3I9V2

Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, oxidized, 2 mol/asu
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
178
structure length
178
Chain Sequence
FFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHLQVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAGKRLEEIELPGKCGHHVHEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the mechanism of respiratory complex I
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords NADH-quinone oxidoreductase subunit 1
total genus 46
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature ec 1.6.99.5: Transferred entry: 1.6.5.11.
pdb deposition date 2009-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01257 2Fe-2S_thioredx Thioredoxin-like [2Fe-2S] ferredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1590 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3i9v201
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3i9v202
2PWJA 1GLPA 1A2MA 4IN0A 4N11A 2GQLA 4OD7A 4YAVA 1AQWA 1V9WA 1MD3A 4TOPA 4GSTA 5J3RA 1KTEA 1PN9A 3DGQA 2OBIA 5CAXA 1OYJA 1W89A 4NWYA 5B8BA 3UAPA 3NZNA 1OC9A 2NBSA 4EC0A 2F8FA 1EP7A 4IGJA 7GSSA 4MH2A 1URMA 4FYBA 2E7PA 2AB6A 13GSA 1TOFA 2PU9C 5JWOB 5C04A 1OC8A 4K0NA 1EV9A 1Z9HA 2OE3A 4LLRA 4OFMA 2IWTA 2ZNMA 5ECHB 3F0IA 2MBTA 5DALB 1FVJA 3VFIA 1ZGNA 3IAM2 2R5GA 5ECMB 3UBLA 4AJ6A 4N30A 4ZBBA 2NPBA 1J0FA 1S3DA 3IA1A 1K3OA 1TRUA 3Q18A 2OBKA 1WRYA 1ZMAA 3W6GA 5IMCA 3H93A 1I9DA 4G9HA 3APSA 3HJPA 3MAKA 3RAZA 5EPFA 3QPMA 2B7KA 1O6JA 1SENA 2FWGA 1WWJA 2LRCA 1JZOA 4XIHA 2WULA 1QGVA 1XWBA 5LNKe 1OKDA 3KH9A 4GQFA 4CHSA 1T4ZA 5D8IA 2JL4A 2BJXA 5AIXA 5D9XA 4MZCA 2LTKA 3KXOA 1E6BA 12GSA 1PA3A 3ZMKA 4KH7A 1Y6EA 1ON4A 3IHQA 2DJ2A 4LA1A 4K1FA 4WBJA 5IO0A 1T00A 2JSYA 2LKUA 2DLXA 4KDXA 1RW1A 1J08A 2EC4A 1TK0B 4WR4A 1XW5A 1H4OA 5CP1A 2OJLA 3CRTA 2FWEA 4L0UA 2B5XA 2IJYA 4J2FA 3RHBA 2DJJA 1FB0A 2GSTA 1Z3EA 4DSQA 2OE0A 3L9VA 2WDUA 18GSA 2H19A 5CNWA 4D73B 4OO5A 3QAGA 1FVKA 1SKSB 3ZREA 3MDKA 5G1KA 1WE0A 2CAQA 1XW6A 2AJQB 3D4MA 5ECNB 1SK2A 4ZL9A 3EE2A 2K6VA 1J9BA 5DJMA 3RBTA 5DJLA 2LNSA 4IJIA 1AUCA 3DWVA 1Q4JA 5GZZB 2CVDA 1TRSA 1WP0A 3HDCA 2EIOA 1NHOA 1DE2A 1GTAA 1M0UA 4E8EA 2P5RA 2VCQA 3FR9A 1JLWA 1WIKA 5IMZA 1XFLA 2JZTA 1A8YA 3FW2A 4XRDA 3GURA 4V1Ap 2TRXA 1XWKA 4HZ2A 1GLQA 20GSA 3TRPA 4EE0A 2HXKA 3TJFA 4I2UA 1PRXA 1JZRA 2M72A 4OFTA 4XS4A 1XIYA 4OFNA 1GL8A 4L5LA 2H66A 4GWRA 5DALA 4QL7A 5G31A 4I97A 3QFAC 1GUKA 2CVBA 1SJ6A 3TJGA 2C1YA 1U88A 2YNXA 5IMAA 1T1VA 2H71A 1GTIA 3M8NA 3HZ4A 3TOUA 2YN1A 3FZ9A 4IELA 2H1BA 5A5KA 4Q5FA 2VM1A 6GSXA 4ECCA 2XPDA 1ERUA 3G9BA 5ELGA 4POLA 3RPNA 5ID2B 1W4VA 2R6KA 3R2QA 2QGVA 1V2AA 3EWLA 2L4CA 4HS1A 5J41A 3LWAA 2WCIA 1G6YA 3KEBA 4ECBA 3DEXA 2O85A 4POBA 6GSVA 1XW9A 5D9TA 2GZZA 1JHBA 4ULXA 4JR6A 2R37A 3O3TA 3ZRDA 2VCZA 3N5OA 3FYGA 1SKRB 5IIZA 2FWHA 4PQIA 3US3A 2LSTA 4KUNA 4JEDA 3TKSC 2B6MA 2DMLA 2FHEA 2LJKA 5C00A 2J9HA 1R5PA 2FLSA 3F8UA 3ZFLA 2H73A 3IBHA 3A2XA 2C3NA 2GGTA 2JADA 2GSQA 1S3CA 4I2TA 4TR3A 3U5RE 5HQPA 1C72A 3N9JA 1XOAA 3FK8A 3G7IA 1EOGA 3EINA 4EDYA 3A5WA 3OR5A 1BYEA 4AF2A 3TRQA 1Y25A 1FG4A 3G7YA 1Z6NA 1UN2A 2TIRA 5IOXA 2KOKA 4LMVA 3TCOA 1AAZA 1FO5A 