 1NPRA 4C5EA 2LRQA 1WHJA 1NEBA 4DBQA 2QEXQ 1SPKA 2EYYA 4FL6A 2DZ9A 2LNVA 3CMET 3RESA 1U8RA 4C8QG 4KUDK 4QW2A 3WVEB 4J8OA 2ZCFB 4F7UF 3GPLA 3OB9A 1WPYA 2JVVA 4B9XA 2ZPFB 1ZA1B 2PVGB 3CCMA 2K4YA 1RI9A 3UA7A 3S3OA 3CMAA 1ZA2B 1VQ8Q 2CT3A 2P0QA 4RCBA 4Q5WA 2CP5A 1GBQA 1M8VA 5A0LA 2SEMA 5C6SA 1TUGB 2BZYA 2YDLA 4GLMA 3LGLA 2DLPA 5L23A 5GANf 2K79A 2EKHA 1WHLA 1TXQA 4JJCA 1PD0A 1YBYA 2PUKB 3CXCP 1GCQC 5FWCA 2E64A 3PNWC 1GCQA 5GMKi 1MMAA 1NM7A 2GBQA 3L2UA 4QQDA 5AT1B 3C95A 2VYTA 2HKQB 5DY9A 3NPFA 2ZPGB 3G71A 4Z8AA 1O75A 4PLIA 4IUPA 6AT1B 1WXUA 4DA4A 3M0SA 3HRSA 3NTKA 2K5FA 4IIOA 1I0CA 4M78C 3A8MB 1JXOA 1KHIA 3CCLQ 1VQLA 3H0HA 2VVKA 1KQSS 1PM3A 2X35A 3DB3A 5C0MA 2RHUA 5LJ3j 3SEMA 4TVRA 1BKBA 2MAMA 2DYBA 4X1VA 4WTOB 1VQ7A 1VQKT 5LJ5f 1IZ6A 1ZSZC 1KK7A 2HKNA 2DVEA 1ZSZA 1E6HA 5FU6B 4EPCA 5D7UA 1VQ4Q 1IB8A 2ESWA 1ZBJA 1SRMA 3OYBA 1MMDA 4PKCC 2GF7A 4RKUE 2DL3A 4J9HA 3UA6A 1VIFA 5GAOq 1K9MC 2ED1A 4M7AG 2RB6A 1OX8A 1VQ6Q 4M75E 1PG5B 3FRNA 1X75C 4C92C 4J9GA 4J9CA 2DERA 3LLRA 2VGNA 1IO6A 1BCMA 2OJ2A 4Y91A 4A53A 2RQRA 4PK4A 1PRLC 4M78F 3MP1A 1QMCA 3OSSC 1VQPT 1I4K1 3J80E 2JM9A 1PCXA 4JUVA 2F5KA 3CD6Q 3N5BB 4MDXA 1BB9A 2GFAA 2KSSA 2E10A 3GLXA 2A7YA 1LVKA 1ZUYA 3L2QA 2GCXA 1K73C 3LYIA 1U1SA 1JJ2A 3HTRA 1NG2A 5LJ3g 4HCKA 2A37A 4OMQA 3G1JA 1UB4A 4FT4A 1YIJT 3GBQA 4R56A 3CEYA 2DETA 1KD1U 2EWNA 4FSSA 3VRZA 2QA4Q 1VQ5Q 3JV3A 2D8HA 2LVMA 2Y4YA 2DL5A 4M7DG 2MMPA 1VIEA 2F2WA 2CP2A 4C92F 5GJVB 1M90R 4BD3A 2LMJA 1VYTA 2EJGA 1NZ9A 1UDLA 2COYA 1T3LA 2HDAA 3HKSA 3F70A 4LDXA 2V26A 4LDUA 3HP9A 3JAME 3DLLA 2KGTA 2CDTA 1AWWA 1YWPA 4HT8A 3JCMW 4LDVA 3JB9J 2EQUA 4FW1A 3I55Q 1B7TA 1VQ8T 2WSEE 4JPBW 4XTXA 3IQLA 1RUWA 3CC2T 2RQTA 1MMGA 1M27C 1R77A 2HNIA 2JS0A 2I2LA 1S72Q 3PVLA 1B3QA 4M75C 1G3YA 4M75A 2EQIA 2KT8A 4IKFA 4OMOA 1TS9A 3JB9D 3CCEQ 2DILA 1D0YA 1RL2A 1UG1A 5AYFA 2HD0A 1XTDA 2JZ2A 1VQNA 1FYNA 3JCMb 1YHQA 2Y4XA 3EGDA 1CKBA 1RAFB 2YUQA 1LNXA 4BDYA 1YI2Q 1Q86R 2KYMA 3EHQA 5LJ3e 4X9DA 2RH2A 4P5NA 3CCLT 4D8KA 5DM7R 4JLIA 2HZYA 1M1GA 1UGVA 2H3JA 1VYVA 2C0OA 4C8QB 2DKGA 3CCSA 2DL8A 2O4XA 1M2VB 2V8JA 5CR2A 3CCQT 4GBQA 4ZGDB 1UTIA 3GNGA 3CCMQ 2M0YA 5CIUA 2E5QA 2BE7D 4KUIA 3L2VA 1X6GA 3EFOB 5KYUB 1D09B 3CMAQ 3SWNC 2R5AA 4HVVA 2DA9A 4M75F 2LQ8A 3I5SA 3CCRA 4DEYA 2DXCA 1UGRB 2VGMA 2QEXA 2RK2A 4J6WA 2BZXA 2DFUA 2P0PA 3VS0A 2OTLA 3UT1A 1XQHA 1VQ6T 3VRYA 1CSKA 3M4YA 1GXIE 4HCBA 2O01E 1VUBA 3CC4T 1HXDA 2A36A 4FCYA 1V29B 1KC8U 2QQ9A 2JMCA 1TH7A 3MP8A 2CYZB 3G71Q 2RD1A 2EQJA 4A4GA 2MWOA 5GAMh 4PJMA 3V7CA 2CT4A 3MJXA 1D3BB 1NEGA 3RKXA 2E4HA 4HVWA 2V1QA 1N27A 3CD6T 3C94A 2DBMA 3JRZA 2ZPHB 3QBYA 3PT9A 3QWYA 2E3IA 3R6NA 2CP3A 4KGZB 1VQLQ 5IXFA 2VKNA 4E7ZA 1R0BG 3I9QA 3M0TA 2X9HA 4FM4B 1WA7A 5LJ3d 1K8AR 3X26B 1H3ZA 1PSEA 1IHVA 2GFUA 3QZ5B 4OGEA 1I5LA 5GANg 1TOVA 4ATOA 1NE8A 3L42A 2LC4A 2E12A 2QA4T 2D9TA 5KYXA 5KYWB 3EG3A 3RKYA 1KHCA 4IURA 1YITA 3JCMe 1Q82R 4C5GA 1NJIU 5KYNA 5DLOA 4J7FA 4RTZA 5HKCA 2KBTA 3EG1A 4M7AB 1KJWA 2RNAA 5KYXB 2K9GA 2XHCA 1BBZA 2GTOA 3RMQA 3TQ7P 4JS4A 3A98A 1QVFA 4KBMB 3M54A 3PIOA 3CC7A 2K6DA 3I55T 3HFOA 1JU5C 1RAEB 2HQEA 1M8MA 1U06A 1E7OA 2HAXA 1VQ4A 5J3BA 4ELZC 2KXCA 1MV0B 5LJ5g 2R58A 4M78G 3FJPA 4ORZA 2PTKA 1S72T 2J6FA 3J7AF 2FRWA 5GAN4 2XD0A 4RTYA 4OGCA 4FT2A 4RTTA 3CCET 2L3SA 3C12A 2YRDA 4A54A 3X28B 5KE3A 2C0TA 3VS2A 1Y71A 4Y92A 3QO3A 1WQWA 2RQVA 3RMSA 1BI3A 3VS5A 4HVUA 1YI2T 1OU8A 1QCOA 3PTAA 3EG9A 4A4HA 1QVGA 5HCKA 4J83A 2XG8D 2RJCA 1T0HA 1TUCA 3JCMX 3H0FA 1YCSB 2LX7A 2DJZA 4M7DB 4BE2A 2EKOA 3JSCA 2JXBA 2KVQG 3UPUA 4RMOA 2LT1A 2RF0A 3EH2A 2X3XD 4C92G 1NPPA 1OPKA 3JCMd 3CCMT 4KULA 3CMAT 1D1AA 4BACA 1KSWA 2WSCE 3RR6A 3ZFJA 2ECZA 3OYGA 2BZ8A 5I2MA 1T3SA 1GBRA 9ATCB 3LWHA 2RI2A 4MZMA 2MCNA 4EMKA 2CH4W 2QG9B 2YWWA 3HRTA 3G71T 1S1NA 1I81A 2VASA 4QQGA 1M1KR 1VQNQ 1YHQQ 2HQHA 2ROTA 3FJ5A 1TU0B 3GP8A 3OA6A 3OS5A 3OYFA 5GMKe 1B34A 3A1PA 1FWZA 3RERA 5KYYA 1FMVA 2ZAEA 2M02A 1T0JA 3OYIA 5FRMA 2BTTA 1VQLT 2GGRA 5FWBA 5CCAA 2QDYB 2K3YA 3FLGA 3V7RA 4PJNA 3OYDA 2EGAA 2W0ZA 3CCSQ 1R0CB
chains in the Genus database with same CATH topology
