3I9V2

Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, oxidized, 2 mol/asu
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
178
structure length
178
Chain Sequence
FFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHLQVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAGKRLEEIELPGKCGHHVHEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the mechanism of respiratory complex I
pubmed doi rcsb
molecule keywords NADH-quinone oxidoreductase subunit 1
molecule tags Oxidoreductase
total genus 46
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature ec 1.6.99.5: Transferred entry: 1.6.5.11.
pdb deposition date 2009-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01257 2Fe-2S_thioredx Thioredoxin-like [2Fe-2S] ferredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1590 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3i9v201
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3i9v202
2JADA 2B6MA 3O3TA 3D4MA 3HVXA 3M1GA 2RLIA 2WDUA 2E0QA 3VPTA 5JCUA 1V40A 1EGRA 2ZNMA 2YV7A 3P90A 3GMFA 2KHPA 2MMOA 1PX7A 2H01A 3FZ5A 4XRAA 3KTBA 3CRTA 1A24A 2X99A 5J5NA 2MMAA 2JSZA 2OBKA 1Z6MA 2EC4A 4YQVA 5G31A 1JZWA 1GNWA 1ZYQB 3CSIA 2AHEA 2FGXA 2IN3A 5C00A 3HD5A 1GSSA 1PMTA 2GZPA 3SWLA 4KDYA 1EZKA 5DDLA 2DBCA 4OWYA 1G6WA 1A0FA 3KEBA 2DJ0A 1AW9A 5F0GA 1K0CA 3GSTA 3VK9A 2H70A 2MZCA 2NDOA 1OAZA 3IOSA 2PGTA 4CDOA 5H5SA 5ELAA 3DD3A 1FVJA 3IAS2 3F3RA 5HFIA 1PL1A 4DSSB 4ZBDA 2A2SA 3VPQA 3KGKA 4XS4B 3TOTA 3L0HA 4EE0A 3BCKA 4PQHA 4NHZA 2FWHA 4MDCA 1F3BA 4RI6A 1T3BA 1Z7RA 1TXXA 2E2GA 5ECNB 3KZQA 4IP6A 3D0ZA 2N5FA 4YAVA 1TK0B 1HD2A 4IQAA 4QQ7A 1GSEA 3P2AA 1SENA 2HLSA 2WGRA 3RPNA 2PVQA 1A0RP 4PUAA 1WWJA 2O8VB 3RDWA 1Z9HA 1A23A 3EC3A 4LL4B 1F6MC 5ID2A 2GTUA 1TU8A 1GUKA 1A2LA 1F3AA 2DC5A 4YQMA 2YPMA 3M9JA 2R3XA 3GFKA 2CVBA 2CX4A 1Q4JA 2HE3A 3CTFA 3M0FA 5IPGA 4K2DA 4KDXA 2LNTA 3DXBA 3ISOA 2OKAA 2B5EA 2J23A 3VWUA 4I2UA 4TXOA 2HT9A 3ZIJA 3UVHA 9GSSA 3F8UA 4IJ3A 2HZEA 3NIVA 2QGVA 4TW5A 4WXTA 2H75A 1SKRB 4MH3A 1SYRA 4HUAA 2IMDA 2H6ZA 2PU9C 1O8XA 1GWCA 2JZRA 5D9TA 4O5RA 2JSYA 4MZCA 3FR6A 4ILFA 1K0BA 1XVWA 3FR3A 22GSA 2WS2A 18GSA 2FNOA 3KMOA 2I3YA 3LJRA 5D9WA 4OFMA 1A8LA 2LQOA 1K3OA 4G9HA 4Q5NA 1XW6A 1BAYA 4V1Ap 1V57A 2F51A 4YH2A 4N0VA 1WMJA 4LMWA 2HSYA 1TRSA 3GL5A 4IN0A 3C1RA 5DQSA 3WGDA 2VIMA 3UVTA 1EGOA 5HR3A 2L4QA 2MMZA 4TR3A 3UMAA 4L5OA 4HZ2A 3BJ5A 1SD8A 3BBYA 1SJ6A 4ZB9A 5A4VA 4OMVA 3L9UA 2OACA 4OCFA 1GTUA 4HJ2A 1O6JA 1W89A 3EWLA 2I4AA 2VLUA 2HRNA 2NBSA 3ZIVA 1GP1A 2IMFA 2L5LA 3GIXA 4EDZA 5CP1A 4FYCA 2QSIA 4BVXA 5LNKe 2L6CA 2FWFA 5B8BA 2GS3A 1HNBA 4K1FA 2ZUPA 5HR2A 4F2IA 3UJ1A 1X9MB 2GVPA 3VWWA 4BA7A 1I5GA 1YF0A 1XOBA 4MPFA 3IA1A 2GT5A 2ON5A 3DKSA 1M0UA 4KGIA 1OKTA 3TKQA 2NTOA 1V9WA 2HXKA 1JLWA 2JACA 3LGCA 2DMLA 3KP9A 2CQ9A 2VCXA 5AIVA 5G1LA 4FYUA 3E0UA 1RK4A 3ZTLA 4G19A 1MD3A 1N2AA 4TR0A 3P8WA 3CSJA 3QDNA 2GQMA 1M99A 3ZLPA 1SKSB 3QOUA 4Q5QA 3CXGA 2HRFA 4JRRA 1UC7A 1R5PA 2IFQA 1GRXA 1PX6A 1B4PA 5COHA 4EUYA 3TJFA 2XPEA 2GSSA 2GDRA 2GSQA 3PH9A 5GSTA 1ON4A 1PN9A 2C0FA 4IS0A 4GWRA 1J08A 3G7IA 2K18A 2IMEA 4ZL8A 2QKEA 3QAVA 2LQQA 1RQMA 1K0NA 1GSYA 3TJKA 4XHMA 3LSZA 4ID0A 4K7IA 4TKYA 2DJ2A 1R7HA 2GLRA 2E2MA 2CZ3A 3ERFA 3RHCA 1WOUA 5F8BA 1M9AA 5EL8A 2HSHA 3HJOA 4D73A 4N30A 4KSOA 3HCZA 1JZOA 6GSUA 4KE3A 1F2EA 4CHSA 2XC2A 2H19A 3UL3A 4JE1A 3LYKA 4LL1B 1HNAA 3IHQA 3J7Yk 2LS5A 2WRTA 3A5WA 5IMCA 2V6KA 2YWNA 3ZREA 5A4UA 3I9V2 4XIHA 3IPZA 4IP1A 1THXA 4GSNA 4WEYA 2JU5A 1ERUA 1JLVA 2F9SA 2VL3A 1TRWA 2HFDA 1X5CA 4ECBA 2ZCTA 5KN0A 2PN8A 1MD4A 5ID2B 1OC9B 4O7HA 2NPBA 4PUFC 1YKAA 1QUWA 3FEUA 3Q74A 2YWMA 3QFBC 5CNWA 5ECMB 1XWAA 3VFIA 3NZNA 1XW5A 1TK8B 1PRXA 5B6NA 4BWQA 5CAXA 1ST9A 1J9BA 2VCTA 4JR6A 3ZMLA 4TXOB 3N9JA 4TR4A 4I97A 4K0GA 17GSA 1IYHA 2LV3A 4GTUA 1GTBA 4L0UA 2CT6A 1TOFA 4F03A 2VL9A 2C0GA 3A2XA 3LQ7A 1F9MA 4KNDA 5JCWA 2OADA 1TU7A 3KMNA 5KEJA 1B4QA 4AF2A 16GSA 1Y25A 2RM5A 1MDJA 3EVIA 2CZ2A 1PD21 4J57E 3SBCA 5AGYA 5CRDA 1X0RA 1ZZYA 2LUSA 1HYUA 1SYXA 3F3QA 4HDEA 5IMDA 2FY6A 4POBA 1CQHA 3TRXA 2H1GA 4TRXA 4I8BA 3GV1A 2D2ZA 2ALBA 2C4JA 2IL3A 3IDVA 4IGJA 4K6XA 4HS1A 1OE8A 1OYJA 2M72A 4MLYA 2WB9A 4HOJA 1FHEA 3UEMA 3DEXA 1DE2A 1V98A 1X5EA 3LEFA 1A2JA 5EPFA 4ULXA 5G30A 1GLQA 3DWVA 4K8MA 2FCHA 3RAZA 3W8JA 3HJPA 1X9SB 3RHBA 1K3YA 1M9BA 1EWXA 2WCIA 1CQGA 2NVLA 1EOGA 3GURA 3HXSA 4ISDA 1ZGNA 3IE3A 3F9UA 3TKSA 3TKSE 1X9WB 1PQNA 3D6IA 4GRFA 3WYWA 6GSVA 2DJ3A 3A2WA 3ZITA 5INYA 1NW2A 2I1UA 5CRWA 3EINA 1V2AA 1NSWA 1XWCA 3W8SA 3F6DA 3A2VA 3QMXA 4HI7A 1BG5A 5EVOA 2OBIA 1G6YA 3KTLA 3CRUA 2H6XA 3TJJA 3QAWA 3CBUA 3FKFA 2WJUA 1GSQA 5IOXA 1B9XC 3M3MA 2H0IA 2J9HA 1B48A 1K0MA 5KN2A 1TKDB 2YWOA 4IKHA 1TJDA 4J2FA 2EIOA 4OFTA 4LA1A 6GSYA 4RQRA 2PUKC 1JZDA 3GH6A 1EV9A 4ML1A 3UBKA 1T1VA 4X0XA 2V32A 1SU9A 4HEA2 4NV5A 3EURA 4GCIA 3ME8A 2IFQB 2X8CA 2C1YA 4GXZA 4DSRA 4POKA 3G9BA 3GKMA 4J56E 4MJBA 1YDKA 5HR0A 1AC1A 3L4NA 4IQ1A 3GX0A 3TOUA 2LKUA 3F4SA 2RM6A 3ERGA 1N8JA 2CV4A 4KCAA 1J0FA 3ED3A 4KX4A 4NMUA 1U3AA 3W6GA 2KP1A 5IMFA 4PNGA 3LXZA 1U87A 1Z3EA 2H30A 1THOA 2B7JA 3TRQA 2FLSA 4POLA 3TGZA 2KOKA 4BVYA 2V1MA 2YJ7A 2K6VA 3IC4A 4Q5FA 