5G5FA 2G2QA 5KN0A 3VWWA 3GV1A 3KJYA 3UEMA 4PQHA 3ZITA 4YAPA 1M99A 1DE1A 2Z9SA 2H6XA 3D6IA 1GNEA 4KB3A 4RUVA 3BCKA 2KP1A 4K9ZA 3TKSE 1XPVA 4AJ7A 1DSBA 5IMFA 3TKQA 4OWYA 4MF6A 2YJHA 3FR6A 3VPQA 1M9AA 1GWCA 3EMXA 4GRFA 3CSJA 3M0FA 5KN1A 4XCSA 3LSZA 1TI3A 1YEPA 4MJEA 5ECLB 4N0VA 2LNTA 4ECIA 4AJ8A 5D9VA 5FWGA 4PNGA 1A24A 3L78A 4K0GA 4TXOB 1HNBA 5CO3A 3HA9A 1M2BA 2YZHA 1PGTA 1V58A 1AIUA 1B9YC 1GSFA 4BVYA 1BAYA 2B3SA 1XBSA 4YQUA 2VCXA 3ME7A 5AIVA 5J4UA 3F6DA 4YQVA 3LQ7A 3GKKA 1SL2B 1TJDA 4WEYA 1GSYA 3APOA 4RQRA 22GSA 4WBRD 3KP9A 3HJOA 4GCIA 1SYXA 1SL0B 2ON5A 4MABA 2JZSA 3TOTA 1AXDA 4ZL7A 2C0GA 1PSQA 4TRXA 1O7UA 1X5EA 5GAND 1VF4A 5CRWA 3A3TA 2FD3A 3RPPA 2WS2A 4JBBA 1TU8A 4GSNA 4GQCA 4PX1A 5E4WA 3F4SA 3M1GA 1HD2A 4K8MA 3CTGA 4F0BA 2LQQA 1XCCA 4DSSB 2C8UA 4GLTA 3ZTLA 3F3QA 2RUEA 5DAKB 5F07A 4OO4A 4IS0A 1GSDA 4PUAA 2H30A 3FHKA 3UVHA 2CAIA 3NIVA 4O5RA 4POMA 5CYYA 4ZILA 1B8XA 4PGTA 1ACVA 1N2AA 4G10A 4TR4A 2C0FA 2E0QA 2FA4A 4PQ1A 2WFCA 4MJAA 3GTUB 4WXTA 2X8CA 2HSHA 4GSSA 5ECSA 2M46A 1UC7A 3H8QA 3APQA 3DYRA 4V2LA 2B1KA 3ERGA 1OAZA 3H4KA 3ERWA 2HLSA 1QQ2A 1PX6A 2MBSA 1EEJA 2N5FA 1A0RP 2KP2A 2QSIA 4BVXA 5G1LA 4TKYA 3GSTA 3EVIA 1IYHA 3ME8A 5DAKA 3JCML 4I8BA 3LG6A 2GTUA 1EZKA 2I4AA 3E3EA 1F2EA 2NTOA 1G7EA 2KUCA 2YJ7A 2EIRA 4FH8A 3MNGA 4NPBA 5CREA 1YKCA 3QAWA 1SJIA 2HRFA 1G6WA 3CSHA 4HI7A 4OCEA 1TW9A 1YF1A 2H1DA 1O8WA 2OACA 6GSWA 1K0NA 4TVEA 4WF4A 16GSA 3HVVA 1K3YA 2PGTA 1F6MC 2AV4A 1YY7A 5ECPB 4IP1A 4IHUA 4AGSA 1V40A 4MK3A 1A2JA 2NDOA 3P90A 2FY6A 4ZBAA 3GH6A 1GSSA 3GKXA 5H5SA 2H6ZA 1XZOA 1K0CA 2XC2A 5EVOA 2CVKA 4O32A 1S3AA 3LORA 1SJZA 3IV4A 1TXXA 3PH9A 2D2ZA 4CDOA 4E8HA 1OC3A 2VD1A 4XS4B 3PINA 1HQOA 3C8EA 1PX7A 4HZ4A 3KP8A 2RIIA 2P31A 3C7MA 4NAXA 3UL3A 1OVNA 1TRWA 4K2DA 3WYWA 1MDIA 1O8XA 1T4YA 1XVWA 1WOUA 2C4JA 3UMAA 1I5GA 4YH2A 5ABRA 2IIYA 3C1RA 1FHEA 2O87A 5L71A 19GSA 3TJBA 3UJ1A 3GKMA 1K0OA 4KNDA 5LCZA 4F03A 4KDYA 3D4TA 4NV5A 2KLXA 1O73A 1KEBA 1EP8A 1YDKA 1WMJA 3CTFA 4MF5A 1LU4A 1BQ7A 3WGXA 4H86A 2IMFA 1F3BA 5A4UA 1VF3A 2IPAA 5KEJA 2MMNA 1FW1A 3CBUA 4HEA2 3DKSA 1FB6A 1KBNA 3GSSA 3GH9A 4ID0A 5DDLA 14GSA 1EEMA 2H8LA 4XRAA 3DMLA 4POKA 2VLVA 6GSTA 2BTOT 4KSMA 1B9XC 1GNWA 3L4NA 2C0DA 5ENUA 2H70A 1R5AA 4WR5A 1YF0A 3FZ4A 5JCUA 3L9UA 1TK8B 4IVFA 1TI1A 2JSZA 5D73A 2IFQB 3F6FA 1R7HA 3GIXA 1M2AA 4V2NA 3ZVJA 3C73A 1PKWA 5A4WA 3EYTA 2LJRA 5HFIA 1YZXA 3AY8A 3IR4A 2K18A 1ERVA 3PR8A 5IMVA 3LGCA 3M3MA 2GZYA 3UOMA 3KIJA 4GTUA 3BOAA 8GSSA 1UVZA 5COHA 1TRVA 3FY7A 3E9JB 3HVSA 2GLRA 5KN3A 2GDRA 5HFKA 1RQMA 2CT6A 3Q19A 1HNAA 1ML6A 1UA5A 4KSOA 3F4TA 3I9V2 2H01A 1WJKA 2MMZA 3D5JA 3F3RA 5DCGA 2J23A 4DSSA 4L5OA 1A23A 2VLUA 4MJCA 4ILFA 5HFGA 2L57A 1V98A 2V41A 2HFDA 2LJAA 4F2IA 3ZYWA 5D93A 1E2YA 3DXBA 1X9WB 5CRDA 2B7JA 2RM5A 4KCAA 1CQGA 3FKFA 4KW6A 4EXJA 2C0EA 1PL2A 4KX4A 4KDUA 4IJ3A 2X8HA 3GNJA 4LL1B 4D73A 5AGYA 4JR4A 6GSSA 1PQNA 2LRTA 3VPTA 3EU4A 4ML1A 5B6MA 3F4RA 3GMFA 5AISA 4RI7A 3QCPA 1OE8A 4F82A 3HJMA 4TN8A 5IO2A 1Z5YE 4V1Ag 1EOHA 1ZOFA 1THOA 1G7OA 4NHWA 3CRUA 3FEUA 4J57E 3W8JA 5GSSA 4HJ2A 3WD6A 1M2DA 4L0WA 1SK1A 4HOJA 5ECRB 4P3YB 3WGDA 2VIMA 1XVQA 5JCGA 4XHMA 4KCEA 2VLTA 2F9SA 1ABAA 1U3IA 2ALBA 3KGKA 