1ZUUA 2DL3A 2O9SA 4J9HA 3UA6A 2O9VA 2MIOA 2ED1A 3EG0A 1SRLA 2JM8A 3EG2A 1W70A 2LP5A 4AFSC 1MV3A 2V1RA 2LJ1A 4J9GA 4J9CA 4EIKA 1IO6A 1HSQA 1K0SA 2GNCA 1U3OA 2OJ2A 2RQRA 1PRLC 4Z89A 4ESRA 2AZVA 1AEYA 1UJYA 1J3TA 2JM9A 4RTUA 3VS6A 2RQUA 1BB9A 4RTWA 5EC7A 3TVTA 1LCKA 4RTVA 2M51A 2DBKA 2CREA 1ZUYA 2FO0A 2NUZA 1PRMC 2KNBB 2CSQA 1WXBA 2DJQA 2LJ0A 4KRTA 3PE0A 2ED0A 1NG2A 2DRKA 4HCKA 2A37A 4OMQA 2EW3A 2DNUA 4IIMA 3UF4A 4R0KA 1U5SA 4LN2A 4LUDA 1UECA 3GBQA 1H92A 1WI7A 4FSSA 2AKKA 2SRCA 3VRZA 1M3BA 1RLQC 2C0IA 2D8HA 2HSPA 3JV3A 1AWXA 2CSIA 2JTEA 2DL5A 1KIKA 1YWOA 1AWOA 1AWJA 2F2WA 1WDXA 2DVJA 4F14A 1AOJA 5I11A 5GJVB 2FPDA 2LMJA 1VYTA 1GL5A 2KROA 2AKLA 1UDLA 1UHCA 1WXTA 1T3LA 2HDAA 2PZ1A 2KRSA 3M0PA 2AK5A 2AZSA 2KGTA 2CDTA 1AWWA 2LQNA 1YWPA 1QWEA 3NGPA 1TUDA 2L2PA 5IXBA 1WYXA 4J9IA 4JPBW 2FPEA 2DL7A 2JMAA 3IQLA 1RUWA 2HEQA 3I35A 4LUEA 1MUZA 1YNZA 3VS3A 1JO8A 2ABLA 4DEXA 2RQTA 4J9FA 1M27C 2RN8A 4CC7A 1PKSA 1XOVA 2JS0A 3TSZA 3O5ZA 3H41A 3PVLA 1B3QA 2EQIA 2IIMA 1E6GA 2KT8A 2LCSA 2J6KA 4OMOA 1K1ZA 2VWFA 2DILA 1M3AA 1UG1A 2DMOA 1UUEA 2CUBA 5ECAA 1JEGA 2YT6A 2J6OA 4CC3A 2DX1A 3EHRA 1FYNA 1JQQA 1CKBA 1ZLMA 2YUQA 5IH2A 4OMLA 2OI3A 1K4US 2I0NA 2FG0A 4CC2A 2KYMA 3EHQA 2DF6A 3ULRB 2L0AA 1PHTA 2F2XA 4D8KA 1TG0A 3RBBB 4JJBA 2L3QA 1SEMA 1QCFA 3KFVA 1ZX6A 1UGVA 1VYVA 2D1XA 2EYXA 2C0OA 4J9BA 2RQWA 3ZL7C 1H3HA 2JT4A 2DL8A 3SHWA 3PVQA 2KYBA 4GBQA 2KRMA 1UTIA 2M0YA 2HBWA 1OV3A 4LNPA 2RMOA 2KRNA 1X6GA 1X27A 1X69A 1BK2A 2YUOA 1UHFA 1ABQA 1HJDA 1G83A 1GFDA 3I5RA 4HVVA 2DA9A 4AFUC 3M0QA 3I5SA 4DEYA 4AG2C 3NHNA 1I1JA 2BZXA 3QWXX 3VS0A 4E6RA 1M3CA 3VRYA 1CSKA 1HD3A 2LZ6B 2X3WD 2A36A 2B86A 5IHNA 2KEAA 2JMCA 1EFNA 4QT7A 1SSHA 1OOTA 2CT4A 1NEGA 3U23A 2FEIA 4HVWA 2V1QA 2GQIA 4F16A 1AZEA 2DE0X 4OMPA 4Z88A 2YUNA 1AVZC 2DBMA 1YN8A 1GFCA 1QKXA 3UATA 3QWYA 1X6BA 3R6NA 3VS1A 1SHFA 1WIEA 5IXFA 4A63B 2J7IA 2VKNA 4ZNXA 1M30A 4M4ZA 2LQWA 2EYZA 3I9QA 1QLYA 2G6FX 3M0TA 4JZ4A 1WA7A 4F17A 4OMNA 1PKTA 3M0UA 2LJ3A 4J9DA 4J9EA 3EGUA 1K76A 3VS7A 1WFWA 2KT1A 2W10A 1K9AA 1I07A 4RUGA 3EG3A 1YP5A 5IHKA 3RNJA 4AFZC 5FW9A 1Z9QA 1QKWA 4OMMA 2A08A 1Y0MA 3VS4A 2FPFA 2P4RA 2LNHB 2J06A 4D8DA 4RTZA 2JW4A 2KBTA 3EG1A 2FRYA 4AFQC 1KJWA 2O2OA 1GRIA 2RNAA 1NYFA 2K9GA 3REAB 1NLOC 2DM1A 3H0IA 1BBZA 2GTOA 2EYWA 1OEBA 1K0XA 1N5ZA 2EVRA 3A98A 1UE9A 4CC4B 2K6DA 2D8JA 2OAWA 1JU5C 1UJ0A 1M8MA 2O31A 1U06A 1E7OA 4LE9A 4JZ3A 1AZGB 2KXCA 1MV0B 5IHIA 4ORZA 2PTKA 2J6FA 1W6XA 2FRWA 5GJWB 2A28A 2EBPA 4RTYA 2MOXA 4RTTA 2L3SA 1VYUA 2K2MA 4WCIA 4K11A 3C0CA 1NEBA 1G2BA 2CUDA 1SPKA 2EYYA 1WLPB 2DRMA 3TSWA 2C0TA 1BU1A 3VS2A 1RLPC 1AD5A 4Y92A 1GCPA 2RQVA 1W1FA 2YSQA 3NMZC 1QWFA 4HVUA 3VS5A 1ZUKA 5HCKA 1V1CA 1X2KA 1T0HA 1FMKA 1TUCA 1RI9A 3UA7A 3H0FA 2EPDA 1YCSB 1CKAA 2LX7A 1PNJA 2JXBA 2CT3A 2F2VA 1JXMA 1GBQA 2RF0A 2SEMA 2X3XD 2L3PA 1OPKA 2BZYA 2YDLA 4GLMA 2YUPA 2DLPA 5L23A 2K79A 2EKHA 4AG1C 4JJCA 2EGCA 1GCQC 1KSWA 2XMFA 5FWCA 1GCQA 4JJDA 1NM7A 2GBQA 1VA7A 2ECZA 3REBB 1PWTA 2ENMA 3LH5A 2BZ8A 1NLPC 3NPFA 1A0NB 1OPLA 2GTJA 2J05A 1X43A 1ZSGA 4Z8AA 5I22A 1T3SA 1B07A 1GBRA 2QDLA 1ARKA 2CH4A 3CQTA 2MCNA 4HXJA 2K7AA 1WXUA 1Z9ZA 2CH4W 2D0NA 3M0SA 2ROLA 1UFFA 2H8HA 1Y57A 4IIOA 1I0CA 2O88A 1H8KA 1JXOA 2RPNA 3M0RA 1S1NA 2KR3A 4RTXA 2K3BA 3H0HA 2VVKA 1KFZA 2ROTA 1NYGA 2E5KA 3FJ5A 1WX6A 2HCKA 1ABOA 2JS2A 2NWMA 2PNIA 3SEMA 2KXDA 2DYBA 4X1VA 2DL4A 1T0JA 2BTTA 2EGEA 2GGRA 5FWBA 1E6HA 3THKA 1SHGA 2KE9A 2EGAA 2ESWA 1ZBJA 2W0ZA 1SRMA 1X2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZUU A;  2DL3 A;  2O9S A;  4J9H A;  3UA6 A;  2O9V A;  2MIO A;  2ED1 A;  3EG0 A;  1SRL A;  2JM8 A;  3EG2 A;  1W70 A;  2LP5 A;  4AFS C;  1MV3 A;  2V1R A;  2LJ1 A;  4J9G A;  4J9C A;  4EIK A;  1IO6 A;  1HSQ A;  1K0S A;  2GNC A;  1U3O A;  2OJ2 A;  2RQR A;  1PRL C;  4Z89 A;  4ESR A;  2AZV A;  1AEY A;  1UJY A;  1J3T A;  2JM9 A;  4RTU A;  3VS6 A;  2RQU A;  1BB9 A;  4RTW A;  5EC7 A;  3TVT A;  1LCK A;  4RTV A;  2M51 A;  2DBK A;  2CRE A;  1ZUY A;  2FO0 A;  2NUZ A;  1PRM C;  2KNB B;  2CSQ A;  1WXB A;  2DJQ A;  2LJ0 A;  4KRT A;  3PE0 A;  2ED0 A;  1NG2 A;  2DRK A;  4HCK A;  2A37 A;  4OMQ A;  2EW3 A;  2DNU A;  4IIM A;  3UF4 A;  4R0K A;  1U5S A;  4LN2 A;  4LUD A;  1UEC A;  3GBQ A;  1H92 A;  1WI7 A;  4FSS A;  2AKK A;  2SRC A;  3VRZ A;  1M3B A;  1RLQ C;  2C0I A;  2D8H A;  2HSP A;  3JV3 A;  1AWX A;  2CSI A;  2JTE A;  2DL5 A;  1KIK A;  1YWO A;  1AWO A;  1AWJ A;  2F2W A;  1WDX A;  2DVJ A;  4F14 A;  1AOJ A;  5I11 A;  5GJV B;  2FPD A;  2LMJ A;  1VYT A;  1GL5 A;  2KRO A;  2AKL A;  1UDL A;  1UHC A;  1WXT A;  1T3L A;  2HDA A;  2PZ1 A;  2KRS A;  3M0P A;  2AK5 A;  2AZS A;  2KGT A;  2CDT A;  1AWW A;  2LQN A;  1YWP A;  1QWE A;  3NGP A;  1TUD A;  2L2P A;  5IXB A;  1WYX A;  4J9I A;  4JPB W;  2FPE A;  2DL7 A;  2JMA A;  3IQL A;  1RUW A;  2HEQ A;  3I35 A;  4LUE A;  1MUZ A;  1YNZ A;  3VS3 A;  1JO8 A;  2ABL A;  4DEX A;  2RQT A;  4J9F A;  1M27 C;  2RN8 A;  4CC7 A;  1PKS A;  1XOV A;  2JS0 A;  3TSZ A;  3O5Z A;  3H41 A;  3PVL A;  1B3Q A;  2EQI A;  2IIM A;  1E6G A;  2KT8 A;  2LCS A;  2J6K A;  4OMO A;  1K1Z A;  2VWF