1XXUA 4ZBBA 4EO3A 3DMLA 4ECIA 3N5OA 2GT6A 4ZL7A 2F3MA 2LRTA 1ZOFA 2E7PA 3KD0A 1YJ6A 1O7UA 5DJLA 2KUCA 1TW9A 4K7OA 1VRSD 2VD1A 3CTGA 5G5FA 3RBTA 3ZFBA 1BJXA 1YQ1A 1TP9A 3NOFA 1SK1A 4HU9A 4EVMA 1XWBA 3IR4A 4BPYA 1GSFA 2K8SA 3FZAA 3KJYA 1O85A 4RI7A 4F0BA 2GQKA 1XFLA 5CRGA 4EF0A 1ZL9A 4Q5RA 3KCMA 5D73A 2A2RA 4FIWA 4G2EA 4AGSA 3HKRA 1GULA 2H72A 1LBKA 2EIRA 5DJMA 1FB0A 2DJKA 3GN3A 1TTZA 4L0WA 3APOA 1O81A 2FA8A 5EY6A 3M9KA 1QQ2A 5AN1A 1SK2A 5KN3A 5ELGA 1DBYA 3ZVJA 3I43A 3AY8A 2FD3A 4ZBAA 2MBTA 3QCPA 5F05A 4XRDA 1S3CA 3HZ8A 3F63A 3ZMKA 5JWOB 1NHYA 2GQLA 3U5RE 4IVFA 3US3A 5CRHA 5DVBA 3HA9A 4TOPA 3GTUA 3GKXA 4WBJA 1E2YA 5DAKB 1X5DA 2VUPA 1R4WA 1WJKA 1SL0B 2K8VA 2GGTA 2KP2A 3KIJA 3O76A 2FUG2 3LXTA 1JHBA 5L71A 4IJIA 3VI5A 3G7JA 2PVOC 4PQIA 2L57A 1SL1B 5FWGA 3DVWA 5LCZA 3Q18A 1XZOA 4MH2A 5DCGA 4PGTA 4Z7XA 2X64A 3IBHA 4FO5A 3GKNA 4GQFA 3HY2A 5D8IA 1PSQA 2DIZA 1EEJA 4ZB6A 3P7XA 1OC3A 1M7TA 1GTIA 1WRYA 2DLXA 2I81A 3ZVJD 3D22A 4HQZA 1TRVA 2CAIA 2VOCA 4MF7A 2FWGA 6GSWA 2AAWA 4AJ7A 1BYEA 2C8UA 5C04A 5ABRA 2JL4A 4XS4A 1T8EB 5AISA 4CW9A 3VI7A 3QPMA 2VLTA 3EMPA 3DYRA 5ECPB 1MDIA 1Z6NA 1G7EA 3WT2A 1B8XA 1T4YA 1K3LA 4MJEA 4BL7A 4PNFA 2AYTA 2H1BA 3BCIA 4ZILA 2DMMA 3GHAA 5DALA 1EP8A 2LTKA 4OD7A 2L4CA 3M8NA 1M2BA 3HVVA 1G0TA 3KM6A 2KLXA 4ZB8A 5J3RA 4NWYA 4KDUA 4YAPA 2H66A 1IYIA 4I2TA 4PQ1A 2YOIA 5E59A 2L59A 3MNGA 4K7NA 2FWEA 2BJXA 2ON7A 4XS6A 5JWQB 3MDKA 4MF5A 1UVZA 1A8YA 2MYGA 1ZMAA 4RUVA 2L6DA 4KW6A 1Z5YE 4GSTA 4F9ZA 2IMKA 11GSA 2PPTA 2AJQB 2CA8A 3VWXA 1PGTA 1EV4A 1MEKA 4HU7A 3APQA 3FRCA 3TKSC 4KAEA 5ECHB 1PL2A 1XVQA 3TJBA 2GSTA 4H86A 1DSBA 4O92A 1QMVA 1B9YC 2YANA 2IMIA 2OJLA 4ACSA 3GL3A 2CX3A 3ZFLA 5E4WA 2PERA 2R4VA 4WBRD 2HI7A 2RUEA 1NM3A 2P0GA 2H1DA 2L5OA 1SD9A 5F07A 4WETA 2H0GA 4BWSA 4JU5A 2LEGA 2V2GA 4IHUA 5J9BA 3C1SA 3MSZA 2HZEB 4NXIA 2IJYA 5ECOB 4TXVA 2RIIA 3LG6A 1XPVA 1MTCA 1S3DA 1YEXA 3LYPA 1JFUA 3OR5A 2P31A 2VCZA 4OCEA 4E8HA 2H1AA 1M2AA 4DEJA 2LJRA 4O32A 3GH9A 1SL2B 2C3TA 4EC0A 2CAQA 4KB3A 3KH9A 5GZZB 3LORA 1FO5A 1LU4A 2DIYA 4OFNA 5H5RA 3J7Yb 3TJGA 1QGVA 2M80A 5B8AA 4FH8A 1G7OA 2P5QA 2R6KA 3TUEA 2VAFA 1KBNA 2C0EA 4ZXGA 4IELA 4HZ4A 3QFAC 3F0IA 1XIYA 3D5JA 1VF4A 5G5EA 4F82A 1WE0A 1GLPA 2LRCA 3IK7A 4EKZA 4XCSA 1GNEA 3GKKA 7GSSA 1AXDA 4I5QA 5GAPD 2H6YA 1TDIA 4MJAA 2TRXA 3GTUB 2TIRA 3C73A 3S9FA 1ERTA 2OE0A 5DCHA 2G0FA 4ECJA 1FOVA 4ZL9A 3VLNA 4MF6A 2AV4A 2FA4A 3TKRA 2O87A 1W4VA 1C72A 1QK8A 3ZRDA 2XBIA 5HFKA 4TVEA 1I9DA 4KA0A 3UAPA 4WR5A 4V2NA 1URMA 2X8HA 1R5AA 3U6VA 3IAM2 1HQOA 2O85A 2WULA 3HDCA 3D21A 2H74A 2VCQA 3K8NA 5CO3A 1XCCA 4TN8A 1S3AA 3DIEA 13GSA 5ECQB 3PINA 1U6TA 2N5AA 3C71A 5IMVA 4MZBA 1YY7A 1K0DA 2YJHA 4KUNA 3TB2A 5ECRB 5A5KA 2AUVA 2Z9SA 2GSRA 3GSSA 2H0HA 5D9XA 2VM2A 2YZHA 19GSA 3LWAA 2R2JA 1AUCA 4N10A 1WIKA 5LD0A 2HNLA 1PKZA 2PBJA 4ECCA 2HZFA 1TI3A 2DJ1A 2WZ9A 3H1NA 1YZXA 4TR1A 3WD6A 5DBQA 2A4VA 5J4UA 1T4ZA 2LRNA 5HFGA 1SKWB 5DALB 4V2LA 2K9FA 1GUMA 3DVXA 4F0CA 2VM1A 2V6OA 3IRAA 5H5QA 3ZYWA 8GSSA 3APSA 5JWRB 4K9ZA 1OE7A 2I9HA 5IQYA 3FW2A 5D9VA 1OC9A 4MMMA 1XWGA 4D73B 4IW9A 2VD0A 3H93A 3C7MA 1XBSA 3WGEA 3V1WA 5IPHA 4GQCA 3KXOA 5GSSA 2VO4A 1YKCA 1QXHA 4OO4A 4N0ZA 3QD9A 3ME7A 5HR1A 1V58A 2REMA 1Q98A 5AIXA 4MK3A 3VURA 2H8LA 1ERVA 3FY7A 1VF3A 3UBLA 2DJJA 2YZUA 1ABAA 4PX1A 3MWHA 10GSA 2IPAA 4RQXA 4WR4A 2B7KA 1HNCA 4GSSA 4MCUA 2YWIA 1Y6EA 1SJIA 1AAZA 5ECKB 2XHFA 2G2QA 3CSHA 3FK8A 3ZZXA 1U88A 5KN1A 3HHVA 4MZWA 2JZSA 4V1Ag 2X8GA 3IV4A 20GSA 4P3YB 3UIWA 1T00A 3H8QA 5CREA 4QL9A 1AIUA 3F4RA 4MP4A 1KNGA 4DVCA 3WT1A 1NHOA 1XOAA 5IOWA 2B1LA 2YP6A 1EOHA 2GZYA 2H71A 4ZIJA 2B5XA 4EXJA 4MA9A 1EEMA 1USBA 2XBQA 4WKWA 2M46A 3D4TA 1TK5B 3FR9A 3UOMA 1ILOA 5FT3A 3I6AA 4KSMA 4OO5A 2VL2C 1F37A 2YCDA 3GX8A 1M2DA 2FHEA 3PGTA 4KH7A 4PXOA 5IO2A 4X1UA 1ACVA 5J9CA 3ERWA 3G7YA 2XPDA 3GA4A 1ERWA 5B7CA 4ML6A 4E8EA 4GLTA 1KTEA 5HQPA 4L5LA 1VGLA 2YV9A 2C3QA 3FYGA 4LLRA 4QL7A 3F4TA 1AQWA 2R37A 5DQYA 2QC7A 2BMXA 3PR8A 2GZZA 6GSSA 3I69A 6GSXA 2RUFA 4MJCA 1R26A 5ECLB 3E3EA 3E9JB 3FZ4A 4EL1A 3O6TA 4DSSA 1U3IA 4JEDA 2DSAA 1ZYEA 1K0AA 4NV2A 4KCEA 2LSTA 3BOAA 1ZCPA 1UN2A 4POMA 1A2MA 3Q6OA 3KP8A 3EE2A 3FZ9A 2VCWA 1DUGA 5IM9A 5A4WA 2LNSA 5JCGA 3EU3A 5J41A 3F6FA 4N11A 4JBBA 1SK0A 2O7KA 1AQXA 4NPBA 1O8WA 4XTSA 1OKDA 2PMTA 12GSA 5GAND 5ECSA 2C3NA 2CVKA 4MABA 2LJKA 3TRPA 3LFLA 1QFNA 1RW1A 4AJ8A 14GSA 1FB6A 2EIQA 4I6XA 4JZQA 4WF4A 2VCVA 3VWVA 4DSQA 1DE1A 2ES7A 1GH2A 1WP0A 1Z7PA 3GRXA 4V2MA 2H73A 2TRCP 2VLVA 3Q19A 5ECIB 2IIYA 1GSUA 2MBSA 1VF2A 3L9SA 1BX9A 4IBPA 1EP7A 5G1KA 3TCOA 4JR4A 1XW9A 2LJAA 1YF1A 4GF0A 1GSDA 3H79A 3EMXA 5CYYA 4PURA 3MAKA 3DRNA 3TKPA 2H76A 2C80A 1AQVA 1GL8A 5B6MA 2PWJA 5F06A 4X43A 3DGQA 5G2ZA 4WF5A 1T7PB 1MDKA 3GNJA 4TR1B 1H4OA 3UARA 4AJ6A 4XS1A 5IIZA 4LMVA 1BQ7A 3QAGA 2P5RA 2O89A 2VL2A 2JZTA 5IO0A 3ZL5A 1SJZA 2OA7A 1TI1A 5D96A 1OVNA 3CYNA 3GYKA 2OE1A 2WFCA 1OC8A 2F8AA 1GTAA 3EYTA 2B3SA 1FAAA 2AB6A 4NAXA 1O73A 1K0OA 5D93A 1JZRA 1PKWA 3BD2A 1WPIA 3IXRA 1UA5A 3H4KA 4G10A 3HVSA 3QR6A 3L78A 1KEBA 3TDGA 4K0NA 1XWKA 1GUHA 2B5YA 2IWTA 4HJMA 2YNXA 1LJRA 3C8EA 3JCML 5FHIA 5IMZA 2R5GA 1TRUA 1YEPA 1VF1A 5ENUA 6GSTA 3RPPA 3R2QA 3CMIA 4HQSA 3HJMA 2MMNA 3EU4A 4EDYA 1E6BA 2C0DA 4FYBA 4NHWA 1FVKA 2CVDA 2F8FA 5DAKA 3HZ4A 2YN1A 3KH7A 1FG4A 2B1KA 3FHKA 1PA3A 2N5BA 4YQUA 4MPGA 3L9VA 2HYXA 4L8EA 1H75A 1FW1A 2V41A 3WGXA 1ML6A 3A3TA 2OE3A 2BTOT 3HYPA 3GUSA 1BEDA 3IK9A 5IMAA