5DBQA 2AHEA 4ML6A 5ECOB 1Z7RA 2CZ2A 3TJKA 5H5QA 2CV4A 3F9UA 2IN3A 3TB2A 1X9MB 4FYUA 3VI7A 2R3XA 3CXGA 2GQMA 4HUAA 2DJ1A 4KE3A 1AQVA 2WB9A 2HZFA 4WF5A 2H0IA 3KM6A 3TDGA 2LV3A 1HNCA 2V6OA 1JFUA 6GSYA 2WJUA 3ZFBA 4HJMA 4MMMA 11GSA 5B7CA 2YWIA 2KHPA 4FIWA 2H75A 2GZPA 1FAAA 4V2MA 1TTZA 5ECKB 4OCFA 1X9SB 2VCVA 5IPGA 3WGEA 4PUFC 1GUHA 2IL3A 5FT3A 1ERTA 3KCMA 4MCUA 2YP6A 4PXOA 2K8VA 4XTSA 3ZL5A 2HYXA 2H72A 1OC9B 3F63A 2VL9A 3HCZA 1RK4A 2C80A 3FZ5A 3HVXA 3HYPA 4MF7A 5EY6A 2YOIA 4DEJA 3CSIA 2OA7A 2I9HA 2GSSA 4JE1A 3LYPA 3EMPA 4ZB9A 1DUGA 3KD0A 4MH3A 1PL1A 3DVWA 2RUFA 4OMVA 3P8WA 2O8VB 4HU9A 4X43A 3ZZXA 5GSTA 2I81A 5ECQB 4EDZA 1M7TA 1ERWA 3IE3A 2YWMA 1GULA 2LRNA 1DBYA 3QAVA 3VURA 1T3BA 3LEFA 4NXIA 4RQXA 3D22A 1SD8A 3VWXA 4HU7A 3I6AA 4I6XA 1QFNA 2YCDA 2VL2A 2E2GA 5G2ZA 3GX0A 1TK5B 3IAS2 4TXOA 2ON7A 3C71A 1JZWA 3LJRA 1TP9A 3DIEA 4N10A 1TDIA 2VCWA 3MSZA 2YWNA 4LL4B 5LD0A 4MPFA 2BMXA 3A2VA 2DBCA 1R26A 1SD9A 2GT5A 3BD2A 4EO3A 2XHFA 1ZYEA 1T8EB 2N5AA 2ES7A 4GF0A 2PPTA 3ZIVA 2FNOA 2V2GA 1PD21 2L5OA 3MWHA 2YV7A 4BA7A 1N8JA 1XWGA 1R4WA 2VL2C 3C1SA 2IMDA 3EC3A 2YANA 4ZBDA 4ZB6A 2GQKA 2HE3A 3UVTA 2DJKA 3IDVA 4EVMA 1USBA 1F37A 1AC1A 3GRXA 4FO5A 2IMEA 5HR2A 4I5QA 4ZXGA 5IQYA 3TRXA 3FRCA 3HY2A 2FGXA 3IK9A 3Q6OA 2FCHA 3BBYA 4NHZA 4O92A 3Q74A 5KN2A 2LUSA 2HRNA 2MMAA 1XXUA 3ERFA 4MZWA 2K9FA 5EL8A 1YKAA 1K0MA 3TKSA 1B4PA 3G7JA 5CRHA 4BL7A 2YZUA 2PN8A 4MA9A 2DJ3A 1EV4A 1BG5A 2VM2A 1GUMA 3QOUA 3P2AA 2HSYA 1K0AA 4K7NA 2DIYA 1M9BA 3RHCA 3O76A 2P5QA 2VL3A 4IW9A 3WT2A 1SKWB 1K3LA 3BCIA 3SWLA 4EL1A 4TR0A 2L6CA 4ISDA 2OE1A 4X1UA 2GS3A 3GX8A 5JCWA 1ILOA 4DSRA 2YWOA 5GAPD 1HYUA 2E2MA 1XWCA 1VGLA 1MDJA 1OKTA 2WGRA 5JWQB 3J7Yb 1ST9A 1K0DA 3KMNA 3KMOA 2F3MA 3DRNA 1X5CA 2VOCA 1O85A 2L4QA 2HZEA 1LJRA 4FYCA 5B8AA 1BX9A 1A2LA 2CX3A 4HQSA 4NV2A 4EF0A 2CQ9A 1V57A 3U6VA 2HI7A 3VWUA 3E0UA 2P0GA 3GYKA 1F3AA 4GXZA 2X64A 3GKNA 2O7KA 1U87A 3VI5A 1ZCPA 4K6XA 4ZIJA 1NSWA 4EKZA 3CMIA 1SYRA 4G2EA 3ZIJA 4XS6A 2B5YA 3TKPA 1U3AA 3KZQA 1ZZYA 3L9SA 1EGRA 2IMIA 5F06A 4MPGA 5IMDA 4BWQA 3GTUA 4XS1A 4O7HA 1T7PB 3QD9A 1A0FA 1NW2A 3UIWA 5HR1A 1GTBA 1AQXA 1QUWA 3GHAA 3GFKA 3O6TA 3H1NA 1THXA 2QKEA 3A2WA 1JLVA 2DJ0A 2R2JA 3HD5A 3I43A 5B6NA 2I3YA 1X0RA 5DQSA 1QXHA 4TXVA 2XPEA 1CQHA 2REMA 3J7Yk 3PGTA 2V1MA 3V1WA 1MDKA 1PKZA 4LMWA 2DSAA 2VO4A 2HT9A 2OADA 1XWAA 1SU9A 2A2SA 2K8SA 3K8NA 5J5NA 2JACA 2VCTA 2N5BA 3FR3A 2FA8A 1FOVA 4IBPA 3I69A 3IRAA 2FUG2 5ELAA 4RI6A 3ED3A 2PERA 4MLYA 1AW9A 3IXRA 4F9ZA 3UARA 2OKAA 1VF2A 3FZAA 4KAEA 4MZBA 3HXSA 5D96A 1GH2A 2PVOC 4NMUA 1BJXA 2H74A 1NHYA 2CA8A 2MYGA 2V32A 4L8EA 3WT1A 5A4VA 4K7OA 4TR1B 4ECJA 4KA0A 1F9MA 3CYNA 2I1UA 1Q98A 1O81A 2AYTA 2FWFA 3GA4A 5AN1A 4J56E 4N0ZA 2HZEB 4WETA 5HR0A 2A2RA 1TKDB 2O89A 1A8LA 2H0GA 17GSA 3D0ZA 4JZQA 3IPZA 3ISOA 4IQAA 3IOSA 3HHVA 3TKRA 3HZ8A 1MTCA 4YQMA 4PNFA 2X8GA 3VLNA 4CW9A 2GVPA 2V6KA 1WPIA 1GP1A 3NOFA 1K0BA 1YEXA 2YV9A 2ZUPA 3ZVJD 1EGOA 1IYIA 4QQ7A 1TU7A 2JU5A 2DC5A 3UBKA 3GN3A 4MDCA 2VD0A 3BJ5A 2H6YA 2MZCA 3KTLA 1MD4A 5G5EA 6GSUA 3SBCA 3QR6A 1B4QA 2ZCTA 2R4VA 3LXTA 2WRTA 5E59A 2F51A 1JZDA 4ZB8A 2EIQA 4JRRA 3L0HA 3M9KA 5IM9A 3LFLA 3TGZA 1YJ6A 5H5RA 2M80A 1MEKA 