A;  2DIL A;  1M3A A;  1UG1 A;  2DMO A;  1UUE A;  2CUB A;  5ECA A;  1JEG A;  2YT6 A;  2J6O A;  4CC3 A;  2DX1 A;  3EHR A;  1FYN A;  1JQQ A;  1CKB A;  1ZLM A;  2YUQ A;  5IH2 A;  4OML A;  2OI3 A;  1K4U S;  2I0N A;  2FG0 A;  4CC2 A;  2KYM A;  3EHQ A;  2DF6 A;  3ULR B;  2L0A A;  1PHT A;  2F2X A;  4D8K A;  1TG0 A;  3RBB B;  4JJB A;  2L3Q A;  1SEM A;  1QCF A;  3KFV A;  1ZX6 A;  1UGV A;  1VYV A;  2D1X A;  2EYX A;  2C0O A;  4J9B A;  2RQW A;  3ZL7 C;  1H3H A;  2JT4 A;  2DL8 A;  3SHW A;  3PVQ A;  2KYB A;  4GBQ A;  2KRM A;  1UTI A;  2M0Y A;  2HBW A;  1OV3 A;  4LNP A;  2RMO A;  2KRN A;  1X6G A;  1X27 A;  1X69 A;  1BK2 A;  2YUO A;  1UHF A;  1ABQ A;  1HJD A;  1G83 A;  1GFD A;  3I5R A;  4HVV A;  2DA9 A;  4AFU C;  3M0Q A;  3I5S A;  4DEY A;  4AG2 C;  3NHN A;  1I1J A;  2BZX A;  3QWX X;  3VS0 A;  4E6R A;  1M3C A;  3VRY A;  1CSK A;  1HD3 A;  2LZ6 B;  2X3W D;  2A36 A;  2B86 A;  5IHN A;  2KEA A;  2JMC A;  1EFN A;  4QT7 A;  1SSH A;  1OOT A;  2CT4 A;  1NEG A;  3U23 A;  2FEI A;  4HVW A;  2V1Q A;  2GQI A;  4F16 A;  1AZE A;  2DE0 X;  4OMP A;  4Z88 A;  2YUN A;  1AVZ C;  2DBM A;  1YN8 A;  1GFC A;  1QKX A;  3UAT A;  3QWY A;  1X6B A;  3R6N A;  3VS1 A;  1SHF A;  1WIE A;  5IXF A;  4A63 B;  2J7I A;  2VKN A;  4ZNX A;  1M30 A;  4M4Z A;  2LQW A;  2EYZ A;  3I9Q A;  1QLY A;  2G6F X;  3M0T A;  4JZ4 A;  1WA7 A;  4F17 A;  4OMN A;  1PKT A;  3M0U A;  2LJ3 A;  4J9D A;  4J9E A;  3EGU A;  1K76 A;  3VS7 A;  1WFW A;  2KT1 A;  2W10 A;  1K9A A;  1I07 A;  4RUG A;  3EG3 A;  1YP5 A;  5IHK A;  3RNJ A;  4AFZ C;  5FW9 A;  1Z9Q A;  1QKW A;  4OMM A;  2A08 A;  1Y0M A;  3VS4 A;  2FPF A;  2P4R A;  2LNH B;  2J06 A;  4D8D A;  4RTZ A;  2JW4 A;  2KBT A;  3EG1 A;  2FRY A;  4AFQ C;  1KJW A;  2O2O A;  1GRI A;  2RNA A;  1NYF A;  2K9G A;  3REA B;  1NLO C;  2DM1 A;  3H0I A;  1BBZ A;  2GTO A;  2EYW A;  1OEB A;  1K0X A;  1N5Z A;  2EVR A;  3A98 A;  1UE9 A;  4CC4 B;  2K6D A;  2D8J A;  2OAW A;  1JU5 C;  1UJ0 A;  1M8M A;  2O31 A;  1U06 A;  1E7O A;  4LE9 A;  4JZ3 A;  1AZG B;  2KXC A;  1MV0 B;  5IHI A;  4ORZ A;  2PTK A;  2J6F A;  1W6X A;  2FRW A;  5GJW B;  2A28 A;  2EBP A;  4RTY A;  2MOX A;  4RTT A;  2L3S A;  1VYU A;  2K2M A;  4WCI A;  4K11 A;  3C0C A;  1NEB A;  1G2B A;  2CUD A;  1SPK A;  2EYY A;  1WLP B;  2DRM A;  3TSW A;  2C0T A;  1BU1 A;  3VS2 A;  1RLP C;  1AD5 A;  4Y92 A;  1GCP A;  2RQV A;  1W1F A;  2YSQ A;  3NMZ C;  1QWF A;  4HVU A;  3VS5 A;  1ZUK A;  5HCK A;  1V1C A;  1X2K A;  1T0H A;  1FMK A;  1TUC A;  1RI9 A;  3UA7 A;  3H0F A;  2EPD A;  1YCS B;  1CKA A;  2LX7 A;  1PNJ A;  2JXB A;  2CT3 A;  2F2V A;  1JXM A;  1GBQ A;  2RF0 A;  2SEM A;  2X3X D;  2L3P A;  1OPK A;  2BZY A;  2YDL A;  4GLM A;  2YUP A;  2DLP A;  5L23 A;  2K79 A;  2EKH A;  4AG1 C;  4JJC A;  2EGC A;  1GCQ C;  1KSW A;  2XMF A;  5FWC A;  1GCQ A;  4JJD A;  1NM7 A;  2GBQ A;  1VA7 A;  2ECZ A;  3REB B;  1PWT A;  2ENM A;  3LH5 A;  2BZ8 A;  1NLP C;  3NPF A;  1A0N B;  1OPL A;  2GTJ A;  2J05 A;  1X43 A;  1ZSG A;  4Z8A A;  5I22 A;  1T3S A;  1B07 A;  1GBR A;  2QDL A;  1ARK A;  2CH4 A;  3CQT A;  2MCN A;  4HXJ A;  2K7A A;  1WXU A;  1Z9Z A;  2CH4 W;  2D0N A;  3M0S A;  2ROL A;  1UFF A;  2H8H A;  1Y57 A;  4IIO A;  1I0C A;  2O88 A;  1H8K A;  1JXO A;  2RPN A;  3M0R A;  1S1N A;  2KR3 A;  4RTX A;  2K3B A;  3H0H A;  2VVK A;  1KFZ A;  2ROT A;  1NYG A;  2E5K A;  3FJ5 A;  1WX6 A;  2HCK A;  1ABO A;  2JS2 A;  2NWM A;  2PNI A;  3SEM A;  2KXD A;  2DYB A;  4X1V A;  2DL4 A;  1T0J A;  2BTT A;  2EGE A;  2GGR A;  5FWB A;  1E6H A;  3THK A;  1SHG A;  2KE9 A;  2EGA A;  2ESW A;  1ZBJ A;  2W0Z A;  1SRM A;  1X2Q A; 
#chains in the Genus database with same CATH topology
 3ME9 A;  5GAN h;  3OYC A;  1VQ7 T;  1KC8 C;  3M53 A;  3TEE A;  1KG1 A;  3MP6 A;  1SRL A;  2JM8 A;  2QQR A;  2VUB A;  3P8B B;  4Y28 E;  3WXM B;  3MEV A;  4AFS C;  2LJ1 A;  5J26 A;  2P4T A;  3CCR Q;  1K0S A;  4XTU A;  4R55 A;  1WQ7 A;  4M7D D;  2EYQ A;  1M90 U;  1M1F A;  5J39 A;  2XID A;  1AEY A;  2OTL Q;  2XI9 A;  1FMW A;  3MO8 A;  4RTU A;  4C5H A;  3KBG A;  4RTW A;  5EC7 A;  2ZPE B;  3TVT A;  4D6W A;  1LCK A;  4RTV A;  2M51 A;  3EH1 A;  2YRV A;  4OB2 B;  4LDW A;  2CSQ A;  1SG5 A;  4E7H A;  1WXB A;  2LJ0 A;  1WHK A;  5A0G A;  3PE0 A;  4J5Y A;  2FB7 A;  3BFM A;  2DRK A;  3GOX A;  2OX7 A;  5LJ5 h;  1UGS B;  3CBP A;  4IIM A;  1QVF P;  1WI7 A;  1VOM A;  1NJI C;  5HY6 A;  5GMK h;  3CXC S;  4ZTJ A;  3E9F A;  1YWO A;  1AWO A;  1WDX A;  2WSF E;  5KH6 A;  3AT1 B;  5I11 A;  2FPD A;  4XTY A;  2KRO A;  4ZGE B;  2AKL A;  2G3R A;  2IG0 A;  2RI5 A;  1UHC A;  3HPW A;  