chains in the Genus database with same CATH superfamily
3DEUA 2JADA 3MAJA 1DP3A 2B6MA 2LSOA 1MMNA 5K1YA 5E17F 3D4MA 3O3TA 1NTCA 1SAXA 5BPDA 2QM3A 3G1OA 3HVXA 3M1GA 2RLIA 2WDUA 3J81Z 1Z3XA 1HW1A 1VQOI 3LSHA 2IGOA 2E0QA 4Y33A 3ZQQA 3VPTA 2P5KA 1YLFA 1S3JA 5JCUA 5HNHA 5ILSA 1V40A 4H0EA 1E3OC 1EGRA 2ZNMA 2YV7A 3P90A 3GMFA 2KHPA 2BW3A 2MMOA 3BPVA 5DTDA 2DBBA 3L2QA 2MD5A 3S1NJ 1PX7A 3PUBA 2H01A 4BAYA 2P7VB 4RB0A 3LAJA 5ILVA 4HF2A 5HLIA 4HPQA 1IN5A 4XR6A 3T5XA 4WCGA 4YG2F 5FRMA 3FZ5A 2CS3A 3CRTA 2L0KA 3KTBA 4M6XA 4XRAA 1A24A 2X99A 2DMTA 5IT9K 2VLAA 4IVNA 1QPIA 2HRAA 5GAHJ 5J5NA 2EJRA 2MMAA 1SC7A 2JSZA 5ICFA 3VSLA 3OOUA 2OBKA 1SEUA 1Z6MA 2EC4A 2JT1A 4QTRA 2V1UA 3BZKA 4YQVA 4B48A 1JZWA 1GNWA 5G31A 5F0CA 1ZYQB 2EWNA 3CSIA 5JLWA 2VOPA 1F9NA 2AHEA 2FGXA 1GT0C 2WZ9A 4UNOA 2IN3A 3KP5A 3HD5A 5C00A 1TWHJ 1GSSA 1PMTA 4G6QA 1DU6A 2GZPA 3SWLA 4KDYA 1EZKA 5DDLA 2X48A 3TOBA 4EM0B 2DBCA 2Z3YA 4OWYA 1UELB 1A0FA 1G6WA 4BDYA 4BXXJ 3KEBA 3ZMVA 2O8XA 1R22A 2A5WA 3GFIA 2DJ0A 1AW9A 3ZQFA 2M34A 5F0GA 1K0CA 3JAMK 3RTRA 3C1DA 3FXJA 5KK1A 3GSTA 1P4AA 5L3GA 1J09A 5BQTA 2H27A 1TW3A 3VK9A 1LFPA 1YOVB 3OWTA 4UUVA 5IPAA 2H70A 2MZCA 2NDOA 2ACJA 5K5OA 1OAZA 1ZLJA 2NNYA 3IOSA 2PGTA 2DMUA 4MGRA 4CDOA 5H5SA 2VJIA 3BTCA 4G8XA 2KHMA 5EYRA 2LMDA 5ELAA 5ICCA 4F7ZA 1QU3A 1PUFA 2BHZA 1JHHA 1VQ5I 3VDXA 4RGUA 1FVJA 3DD3A 1R1VA 3IAS2 4YIIA 1B8IA 3F3RA 5DD8A 4LD5A 3FIWA 4ENMA 2IS4A 5HFIA 1FPQA 4ZZLA 1YX5A 2HVQA 1PL1A 3EPTA 4DSSB 4ZBDA 3CUQB 2A2SA 1FY7A 3VPQA 2DA6A 3KGKA 2XSDC 2IGKA 2Y0SA 4XS4B 2DO7A 5FJ8J 3S1RJ 3TOTA 2MD0A 1ZR2A 3L0HA 2D2WA 4J19A 1Y39A 3H9GA 2MA3A 4EE0A 5HDNA 3BCKA 2DA2A 4ZYAA 4PQHA 5F1RA 3TW6A 1ETQA 4NHZA 2FWHA 3M8JA 2V1DA 4NQWB 4CYDA 4MDCA 1F3BA 2ZJQF 3K4LA 3OYGA 2KQRA 4RI6A 2NVQJ 1T3BA 4X1EA 3ZGKA 1Z7RA 1TQIA 3ABLH 2UZ8A 4EM1A 2XGCA 4A0XA 5EGOA 2DDAA 1YRNB 2QSHX 1TXXA 2PBIA 1WFXA 3QQAA 1UMQA 1TWCJ 2EQRA 1DGWY 2X4HA 3QOEA 5ECNB 3V7CA 3KZQA 3D0ZA 4Y4RA 4IP6A 2N5FA 3RIRA 1MKMA 4BL7B 4YAVA 3SEZA 3OYIA 3DBHB 3G1MA 1TK0B 1HD2A 4IQAA 4QQ7A 1RNLA 1GSEA 2H6CA 3P2AA 1ORKA 3MMYB 2Z2SB 2KLOA 1MZBA 1SENA 1IN7A 2HLSA 4C2TA 1QZYA 3OIOA 2WGRA 3I54A 3RPNA 2M9HA 2PVQA 3O6BB 1A0RP 2R93J 4PUAA 1WJCA 1WWJA 1QQIA 1ZN2A 2O8VB 3JRFA 2CQNA 5HS9A 3P7NA 3Q9SA 4A3KJ 1DP7P 3RDWA 1Z9HA 2KIFA 4BQOA 2DOFA 1A23A 3P9IA 4W97A 4GGGA 1MBEA 3EC3A 3TDZC 1LPQA 4RM2A 3OR2C 4LL4B 2H6BA 5EZHA 4RDUA 1F6MC 3QAHA 5ID2A 2GTUA 1WWXA 3W2WA 3AKZA 1A2LA 1GUKA 1BN5A 1TU8A 1B6AA 1MBHA 4TR0A 3OYFA 1LEAA 2FBHA 1APLC 4CUGA 3TOAA 4LMYA 1HLVA 2DYRH 2M0MA 1F3AA 4LG0A 2DC5A 2V79A 1FYLA 3S1QJ 2FOWA 3I53A 4AIHA 2YPMA 4YQMA 3M9JA 4YIRX 2R3XA 3GFKA 2NOGA 2CVBA 2VQHA 4UUSB 1Q4JA 2CX4A 2HE3A 3CTFA 3M0FA 3LSKA 4C3HJ 5IPGA 2JA2A 4K2DA 2W00A 3FHNA 3WU1B 2YS9A 4KDXA 2QF7A 4I0AA 2W57A 2LNTA 5HS8A 3DXBA 3ISOA 4PFPA 2OKAA 2B5EA 2J23A 2M4GA 3VWUA 2WADA 3Q0VA 1I39A 4I2UA 3CQZJ 1A5JA 1FX7A 3CUQC 1FOXA 2QBYA 4TXOA 2HT9A 3ZIJA 3LAPA 4KN4X 3UVHA 4A5NA 4DZPA 9GSSA 4Y3OA 1PJRA 3F8UA 4IJ3A 5F04A 3CJRB 4FTHA 4PJMA 2HZEA 1R9TJ 3NIVA 3TBIA 2JZYA 1FSEA 4ICYA 4N9HA 2QGVA 2Q2EA 4TW5A 4WXTA 3RZDJ 3H3ZA 4HV6A 2H75A 1BA5A 1EJ9A 2CW8A 4I0BA 1KGSA 1W4MA 1R36A 4M71A 3P9CA 3I55I 1SKRB 4MH3A 5AIPA 3REOA 2CV2A 3S93A 1SYRA 2E7WA 4HUAA 2PN6A 2Y9YA 2K4JA 2LBFB 2ZKZA 2IMDA 1B1BA 2H6ZA 2PU9C 3HKZA 1GWCA 1O8XA 4P9FA 2JZRA 5D9TA 2LLKA 3MFKA 2QSGX 1ZARA 4FX0A 4O5RA 1ZG1A 4HQMA 2JSYA 5HODA 2VASA 4MZCA 3FR6A 2CMPA 4PCQA 4ILFA 1REPC 1K0BA 4A6DA 1XVWA 3FR3A 2R5YB 1GXPA 22GSA 2WS2A 1ZGAA 18GSA 2MBFA 2K9MA 3E6CC 2PI0A 2FNOA 3KMOA 2I3YA 2HQRA 1T0FA 3OSGA 1OYWA 1WGXA 3LJRA 5BMUA 3VFZA 5D9WA 2QLZA 2BY1A 4OFMA 4KT5C 2KIUA 3U9GA 1RUNA 1A8LA 2A05A 4EJTA 2LC2A 3DPUA 2LQOA 1K3OA 4G9HA 5ERIA 4Q5NA 4LIVA 4E7KA 4XKVA 1XW6A 1RKWA 2ESHA 4XK4A 1BAYA 1R6RA 1U9OA 4BVXA 4UHTA 4V1Ap 2CUJA 1SFKA 5D8KB 3AAFA 4IQ4A 4JX6A 2LOOA 1V57A 3GTQJ 2F51A 2LY1A 1TT0A 2L7ZA 1D8KA 1ZAOA 5BOXA 4OIPF 1KYZA 4N0VA 4YH2A 1WMJA 3S14J 2E1MB 2FQ3A 3M9AA 1H8AC 4LMWA 2JRMA 5EEHA 2HSYA 5KAFC 2K3PA 1TRSA 1FT9A 3GL5A 4IN0A 1IRGA 3M7GA 3C1RA 1VQKI 3PNTA 5DQSA 2VIMA 3KX2A 2G7HA 3WGDA 3UVTA 2DMQA 1XPXA 3L7WA 3BQZA 1EGOA 2MLKA 1MJBA 2XRNA 5HR3A 1TC3C 2UV1A 3C18A 5E3OA 3BTJA 5CQEA 4PTSA 3JAMZ 1G8XA 2L4QA 2MMZA 4G0IA 4CO8A 4TR3A 1GVDA 1W5TA 5FKMA 4A3MJ 3UMAA 2IA0A 2O9LA 1BBYA 3A0HC 4L5OA 2ME0A 2GIVA 3E3VA 3BJ5A 4HZ2A 2EZHA 1SD8A 3BBYA 1SJ6A 3R4KA 4AIKA 4ZB9A 2JSCA 1FMVA 1ON1A 2R4GA 5A4VA 4OMVA 3L9UA 5HOOA 2VJ5A 3RYPA 2OACA 1R5ID 2HQ5A 2UWMA 4OCFA 2EV6A 3RSNA 1GTUA 2X6OA 1ZELA 4HJ2A 5A2QZ 2NXNB 2KRHA 5LD2C 3FM5A 1O6JA 3F72A 2HKOA 3DPLC 2RKHA 1B72B 1DUXC 3HTUA 1VQ6I 3ECOA 5IOYA 1W89A 2AQFA 3ZOBA 2DPDA 1ETWA 3EWLA 3D0SA 4LFUA 2I4AA 1PVEA 2L02A 3OYHA 4RMNA 2HNHA 1FYKA 2ZSIB 3BJAA 3F8NA 3RPUD 4CXFA 1VQPI 2HRNA 1FYMA 2NBSA 2VLUA 3ZIVA 3MKZA 4CY6A 2Y0SN 3MWMA 2M1BA 1XGSA 2QZ8A 4BKXA 3S2DJ 1GP1A 2IMFA 2L5LA 1XC5A 4MEXF 4HA8A 3GIXA 3HM5A 2JQ7A 1YQAA 