4Q5QA 2G0FA 3QMXA 4TW5A 4JU5A 1QK8A 4ACSA 2VUPA 5INYA 3GL5A 2LEGA 1Z6MA 4QL9A 1X5DA 2WZ9A 2AUVA 2H1AA 4IKHA 2GSRA 3VWVA 4MP4A 3KH7A 2H0HA 3IC4A 5DQYA 3GUSA 3H79A 3QDNA 5D9WA 2LS5A 4Z7XA 5ID2A 5IOWA 2DIZA 2QC7A 2PMTA 1NM3A 4BWSA 5IPHA 4HQZA 1QMVA 2L59A 1SL1B 4IQ1A 3DVXA 3W8SA 2NVLA 5F05A 1PMTA 4ZL8A 3LXZA 2B1LA 3QFBC 1GTUA 1XOBA 3EURA 1ZL9A 1ZYQB 2PBJA 1GSEA 4IP6A 4MJBA 5J9BA 2CX4A 2RLIA 1KNGA 2YPMA 4Q5RA 2VAFA 2XBIA 1LBKA 3TJJA 3LYKA 1Z7PA 3S9FA 2PVQA 2JZRA 5JWRB 4G19A 9GSSA 5FHIA 5HR3A 2A4VA 3M9JA 2GT6A 1VRSD 1VF1A 2MMOA 1GSUA 4WKWA 4DVCA 5CRGA 2XBQA 5F8BA 3VK9A 1OE7A 2TRCP 2X99A 3D21A 3KTBA 5DVBA 2CZ3A 4TR1A 3ZLPA 10GSA 3IK7A 1U6TA 5G30A 2L6DA 4Q5NA 2LQOA 1EWXA 1YQ1A 3DD3A 5J9CA 1GSQA 2B5EA 2DMMA 2L5LA 1SK0A 5F0GA 4KGIA 3GL3A 5DCHA 2AAWA 3P7XA 3EU3A 3HKRA 4PURA 4EUYA 2IMKA 1BEDA 2HNLA 4F0CA 2IFQA 3ZMLA 1G0TA 4HDEA 3TUEA 2F8AA 1B48A 1GRXA 2RM6A 2C3TA 1H75A 2H1GA 2C3QA 4X0XA 2PUKC 4BPYA 3RDWA 4K7IA 5ECIB 2H76A
chains in the Genus database with same CATH superfamily
1JTXA 2F2EA 4CH7A 3RI4A 2PWJA 2W00A 1YW9A 2NOGA 3HYIA 2FBKA 1GLPA 4UVAA 3FKJA 3WTZA 2LC2A 1JKPC 1A31A 1A2MA 4IN0A 4N11A 5IY5H 2W7NA 5LBQA 2O8KA 3WTYC 3VWBA 2X6YA 2XAJA 1FBSA 3F0CA 3MEXA 4KMUX 4M3FA 2GQLA 4D5FA 4OD7A 4LITA 2M1BA 4YAVA 1AQWA 1V9WA 4LB6B 5LHGA 1OYYA 2M4GA 5CVJA 4GYGA 3TMOA 1RESA 2EFPA 3LMMA 3BZKA 3CMYA 1MD3A 2PMZA 4TOPA 4PJLA 1XS9A 5GAEJ 4GSTA 2DA6A 1WGXA 2QKLB 4CCOA 3K1NA 5J3RA 2W4SA 3LA2A 4HPQA 2HSMA 2RGVA 3CJNA 3KP5A 5D8LB 1XD7A 3V7CA 1IG7A 1KTEA 1PN9A 3DGQA 2OBIA 5CAXA 2E5NA 1OYJA 1W89A 1AA7A 2Y9YA 3EDPA 4NWYA 1T95A 5B8BA 2A4HA 3UAPA 4PJJA 3NZNA 1IXCA 5ILVA 4F7ZA 1Y0NA 3MMYB 1OC9A 5DCFA 1SVMA 3IWFA 4BDZA 3WGHA 1P7IA 4NDLA 4GCVA 2BY1A 2K4JA 1IN4A 4JP0A 4S05A 2NBSA 4EC0A 2F8FA 1EP7A 2V4JC 4IGJA 2LKSA 4U0YA 7GSSA 3RPUD 3JW4A 1HQCA 4MH2A 1MH3A 1X1BA 4C30A 1URMA 4FYBA 2M7AA 5FKKA 2G9WA 2R7UA 2E7PA 3HOXJ 2AB6A 2FA5A 3R3EA 3J7AY 2KZVA 2JA6J 4PDKA 2DYRH 3G3ZA 2Y2ZA 5FD5A 1B72B 3DWLE 1EH7A 13GSA 4CCMA 1OC8A 5C04A 4YELA 4K0NA 1EV9A 2BHZA 1Z9HA 2OE3A 4LLRA 4OFMA 2ME0A 4QPQA 2IWTA 2ZNMA 1MNMC 5ECHB 2M8GX 3F6OA 3IKVA 1OR7C 3F0IA 2MBTA 5DALB 2M9HA 1I1GA 1FVJA 3EPTA 3VFIA 3MN2A 3RZOJ 1T56A 3CMMA 2WAQA 3FXKA 3F8FA 2DA7A 3IAM2 4M72A 5EEHA 1ZGNA 5ECMB 3UBLA 5KOXA 1SD4A 5E17F 4N30A 4AJ6A 4ZBBA 2IJLA 2IAIA 3Q0WA 3CCJI 2NPBA 1J0FA 1S3DA 3IA1A 1K3OA 1TRUA 3Q18A 3ZN1A 2Y0SN 2OBKA 1PYVA 3C2HA 4HNUA 1F36A 5AIPA 1WRYA 3K1PA 1CGPA 1ZMAA 4K5SA 3W6GA 5IMCA 1E3PA 4HX8A 1UFMA 3PNVA 2OF7A 3H0DA 1I9DA 3H93A 1YG2A 4G9HA 1OCOH 2HDWA 2EZHA 3APSA 2VONA 3HJPA 3GTQJ 3MAKA 3PL8A 1VFCA 5EPFA 3RAZA 4KT6A 5E8IA 3J81Z 1XSXA 2RVCA 4HDVA 1MMSA 3DP7A 3QPMA 2B7KA 1I6XA 2L5QA 1O6JA 1R58A 5BNGA 3AL0B 1TT0A 4HLXA 4E70A 1SENA 2OAZA 1WWJA 2FWGA 3JRIA 2N5FA 1FMVA 3MVPA 4CZCA 2LRCA 1FZPB 3S16J 2IXSA 3F6VA 3IH3A 4UB6C 5HDKA 5IP9J 2E36A 4OU0A 2XROA 1JZOA 2WULA 4XIHA 5LGTA 3K6GA 4Y13A 1QGVA 1XWBA 5KOWA 4DNCA 1NG6A 4KIGA 1T38A 2K85A 5F1RA 5C4XJ 5LNKe 2KRHA 4QLCU 2H8WA 2XB5A 1O4XA 1OKDA 3KH9A 4GQFA 2JQ7A 3KZZA 2HZTA 1OCPA 5K5RA 3O2PE 3DV8A 5D5VB 1T4ZA 5D8IA 1OISA 4CHSA 2JL4A 3H5AA 2Y0SA 3WHCA 2EZIA 5B1AH 2BJXA 4LIVA 2K9QA 5AIXA 5D9XA 1WPKA 4I2OA 