1Q86 U;  2B8A A;  5GAM j;  3M0P A;  3S3M A;  1YJW A;  8AT1 B;  2QGF B;  4OMF B;  1X01 A;  1QCN A;  1QP2 A;  4XU2 A;  2ATC B;  1YIT Q;  2CZ1 B;  2L2P A;  5IXB A;  5FU6 C;  3FIF A;  3UWN A;  3MPU B;  1QVG P;  2FPE A;  3EGX A;  3I35 A;  5I2S A;  4LUE A;  1JO8 A;  2E6Z A;  2ABL A;  4DEX A;  2MK5 A;  2RN8 A;  1XOV A;  4BY6 B;  4CRI A;  2DAQ A;  4OB1 B;  1E6G A;  3X20 B;  2CP6 A;  2J6K A;  1ACM B;  3CC7 Q;  1V76 A;  2QQA A;  1K9M R;  1UUE A;  4EDU A;  4CC3 A;  3EGX B;  3EHR A;  4YTL A;  3OMG A;  1N9S A;  1JQQ A;  2QK0 A;  1ZLM A;  4OML A;  4M78 B;  2I0N A;  2DZC A;  1PC0 A;  4ZN3 A;  2PU9 B;  5FRO A;  4A4F A;  3RBB B;  2L3Q A;  1VQN T;  1YHQ T;  4RCC A;  2EYX A;  3A8O B;  2RQW A;  3ZL7 C;  3MEW A;  5GAM g;  3OYM A;  1IRX A;  4C8Q E;  2JN0 A;  1K73 R;  3PVQ A;  4M77 G;  4BI8 B;  2HBW A;  4LNP A;  2RMO A;  1X69 A;  1BK2 A;  3OBW A;  1ABQ A;  3NTH A;  3I5R A;  3BW1 A;  3CCS T;  2RHZ A;  4AG2 C;  4AT1 B;  3NHN A;  3JCM V;  1I8F A;  3CBM A;  3BDU A;  3QWX X;  3M57 A;  4BI4 A;  3JB9 F;  1M9S A;  4PJO G;  4QVD A;  3FDR A;  4QVZ A;  3JCM J;  3OW2 A;  1HD3 A;  2IPO B;  1G3T A;  3CCR T;  2L5Q A;  4KGV B;  1O9S A;  2QEX T;  1EZZ B;  3QDR B;  4QT7 A;  5GAO p;  1OOT A;  1OYX A;  2ZPB B;  2OTL T;  4II1 A;  3TU4 K;  3U23 A;  1Q7Y C;  2RHY A;  3CPF A;  2FHD A;  3L2R A;  5CQY A;  2K5I A;  4KGX B;  4HCZ A;  1WIE A;  2ZPI B;  3DKM A;  5CK9 A;  2YXY A;  1D0X A;  1RAB B;  4M4Z A;  4CI0 C;  5GAN 5;  3G7Z A;  3ASK A;  4OMN A;  2QGG A;  4IUT A;  2LJ3 A;  4J9D A;  3EGU A;  3MEU A;  4KH1 B;  5CAI A;  1MMN A;  1K9A A;  5GAM e;  3HFN A;  2D6F A;  3RNJ A;  4L5G A;  1Z9Q A;  2LQK A;  2QAZ A;  2L89 A;  2A08 A;  2WAC A;  3VS4 A;  2LNH B;  2EQK A;  5GAN 3;  1PSF A;  4C8Q C;  2XDD A;  2FRY A;  4XU1 A;  4C8Q A;  4AFQ C;  3JB9 I;  3L1A A;  2O2O A;  4FU6 A;  4N0A A;  1GRI A;  4M7A E;  1M2V A;  2RHX A;  2ZGW A;  1NLO C;  2DM1 A;  3H0I A;  3OYJ A;  1K0X A;  2EYW A;  1OEB A;  2VB6 A;  1YIT T;  5KCH A;  3EFO A;  5KYU A;  5FRN A;  4XAX B;  1M4Z A;  4LD9 K;  1I5O B;  3G4S A;  2BE9 B;  2OAU A;  1MGQ A;  1Y07 A;  1W2B A;  1AZG B;  5IHI A;  3PFS A;  3KXT A;  1MNE A;  1UGQ B;  1W4S A;  5GAN j;  4FYY B;  3CC7 T;  4F7U G;  1VYU A;  1BYM A;  3C0C A;  1WJR A;  2DRM A;  1VQ4 T;  1BU1 A;  1RLP C;  4PFO A;  1LPL A;  2E41 A;  2DXU A;  1QVP A;  3M55 A;  3NMZ C;  1D3B A;  3KUF A;  2QXF A;  4FYV B;  1V1C A;  2JTM A;  2V8K A;  3X24 B;  3V8J A;  4C8Q F;  1M1K U;  3I56 Q;  1WJS A;  1PNJ A;  3FC3 A;  3MHX A;  4M7D E;  3A8L B;  3NFC A;  1G8X A;  5GAM d;  1WJQ A;  5D6W A;  4BUG A;  1YJW Q;  4XK8 E;  1OI1 A;  5CKE A;  3SWN B;  1BI1 A;  4F04 B;  3JCM Q;  2YUP A;  5LJ5 j;  4AG1 C;  1Y96 B;  2XMF A;  4NL2 A;  1MHN A;  2XIC A;  4LDY A;  2H3E B;  1VA7 A;  3REB B;  5KYW A;  3CPW A;  3LH5 A;  4PL6 A;  1A0N B;  3V7S A;  2J05 A;  1ZSG A;  5GMK j;  1FXX A;  1Q81 U;  3CCJ Q;  1ARK A;  2CH4 A;  3CQT A;  3CC2 A;  2DPP B;  1Z9Z A;  2D0N A;  1JJ2 P;  2ROL A;  3QZ9 B;  4M7A C;  1N8R U;  1JJ2 S;  4M7A A;  2LTO A;  4MMK A;  3LH0 A;  2O88 A;  1VQ5 T;  2RPN A;  2F69 A;  4E7L A;  2K3B A;  1RI0 A;  4BE1 A;  1KFZ A;  3OW2 P;  1NYG A;  4J6X A;  4C8Q D;  1VQM A;  1WX6 A;  4JRI A;  1BCO A;  2PNI A;  2KXD A;  4JRQ A;  4BDZ A;  2QQB A;  5FLX E;  3P8D A;  1KQ2 A;  4UC4 A;  2KMT A;  3CCV A;  2RJE A;  2KE9 A;  4O6J A;  1WHG A;  1KD1 C;  1ZUU A;  2O9S A;  2MIO A;  5CKF A;  2Z0W A;  4M77 B;  2MYS A;  3CCQ A;  3D7S B;  1W70 A;  3OBY A;  1MV3 A;  2V1R A;  2FYK A;  2DTI A;  1HSQ A;  2GNC A;  4MML A;  4M7A F;  4GY5 A;  5FU7 B;  2AZV A;  4M7D C;  1QW1 A;  4PLL A;  4M7D A;  1UJY A;  3UDC A;  4KH0 B;  5LJ3 f;  2CKK A;  5HK3 A;  3MET A;  4PJO B;  2VC8 A;  5A0D A;  1BIB A;  3HRU A;  2FO0 A;  2CRE A;  1JRI A;  4PNO A;  1PRM C;  5D6X A;  2KNB B;  5GAN e;  3MKD A;  2V8I A;  2DJQ A;  2K2V A;  3AHU A;  2DIQ A;  4JDS A;  5CKB A;  3M56 A;  1U1T A;  1KQS A;  4R0K A;  1U5S A;  4LN2 A;  4LUD A;  4EMH A;  1UEC A;  4PFP A;  3QUI A;  1K9M U;  2AKK A;  2SRC A;  1M3B A;  2RI3 A;  3QDF A;  4QQ6 A;  2C0I A;  2EQM A;  4GLK A;  3C4S A;  2JTE A;  2P84 A;  1KIK A;  2E3H A;  2L3R A;  3QYG B;  4OF1 A;  1AWJ A;  2GQV A;  1OUL A;  4J6Y A;  2DVJ A;  1AOJ A;  3VYH B;  1XNI A;  5EG2 A;  1WXT A;  4N4I A;  2KRS A;  4M7A D;  3QII A;  4EMK C;  4M7D F;  1VQK Q;  2AK5 A;  1SKU B;  3EFS A;  3OMC A;  1QWE A;  5L8R E;  3NGP A;  2DD4 A;  2BKD N;  1TUD A;  5LJ5 e;  4NOY A;  4ZTF A;  2F1L A;  4PFZ A;  4V2S A;  2COZ A;  2DL7 A;  2JMA A;  2HEQ A;  4HCC A;  2E6N A;  1Y7X A;  1YJW T;  3VYG A;  3OY9 A;  2KK4 A;  4PJJ A;  