4EDZA 2VBYA 2E1CA 2HRKA 2QQ9A 5DV5A 2HOAA 1S5LC 2NVYJ 5CP1A 2O3FA 2X4AA 5B66C 4FYCA 4IPAA 3ZMUA 2QSIA 4JYKA 5CLSA 2ZO4A 2FQ4A 4L5JA 4N9IA 2L6CA 1EV7A 1YW8A 3SZPA 1Z3YA 1W36C 2FWFA 4BNCA 1EH6A 1HNBA 2GS3A 5B8BA 2M30A 4K1FA 2ZUPA 5HR2A 2MG4A 1GLNA 2A07F 3UJ1A 4F2IA 1ZGJA 1X9MB 2DPUA 2GVPA 3VWWA 2D45A 4PJJA 3HOSA 1I5GA 4BA7A 4S04A 1U5TB 3SHFA 1YF0A 2ZSHB 5LEKA 2GXAA 1XOBA 2FRHA 4MPFA 3IA1A 1ZK8A 3CMEI 2GT5A 2LNBA 2ON5A 3FXMA 4QPQA 3DKSA 2XKOA 1M0UA 1GVJA 2DKHA 2F6CA 2QUFA 2BE5F 4KGIA 3RKWA 2EV5A 2MFZA 3EUAA 3FX3A 4DOZA 1OKTA 3TKQA 4CCKA 2NTOA 3T8RA 3MZHA 3GUDA 1JTYA 2XGEA 1HA8A 2MABA 1V9WA 2HXKA 2DW4A 2P4WA 4LB5A 1JLWA 2XAHA 3S2WA 2JACA 3LGCA 3KIOA 2DMLA 1CGPA 3KP9A 5LGNA 2LRDA 2CQ9A 2VCXA 4IF4A 1SMTA 5AIVA 5G1LA 5KVRA 1T08B 1TW2A 3WGIA 1JGGA 1RK4A 3E0UA 4FYUA 1S72I 3ZTLA 4G19A 1MD3A 3E6DA 1N2AA 3HG9A 3CSJA 2E7XA 3P8WA 2EA4A 3QDNA 1BJAA 2GQMA 5DM7F 1D0YA 1M99A 2ZFUA 2VT3A 2K9QA 4XRFA 4CSWA 2RGVA 3MYDA 3ZLPA 1SKSB 3QOUA 3C2BA 4Q5QA 1A6IA 4G9YA 4U0VA 4U88A 3CXGA 2HRFA 2HYJA 4JRRA 4FQUA 4D5FA 1J59A 1UC7A 2NS0A 5KCMA 2BW3B 5E8IA 1ENHA 3FM3A 3K4NA 3G4SI 2AXLA 1R5PA 4KDPA 1A6QA 2IFQA 1EKEA 4XLHA 4E7LA 3I4MJ 5DUKA 1GRXA 1N77A 3QU6A 4E70A 1B4PA 1PX6A 2HOTA 5COHA 4EUYA 3JREA 3TJFA 4ZH4F 2XPEA 3RDIA 4F93B 2GSSA 3PQJA 2GDRA 1TWGJ 4PUSA 4I09A 4XBFA 4HSRA 2F5DA 2O6GE 3B73A 2GSQA 2I5UA 4OAYA 5IYBJ 3PH9A 4F91B 4WX9A 2H09A 1SFOJ 4IQJA 4AVPA 2LH9A 3H36A 5GSTA 1ON4A 4ETSA 1PN9A 2HPMA 2C0FA 4IS0A 3RKYA 4XSZF 3I56I 3IHUA 4O5VA 2DOAA 2F5EA 2Y0MA 2COMA 4RA2A 3HZJA 4BY1J 3FKJA 1Q1HA 2JK3A 2IA1A 4GWRA 4IHWA 1J08A 2K5CA 4BHBA 3G7IA 3S32A 2K18A 2ECCA 2GOMA 2IMEA 2JN6A 4GRIA 4ZL8A 2QKEA 4OIQF 1HKSA 4WK8F 3QAVA 2LQQA 5E1WA 1G3TA 1RQMA 1K0NA 1V4RA 1GSYA 2K4BA 5DCFA 3TJKA 3HKZN 4XHMA 3KP7A 3LSZA 2Y2ZA 3LFUA 5LEJA 4ID0A 4GFBA 1FBUA 4LJZF 2W82A 4K7IA 3BC8A 5J6XA 1JHFA 4TKYA 2DJ2A 1IN4A 1R7HA 4O6JA 4ESFA 1K78A 2E2MA 2GLRA 3JTHA 2CZ3A 3ERFA 3RHCA 2IPQX 1WOUA 1AOYA 1SVLA 1YS7A 5F8BA 1DPRA 1D1CA 2PJRB 4KIBA 1M9AA 2R0QC 2CFOA 4FT8A 3H0DA 5IYCJ 1PYVA 1VNDA 2NOJB 5B5EC 5EL8A 2HSHA 1YI2I 2H1KA 3HJOA 5H6RA 4D73A 3T8TA 1K4TA 1VQ9I 1M3IA 1XG1A 2GA2A 3Q0UA 4RBOA 4K2XA 4N30A 4KSOA 2ICWG 2DFHA 4LK0F 3HCZA 1JZOA 1ZYPA 4IOAF 3WHCA 2VB6A 1I50J 3X2QH 6GSUA 4KE3A 1F2EA 4CHSA 2TDXA 4JBAA 2DT7B 3GTGJ 2ID3A 2L4MA 3F6OA 4II3A 3COAC 2XC2A 3S17J 2H19A 1T98A 2FE3A 3UL3A 4EDYA 1ETYA 2IBDA 4JE1A 1S7OA 4I02A 5CJ9A 3HUGA 2XPUA 2B63J 3LYKA 2QVOA 1KU9A 4LL1B 2TCTA 5CVUA 3OV8A 2M7AA 5EGOB 1HNAA 3IHQA 4E7SA 3J7Yk 2DA7A 1MNDA 1YX3A 3F21A 2WAQA 2NS8A 2LS5A 2KIQA 4RAZA 4K0GA 1WH7A 1D5YA 2WRTA 2KT0A 3L2VA 1T39A 1J75A 1USSA 2DKIA 3A5WA 1K6OA 3FBIB 5IMCA 2V6KA 3F3XA 3A2KA 2YWNA 3NRVA 3ZREA 5A4UA 1KU3A 1N75A 3I9V2 4XIHA 2OCEA 2VQGA 3IPZA 4BQAA 4F52A 4IP1A 5LRSA 1FSHA 5FB2A 4UY8I 2IS6A 4FCYA 1THXA 4A6EA 2W85A 3GFMA 2NVUB 3I59B 1X4OA 3K69A 2XAQA 3JTGA 4GSNA 4WEYA 4FETA 2JU5A 1O57A 1WJEA 1ERUA 1JLVA 2A6TA 3V4GA 2F9SA 2K3FA 3IP4B 3OIPA 2VL3A 1TRWA 1TQPA 3S8PA 2HFDA 1X5CA 3BWGA 4ECBA 2ZCTA 5KN0A 3EDPA 2PN8A 1MD4A 5ID2B 4UV8A 1YS6A 4C2UA 2NYXA 4IKFA 2VKVA 1OC9B 5D5VB 3JR9A 2NPBA 4O7HA 4O5QA 4PUFC 1YKAA 4A3GJ 1QUWA 1ULYA 3FEUA 2M7BA 4LG0B 3ZQLA 5KAIC 5FLXK 4Q48A 2YWMA 3Q74A 3CCJI 2KKOA 3QFBC 4L9VA 5CNWA 5ECMB 1IO2A 1XWAA 5JR3A 3VFIA 1X3WB 2HDDA 4I01A 1X3UA 2K27A 2R7TA 1QVTA 1Z21A 1MMGA 1XGNA 4G12A 4BEHA 3HDDA 1S9HA 1ERDA 3ZN1A 2DMNA 3MN2A 3SQNA 3NZNA 1RR8C 4EJOA 2HR3A 1O3TA 1XW5A 1TK8B 3HIFA 3R6SA 1SMYF 2LREA 3WTXC 1VQ7I 1PRXA 4BWQA 5B6NA 4PJLA 5HLHA 5CAXA 2A5YB 1ST9A 2GOXB 1J9BA 3LSTA 2QBYB 2ELHA 2VCTA 4JR6A 4TXOB 3ZMLA 2O0YA 3C2GA 3N9JA 1UHWA 4TR4A 4I97A 1HSJA 2L9VA 2HOEA 4HV5A 4R1HA 2M2EA 3MQ0A 4Q47A 3SFZA 2ZJRF 17GSA 2H94A 1HQCA 1IYHA 4UUTA 2E2GA 2LV3A 3KZIC 4GTUA 1GTBA 1MMDA 3A0BC 2VKHA 2VXZA 1ZTRA 4MTEA 2CT6A 4L0UA 1ZHFA 3BQYA 3S16J 3KH7A 4X6AJ 2DMPA 1TOFA 4F03A 2PMZA 2ZXWH 4QIWN 2VL9A 2C0GA 3QOPA 5G30A 2E1NA 2HTJA 3A2XA 3LQ7A 3TO7A 1F9MA 3E5QA 2ESNA 4KNDA 1FOHA 4CCLA 1H9GA 1RESA 2WBMA 4BXFA 3WGHA 4CCJA 3CZ6A 1IG7A 5JCWA 1R49A 2OADA 1TU7A 2RNGA 1G3SA 4M3BA 3JSPA 1OR7A 2DA4A 5CVVA 3KMNA 5KEJA 3QP5A 3CLOA 4NDLA 1B4QA 4AF2A 4E4HA 16GSA 4FX4A 2DI3A 4TR1A 1Y25A 2RM5A 1MDJA 5CVRA 5BNGA 4EGYA 3EVIA 2XDVA 2CZ2A 2GZWA 1PD21 3ZR8X 1F4KA 4J57E 2CW7A 3SBCA 3OL4A 1YFHA 1FOYA 1Z7UA 4CH7A 1WJAA 1SANA 5F0HA 5AGYA 5CRDA 1X0RA 1ZZYA 2LUSA 1MBGA 1HYUA 2QGUA 1SYXA 1Y0UA 1I5ZA 1IV8A 3PSFA 3F3QA 4HDEA 1V5EA 2X6WA 5IMDA 2FY6A 4HX7A 4GYIA 4POBA 4V2GA 1CQHA 2JTVA 3OYLA 3TRXA 2JJ7A 2OPTA 4IXAA 4XLFA 4XLCA 1E17A 3MZ8A 2H1GA 4I8BA 4TRXA 3GV1A 2D2ZA 1R1UA 2IT0A 3VYSB 4AUXA 3OS1A 2ALBA 5H2FC 2C4JA 2IL3A 4RLQA 3IDVA 2V9PA 4IGJA 4K6XA 3TKYA 2IGNA 5FKOA 1JKOC 4HS1A 1OE8A 1OYJA 4S0HB 2M72A 3ZMTA 1WJ5A 3PPUA 2WB9A 4MLYA 2OQGA 3CO7C 3CC4I 3MKLA 2H8WA 1AA7A 4HOJA 1FHEA 3UEMA 5K7FA 5FO5A 4HQEA 3DEXA 1DE2A 1V98A 4DNCA 3BR5A 3CCLI 2DFFA 2F5FA 1BIAA 4R8HA 1R23A 4BDZA 1QBJA 1VZ0A 1X5EA 3LEFA 3D5LA 2OU2A 2IW5A 3H0GJ 3LA7A 1A2JA 5EPFA 3CDIA 3EQLF 2JA8J 2R0CA 2VL8A 2NAZA 2W24A 3WODF 4DYQA 2KRCA 1Z1DA 2E5ZA 2FMLA 4HX8A 5CKTA 4C2MJ 4DW6A 2HVSA 1GLQA 3VODA 3DWVA 4K8MA 3DF8A 2R7DA 2FCHA 3RAZA 3W8JA 