3LOCA 4MZCA 3GWZA 4ENJA 2LTKA 5JWOB 3KXOA 2HOAA 1E6BA 1IN6A 4OIOF 12GSA 4YG2F 3HTUA 3CCQI 4OIPF 1G3SA 1PA3A 3ZMKA 4QIWN 4KH7A 3BG9A 2OTLI 1W36D 1Y6EA 4CGZA 1ON4A 3IHQA 1Z7LA 1W1WE 4LLNA 2DJ2A 4LA1A 5BMUA 1AKHA 3H3UA 3G73A 2DK5A 3EUKL 2V79A 4K1FA 4UUTA 4WBJA 1YX3A 2EFNA 1ZRCA 2I5UA 5ICFA 2MH9A 3FXLA 1Z21A 2XIGA 1K4TA 4UUSB 3D5SC 5IO0A 2NOJB 1T00A 3DF8A 2JSYA 2LKUA 2YPRA 3HHHA 4IHVA 2HKXA 2QGUA 2CG4A 4E6KG 3LL7A 3P7NA 4I01A 4EEFG 2DLXA 2FU4A 4KDXA 3FXRA 3VSKA 2CUEA 3E6DA 1XDUA 3M7GA 2HRKA 1LJ9A 1ODDA 3HOYJ 3GYHX 5EG0B 1RW1A 3UR3C 1J08A 2EC4A 1TK0B 2E5ZA 3F9KA 4WR4A 2DI3A 1H4OA 4XIDA 3KLOA 1XW5A 4EQQA 5CP1A 3CLQA 3RTRA 2FWEA 3IUOA 1XGMA 2OJLA 3CRTA 4BVYB 4B3AA 4HG2A 2RQQA 2WAFA 4L0UA 2B5XA 2IJYA 4RMNA 4A3MJ 4J2FA 1NTCA 2XASA 2DJJA 3BTJA 3RHBA 1T0FA 1GVJA 1FB0A 2GSTA 4Z2RA 1RC9A 1Z3EA 4DSQA 2OQRA 2OE0A 2WDUA 3L9VA 5J1UA 18GSA 2H19A 5CNWA 3BJ6A 2ECBA 2DMPA 5LD2C 3SEQA 5D5XB 1JI8A 4D73B 3PQJA 1X58A 4OO5A 4ZDLA 2BEOA 2R4GA 3BQYA 4ANJA 3VYTB 3GW2A 3G71I 1FVKA 1QO0D 3QAGA 1MKMA 3CP2A 1U5TA 4U7DA 1YS7A 2V1NA 2R5ZA 1SKSB 3H0GJ 1HSTA 2MLKA 2EV6A 3ZREA 1YIJI 4F3QA 3MDKA 1MGTA 4G94A 5G1KA 2BXZA 3CQZJ 3ZMZA 3I0TA 4B3XA 1H8AC 1W36C 1ACIA 1WE0A 1XW6A 4I0BA 1FNNA 3K69A 5GAGJ 2AJQB 1X1AA 3DLLF 3HC7A 3D4MA 3VOEA 5ECNB 5L3FA 1SK2A 4ZL9A 3HHGA 2CWEA 3EE2A 2LOOA 2DA5A 3MKWB 2LY9A 2DKHA 2MC4A 2F5CA 1FBUA 1R71A 1X1DA 2K6VA 1J9BA 5DJMA 4UUSA 3GTKJ 1A04A 3E6CC 3TP3A 3ZQ7A 4YIIA 4CCNA 4HNVA 5BOXA 1ZR2A 2IS2A 2LNSA 1X1CA 5DJLA 3RBTA 1CF7B 2BV6A 3PNYA 1MBFA 2R5YB 2PMZN 1HCRA 1AUCA 3DWVA 4IJIA 1Q4JA 5GZZB 4HSCX 2HXIA 3CCRI 2QUFA 2UV1A 2CVDA 2HYFA 1TRSA 1S9HA 1WP0A 3HDCA 3DBRB 3HZJA 1IV6A 3CD6I 2CW7A 2VOPA 2EIOA 2VQGA 1Z0XA 3NRVA 2CGPA 2OZ6A 1RIOH 2EV0A 3A2KA 1HOMA 4BQOA 1GTAA 1M0UA 1NHOA 1D0XA 4E8EA 2EPFA 2F5DA 3EETA 2HZDA 2I8DA 2WV0A 3TW7A 2P5RA 2VCQA 3BG5A 3J7ZI 3FR9A 1HKTA 1JLWA 3I71A 1TWAJ 2ZJPF 1W0TA 1WIKA 2H27A 4ON0A 3D1NI 3DTKA 2KJCA 4BBSJ 1A8YA 2L2OA 1XFLA 4L18B 4KITB 2JZTA 3FW2A 2XRLA 1HC8A 3GURA 5BMZA 2QQ9A 3PO3J 1I5ZA 2FRHA 1TQPA 2XRNA 4B09A 3FMWA 4BXUA 2HU9A 4RGRA 3BTCA 5CVRA 1JXSA 3LSIA 4V1Ap 3ZRGA 2Y30A 1K78B 2E1OA 2VKEA 1XWKA 1GLQA 20GSA 2TRXA 4HZ2A 2O8XA 2XC7A 2VC0A 3TRPA 4EE0A 4RM3A 2DK8A 2KP6A 1MNEA 1NK2P 3K10A 2HXKA 3TJFA 4ZTJA 1PRXA 4I2UA 1Z6TA 2LKPA 1TW2A 5K1YA 1UAAA 1OLTA 3M8EA 1JZRA 2M72A 4OFTA 1D0YA 1OJLA 1D5YA 3N4MA 1SAXA 1MJ9A 4XS4A 1BIBA 3KFWX 4CHUA 1XIYA 4I0AA 3GTMJ 4OFNA 1GL8A 1MMDA 5FRNA 1H89C 4L5LA 4Y52J 2ZBKA 1H0MA 4A3GJ 1VQOI 2H66A 1S7AA 2PEXA 3IL2A 1WJDA 3PIPF 1VQ5I 1FEXA 4GWRA 4QL7A 5G31A 5H2FC 4I97A 1FOXA 3K9TA 3QFAC 3MFKA 4AVZA 2VN2A 1GUKA 2CVBA 5M5XJ 1ORKA 1ZLJA 1SJ6A 3TJGA 4CO8A 3HSRA 2C1YA 1U88A 1W7PD 3FBIB 2DOEA 2VKDA 4FASD 3S3MA 3FISA 1VZ0A 1T1VA 2YNXA 3SZPA 3CJRB 2B7EA 3J81K 2H71A 3I56I 3BT9A 4L9TA 4B47A 3BTLA 3OWTA 2CJJA 1GTIA 4ENNA 3M8NA 3TOBA 2NS0A 3RQ4A 5LHHA 1T98A 4WK8F 3HZ4A 2QVOA 3DLAA 4BE1A 2VJJA 1ONVA 3TOUA 2YN1A 4AIHA 3FZ9A 4IELA 2H1BA 5A5KA 3OY9A 4IHSA 5EZHA 2M87A 2CQKA 3B73A 4Q5FA 1RKWA 3HEFA 1U9OA 3FBNB 2VM1A 2CUFA 2O0YA 2E2IJ 2DA1A 6GSXA 4RB3C 1EV7A 4ECCA 1E3OC 2XPDA 2XF7A 4AWXB 1FOKA 1ZRFA 1ERUA 2A5YB 3C7JA 4L0ZB 2HKOA 4P55A 1R1TA 2A05A 