4E2F B;  5KCO A;  3OS1 A;  1PKS A;  3VKI A;  3H41 A;  3MCA B;  2NUP A;  4XTZ A;  1WNL A;  4JRP A;  4C0D B;  2P0K A;  1K1Z A;  2VWF A;  2DMO A;  2OTJ A;  1KC8 R;  2CUB A;  1JEG A;  1PD1 A;  1YJ9 A;  1LJO A;  3G4S Q;  1VQP Q;  4E7I A;  3P8H A;  5IH2 A;  3HHT B;  5GAN d;  2NUP B;  2FG0 A;  2MWP A;  4M78 E;  3EFR A;  3CPW P;  3JCM f;  3CPW S;  2DF6 A;  5DLQ E;  1D1B A;  2L0A A;  4FYW B;  4HT9 A;  2F2X A;  4F7U B;  1TG0 A;  1QCF A;  1G3S A;  4JS5 A;  1VQO A;  2R5M A;  2D1X A;  1H3H A;  3A5Z B;  5LL6 S;  2JT4 A;  4KT0 E;  2D0Q B;  4M75 G;  2CS7 A;  2KYB A;  2KRM A;  1VQ9 A;  2DO3 A;  2KRN A;  1X27 A;  3QJY A;  2YUO A;  1UHF A;  3PIP A;  1HJD A;  1Q81 C;  1FX7 A;  1N6A A;  4AFU C;  3SD4 A;  3QG1 A;  2M1H A;  1RAI B;  1N8R C;  3PMI A;  1NJI R;  5LJ5 d;  1YJN A;  2YRC A;  3CCU A;  1QVF S;  2RJD A;  2LZ6 B;  4VUB A;  1WGS A;  4C92 E;  3Q1J A;  3QJ6 A;  2B86 A;  1C0M A;  3BE3 A;  2KEA A;  2L8D A;  1QQJ A;  1LOJ A;  5CKD A;  3EAE A;  3QHS A;  1JB0 E;  1ZBX A;  3I56 A;  2FEI A;  3CC2 Q;  2GQI A;  3QKJ A;  5GAO l;  4OMP A;  3OQ5 A;  4HKE A;  2F5T X;  1QKX A;  1WHH A;  4BY6 C;  1SHF A;  4DOW A;  4JRK A;  3G6E A;  5M9O A;  4A63 B;  2LQW A;  2EYZ A;  4Z02 A;  3E2U A;  2G6F X;  2QQS A;  1VQM Q;  4JZ4 A;  4F17 A;  3M9Q A;  3FEO A;  1QVG S;  2M16 A;  3VJP A;  2PQW A;  4J9E A;  2RA2 A;  3H6Z A;  2XKO C;  3CCJ A;  2W10 A;  4MDW A;  2KI7 A;  4M78 A;  3CCV Q;  4RUG A;  1OX9 A;  1YP5 A;  3CBO A;  5IHK A;  3R6O A;  3TRE A;  4AFZ C;  1R8O B;  1KQS P;  5GAN 2;  1Y0M A;  5CVI A;  5KE2 A;  2DXB A;  4D8D A;  3QYH B;  2JW4 A;  2QI2 A;  3X25 B;  3CCQ Q;  2LX9 A;  2VXF A;  3RDV A;  2DXT A;  1N5Z A;  2MI6 A;  4FIB A;  2AIR B;  4ZGJ B;  3L2Z A;  5GAN 7;  1UE9 A;  2EFI A;  3QSU A;  1KQ1 A;  5I21 A;  1RAA B;  1UJ0 A;  2EJ9 A;  2O31 A;  2HMA A;  4LE9 A;  3CME A;  2DYI A;  8ATC B;  3GIB A;  3RIR A;  3E9G A;  1UGP B;  4DQ2 A;  4C0Z A;  4A4E A;  1W6X A;  2KY9 A;  1ZSZ B;  2A28 A;  1MND A;  2EBP A;  4PJL A;  3CC4 Q;  4C92 A;  2MOX A;  4JLG A;  2K2M A;  2X4X A;  2YLC A;  4K11 A;  4WCI A;  4EMG A;  1G2B A;  2CUD A;  1SSF A;  1WLP B;  3G4S T;  3TSW A;  1K8A U;  1NBE B;  1AD5 A;  3A8H B;  3OYE A;  1GCP A;  3MEA A;  1G3W A;  1W1F A;  2YSQ A;  1AT1 B;  1F1B B;  1QWF A;  4L6V 5;  1ZUK A;  4OVA A;  2FZG B;  2JOY A;  4C92 B;  2CZ0 B;  1X2K A;  2A3L A;  3E1S A;  2JUF A;  1FMK A;  1P92 A;  1Q7Y R;  1Q82 U;  2FL7 A;  4J7I A;  3OS2 A;  1RAC B;  2EPD A;  1CKA A;  3DB4 A;  4E7S A;  4C0G A;  1IXD A;  4AMC A;  2F2V A;  1JXM A;  2NYS A;  5GAN 8;  2L3P A;  2RO0 A;  5CKH A;  2CP7 A;  3OYY A;  1G5V A;  2EGC A;  3M59 A;  4DBF A;  2VXE A;  3BDL A;  1XJW B;  4JJD A;  2C06 A;  2PVD B;  2LDM A;  1PWT A;  2ENM A;  1NLP C;  3LX7 A;  1OPL A;  2GTJ A;  3JCM c;  1X43 A;  4QVC A;  5I22 A;  1B07 A;  1HK9 A;  2R57 A;  2QDL A;  2FVU A;  3O8V A;  3PGG A;  3ZEH A;  4HXJ A;  5GAO m;  3SDZ A;  4M78 D;  2K7A A;  1EX4 A;  3H9N A;  1UFF A;  1M90 C;  2H8H A;  2BUD A;  1Y57 A;  3OYN A;  2OTJ Q;  1VQK A;  1H8K A;  1YJ9 Q;  1X6O A;  3M58 A;  3M0R A;  2KR3 A;  4RTX A;  2ZZD A;  3M4G A;  2E5K A;  2HCK A;  1ABO A;  1JBM A;  2DEQ A;  3HSB A;  2JS2 A;  4ANJ A;  2NWM A;  1D0Z A;  4JJN K;  4N0A C;  4LXC A;  3H8Z A;  2DL4 A;  2DIG A;  4ELY C;  2E65 A;  2LT4 A;  2EGE A;  1ZQ1 A;  3E19 A;  5A2Q E;  1VQO Q;  3THK A;  3OS0 A;  3OYK A;  1SHG A;  5CQX A;  1VQM T;  1X2Q A;  4E7K A;  2IVW A;  3RKW A;  3QXE B;  3V8K A;  2O9V A;  1VQ9 Q;  3JCM P;  3LGF A;  4A4K A;  4M75 B;  1VQP A;  4C92 D;  3EG0 A;  3S6W A;  4M77 E;  3EG2 A;  2LP5 A;  3CCV T;  3L2W A;  4EIK A;  1U3O A;  1Q86 C;  5GAN 6;  2KDS A;  3EGD B;  4Z89 A;  4ESR A;  1IGQ A;  4X34 A;  2BIV A;  1YJN Q;  1J3T A;  3CCU Q;  3VS6 A;  3JCM g;  4RG8 A;  2RQU A;  2NLU A;  2K57 A;  4C0F A;  3J81 E;  4LD6 A;  4PJO E;  2X51 A;  3SWN A;  5IAY A;  2DBK A;  1YIJ A;  2NUZ A;  1TWB A;  2DK3 A;  2CZ6 B;  1Y96 A;  4RG2 A;  3ZBD A;  3QPH A;  4KRT A;  2ED0 A;  2O4X B;  2EW3 A;  4MZP A;  2DTH A;  2DNU A;  1RAD B;  3DLM A;  3UF4 A;  2RHI A;  2K3X A;  4OB3 B;  1H92 A;  1Q95 G;  3M5A A;  4HA8 A;  3G6E Q;  1OQK A;  1RLQ C;  2XDB A;  2HSP A;  1AWX A;  2CSI A;  2EIF A;  2COW A;  2VV5 A;  4ME7 A;  2HL3 A;  3ER0 A;  4F14 A;  1GL5 A;  3LW5 E;  4FYX B;  1VQ8 A;  3OYL A;  2PZ1 A;  2E70 A;  3A8G B;  4OP0 A;  3INZ A;  1H64 1;  3BY7 A;  2AZS A;  2CP0 A;  4L59 A;  2JJ9 A;  5GAO r;  2LQN A;  1M2O A;  2E1H A;  1D1C A;  2MF2 A;  3OYA A;  3LWI A;  4XQ3 A;  1ZHI A;  1WYX A;  4J9I A;  5LJ3 h;  3OSV A;  2PVO B;  4OB0 B;  3TCJ A;  2EJF A;  1YCY A;  3OW2 S;  