2K85A 2XAJA 4MQ9F 4IRIA 3HJPA 2RVCA 1X9SB 3DTIA 2MGQA 3EYYA 2E5NA 3RHBA 1K3YA 3HJEA 3OYNA 3DP7A 2B7EA 1HDDC 1EWXA 1M9BA 5C44J 2WCIA 2L4AA 4MTDA 4E7JA 2NVLA 1CQGA 1A04A 4XONA 1EOGA 3GURA 3HXSA 2LDUA 4ISDA 1ZGNA 2LKXA 3RKQA 3IE3A 3F9UA 5B3SH 3R0JA 3TKSA 3TKSE 3J7ZI 1X9WB 1R4MB 3I4PA 4Z6YA 1WI3A 1OCTC 1PQNA 3D6IA 1SFEA 1D1AA 2ZMEC 4GRFA 3WYWA 6GSVA 2WAFA 1EH8A 4LLNA 1E3PA 3HTSB 3PO2J 2DJ3A 3A2WA 3ZITA 5INYA 1NW2A 1WJDA 3IWFA 4E8HA 2PQ8A 3VOEA 4A5MA 4BE0A 2I1UA 1GV5A 4MFEA 3EINA 5CRWA 4O5UA 1PFOA 2DLLA 1V2AA 4TV7A 1NSWA 1XWCA 3W8SA 1T0FC 3HRUA 1O3RA 4X0GA 3OYBA 3F6DA 1UHMA 3A2VA 3CD6I 3QMXA 2WY8Q 2VN2A 2CH0A 3BJOA 1VQ8I 3IL2A 2R7SA 2Y75A 4AIDA 3R3EA 1A36A 5IP6A 4EV0A 2BY3A 3GW2A 1P6RA 4HI7A 2DT6A 4XOPA 1BG5A 5EVOA 2ID6A 2HPIA 4DYCA 5BMZA 1YIJI 2E2JJ 2OBIA 1G6YA 5J4VA 5K7HA 4N4OB 3CO6C 1WPKA 1NK3P 1G4DA 3KTLA 2WAQN 4RGXA 2VKEA 2DJIA 3A4CA 3CRUA 3K1NA 5HNFA 3H1NA 4L9TA 3E6BA 2H6XA 5CPRB 3TJJA 1CF7A 3QAWA 3MCZA 3CBUA 1ON2A 2CO5A 3FKFA 2PFBA 5KNLA 1GSQA 2WJUA 2P6TA 3GZ6A 2VPLA 3HSRA 1Y0NA 2IAIA 4ZTFA 1B9XC 3M3MA 2H0IA 1FBSA 2YX7A 2J9HA 4BL0B 2EINH 4OINF 1BW6A 4OAZA 5JVGF 4E7HA 1G2HA 1B48A 1K0MA 2YWOA 4IKHA 1TKDB 5TGTA 1TJDA 4J2FA 1WH5A 1TT5B 2EIOA 3IHGA 3DTKA 4OFTA 2DA5A 3DKXA 4LA1A 4RQRA 6GSYA 1RKTA 5IT3A 2PUKC 3BTIA 2X6XA 3CDLA 3LA3A 2CQQA 2CJJA 3AG4H 2AQEA 3K2ZA 3M07A 5LLQA 3DQVC 1T95A 2HZDA 3IC8A 3HGGA 1JZDA 1F43A 3GH6A 3BJ6A 4FE4A 2HFHA 1R5GA 1I3AA 5FLXZ 1H0MA 2KDZA 2CQXA 2STTA 1EV9A 4ML1A 5GPAA 3J7AO 3UBKA 1ZYRF 3LL7A 1T1VA 4X0XA 2V32A 2KFDA 3HSFA 1F5TA 3Q9VA 2K9SA 2WB1A 4E6KG 4A12A 5LGTA 1SU9A 4HEA2 2F5CA 4NV5A 3MKYB 4QWQA 4EQQA 3L2UA 3EURA 2E1OA 3FK7A 1U8BA 3ME8A 4GCIA 1I1GA 4LITA 6PAXA 3S3MA 2EBIA 4FE7A 4RB3C 2IFQB 2X8CA 2C1YA 2B0LA 4GXZA 2RNJA 1IZ1A 4DSRA 3RQ4A 4POKA 2BXYA 5M5XJ 1XB4A 1UHSA 1U6GA 1ETXA 4HOBA 2LFBA 1H89C 3G9BA 3O8HA 2JA6J 1IXRC 2JVHA 4MNUA 3GKMA 4J56E 4MJBA 2K7LA 4KMFA 1K83J 5LRRA 3F8MA 1D0ZA 4WF2A 1FJLA 2GXGA 4L0YB 2W84A 1AC1A 2XV4S 1YDKA 3L4NA 3CCUI 5HR0A 4YKGA 4HDVA 1DU0A 4IQ1A 2PMZN 3PNYA 2EPFA 3L2CA 2A6EF 2OJED 1Y1WJ 2CYYA 1YG2A 3GX0A 3CLQA 2VBWA 2DQRA 2PEXA 3IC7A 5JLXA 2LKUA 3TOUA 4F55A 3ELKA 3E7LA 4PK4A 3F4SA 1HDPA 3H1CA 4F3QA 2RM6A 3ERGA 1N8JA 2CW0F 2CV4A 4KCAA 1LNWA 2LY9A 3NAUA 4BGDA 1J0FA 1U2WA 5HVQC 5DS9A 2N8GA 1ZKGA 3OS0A 2XAGA 1HBXG 1ZG5A 3ED3A 1FMWA 4ULXA 4KX4A 2M0CA 2VBXA 3BR2A 4LLLA 1EA3A 2XB5A 4FHTA 2XAFA 2FF4A 3KLNA 4NMUA 1U3AA 3W6GA 2E2IJ 2KP1A 2PMUA 5IMFA 1BIBA 4PNGA 3LXZA 2JA5J 5GAEJ 2KPMA 3DEEA 1U87A 2Q8KA 4EJUA 2L9NA 1D1BA 2NVXJ 1TBXA 1Z3EA 3KZYA 3LOCA 2Q0OA 2H30A 3S1MJ 3BG7A 1JTXA 1THOA 2EFQA 2B7JA 2OUMA 3LSRA 3CF2A 3TRQA 4NBQA 3PO3J 4XSXF 1JKRC 2FLSA 3PM1A 3TGZA 4POLA 2KOKA 4BVYA 2V1MA 2V6EA 5H20A 2K6VA 2YJ7A 3IC4A 4Q5FA 1XXUA 3GTLJ 4ZBBA 4EO3A 3T0YA 3DMLA 3OMYA 1ZREA 3RI4A 4ECIA 3N5OA 5K7ZA 2GT6A 4ZL7A 1LUJB 2VUMJ 3FF5A 2F3MA 3BY6A 1LDDA 3ZQHA 2LRTA 1ZOFA 1YE9A 2L54A 2E7PA 2ZMEA 3U21A 1OCZH 3KD0A 4Z2RA 1VI0A 3PFYA 4M3FA 3DU6A 3KZZA 1YJ6A 3FBNB 3A02A 1O7UA 5DJLA 2KUCA 4CA0A 2G7UA 3JRDA 2R7RA 1K7AA 1KQ0A 4IHSA 1TW9A 3WGGA 3ZMDA 4K7OA 2LYCA 2GWRA 1VRSD 2YX4A 4ZZDA 2VD1A 2E60A 4M9XA 4BXUA 3CTGA 3OYJA 5G5FA 3RBTA 4YFXF 3GLLA 3ZFBA 2P81A 1BJXA 4BHPA 1TP9A 1YQ1A 3NOFA 1QHHD 3VWBA 1SK1A 4ZDLA 4YIFA 2VJJA 4HU9A 1XWBA 3IR4A 4EVMA 2VPRA 2VODA 1HC8A 5IT9Z 3QWLA 3KYCB 1YIOA 4M9ZA 2QQ8A 1MW7A 4BPYA 2X1CA 2JMWA 1BW5A 3IKVA 1GSFA 2K8SA 5E3MA 3KYLA 3FZAA 3KJYA 1P9QC 2R5ZA 1K4SA 1O85A 5DCMA 2K02A 1Z77A 2QYOA 2EZLA 2GQKA 3K4CA 1XTAA 2L9SA 1XFLA 1OCRH 5CRGA 4EF0A 1ZL9A 2FBIA 4ZYGA 4L9NA 3KCMA 3S3OA 1LB2A 1ZRFA 2A2RA 4FIWA 4G2EA 4Q5RA 5D73A 4ZYDA 3HKRA 4AGSA 1GULA 2H72A 3N05A 5DD4A 1LBKA 1LEBA 3WE2A 4M6VA 2EIRA 1MNEA 5DJMA 3NWTA 1X3ZB 1FB0A 2DJKA 3K1PA 1RR7A 3GN3A 3QPSA 3ZCOA 3G2BA 3IWZA 2R7QA 4GO1A 2FNAA 5GP9A 2NVTJ 1TTZA 4D0PA 2RC4A 4L0WA 2HDWA 1VQNI 1O81A 3APOA 1SFXA 4JQFA 1QNTA 3ERMA 3Q3SA 4M72A 5FKKA 2FA8A 3M9KA 5EY6A 1QQ2A 5LBQA 5DYMA 1SK2A 5AN1A 5JVTA 5ELGA 2GM4A 3CCVI 3Q0WA 3HC7A 1DBYA 3I4NJ 1TQMA 1WZ2A 3ZVJA 5DM6F 3OYDA 1DGRM 3BG5A 1PDNC 3I43A 3AY8A 3I58A 1V54H 4KIGA 3HL2A 2HXOA 2FD3A 2R7OA 2X6YA 4EGZA 2R7XA 4ZBAA 2R7UA 5F64A 5EJCA 4U7DA 2MBTA 5EEAA 1JT6A 2D5VA 3QCPA 5F05A 5D8LB 4XRDA 1IC8A 1T2KA 1S3CA 2J5OA 5B1AH 3HZ8A 3GZ5A 3IH3A 2FX0A 4M6YA 2O8KA 3F63A 3ZMKA 5JWOB 5D4RA 3GTMJ 2IP2A 4USSA 1SD5A 4A3EJ 1NHYA 5AONA 2G0EA 3FZVA 2GQLA 4XN3A 4HZFA 3OYAA 2R7WA 1IV6A 2H8RA 4ZDOA 3U5RE 1L3LA 3BR3A 4P5OA 2B9SA 5IOXA 4IVFA 2FJ1A 3US3A 2RQPA 5DEQA 3DCFA 5CRHA 5DVBA 3HA9A 4TOPA 3GTUA 1OJLA 4D1QA 3GFLA 3GKXA 4CZZA 4XOTA 5J1YA 4A2UA 4OIOF 2HTSA 4WBJA 1E2YA 5FROA 2CUFA 2W4SA 3IH2A 3M4OJ 3ABMH 1X5DA 5DAKB 2VUPA 5C4JJ 1SVOA 1R4WA 2V9KA 3L1PA 1HSTA 2M87A 2F4MB 2OD5A 1WJKA 1Z6RA 3WE3A 1SL0B 1NG7A 1BC8C 3SDBA 3Q5FA 2X1EA 2K8VA 2GGTA 4D9JA 2KP2A 3H5NA 3K6GA 4IJAA 2DXIA 3KIJA 2QSFX 1KQ8A 1FIPA 2A61A 3O76A 2Z5UA 3V42A 1MMAA 1D8JA 3SZGA 3LA2A 2FUG2 3LXTA 1JHBA 5L71A 2WB1N 3C3WA 4IJIA 3DFGA 2JVGA 3HPHA 3VI5A 3G7JA 2ELJA 2PVOC 3H35A 4PQIA 5JHUA 2L57A 1SL1B 5FWGA 2WV1A 3IKTA 3DVWA 4XLAA 5LCZA 4G7OF 5J47A 2XASA 1XZOA 3Q18A 1ETVA 2XPWA 4MH2A 1TZLA 1X1AA 1AKHB 1FZPB 2VKDA 4UB6C 