3G9BA 5ELGA 4POLA 4V2FA 3RPNA 2EILH 3OYEA 3IRRA 1JKRC 2LMDA 3H36A 3TQNA 2E1CA 1Z67A 5ID2B 1W4VA 2R6KA 2IGMA 3R2QA 5IOWA 2QGVA 1V2AA 3EWLA 2L4CA 1GV2A 3GEZA 4HS1A 5J41A 3LWAA 1ZG1A 5FRMA 1G6YA 3WU2C 1FYLA 2DTZA 3CESA 2WCIA 2QENA 3ZPLA 3KEBA 1G3YA 5J1YA 4G0IA 5F64A 3COAC 2OQGA 3DPTA 2GXBA 4ECBA 1YJWI 2O85A 3DEXA 2XGCA 5B66C 4POBA 2HXOA 2VJ4A 2LYCA 2HRAA 6GSVA 2FSWA 2EIKH 1YITI 3S2HJ 1XW9A 2CSOA 3R60A 2GZZA 5D9TA 1JHBA 1GXQA 3K4JA 2PJRA 4ULXA 5ILUA 5LEKA 1VQKI 3I59A 4JR6A 4L9VA 4JX4A 2R37A 2LK2A 1VQ6I 3O3TA 3GFJA 2JTVA 1SMYF 3ZRDA 4BJ6C 5M5YJ 2VCZA 3RSNA 2X49A 3N5OA 4B48A 3ZCOA 3FYGA 4ETSA 5BPDA 1ZGJA 5IIZA 2CH0A 1SKRB 2FWHA 4PQIA 5EEAA 4WXDA 2LY1A 4CCJA 1MBKA 4EJWA 1U3EM 3QYEA 4Q48A 2OA4A 3KIOA 5M3FJ 3JRAA 5TRDA 2OPTA 2P6TA 2QM3A 5HS8A 1JGGA 4LIUA 3SFZA 2CV1A 3US3A 5F04A 4D9JA 3V8JA 2A61A 4P96A 4AD9A 3RJPA 3GFLA 3RKXA 2LD5A 1TLHB 3W6VA 2LSTA 4JEDA 4KUNA 1MDMB 3FHNA 2B6MA 3TKSC 4M6YA 2GBYA 3IKTA 2DMLA 4HQEA 2FHEA 1A6QA 1MBJA 3DBHB 4M3GA 4BQNA 2LJKA 4HV6A 4KNYA 4XLEA 1A6IA 5C00A 2NNNA 2J9HA 3ASNH 2HQAA 1R5PA 2JWTA 3B02A 2FLSA 3F8UA 5CQEA 5KNLA 2QF7A 1LEBA 3ZFLA 3E97A 4A6EA 5C4JJ 4D7MA 4YIFA 1YJNI 2H73A 3BJOA 3IBHA 1Z05A 3A2XA 2C3NA 3M9AA 3E6BA 4HOBA 2GGTA 3IRQA 2GSQA 3OYJA 1S3CA 2JADA 4I2TA 4TR3A 4FE7A 4U0VA 3U5RE 2ZJ2A 5HQPA 1C72A 3N9JA 5GAHJ 1XOAA 2L9SA 3FF5A 1GDTA 3FK8A 3G7IA 1EOGA 3EINA 3KYLA 4EDYA 5EF6A 2UWMA 2M34A 4Q47A 5IPAA 3A5WA 3OYDA 3OR5A 1OPCA 3C2GA 3JTHA 1PUFA 1BYEA 3QODA 4AF2A 3KYCB 3TRQA 3NWTA 1B72A 1Y25A 1FG4A 1VQ8I 3I59B 4ZTFA 4U87A 1LKXA 3G7YA 1Z6NA 3CUOA 3ZVJA 4L5JA 3VYUB 5E3NA 3F21A 4J00A 3LSKA 3GTLJ 2COBA 2IEKA 1UN2A 2TIRA 2CFOA 2X6WA 2AS5F 2R5ZB 2JMWA 5IOXA 2KOKA 3A03A 4MIMA 4LMVA 1I27A 3TCOA 3QP6A 2PX9A 4IZZA 2HOSA 2P6SA 1AAZA 5F0HA 1FO5A 5G5FA 3JR9A 3OR1C 2X4AA 3H35A 4YFKF 2G2QA 1TWGJ 4O5QA 2NYXA 4A3JJ 5KN0A 4EIPA 1JT6A 3MWMA 3GMEA 5KK1A 1FWZA 1ZYRF 2X6XA 3JSPA 3VWWA 2VXZA 2YUSA 3ESWB 3GV1A 2HVRA 2O6GE 3KJYA 3UEMA 1AOYA 3B6CA 1W5TA 1O3TA 2JPBA 3MZYA 5D6EA 3K2AA 1F1ZA 3WTTC 1PP8F 4PQHA 3ZITA 1LE8A 4YAPA 1M99A 1DE1A 2Z9SA 2OUMA 2H6XA 2HEOA 4XKVA 3D6IA 5DM7F 1GNEA 2F5VA 4KB3A 3V7SA 4AC0A 4RUVA 1AHDP 5DD8A 3DTEA 1H88C 2EFOA 3BCKA 2DMTA 1J09A 1LDJA 1U8RA 1OYIA 1SEUA 3W2AA 3JRGA 3K7AJ 4A3FJ 2ZC2A 2KP1A 4K9ZA 3OOUA 1VI0A 3G4SI 1EJ9A 3TKSE 4A6DA 4Q5SF 2ELHA 4JQFA 1XPVA 2XF5A 4FCYA 5KCMA 4YFXF 2ID3A 1ZGWA 5EZGA 3GFMA 4AJ7A 1DSBA 4O3MA 1X3ZB 2QCOA 5IMFA 3TKQA 4OWYA 2E71A 2JVGA 4I02A 3U1KA 2YJHA 3FR6A 4MF6A 4BAYA 1N75A 5JR3A 4DQ2A 3VPQA 1M9AA 1GWCA 3EMXA 4GRFA 5CKTA 4G7HF 3CSJA 3M0FA 3FIWA 3HDDA 5KN1A 4XCSA 2P5KA 4AVPA 3L2CA 1YLFA 3HSEA 3LSZA 1TI3A 1NH3A 3HOUJ 5BRTA 4RAYA 3SZTA 1YEPA 2EIJH 4MNNA 4MJEA 5ECLB 2IP2A 3R0AA 1IN8A 4IXAA 2LNTA 4N0VA 4AJ8A 1IJWC 4ECIA 4Y3OA 2QQAA 1JJ6C 3NQOA 5D9VA 5FWGA 2JUGA 1E2XA 3ABMH 3V4GA 1Y1WJ 3RYPA 5FB2A 4PNGA 1A24A 5DDGA 5J4YA 3L78A 3HKZA 1DP3A 3FXOA 2JJ7A 3Q5FA 2KKOA 4C2UA 4ZJZA 1SC7A 1TNSA 1Y56A 2LLKA 4K0GA 4TXOB 1HNBA 5CO3A 2COMA 3HA9A 2MC3A 1XCVA 1M2BA 1OCTC 2YZHA 2G7UA 4KFCA 5E3OA 1PGTA 1V58A 4OIQF 1AIUA 1B9YC 1N25A 1GSFA 2IT0A 4BVYA 4KIFA 1BAYA 1KGSA 2B3SA 1XBSA 1Z9CA 4YQUA 4MNUA 1E0EA 5E3MA 2VCXA 3ME7A 5AIVA 