3V8L A;  1MUZ A;  1YNZ A;  1VQ7 Q;  3VS3 A;  4M75 D;  4J9F A;  4CC7 A;  2HL5 C;  3TSZ A;  3O5Z A;  1IGU A;  1K8A C;  2X4W A;  4M77 C;  2IIM A;  4M77 A;  2LCS A;  3GNF B;  2JTF A;  1C6V X;  1OZ2 A;  4ZN1 A;  2QTV A;  1KD1 R;  1M3A A;  3OYH A;  5ECA A;  2CGH A;  2YT6 A;  2J6O A;  2DX1 A;  1WZO A;  3CCL A;  3CME Q;  5GMK l;  2DTO A;  4XTW A;  2M9U A;  1N9R A;  5FU7 C;  1Q82 C;  5GAM f;  2OI3 A;  1K4U S;  2QTX A;  4B6M A;  4CC2 A;  2QAS A;  3GF5 A;  5IN1 A;  1BI2 A;  4DOV A;  2X4J A;  4PJO C;  1YFN A;  2OTJ T;  2HBP A;  4PJO A;  3ULR B;  1YJ9 T;  5D6Y A;  1PHT A;  4JJB A;  1SEM A;  3NTI A;  4F7U E;  3KFV A;  1ZX6 A;  2X4Y A;  1SF9 A;  3CXC A;  1BIA A;  5IT9 E;  4IUQ A;  4J9B A;  7AT1 B;  2PUO B;  1QP3 A;  1TTH B;  2K5L A;  3SHW A;  1OV3 A;  2FZC B;  2DEU A;  1VQ6 A;  1TSF A;  3JB9 G;  1G83 A;  4XU3 A;  1VQO T;  1GFD A;  4QKU A;  3CC4 A;  3HL8 A;  2AHJ B;  4BB7 A;  2YLB A;  4M77 F;  3M0Q A;  1RAG B;  4BI3 A;  5GAO n;  4X9C A;  1I1J A;  4E7J A;  2XU8 A;  1VQ9 T;  2RJF A;  2HSE B;  3WVD B;  4E6R A;  3VUB A;  1M3C A;  1UEB A;  3CD6 A;  2X3W D;  1IRE B;  4E47 A;  2KAF A;  4IUV A;  5IHN A;  1W2B P;  1EFN A;  3URG A;  1W2B S;  4PJO F;  1SSH A;  1YJN T;  3VUZ A;  5HK0 A;  1WHM A;  1C1A A;  4WF2 A;  3EG9 B;  3JCM h;  3CCU T;  4F16 A;  1AZE A;  2DE0 X;  4Z88 A;  2CZ7 B;  2MPX C;  2YUN A;  1AVZ C;  1YN8 A;  1GFC A;  2NUT A;  1OU9 A;  3UAT A;  1OZ3 A;  4XU0 A;  1X6B A;  3VS1 A;  5CO7 A;  3FB9 A;  1DJ7 B;  2LCC A;  3SB2 A;  3I56 T;  2QA4 A;  2Y90 A;  2J7I A;  4C0D C;  4ZNX A;  1VQ5 A;  1M30 A;  1QLY A;  1AHJ B;  4NL3 A;  1K73 U;  3SFM A;  1PKT A;  4NS5 A;  3M0U A;  4FW2 A;  2NUT B;  1K76 A;  2LCL A;  4M77 D;  3VS7 A;  3T9N A;  1WFW A;  2YHT A;  2KT1 A;  4BE0 A;  4N4H A;  3G6E T;  4MZT A;  1I07 A;  4O5V A;  2DD5 A;  2M0O A;  5FW9 A;  1QKW A;  4OMM A;  4B9W A;  4F7U A;  1RAH B;  4C5I A;  3PMT A;  2FPF A;  2P4R A;  4N4G A;  3I55 A;  2RK1 A;  2J06 A;  4EMK B;  3CCJ T;  1M1K C;  4PJO D;  1HYO A;  1Q7Y U;  1NYF A;  1BI0 A;  3REA B;  1S72 A;  1IHW A;  2FZK B;  2XDP A;  1EIF A;  2EVR A;  4XTV A;  3RUX A;  3VV0 A;  4DBH A;  3S3N A;  3VU3 C;  4CC4 B;  3CCE A;  2D8J A;  4FSX A;  2OAW A;  2RM4 A;  2AT1 B;  2XK0 A;  3JB9 H;  2JNG A;  5GMK m;  1B34 B;  4JZ3 A;  1M5Q 1;  2EAY A;  5KYY B;  1Q81 R;  4DBR A;  4IUU A;  1YIJ Q;  2QYZ A;  5GJW B;  2HQX A;  1YI2 A;  2KQW A;  2A0F B;  1N8R R;  1NPR A;  4C5E A;  2LRQ A;  1WHJ A;  1NEB A;  4DBQ A;  2QEX Q;  1SPK A;  2EYY A;  4FL6 A;  2DZ9 A;  2LNV A;  3CME T;  3RES A;  1U8R A;  4C8Q G;  4KUD K;  4QW2 A;  3WVE B;  4J8O A;  2ZCF B;  4F7U F;  3GPL A;  3OB9 A;  1WPY A;  2JVV A;  4B9X A;  2ZPF B;  1ZA1 B;  2PVG B;  3CCM A;  2K4Y A;  1RI9 A;  3UA7 A;  3S3O A;  3CMA A;  1ZA2 B;  1VQ8 Q;  2CT3 A;  2P0Q A;  4RCB A;  4Q5W A;  2CP5 A;  1GBQ A;  1M8V A;  5A0L A;  2SEM A;  5C6S A;  1TUG B;  2BZY A;  2YDL A;  4GLM A;  3LGL A;  2DLP A;  5L23 A;  5GAN f;  2K79 A;  2EKH A;  1WHL A;  1TXQ A;  4JJC A;  1PD0 A;  1YBY A;  2PUK B;  3CXC P;  1GCQ C;  5FWC A;  2E64 A;  3PNW C;  1GCQ A;  5GMK i;  1MMA A;  1NM7 A;  2GBQ A;  3L2U A;  4QQD A;  5AT1 B;  3C95 A;  2VYT A;  2HKQ B;  5DY9 A;  3NPF A;  2ZPG B;  3G71 A;  4Z8A A;  1O75 A;  4PLI A;  4IUP A;  6AT1 B;  1WXU A;  4DA4 A;  3M0S A;  3HRS A;  3NTK A;  2K5F A;  4IIO A;  1I0C A;  4M78 C;  3A8M B;  1JXO A;  1KHI A;  3CCL Q;  1VQL A;  3H0H A;  2VVK A;  1KQS S;  1PM3 A;  2X35 A;  3DB3 A;  5C0M A;  2RHU A;  5LJ3 j;  3SEM A;  4TVR A;  1BKB A;  2MAM A;  2DYB A;  4X1V A;  4WTO B;  1VQ7 A;  1VQK T;  5LJ5 f;  1IZ6 A;  1ZSZ C;  1KK7 A;  2HKN A;  2DVE A;  1ZSZ A;  1E6H A;  5FU6 B;  4EPC A;  5D7U A;  1VQ4 Q;  1IB8 A;  2ESW A;  1ZBJ A;  1SRM A;  3OYB A;  1MMD A;  4PKC C;  2GF7 A;  4RKU E;  2DL3 A;  4J9H A;  3UA6 A;  1VIF A;  5GAO q;  1K9M C;  2ED1 A;  4M7A G;  2RB6 A;  1OX8 A;  1VQ6 Q;  4M75 E;  1PG5 B;  3FRN A;  1X75 C;  4C92 C;  4J9G A;  4J9C A;  2DER A;  3LLR A;  2VGN A;  1IO6 A;  1BCM A;  2OJ2 A;  4Y91 A;  4A53 A;  2RQR A;  4PK4 A;  1PRL C;  4M78 F;  3MP1 A;  1QMC A;  3OSS C;  1VQP T;  1I4K 1;  3J80 E;  2JM9 A;  1PCX A;  4JUV A;  2F5K A;  3CD6 Q;  3N5B B;  4MDX A;  1BB9 A;  2GFA A;  2KSS A;  2E10 A;  3GLX A;  2A7Y A;  1LVK A;  1ZUY A;  3L2Q A;  2GCX A;  1K73 C;  3LYI A;  1U1S A;  1JJ2 A;  3HTR A;  1NG2 A;  5LJ3 g;  4HCK A;  2A37 A;  4OMQ A;  3G1J A;  1UB4 A;  4FT4 A;  1YIJ T;  3GBQ A;  4R56 A;  3CEY A;  2DET A;  1KD1 U;  2EWN A;  4FSS A;  3VRZ A;  2QA4 Q;  1VQ5 Q;  3JV3 A;  2D8H A;  2LVM A;  2Y4Y A;  2DL5 A;  4M7D G;  2MMP A;  1VIE A;  2F2W A;  