4PGTA 5DCGA 4Z7XA 2X64A 3IBHA 3GBGA 4FO5A 3GKNA 2DT5A 3CCSI 3SJMA 3SFIA 5JI6A 3B6CA 3JRCA 3HY2A 4GQFA 1PSQA 5D8IA 3TO6A 3OYCA 2O03A 2DIZA 4Y52J 1V5GA 3BTLA 4KJZA 4BACA 2KMUA 4C9YA 1X1BA 1MH4A 1EEJA 3H5AA 4ZB6A 1R5HA 3DKWA 3I71A 3LWFA 4DZJA 4U0YA 2HI3A 2G9WA 3P7XA 1P7JA 2MW8A 1OC3A 2OZ6A 3MKWB 3RJPA 4ZYEA 1M7TA 1GTIA 2VE9A 1WRYA 1W0TA 2DLXA 2DK5A 2I81A 2HSMA 4YEJA 3ZVJD 3K2AA 1FBQA 2PX9A 4CZCA 1ZYNA 3D22A 4HQZA 1J5YA 1RETA 3ESWB 4A3LJ 1PN0A 4BU2A 1TRVA 2CAIA 1C0WA 3HOYJ 2VOCA 4MF7A 3F8BA 3KEYA 2FWGA 1PP8F 1K79A 6GSWA 1X58A 4K2EA 4N0BA 3SEQA 2HEOA 2AAWA 4AJ7A 1BYEA 1W1WE 2C8UA 5C04A 5ABRA 2JL4A 3ABTA 3OY9A 3KP4A 3F9KA 4EEFG 5IP9J 2CSOA 4ENNA 4XS4A 5AISA 1T8EB 4B09A 2O61A 1XGMA 2V26A 4CW9A 3VI7A 1J0RA 3AL0C 2K9NA 3QPMA 4NQWA 3VEPA 3ONQA 5L3CA 2VLTA 3EMPA 3DYRA 2A3SA 2YR2A 1P7IA 1UCRA 4KITB 3LQQA 4UVBA 2L5QA 1AU7A 5ECPB 4II2A 1MDIA 1QVUA 1Z6NA 4I99C 4P1WA 3TMOA 1G7EA 3WT2A 3RQIA 2IXSA 1B8XA 1ZH5A 4RB1A 1T4YA 1K3LA 4MJEA 1OR7C 1P2FA 4BL7A 4PNFA 3JRIA 3CC2I 5ICEA 2AYTA 2H1BA 3BCIA 3K4KA 3DV8A 4ZILA 2DMMA 2QQAA 3QP6A 2YUSA 2CV1A 3GHAA 1EP8A 5DALA 4PGGA 3D1NI 3QPTA 3U1DA 4IZZA 3TO9A 3VB2A 3OS2A 2VE8A 4YFKF 2GLOA 2LTKA 1IRXA 1T6SA 4OD7A 2L4CA 4RGRA 4BE2A 3M8NA 2L7KA 4KIFA 1QHGA 1M2BA 3NQOA 5JHFA 3HVVA 1G0TA 3KM6A 2FNPA 5LHGA 2CV0A 3NWSA 2KLXA 4AVZA 4EJWA 4ZB8A 5J3RA 4NWYA 3I0TA 3TW7A 4KDUA 4YAPA 4AIJA 2I10A 3QYBA 2H66A 1EF4A 3LSJA 2PJPA 1D5VA 1IYIA 4I2TA 4PQ1A 1N25A 1T56A 3L00A 5EZGA 4BIKA 2YOIA 2F4IA 2KJCA 1PUFB 5E59A 2L59A 1S7EA 3MNGA 4K7NA 4CY8A 3BOQA 2ISZA 1B8IB 1X4PA 3V8JA 4Y15A 1IW7F 3KLOA 3M8EA 3M1CA 3HSEA 2FWEA 2BJXA 2ON7A 4XS6A 2BZTA 4UUSA 5JWQB 3HYIA 4BBRJ 1FTTA 2D1HA 4HAMA 3MDKA 3LSMA 1IXSB 1V5FA 1W7PA 2OCCH 1OMIA 4L5IA 4WXCA 4CCNA 1G3YA 2GBYA 1UVZA 1A8YA 3CC7I 2ADUA 2EFWA 3GTPJ 4L9JA 2MYGA 1ZMAA 5DDGA 2WWYA 4V19K 3V8KA 2EH3A 1TWFJ 2MSYA 3CQFA 4XKWA 4RAYA 2L6DA 4RUVA 2EA2A 4BS9A 3TGNA 4KW6A 2XHKA 1Z5YE 4GSTA 9ANTA 3ZRGA 5J3LA 1NG6A 4AU7A 4F9ZA 2M8EA 2JUGA 3KP2A 1HKTA 2PG4A 3ERED 1R00A 2IMKA 3KP6A 11GSA 2PPTA 2AJQB 3FISA 2E71A 2CA8A 1UJ8A 2WTEA 2DK8A 5LGUA 1XCBA 3VWXA 1PGTA 1EV4A 4S05A 1MEKA 4HU7A 3PIPF 3ABKH 1TTYA 3APQA 3FRCA 3TKSC 2QKMB 1N78A 4XKCA 4KAEA 4BJTA 3WU0A 2GA1A 5ECHB 1PL2A 3CTAA 1XVQA 2UXNA 4GCVA 4ZC3A 2XROA 3JSOA 4L18B 2GSTA 3CP8A 3TJBA 1OKRA 3B02A 1HW5A 4H86A 5E79C 2CQKA 4Z2UA 1DSBA 4O92A 2CWEA 1ETKA 2FXAA 4IRGA 3PIOF 2ZC2A 1B9YC 1QMVA 2YANA 2IMIA 1TLHB 1ETOA 1U9NA 3K7AJ 3OIQA 4P55A 1IJWC 2OJLA 4M9SA 2Y31A 4G6DA 3W6KB 2EIJH 2R5YA 2XUBA 4CCOA 4ACSA 3GL3A 5TRDA 2YSRA 2OA4A 3LSIA 1P4WA 4BY7J 3U2RA 2XF5A 1AHDP 3HOWJ 2OTJI 2CX3A 4G0KA 5E4WA 3LMMA 3PUFA 1YHQI 2PERA 4EVIA 2R4VA 4WBRD 2HI7A 4AYBA 3S3NA 2RUEA 3O3KA 1NM3A 5D4SA 2P0GA 2H1DA 3EYIA 2A6HF 2VI6A 4DYRA 1RIOH 4LB6B 4CICA 2LVSA 2L5OA 1SD9A 5F07A 4WETA 2W1OA 3I5UA 2ELKA 4ZTJA 2H0GA 3VPRA 2QA2A 4HDUA 4BWSA 1G59A 3FXQA 3LSGA 4NNJA 4JU5A 2J5PA 2HXIA 2EB7A 1OISA 2E35A 5FKNA 2DOEA 2XF7A 4A0YA 2LEGA 4V2FA 4B44A 2V2GA 2RAEA 2X49A 4IHUA 5J9BA 3C1SA 2PLYA 3UR3C 2CQ7A 1FLIA 2KZGA 3HXLA 1X19A 5M3FJ 3BR1A 4JP0A 1MDMA 4O3MA 1W7PD 3G1LA 4CGZA 3MSZA 2HZEB 4NXIA 1RPWA 2IJYA 2Q2EB 5ECOB 3DXJF 2R7FA 1XG8A 2RDPA 4TXVA 3GFJA 3R60A 2RIIA 1IDYA 3LG6A 1XPVA 3DLAA 3GCMA 1U78A 1MTCA 1S3DA 4BVYB 3GTJJ 1YEXA 1DPUA 1A35A 1UG2A 3LYPA 4PJNA 1XSVA 2LKSA 3EPZA 1KU7A 5GPCA 3EETA 3H9QA 1EH7A 1FP2A 3GF2A 1TNTA 1CQTA 3HVNA 4B43A 1JFUA 1WRJA 4RAGA 5K5QA 3OR5A 2P31A 2VCZA 4OCEA 4B1RA 1X2NA 2ZMEB 5ED4A 3L2WA 1IF1A 3OR1C 1M2AA 2H1AA 2E19A 4YELA 3F22A 2IS2A 3D5RC 3CCQI 4DEJA 1Y8RB 2P6SA 5EG0A 2LJRA 4O32A 3GH9A 1SL2B 2FD5A 1WKMA 2C3TA 1I27A 2EFPA 4EC0A 2CAQA 4KB3A 4HNTA 3VYTB 1B72A 3KH9A 1FOWA 4HF0A 3WTWC 5GZZB 3SYTA 4YFNF 4JX4A 4KA4A 3LORA 3GVAA 1FO5A 2DTZA 3OYEA 1ZR4A 2UXXA 4KUMA 3WTZA 2Z1DA 4KMUX 3V7SA 1LU4A 2UZKA 1IRZA 4MNNA 1J9IA 2DIYA 2FOKA 2DQLA 4OFNA 5H5RA 3MEXA 3J7Yb 1ITYA 2ZXHA 3TJGA 4OMZA 1MIJA 1QGVA 4M74A 2M80A 2L01A 4NC7A 4D7MA 5FLMJ 3JRHA 1S3RA 5B8AA 3UKGA 3FK6A 2L7FP 2CUZA 3BLYA 3HRMA 3PSIA 4JK1X 2V6CA 3F8FA 5DCMB 4IHYA 2Z33A 2EIKH 2XGXA 4FH8A 1G7OA 2KJBA 3CF5F 2HQNA 2P5QA 2R6KA 5GADJ 3TUEA 3DBLB 3KPHA 2M45A 3W3CA 1OYYA 3ZN0A 2VAFA 4A3BJ 3K70C 1KBNA 2I8DA 2E36A 3KETA 2C0EA 4ZXGA 1D0XA 1U5TA 4LIUA 1TNSA 3G73A 4IELA 4A3JJ 3R0AA 4HZ4A 3QFAC 3F0IA 1QPMA 5LNKe 1Z7LA 1XIYA 3G3ZA 4C3IJ 3D5JA 3W2VA 4XLNF 3BR0A 5ILUA 3ASNH 3ZQGA 2K40A 1VF4A 5G5EA 4F82A 1WE0A 5KHDA 1GLPA 4EJVA 2LRCA 1T38A 3IK7A 4EKZA 4Y17A 2DDBA 2XGDA 4XCSA 3W6JB 1NH3A 1GNEA 3GKKA 7GSSA 1AXDA 4I5QA 1F1ZA 2F48A 5GAPD 2FMYA 2X51A 3J80K 1KA8A 1ZRDA 2ZBKA 2H6YA 3CUOA 1Y1VJ 4LK1F 4ITVA 4HSTA 1LE8A 1KZHA 5IOZA 1RZ4A 1TDIA 4BJ5C 2RN7A 4D7NA 1ACIA 1OPCA 4Y13A 1VFCA 4ZYHA 4MJAA 4QSHA 1JKQC 1IN6A 2TRXA 1MD0A 3GTUB 4YKFA 5FFXA 3QODA 1O7FA 2TIRA 3C73A 3S9FA 1ERTA 4R79A 3DEWA 4NC6A 2KRFA 5L3EA 2DJNA 2OE0A 5DCHA 5E3NA 2VC1A 3LNQA 2Z9OA 2M5WA 2G0FA 4XKBA 1F36A 3GTOJ 1OCOH 4XN0A 5HS7A 4ECJA 1FOVA 2BOLA 1I6HJ 3TQNA 4ZL9A 5KN2A 1YJWI 3ZPLA 2KDOA 3VLNA 4MF6A 2AV4A 2FA4A 3TKRA 3J7YJ 2O87A 1W4VA 4HNVA 4BVXB 5IY5H 2GXBA 1C72A 1QK8A 3E5XA 3ZRDA 2XBIA 3BR6A 3GMEA 5HFKA 1RUOA 2VQCA 3LFKA 1Y56A 4TVEA 1SAUA 