3H9QA 5J4UA 3DBLB 3F6DA 4NC8A 4YQVA 3LQ7A 1WFXA 4EM2A 3MZ8A 5CQGA 3GKKA 1SL2B 1TJDA 4WEYA 3DTIA 2J5PA 2W84A 1GSYA 3APOA 1KU2A 4RQRA 3SZGA 5K5QA 22GSA 2HFHA 4WBRD 3HBLA 3KP9A 1XSVA 2DMQA 2GXGA 3F22A 3WGIA 2ADUA 4NQWA 2HTJA 5HVQC 3RPUA 3CCMI 4RDUA 4GCIA 1JUPA 1R1UA 2HTSA 1SYXA 1SL0B 2ON5A 3ZN0A 4MABA 2MGQA 4XN0A 3ZQFA 1J59A 2JZSA 3TOTA 1AXDA 2Q2EA 2DJNA 4ZL7A 2C0GA 4U0WA 1PSQA 4K5RA 2R5GA 4ZZLA 1YQAA 4TRXA 3I54A 4HF0A 1O7UA 4N0BA 4HDUA 1X5EA 3WG9A 1ETQA 5GAND 1VF4A 5CRWA 4MHGA 2X9DA 4XMYA 2WAQN 3A3TA 2FD3A 3RPPA 3FMSA 2WS2A 1OFCX 1BOBA 4JBBA 1SD5A 2VPRA 2M3AA 1Y8QB 2W57A 2UZKA 1TU8A 4BY1J 2GQQA 3CQFA 4GSNA 4GQCA 3TDZC 1U2WA 4PX1A 5E4WA 4IEJA 1MMAA 1SAUA 1TWFJ 3F4SA 4AUXA 1HD2A 3M1GA 1T08B 4K8MA 4CY6A 4PCQA 3CTGA 1FPQA 4F0BA 2LQQA 1XCCA 4DSSB 3BZ6A 2VQCA 2HDCA 4FT8A 3WG7H 1ETYA 1WJBA 3HB9A 3FM5A 3D0SA 1APLC 2C8UA 4GLTA 3ZTLA 3F3QA 1WJEA 2RUEA 5DAKB 5F07A 2A68F 2MFZA 3QYFA 4OO4A 3RPQA 1VTNC 2WC2A 1STZA 4IS0A 3CDHA 4IRIA 1GSDA 4PUAA 2H30A 4N4NB 4IJAA 1M3JA 3FHKA 3UVHA 5EEGA 2RV8A 2CAIA 3NIVA 1MDMA 4TV7A 3GTPJ 4G0KA 4O5RA 2W85A 4POMA 3LQQA 1UELB 5CYYA 1S3JA 5DUKA 4ZILA 2MSYA 2JA7J 3JRDA 1B8XA 2JK3A 4PGTA 5ERIA 4BQAA 1ACVA 1N2AA 2N8GA 4G10A 4TR4A 2C0FA 3D5RC 2CV0A 4GDFA 4DYRA 2E0QA 1PN0A 2XV4S 3FDYA 2FA4A 2WFCA 1O7FA 3GTUB 4MTDA 4MJAA 2WB1A 5K7ZA 2LVSA 3FM3A 5BS6A 4WXTA 3OYGA 4XICA 2B0LA 1FBQA 5D8KB 2X8CA 4IRGA 2EJRA 1RR8C 4FX4A 2HSHA 1YIOA 1R6RA 2JT1A 2GXAA 4GSSA 3F8CA 2MLGA 5M3MJ 5ECSA 1J2XA 1MBGA 2M46A 3H5RA 1UC7A 3CP8A 4EM0B 2JA2A 4A3DJ 3KZIC 4XSZF 3H8QA 3APQA 2JN6A 3DYRA 4V2LA 2BXYA 1AKHB 2CUZA 4F91B 2B1KA 3ERGA 3QQAA 1OAZA 5IT9Z 5D6FA 3HUGA 3P9IA 4WF2A 1ETVA 4BGDA 4A3LJ 3TP0A 1ZG3A 2STWA 3H4KA 1F9NA 4HBLA 1IGNA 3ERWA 3V8KA 2HLSA 2R0PA 4JYKA 4E7JA 2ECCA 1QQ2A 1Q1HA 2KMUA 2NVTJ 2VQLA 4EIQA 1PX6A 3I3LA 3MKLA 1EEJA 2MBSA 1B6AA 2YX7A 1A0RP 4KJZA 4A3BJ 2DU9A 2KP2A 2AHQA 1RZ4A 4CYCA 2QSIA 4F03A 2KIFA 2IS1A 2QA2A 4BVXA 5G1LA 4G9YA 2QSHX 4TKYA 4BE2A 3ULQB 2VBXA 4EV0A 3GSTA 4M74A 1FP2A 5LRRA 2CW8A 3EVIA 2NS8A 3KP7A 2VKHA 4C3HJ 1IYHA 2PG4A 4P9FA 1I39A 1HA8A 4FISA 4XOPA 3ME8A 2FQ4A 5DAKA 1MSEC 2L9NA 2CO5A 3JCML 4I8BA 2A6TA 5LLQA 1FLIA 3LG6A 4KF9A 2GTUA 3HIFA 2CAQA 1EZKA 1C0WA 2DA2A 2I4AA 4E7LA 1JHHA 3AAFA 3SEZA 4DIQA 1IAWA 2ISZA 3E3EA 3S93A 2IVMA 1IW7F 4IQ4A 3LSGA 1ETWA 2Z16A 1IXSB 2V7FA 1F2EA 2IRFG 2NTOA 4XL9A 1O3RA 2KUCA 1G7EA 1VNDA 4G6DA 2YJ7A 2EIRA 4KT5C 2LG4A 2D45A 3MNGA 4FH8A 4NPBA 2H09A 4XLNF 1G3WA 1PFOA 1Z1DA 5CREA 1YKCA 3QAWA 3P9CA 4X4JA 4I09A 4A12A 5FROA 3RKYA 1SJIA 2IGKA 4PUSA 1G6WA 2HRFA 4A69C 3CSHA 1WWXA 4XR6A 4HI7A 4OCEA 2ZNZA 4LLGF 1XN7A 5LFAA 1TW9A 3KEQA 4IL6C 2R7TA 1YF1A 4OAYA 2H1DA 1O8WA 2OACA 6GSWA 4ASNA 4YKFA 1K0NA 3F8NA 4BBRJ 2DA4A 2FXAA 5DD4A 1TC3C 1IDYA 2BZTA 2TCTA 3M8FA 1X19A 2DFIA 1EKEA 2GOMA 4LLLA 4TVEA 1QNTA 3ZXSA 4IQJA 2XHKA 4WF4A 2H94A 2LH9A 1LDKB 16GSA 3HVVA 1EH8A 1K3YA 1HDPA 2NVYJ 4BVXB 1ZARA 2LRDA 2PGTA 1F6MC 2KDOA 2AV4A 1YY7A 1WI9A 1ZG5A 4MFEA 5ECPB 1HW2A 2YSRA 3E7LA 4IP1A 5TISC 2EA4A 4A0YA 1A36A 4IHUA 3K70D 4AGSA 1V40A 3RQIA 4MK3A 2BVLA 2QLZA 1A2JA 1GXPA 4G8XA 1BOAA 1HW1A 2XPVA 4CICA 4BNCA 2NDOA 2FY6A 3P90A 3MKZA 4ZBAA 2EK5A 2W24A 3IWZA 4AIKA 