2CP2 A;  4C92 F;  5GJV B;  1M90 R;  4BD3 A;  2LMJ A;  1VYT A;  2EJG A;  1NZ9 A;  1UDL A;  2COY A;  1T3L A;  2HDA A;  3HKS A;  3F70 A;  4LDX A;  2V26 A;  4LDU A;  3HP9 A;  3JAM E;  3DLL A;  2KGT A;  2CDT A;  1AWW A;  1YWP A;  4HT8 A;  3JCM W;  4LDV A;  3JB9 J;  2EQU A;  4FW1 A;  3I55 Q;  1B7T A;  1VQ8 T;  2WSE E;  4JPB W;  4XTX A;  3IQL A;  1RUW A;  3CC2 T;  2RQT A;  1MMG A;  1M27 C;  1R77 A;  2HNI A;  2JS0 A;  2I2L A;  1S72 Q;  3PVL A;  1B3Q A;  4M75 C;  1G3Y A;  4M75 A;  2EQI A;  2KT8 A;  4IKF A;  4OMO A;  1TS9 A;  3JB9 D;  3CCE Q;  2DIL A;  1D0Y A;  1RL2 A;  1UG1 A;  5AYF A;  2HD0 A;  1XTD A;  2JZ2 A;  1VQN A;  1FYN A;  3JCM b;  1YHQ A;  2Y4X A;  3EGD A;  1CKB A;  1RAF B;  2YUQ A;  1LNX A;  4BDY A;  1YI2 Q;  1Q86 R;  2KYM A;  3EHQ A;  5LJ3 e;  4X9D A;  2RH2 A;  4P5N A;  3CCL T;  4D8K A;  5DM7 R;  4JLI A;  2HZY A;  1M1G A;  1UGV A;  2H3J A;  1VYV A;  2C0O A;  4C8Q B;  2DKG A;  3CCS A;  2DL8 A;  2O4X A;  1M2V B;  2V8J A;  5CR2 A;  3CCQ T;  4GBQ A;  4ZGD B;  1UTI A;  3GNG A;  3CCM Q;  2M0Y A;  5CIU A;  2E5Q A;  2BE7 D;  4KUI A;  3L2V A;  1X6G A;  3EFO B;  5KYU B;  1D09 B;  3CMA Q;  3SWN C;  2R5A A;  4HVV A;  2DA9 A;  4M75 F;  2LQ8 A;  3I5S A;  3CCR A;  4DEY A;  2DXC A;  1UGR B;  2VGM A;  2QEX A;  2RK2 A;  4J6W A;  2BZX A;  2DFU A;  2P0P A;  3VS0 A;  2OTL A;  3UT1 A;  1XQH A;  1VQ6 T;  3VRY A;  1CSK A;  3M4Y A;  1GXI E;  4HCB A;  2O01 E;  1VUB A;  3CC4 T;  1HXD A;  2A36 A;  4FCY A;  1V29 B;  1KC8 U;  2QQ9 A;  2JMC A;  1TH7 A;  3MP8 A;  2CYZ B;  3G71 Q;  2RD1 A;  2EQJ A;  4A4G A;  2MWO A;  5GAM h;  4PJM A;  3V7C A;  2CT4 A;  3MJX A;  1D3B B;  1NEG A;  3RKX A;  2E4H A;  4HVW A;  2V1Q A;  1N27 A;  3CD6 T;  3C94 A;  2DBM A;  3JRZ A;  2ZPH B;  3QBY A;  3PT9 A;  3QWY A;  2E3I A;  3R6N A;  2CP3 A;  4KGZ B;  1VQL Q;  5IXF A;  2VKN A;  4E7Z A;  1R0B G;  3I9Q A;  3M0T A;  2X9H A;  4FM4 B;  1WA7 A;  5LJ3 d;  1K8A R;  3X26 B;  1H3Z A;  1PSE A;  1IHV A;  2GFU A;  3QZ5 B;  4OGE A;  1I5L A;  5GAN g;  1TOV A;  4ATO A;  1NE8 A;  3L42 A;  2LC4 A;  2E12 A;  2QA4 T;  2D9T A;  5KYX A;  5KYW B;  3EG3 A;  3RKY A;  1KHC A;  4IUR A;  1YIT A;  3JCM e;  1Q82 R;  4C5G A;  1NJI U;  5KYN A;  5DLO A;  4J7F A;  4RTZ A;  5HKC A;  2KBT A;  3EG1 A;  4M7A B;  1KJW A;  2RNA A;  5KYX B;  2K9G A;  2XHC A;  1BBZ A;  2GTO A;  3RMQ A;  3TQ7 P;  4JS4 A;  3A98 A;  1QVF A;  4KBM B;  3M54 A;  3PIO A;  3CC7 A;  2K6D A;  3I55 T;  3HFO A;  1JU5 C;  1RAE B;  2HQE A;  1M8M A;  1U06 A;  1E7O A;  2HAX A;  1VQ4 A;  5J3B A;  4ELZ C;  2KXC A;  1MV0 B;  5LJ5 g;  2R58 A;  4M78 G;  3FJP A;  4ORZ A;  2PTK A;  1S72 T;  2J6F A;  3J7A F;  2FRW A;  5GAN 4;  2XD0 A;  4RTY A;  4OGC A;  4FT2 A;  4RTT A;  3CCE T;  2L3S A;  3C12 A;  2YRD A;  4A54 A;  3X28 B;  5KE3 A;  2C0T A;  3VS2 A;  1Y71 A;  4Y92 A;  3QO3 A;  1WQW A;  2RQV A;  3RMS A;  1BI3 A;  3VS5 A;  4HVU A;  1YI2 T;  1OU8 A;  1QCO A;  3PTA A;  3EG9 A;  4A4H A;  1QVG A;  5HCK A;  4J83 A;  2XG8 D;  2RJC A;  1T0H A;  1TUC A;  3JCM X;  3H0F A;  1YCS B;  2LX7 A;  2DJZ A;  4M7D B;  4BE2 A;  2EKO A;  3JSC A;  2JXB A;  2KVQ G;  3UPU A;  4RMO A;  2LT1 A;  2RF0 A;  3EH2 A;  2X3X D;  4C92 G;  1NPP A;  1OPK A;  3JCM d;  3CCM T;  4KUL A;  3CMA T;  1D1A A;  4BAC A;  1KSW A;  2WSC E;  3RR6 A;  3ZFJ A;  2ECZ A;  3OYG A;  2BZ8 A;  5I2M A;  1T3S A;  1GBR A;  9ATC B;  3LWH A;  2RI2 A;  4MZM A;  2MCN A;  4EMK A;  2CH4 W;  2QG9 B;  2YWW A;  3HRT A;  3G71 T;  1S1N A;  1I81 A;  2VAS A;  4QQG A;  1M1K R;  1VQN Q;  1YHQ Q;  2HQH A;  2ROT A;  3FJ5 A;  1TU0 B;  3GP8 A;  3OA6 A;  3OS5 A;  3OYF A;  5GMK e;  1B34 A;  3A1P A;  1FWZ A;  3RER A;  5KYY A;  1FMV A;  2ZAE A;  2M02 A;  1T0J A;  3OYI A;  5FRM A;  2BTT A;  1VQL T;  2GGR A;  5FWB A;  5CCA A;  2QDY B;  2K3Y A;  3FLG A;  3V7R A;  4PJN A;  3OYD A;  2EGA A;  2W0Z A;  3CCS Q;  1R0C B; 
#chains in the Genus database with same CATH homology