4IRHA 3IRQA 1I3QJ 1WJFA 1XMXA 1I9DA 4KA0A 3UAPA 1LVAA 1PUEE 4V2NA 4BQNA 1URMA 4WR5A 1TWAJ 3LQRA 1Z67A 2X8HA 5F1JA 1R5AA 3U6VA 2MYSA 3IAM2 3DKYA 3DLLF 1HQOA 2O85A 2WULA 3HDCA 3D21A 5CVJA 2LF8A 2H74A 2VCQA 3K8NA 4E7ZA 5CO3A 4A5PA 2JPBA 1M3JA 4KYWA 1XCCA 4BJ6C 4TN8A 3RZOJ 1OCPA 1S3AA 3DIEA 1XMAA 13GSA 5ECQB 3QPHA 5LFAA 2WV0A 3L9FA 5F08A 3PINA 2W48A 1WSUA 1U6TA 4I98B 1VTNC 5KOWA 1HKQA 2RV8A 2HWVA 2L2OA 3JRBA 2X85A 2N5AA 2YPRA 3FHZA 3TL4X 3C71A 5IMVA 2PJRA 4IHXA 4MZBA 1YY7A 3JW4A 1OYIA 1K0DA 2R7VA 2JWTA 2YJHA 5ICGA 4KUNA 4CDGA 4AYBN 5J1RA 1MSEC 5A2QK 3TB2A 2ZFWA 1O3QA 2LY2A 4DIQA 3BPXA 5E1XA 5ECRB 4LLGF 3ZMSA 4OOIA 2AUVA 3JRGA 2Z9SA 3BZ6A 5FKLA 1S7AA 2GSRA 5A5KA 4IHTA 3GSSA 1XD7A 2H0HA 5D9XA 4NB5A 2VM2A 2ETHA 2YZHA 1L0OC 2HVRA 19GSA 1FOKA 3LWAA 3PFIA 2R2JA 1BI1A 1AUCA 4N10A 1WIKA 5LD0A 2HNLA 1LFBA 1PKZA 1P92A 2PBJA 4ECCA 1M1EB 3R61A 3I3LA 1MNMC 1TI3A 2DJ1A 2HZFA 1YZXA 3DU5A 4FASD 5LHIA 3BCBA 2E2HJ 3J7AY 2A69F 3M8FA 5DBQA 4KF9A 1TL8A 3W6VA 2A4VA 3B6AA 3A1YA 3CCEI 1BR4A 1RI7A 5FD5A 3WTTC 4HSCX 5J4UA 4MEYF 2Z16A 1ZRCA 3L09A 1QZZA 2P5VA 4PSXA 4LG3A 1T4ZA 2LRNA 5HFGA 1SKWB 3VYRB 2XRLA 3G6EI 4HRIA 5F27A 1H9TA 2EFNA 3FXOA 2VXDA 3K4BA 3TP0A 4V2LA 2K9FA 2P7CB 2XIGA 4LGWA 4PGHA 1JUMA 5J1UA 2X1DA 2W7NA 1GUMA 5D5WB 4DBRA 3DVXA 2VM1A 4F0CA 1MJAA 1YW9A 4G7ZF 2V6OA 4Q4ZF 3BG9A 4NC8A 3K4MA 4UV9A 3ZQCA 3IRAA 5H5QA 3ZYWA 2EIMH 2BYVE 1ZQ3P 4EIPA 8GSSA 3APSA 4XLPF 3KYDB 5E3LA 1BC7C 3I59A 1DQUA 5JWRB 4K9ZA 1XN7A 3E1SA 4BH9A 2P5LC 4KISA 3QU3A 1WVRA 1OFCX 1OE7A 1Z05A 2V7FA 2BVMA 1K78B 5AIXA 2KIMA 2I9HA 1X1PA 5IQYA 2XKPA 3F8CA 3GO5A 4MIMA 1HW2A 3GTKJ 1E0EA 3FW2A 4G7HF 5J40A 5D9VA 2MH2A 1YYVA 3RPQA 2F2EA 1OC9A 3K0LA 4A0ZA 2LKPA 3H3UA 2KISA 3BG6A 1J7KA 1LQ1A 4MMMA 1XWGA 3WTSC 4D73B 3KEQA 4B3XA 1QGPA 3DTEA 5J8CA 2VD0A 3H93A 3HRTA 4I76A 1SFUA 3SZTA 3AG2H 5EF6A 1XBSA 3C7MA 3V1WA 3WGEA 1W7PB 5IPHA 1JGSA 2JSPA 4GQCA 3KXOA 5GSSA 1QZEA 4IEJA 1IRFA 1WHUA 2Y30A 2VO4A 3DBRB 3GWZA 1YKCA 4RI7A 1BR2A 2M8GX 5CYVA 4B47A 1QXHA 4OO4A 1IN8A 4XNFA 1U0JA 1W0UA 1A31A 2ZJ2A 1GV2A 2M3AA 4N0ZA 3QD9A 1USTA 1E2XA 3ME7A 4BBSJ 3CJNA 1UZCA 2VQLA 5HR1A 3HUGB 4U7BA 4E7IA 3O8GA 2VONA 1V58A 2REMA 5F0FA 1JKPC 3RYRA 2E34A 1Q98A 2L3DA 3GEZA 2V4JC 1XMKA 3CJQB 5J4YA 4U0WA 4LOCA 4BE1A 3KP3A 3A01A 2VT2A 5B1BH 2H8LA 4MK3A 2GAUA 3VURA 2CFXA 4RS8A 4ESJA 1YJNI 2A68F 3WG7H 4CHUA 1IGNA 1ERVA 3FY7A 1R71A 1TP4A 1VF3A 2XSJC 1D3YA 4B4CA 2DJJA 3UBLA 2HQAA 3MVPA 1SD6A 2YZUA 1UG0A 3J80Z 3ZQIA 2CGPA 1O4XA 1ABAA 1FIAA 4ENJA 4PX1A 4HBLA 1LDJA 3MWHA 3QYFA 10GSA 4L0ZB 3RPUA 2XF6A 2IPAA 4RQXA 1BJZA 4UB8C 4A3FJ 3CDHA 1OCCH 1U8RA 4WR4A 3FKIJ 2B7KA 1HNCA 4GSSA 3RCOA 4Z2YA 4EMSA 4MCUA 2YWIA 1Y6EA 1S29A 1RC9A 2R3SA 1SJIA 1AAZA 3AG1H 5ECKB 1FTZA 1JXSA 2JUCA 2G2QA 2XHFA 5DUIA 1I6XA 4P9UA 2JRTA 2TRTA 3CSHA 3E6MA 4H4KC 3FK8A 3WG9A 3ZZXA 1U88A 4CYCA 1G6NA 2XC7A 3G71I 3O2PE 3K70D 5KN1A 4ENKA 2COBA 2RREA 1KQ9A 3HHVA 4MZWA 2JZSA 2IGMA 4ZJZA 1YITI 4NHJA 2X8GA 4V1Ag 3IV4A 3E5UA 1MJ9A 1MBJA 4BEHB 5K5RA 3C7JA 1VF9A 5D5XB 1Z0XA 20GSA 4P3YB 4QPOA 1T00A 3H8QA 2XPVA 3UIWA 3HB9A 1GXQA 3GYHX 3PQKA 5CREA 5LHHA 2QCOA 4PJ0C 4RAFA 4W1UA 3U1KA 4GYGA 4QL9A 5JFRA 3KFWX 2OQRA 3E97A 2MH9A 3HOUJ 3FMQA 5C3EJ 3IH4A 1KYWA 1MDMB 2PMHA 3HOTA 1AIUA 3F4RA 4M3GA 4PZJA 5EEGA 1YW7A 4MP4A 4XM3A 1KNGA 2NNNA 3BCAA 4G0LA 2M4KA 3H9JA 5D6EA 1ZLKA 4J00A 4DVCA 3WT1A 1NHAA 1NHOA 2MC4A 1XX5A 3AL0B 1MBKA 1XOAA 5IOWA 2B1LA 1K6YA 2MC3A 3RKXA 4N4NB 2YP6A 1EOHA 1XSXA 4HYEA 5BS6A 2GZYA 1BI2A 1Q1VA 3GZNB 1RRJA 4XIDA 2CUEA 2F5VA 2QQBA 3GLXA 2ME6A 2H71A 4A69C 5E18F 4ZIJA 2B5XA 4EXJA 4EATA 4MA9A 1EEMA 1LFUP 1USBA 2XBQA 2X9DA 4WKWA 1IUYA 4IOCF 1ZG3A 2M46A 3D4TA 4XRMA 2ZCWA 1TK5B 5EG0B 2EK5A 1JJ8C 3FR9A 1Z91A 2V1XA 2QKLB 2FEZA 4UXNA 5HDKA 1VQLI 5IYDJ 3UOMA 1ILOA 5FT3A 4MFDA 4A3CJ 3I6AA 1UB9A 3NEUA 4A3IJ 2LTPA 3FXKA 4KSMA 3ULQB 5D5UB 3F6VA 2VL2C 4XMYA 4OO5A 1F37A 2KP6A 2YCDA 3L2RA 4MHGA 5FLVA 3F23A 3GX8A 1M2DA 3LW9A 2LP0A 2FHEA 1J2XA 3PGTA 4L5EA 1FWZA 4KH7A 4PXOA 3TP3A 4X1UA 5IO2A 4HNUA 3ROUA 2CG4A 1ACVA 1KU2A 1BI3A 5J9CA 3ERWA 2Y69H 3G7YA 2XPDA 2R7ZJ 3GA4A 4MLOA 2ZJPF 2ZNZA 2A4HA 1ERWA 3EUHC 4IHVA 4ML6A 2OF7A 5L3FA 1QO0D 5HLGA 5B7CA 4E8EA 4GLTA 2XB0X 2XVCA 3E0JB 4A3DJ 4ABZA 2CRGA 1KTEA 1GHCA 5HQPA 4L5LA 3ISPA 4FQGA 3WTYC 3H3VK 1VGLA 1LJ9A 4BYYA 2C3QA 2YV9A 3FYGA 4LLRA 4QL7A 2NS7A 1MSFC 3TEDA 3HOZJ 3F4TA 4QLCU 3OYMA 4UVAA 4XORA 4YRVA 2HS5A 3OSFA 1AQWA 2R37A 4MO7A 3V8LA 1DDNA 4KNYA 1R58A 2OZUA 5DQYA 2QC7A 1JJ6C 4IX7A 1B9MA 3AFHA 2E1MC 2OAZA 3NARA 2QEXI 2BMXA 2GZZA 3PR8A 6GSSA 2HKXA 1VQMI 2JA7J 1I1SA 4Q5SF 3I69A 3BP8A 6GSXA 3CJTB 4KICA 2RUFA 4MJCA 3CMAI 1R26A 4K5SA 5ECLB 3H5RA 2BY2A 3E3EA 4EIQA 3E9JB 3FZ4A 3A03A 4EL1A 2BGCA 3O6TA 4DSSA 1U3IA 4M3EA 4JEDA 5FD6A 3CUQA 2DSAA 3V7RA 3HPGA 1ZYEA 4KFCA 5KN3A 1JUSA 1Z6TA 2VC0A 1WI9A 4KN7X 4CCMA 1B4AA 3FMRA 1FP1D 1WCMJ 1K0AA 4NV2A 4KCEA 2IS1A 2FBKA 4C30A 2IEKA 1G3WA 2LSTA 2HOSA 1K61A 2AO9A 3BOAA 1BOAA 3ZQ7A 2K86A 1UN2A 1ZCPA 4POMA 1A2MA 1HOMA 2R0GA 3Q6OA 3KP8A 1X1DA 3QRFF 1JUPA 1OLTA 2WC2A 3EE2A 3N4MA 3FZ9A 4XL9A 1LE8B 2VCWA 3BT9A 3HOXJ 1FNNA 1R4NB 4IW9A 2VOOA 2DAOA 1DUGA 5IM9A 2LK2A 1MBFA 2DCEA 2L7MP 3K10A 3TDUC 5A4WA 3ZXSA 2LNSA 4MQVA 1YRNA 3T1BA 5JCGA 1WJBA 1UFMA 2AHQA 3EU3A 1OQYA 5J41A 3F6FA 3CCMI 4N11A 4JBBA 1SK0A 2LR8A 4G94A 4ZDPA 3S2HJ 2DA1A 2JPCA 4J01A 3PNVA 3JCUC 3ZFLA 2IRFG 2O7KA 4RM3A 2Z99A 1AQXA 4NPBA 1O8WA 4HLYA 4HW0A 3UNGC 4XTSA 1OKDA 2PMTA 1XGOA 2WY7Q 12GSA 2QA1A 5GAND 1AWCA 2DFIA 5ECSA 2BY0A 3H92A 3WTVC 1GDTA 2C3NA 2CVKA 4MABA 4XRSG 2LJKA 3TRPA 3LFLA 1QFNA 1RW1A 1BM9A 4AJ8A 1LDKB 3CCYA 4ON0A 1FB6A 2GIZA 2YU9J 2HZTA 14GSA 2EIQA 3HRSA 4I6XA 3LSPA 2OBPA 2MLGA 2RQQA 4JZQA 5M5WJ 2VCVA 2P8TA 2LG4A 4WF4A 3VWVA 4DSQA 1O7LA 2LF7A 2ES7A 1DE1A 2QWWA 3CMYA 3IV5A 1GH2A 3QPLA 2WA0A 2C6YA 1WP0A 1Z7PA 4Z2TA 3BROA 3FXUA 1XSDA 2AS5F 1CF7B 2V1NA 2Q1ZB 4D5CA 2YU3A 4HG2A 3J81K 2VJ4A 2ISYA 3K9TA 4JOMA 3GRXA 2ZXIA 3FXLA 4GXOA 5FFZA 4V2MA 1U5TC 4M73A 3KEOA 1XCVA 3P9KA 1SD7A 3N97A 1U3EM 1VQ4I 2H73A 2F4OB 2TRCP 2W25A 3HEFA 3S15J 4X4JA 1STZA 2VLVA 3Q19A 5ECIB 1MMSA 3P5JA 3FWEA 1GSUA 2FA5A 4A93J 2IIYA 4PFOA 1Y6IA 2MBSA 1W5CC 3BDDA 2O7OA 2ZNYA 2ZB9A 1BX9A 3MZYA 1VF2A 3L9SA 3HHHA 3VYUB 1EP7A 4IBPA 3ZP5A 5G1KA 1ONVA 1XS9A 3K4JA 4RGSA 3KE2A 3TCOA 1SD4A 4F92B 4EM2A 4JR4A 2V9VA 4RB2C 1XW9A 2HYFA 2LJAA 1IUFA 1YF1A 4GF0A 1GSDA 4WWCA 3H79A 3EMXA 5CYYA 3OYKA 4PURA 1PP7U 3MAKA 1T8IA 5L3BA 3DRNA 5CQGA 4C3JJ 4XICA 3K1MA 1WQ2A 2GQQA 2HGCA 3M1EA 3W2AA 3TKPA 4DQ2A 2H76A 2LD5A 2C80A 1AQVA 2EV0A 2KZVA 5B6MA 1GL8A 4ANJA 3C2HA 4PSWA 3PJRA 5FRNA 2PWJA 5F06A 4X43A 5DALB 2HDCA 3DGQA 2Y48A 1UAAA 5G2ZA 1LVKA 2LBFA 4IL6C 3SDGA 2FSWA 4WF5A 1T7PB 1MDKA 3GNJA 3GX4X 4TR1B 3HOVJ 1H4OA 2DTRA 3BZCA 1FEXA 4GDFA 4XS1A 3UARA 4I2OA 4AJ6A 5IIZA 1T33A 3EUKL 1BQ7A 4LMVA 3ASOH 3QAGA 4BQQA 2O89A 2P5RA 2VL2A 4F0BA 2CU7A 3CP2A 4M3DA 2JZTA 2WAEA 3WHBA 5GTHC 5IO0A 3A5IA 5KOXA 3ZL5A 3FMSA 3GXOA 2BHYA 1MGTA 2DODA 5BPIA 2QA4I 1SJZA 2OA7A 3WU2C 1TI1A 5D96A 1OVNA 3CYNA 3CESA 2OE1A 3GYKA 2WFCA 1OC8A 2F8AA 3ECHA 4DBQA 1R7JA 2UUZA 1GTAA 5M5YJ 1YJ9I 3EYTA 2ZXJA 3KCCA 2B3SA 1FAAA 2AB6A 3EUHA 2KL4A 4NAXA 2H1LA 3HHGA 5F6FA 3JRAA 1O73A 1B59A 2BEOA 1HF0A 2HYGD 5E8GA 1IAWA 1K0OA 4IO9F 5D93A 1JZRA 1PKWA 2DN0A 1MH3A 2BVLA 3BD2A 1R1TA 1XDSA 1WPIA 1GUUA 4ASNA 3HBLA 2EZIA 2ECBA 2K9LA 3FMWA 2D1VA 3IXRA 1ODDA 4ESBA 4HF1A 2STWA 1UA5A 3H4KA 3OL3A 1X2MA 1KONA 4G10A 1O3SA 2AXTC 3HVSA 1QA6A 3QR6A 1IDZA 3CCRI 2OC6A 3L78A 3SXYA 1E3HA 2FU4A 3HGYA 1KEBA 4XRSA 5TISC 3TDGA 2XAUA 3IUOA 3OOPA 4K0NA 3F0CA 1XWKA 1ZGWA 4XLEA 1GUHA 5GAGJ 2DA3A 2B5YA 2IWTA 4HJMA 5L3DA 2YNXA 1S6LA 3MD2A 1LJRA 1IXCA 5HLTA 2EFOA 4JX5A 4WXHA 3C8EA 3ZMZA 3M3YJ 3JCML 5FHIA 5IMZA 1POGA 1X1CA 2R5GA 4HLXA 4OMYA 1TRUA 4AM3A 4UVCA 4I6ZA 1YEPA 1VF1A 3ABUA 4DJAA 5ENUA 3VSKA 6GSTA 2L9RA 5BRTA 4KT6A 1Z9CA 4OIRF 2VIXA 2DFEA 3RPPA 1YO5C 1W5SA 2NRAC 2DU9A 4BHCA 1HXDA 3R2QA 2OV7A 2HU9A 4G6TB 3CMIA 1S8NA 4OU0A 1JE8A 4PDKA 4HQSA 3HJMA 2MMNA 4B8XA 3EU4A 1NK2P 4K5RA 1YTYA 3BG3A 3A01B 1V55H 2O5RA 3FDYA 2QENA 3QYEA 4B3AA 5GTIC 3IRRA 1E6BA 3DPTA 2C0DA 4DGWB 4FYBA 1V3FA 2R0PA 5CVIA 1QRYA 3D5SC 5FGMA 4NHWA 4AD9A 1HCRA 1FVKA 2CVDA 1BR1A 2BBYA 2F8FA 5DAKA 4P96A 1P4XA 1LKXA 3AG3H 3HZ4A 2YN1A 4U87A 1JI8A 2EZKA 5AIQA 4OWRB 5TJJA 1JT0A 5E20A 3I64A 4RLFA 1FG4A 2B1KA 5EDNA 4AWXB 2Y9ZA 5H6QA 3FHKA 2OTLI 1PA3A 3PL8A 4HX4A 4WXDA 4MF5A 5IP7J 2N5BA 2R5ZB 4AC0A 5C4XJ 5HDGA 3WTUC 1H88C 4YQUA 2BV6A 4MPGA 3L9VA 5M3MJ 1XDUA 1W36D 2HYXA 4L8EA 1H75A 2A2PA 1BI0A 1FW1A 2V41A 2P0WA 3ML6A 4CYCB 1SVMA 4FISA 5E1ZB 3MIXA 3WGXA 2IA2A 2BXZA 4I7HA 4XQFA 2DYSH 1Y8QB 1AKHA 1FC3A 1ML6A 1BOBA 2X0LA 3A3TA 2OE3A 2BTOT 3HYPA 3GUSA 1BEDA 4NUBA 3IK9A 4Y7NJ 2EILH 2IJLA 4BUPA 3DWLE 3WD6A 3FXRA 5D6FA 2VBZA 2R92J 3CMMA 5J8FA 5IMAA 2IVMA 1BL0A 1B9NA
chains in the Genus database with same CATH topology
2JADA 1DP3A 2B6MA 3O3TA 1MMNA 3D4MA 3HVXA 3M1GA 2RLIA 2WDUA 1Z3XA 3LSHA 2IGOA 2E0QA 4Y33A 3ZQQA 3VPTA 5JCUA 5HNHA 1V40A 1EGRA 2ZNMA 2YV7A 3P90A 3GMFA 2KHPA 2BW3A 2MMOA 3L2QA 1PX7A 3PUBA 2H01A 4HPQA 4XR6A 5FRMA 3FZ5A 4XRAA 2CS3A 3CRTA 3KTBA 1A24A 2X99A 2VLAA 2HRAA 5J5NA 2MMAA 2JSZA 3VSLA 2OBKA 3OOUA 1Z6MA 2EC4A 4YQVA 4B48A 1JZWA 1GNWA 5G31A 1ZYQB 3CSIA 2AHEA 2FGXA 2IN3A 5C00A 3HD5A 1GSSA 1PMTA 2GZPA 3SWLA 4KDYA 1EZKA 5DDLA 2DBCA 4OWYA 1UELB 1A0FA 1G6WA 4BDYA 3KEBA 2A5WA 2DJ0A 1AW9A 5F0GA 1K0CA 3RTRA 3GSTA 1J09A 3VK9A 1LFPA 3OWTA 2H70A 2MZCA 2NDOA 1OAZA 3IOSA 2PGTA 4CDOA 5H5SA 2VJIA 2KHMA 5ELAA 1QU3A 3VDXA 3DD3A 1FVJA 3IAS2 3F3RA 2IS4A 5HFIA 1YX5A 2HVQA 1PL1A 3EPTA 4DSSB 4ZBDA 2A2SA 3VPQA 3KGKA 2IGKA 2Y0SA 4XS4B 3TOTA 2MD0A 3L0HA 3H9GA 4EE0A 3BCKA 4ZYAA 4PQHA 4NHZA 2FWHA 3M8JA 4NQWB 4MDCA 1F3BA 3K4LA 3OYGA 2KQRA 4RI6A 1T3BA 3ZGKA 1Z7RA 2UZ8A 1TXXA 2E2GA 1WFXA 3QOEA 1DGWY 5ECNB 3KZQA 4IP6A 3D0ZA 4Y4RA 2N5FA 4BL7B 4YAVA 3SEZA 3OYIA 1TK0B 1HD2A 4IQAA 4QQ7A 1GSEA 3P2AA 3MMYB 2Z2SB 2KLOA 1SENA 2HLSA 4C2TA 2WGRA 3RPNA 2PVQA 1A0RP 4PUAA 1WJCA 1WWJA 2O8VB 3RDWA 1Z9HA 4BQOA 1A23A 3EC3A 4RM2A 3OR2C 4LL4B 1F6MC 5ID2A 2GTUA 3W2WA 3AKZA 1GUKA 1A2LA 1TU8A 3OYFA 4CUGA 2M0MA 1F3AA 2DC5A 2YPMA 4YQMA 3M9JA 2R3XA 3GFKA 2CVBA 2VQHA 2CX4A 1Q4JA 2HE3A 3CTFA 3M0FA 3LSKA 5IPGA 2JA2A 4K2DA 2W00A 3FHNA 4KDXA 2LNTA 3DXBA 3ISOA 4PFPA 2OKAA 2B5EA 2J23A 2M4GA 3VWUA 2WADA 4I2UA 4TXOA 2HT9A