 1ZUU A;  2DL3 A;  2O9S A;  4J9H A;  3UA6 A;  2O9V A;  2MIO A;  2ED1 A;  3EG0 A;  1SRL A;  2JM8 A;  3EG2 A;  1W70 A;  2LP5 A;  4AFS C;  1MV3 A;  2V1R A;  2LJ1 A;  4J9G A;  4J9C A;  4EIK A;  1IO6 A;  1HSQ A;  1K0S A;  2GNC A;  1U3O A;  2OJ2 A;  2RQR A;  1PRL C;  4Z89 A;  4ESR A;  2AZV A;  1AEY A;  1UJY A;  1J3T A;  2JM9 A;  4RTU A;  3VS6 A;  2RQU A;  1BB9 A;  4RTW A;  5EC7 A;  3TVT A;  1LCK A;  4RTV A;  2M51 A;  2DBK A;  2CRE A;  1ZUY A;  2FO0 A;  2NUZ A;  1PRM C;  2KNB B;  2CSQ A;  1WXB A;  2DJQ A;  2LJ0 A;  4KRT A;  3PE0 A;  2ED0 A;  1NG2 A;  2DRK A;  4HCK A;  2A37 A;  4OMQ A;  2EW3 A;  2DNU A;  4IIM A;  3UF4 A;  4R0K A;  1U5S A;  4LN2 A;  4LUD A;  1UEC A;  3GBQ A;  1H92 A;  1WI7 A;  4FSS A;  2AKK A;  2SRC A;  3VRZ A;  1M3B A;  1RLQ C;  2C0I A;  2D8H A;  2HSP A;  3JV3 A;  1AWX A;  2CSI A;  2JTE A;  2DL5 A;  1KIK A;  1YWO A;  1AWO A;  1AWJ A;  2F2W A;  1WDX A;  2DVJ A;  4F14 A;  1AOJ A;  5I11 A;  5GJV B;  2FPD A;  2LMJ A;  1VYT A;  1GL5 A;  2KRO A;  2AKL A;  1UDL A;  1UHC A;  1WXT A;  1T3L A;  2HDA A;  2PZ1 A;  2KRS A;  3M0P A;  2AK5 A;  2AZS A;  2KGT A;  2CDT A;  1AWW A;  2LQN A;  1YWP A;  1QWE A;  3NGP A;  1TUD A;  2L2P A;  5IXB A;  1WYX A;  4J9I A;  4JPB W;  2FPE A;  2DL7 A;  2JMA A;  3IQL A;  1RUW A;  2HEQ A;  3I35 A;  4LUE A;  1MUZ A;  1YNZ A;  3VS3 A;  1JO8 A;  2ABL A;  4DEX A;  2RQT A;  4J9F A;  1M27 C;  2RN8 A;  4CC7 A;  1PKS A;  1XOV A;  2JS0 A;  3TSZ A;  3O5Z A;  3H41 A;  3PVL A;  1B3Q A;  2EQI A;  2IIM A;  1E6G A;  2KT8 A;  2LCS A;  2J6K A;  4OMO A;  1K1Z A;  2VWF A;  2DIL A;  1M3A A;  1UG1 A;  2DMO A;  1UUE A;  2CUB A;  5ECA A;  1JEG A;  2YT6 A;  2J6O A;  4CC3 A;  2DX1 A;  3EHR A;  1FYN A;  1JQQ A;  1CKB A;  1ZLM A;  2YUQ A;  5IH2 A;  4OML A;  2OI3 A;  1K4U S;  2I0N A;  2FG0 A;  4CC2 A;  2KYM A;  3EHQ A;  2DF6 A;  3ULR B;  2L0A A;  1PHT A;  2F2X A;  4D8K A;  1TG0 A;  3RBB B;  4JJB A;  2L3Q A;  1SEM A;  1QCF A;  3KFV A;  1ZX6 A;  1UGV A;  1VYV A;  2D1X A;  2EYX A;  2C0O A;  4J9B A;  2RQW A;  3ZL7 C;  1H3H A;  2JT4 A;  2DL8 A;  3SHW A;  3PVQ A;  2KYB A;  4GBQ A;  2KRM A;  1UTI A;  2M0Y A;  2HBW A;  1OV3 A;  4LNP A;  2RMO A;  2KRN A;  1X6G A;  1X27 A;  1X69 A;  1BK2 A;  2YUO A;  1UHF A;  1ABQ A;  1HJD A;  1G83 A;  1GFD A;  3I5R A;  4HVV A;  2DA9 A;  4AFU C;  3M0Q A;  3I5S A;  4DEY A;  4AG2 C;  3NHN A;  1I1J A;  2BZX A;  3QWX X;  3VS0 A;  4E6R A;  1M3C A;  3VRY A;  1CSK A;  1HD3 A;  2LZ6 B;  2X3W D;  2A36 A;  2B86 A;  5IHN A;  2KEA A;  2JMC A;  1EFN A;  4QT7 A;  1SSH A;  1OOT A;  2CT4 A;  1NEG A;  3U23 A;  2FEI A;  4HVW A;  2V1Q A;  2GQI A;  4F16 A;  1AZE A;  2DE0 X;  4OMP A;  4Z88 A;  2YUN A;  1AVZ C;  2DBM A;  1YN8 A;  1GFC A;  1QKX A;  3UAT A;  3QWY A;  1X6B A;  3R6N A;  3VS1 A;  1SHF A;  1WIE A;  5IXF A;  4A63 B;  2J7I A;  2VKN A;  4ZNX A;  1M30 A;  4M4Z A;  2LQW A;  2EYZ A;  3I9Q A;  1QLY A;  2G6F X;  3M0T A;  4JZ4 A;  1WA7 A;  4F17 A;  4OMN A;  1PKT A;  3M0U A;  2LJ3 A;  4J9D A;  4J9E A;  3EGU A;  1K76 A;  3VS7 A;  1WFW A;  2KT1 A;  2W10 A;  1K9A A;  1I07 A;  4RUG A;  3EG3 A;  1YP5 A;  5IHK A;  3RNJ A;  4AFZ C;  5FW9 A;  1Z9Q A;  1QKW A;  4OMM A;  2A08 A;  1Y0M A;  3VS4 A;  2FPF A;  2P4R A;  2LNH B;  2J06 A;  4D8D A;  4RTZ A;  2JW4 A;  2KBT A;  3EG1 A;  2FRY A;  4AFQ C;  1KJW A;  2O2O A;  1GRI A;  2RNA A;  1NYF A;  2K9G A;  3REA B;  1NLO C;  2DM1 A;  3H0I A;  1BBZ A;  2GTO A;  2EYW A;  1OEB A;  1K0X A;  1N5Z A;  2EVR A;  3A98 A;  1UE9 A;  4CC4 B;  2K6D A;  2D8J A;  2OAW A;  1JU5 C;  1UJ0 A;  1M8M A;  2O31 A;  1U06 A;  1E7O A;  4LE9 A;  4JZ3 A;  1AZG B;  2KXC A;  1MV0 B;  5IHI A;  4ORZ A;  2PTK A;  2J6F A;  1W6X A;  2FRW A;  5GJW B;  2A28 A;  2EBP A;  4RTY A;  2MOX A;  4RTT A;  2L3S A;  1VYU A;  2K2M A;  4WCI A;  4K11 A;  3C0C A;  1NEB A;  1G2B A;  2CUD A;  1SPK A;  2EYY A;  1WLP B;  2DRM A;  3TSW A;  2C0T A;  1BU1 A;  3VS2 A;  1RLP C;  1AD5 A;  4Y92 A;  1GCP A;  2RQV A;  1W1F A;  2YSQ A;  3NMZ C;  1QWF A;  4HVU A;  3VS5 A;  1ZUK A;  5HCK A;  1V1C A;  1X2K A;  1T0H A;  1FMK A;  1TUC A;  1RI9 A;  3UA7 A;  3H0F A;  2EPD A;  1YCS B;  1CKA A;  2LX7 A;  1PNJ A;  2JXB A;  2CT3 A;  2F2V A;  1JXM A;  1GBQ A;  2RF0 A;  2SEM A;  2X3X D;  2L3P A;  1OPK A;  2BZY A;  2YDL A;  4GLM A;  2YUP A;  2DLP A;  5L23 A;  2K79 A;  2EKH A;  4AG1 C;  4JJC A;  2EGC A;  1GCQ C;  1KSW A;  2XMF A;  5FWC A;  1GCQ A;  4JJD A;  1NM7 A;  2GBQ A;  1VA7 A;  2ECZ A;  3REB B;  1PWT A;  2ENM A;  3LH5 A;  2BZ8 A;  1NLP C;  3NPF A;  1A0N B;  1OPL A;  2GTJ A;  2J05 A;  1X43 A;  1ZSG A;  4Z8A A;  5I22 A;  1T3S A;  1B07 A;  1GBR A;  2QDL A;  1ARK A;  2CH4 A;  3CQT A;  2MCN A;  4HXJ A;  2K7A A;  1WXU A;  1Z9Z A;  2CH4 W;  2D0N A;  3M0S A;  2ROL A;  1UFF A;  2H8H A;  1Y57 A;  4IIO A;  1I0C A;  2O88 A;  1H8K A;  1JXO A;  2RPN A;  3M0R A;  1S1N A;  2KR3 A;  4RTX A;  2K3B A;  3H0H A;  2VVK A;  1KFZ A;  2ROT A;  1NYG A;  2E5K A;  3FJ5 A;  1WX6 A;  2HCK A;  1ABO A;  2JS2 A;  2NWM A;  2PNI A;  3SEM A;  2KXD A;  2DYB A;  4X1V A;  2DL4 A;  1T0J A;  2BTT A;  2EGE A;  2GGR A;  5FWB A;  1E6H A;  3THK A;  1SHG A;  2KE9 A;  2EGA A;  2ESW A;  1ZBJ A;  2W0Z A;  1SRM A;  1X2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...