1WRJA 3HVNA 3GH6A 2VASA 5E20A 5DM6F 5GTHC 1GSSA 4ZYDA 3GKXA 1O3SA 2OBPA 1D1AA 5H5SA 2H6ZA 4MFDA 2WY7Q 1KA8A 1YW7A 3GLLA 5ICCA 3J7YJ 1W7PB 1TBXA 1K0CA 1XZOA 4XRSA 2Q0OA 2W82A 5HLHA 2O5RA 5EVOA 3VFZA 2CVKA 2HDDA 1D1CA 3MD2A 3AG1H 4O32A 3X2QH 1S3AA 3ABUA 3T8TA 1HW5A 4M71A 3MZHA 3LORA 4CYDA 2IA1A 3ABKH 1SJZA 2IGNA 2PI0A 3FXUA 3OYBA 3QPLA 1TXXA 3IV4A 5KAFC 1XMAA 4FQGA 1KQ9A 1OMIA 2CQQA 4N4OB 4CDGA 2VBZA 3HOVJ 1X3WB 2VB6A 3R4KA 1OC3A 3C18A 1MD0A 4LG0A 1OKRA 2D2ZA 1SFEA 3DU5A 4HYEA 3K4LA 2VD1A 4XS4B 1OCRH 2WA0A 3K2ZA 4M6XA 3PINA 1HQOA 3C8EA 4XORA 1YO5C 2E7XA 1PX7A 1HSJA 4HZ4A 2VJ5A 3AL0C 5GP9A 3KP8A 1IUFA 4M73A 2H1LA 2L4AA 1USTA 1XG1A 3BZCA 1EA3A 2VL8A 2HI3A 4CXFA 2P31A 2RIIA 3C7MA 4NAXA 1NHAA 2A3SA 2IPQX 3UL3A 1HKQA 1OVNA 3W2VA 4EJOA 1TRWA 1M1EB 1ZYPA 4K2DA 3WYWA 1MDIA 1WHUA 5HDNA 2KRCA 1O8XA 1T4YA 1B59A 1XVWA 5DS9A 5JVGF 2VPLA 4BHCA 5FLXZ 2WADA 1WOUA 2E19A 1UHSA 5GTIC 2C4JA 4ZC3A 1H9TA 1ON2A 3KX2A 3LSMA 3NAUA 4A3CJ 3UMAA 1ON1A 1R00A 3TOAA 1I5GA 2K7LA 4YH2A 5ABRA 2IIYA 2NVXJ 3LAJA 3C1RA 2KPMA 2XGDA 5GPAA 3DQVC 1FHEA 2O87A 1MZBA 5L71A 2ETHA 19GSA 3TJBA 4UB8C 3UJ1A 5JLWA 3GKMA 1FTZA 3DEEA 3BG7A 1ENHA 3S17J 1K0OA 2MW8A 2XGXA 5E3LA 4KNDA 2XUBA 1SVOA 3CC7I 1T2KA 3IC8A 2GIZA 4FETA 5LCZA 1F5TA 3BG3A 1Z77A 1IRGA 1O7LA 1W4MA 1BJZA 1QRYA 2D2WA 3I53A 3OYCA 1QQIA 4KDYA 4Q4ZF 2M8EA 3D4TA 4NV5A 5IT3A 2KLXA 2R7ZJ 1O73A 3KEOA 1B9MA 3CC4I 1KEBA 1EP8A 1R9TJ 5J9BA 1YDKA 3E5QA 2NVUB 4D7NA 1WMJA 2F4OB 3F3XA 3CTFA 5ILSA 4MF5A 1LU4A 1DGRM 1P4AA 2WB1N 1BQ7A 1QBJA 3WGXA 2VC1A 5DTDA 4H86A 1ITYA 3W6KB 1F3BA 2IMFA 4Y4RA 3HKZN 5A4UA 2GOXB 4U7BA 3S14J 4I6ZA 1BW6A 1VF3A 2IPAA 5KEJA 1P4WA 2Z3YA 3WHBA 4QPOA 1XG8A 1R36A 3PUBA 5FGMA 4XQFA 1IDZA 2MMNA 2LSOA 2XB0X 3WE2A 2R7VA 3IC7A 1FW1A 3CBUA 3CMEI 1B8IB 1T0FC 2DPUA 4HEA2 5IOZA 1I6HJ 4PJ0C 3BP8A 2AXLA 3K4CA 3DKSA 1UB9A 1FB6A 4HAMA 1LQ1A 1J9IA 1KBNA 2DQLA 3Q9SA 3GSSA 3GZNB 3GH9A 1HXDA 4AM3A 4MQVA 4CCKA 2V9PA 4ID0A 4G6TB 5DDLA 14GSA 4WXCA 1EEMA 2VE8A 4P5OA 2H8LA 5DV5A 4DZJA 1H9GA 5K5OA 1BW5A 3DMLA 1LDDA 2BYVE 3TDUC 4POKA 4XRAA 1QHHD 1S3RA 2E60A 2VLVA 6GSTA 1XGOA 4YRVA 1D8KA 2BTOT 4KSMA 3GVAA 4H0EA 1B9XC 1GNWA 3L4NA 5EJCA 4ENMA 4X6AJ 2C0DA 5ENUA 4G6QA 1T6SA 2IBDA 4A3KJ 2R7RA 2H70A 4BY7J 1R5AA 4WR5A 4N9IA 1YF0A 2Y31A 3FZ4A 2X51A 4BU2A 2R5YA 5JCUA 2JRTA 3L9UA 3CF2A 1TK8B 4IVFA 3FK6A 1TI1A 2JSZA 2IFQB 1QPIA 2XPWA 5D73A 4MJBA 3IV5A 3F6FA 1R7HA 3GIXA 4RS8A 1I3AA 4BL0B 3C1DA 5KVRA 3GZ5A 4UNOA 1M2AA 1SD6A 2AO9A 2L0KA 3K0LA 3Q0UA 4X0GA 3GZ6A 3C73A 2WTEA 3KE2A 3H5NA 1PKWA 2XAFA 3T8RA 5A4WA 3EYTA 2RNGA 3BG6A 2LJRA 3E1SA 2YU3A 1QU3A 3FXJA 3EYYA 3JCUC 5HFIA 2ZSIB 3OYHA 2WWYA 3HPHA 4LJZF 1F4KA 1YZXA 3AY8A 2DO7A 4KICA 3IR4A 4NC7A 2BW3B 1IO2A 2XF6A 1R22A 1ERVA 2K18A 3PR8A 2QQBA 2UXNA 3DKYA 3O3KA 3OOPA 2ZMEB 4HW0A 3LGCA 3M3MA 1XC5A 2GZYA 2DFHA 3UOMA 2DBBA 3HRSA 1DDNA 2P0WA 2FBHA 3KIJA 4GTUA 1BJAA 1UG0A 2UUZA 1S7EA 2MA3A 4C9YA 3E5UA 1FOYA 1IF1A 3BCAA 5TJJA 3BOAA 8GSSA 3FHZA 2XSJC 1ETXA 1UVZA 1IN5A 5COHA 2A69F 4RM2A 1YOVB 1UMQA 3BOQA 3F8BA 3S2WA 1TRVA 5E1ZB 4HNTA 2NS7A 3CUQB 3E9JB 3FY7A 3HVSA 1VQNI 2GLRA 2Q2EB 3TGNA 4FX0A 3OYIA 5KN3A 2GDRA 5HFKA 1R5HA 1TTYA 1RQMA 2CT6A 3Q19A 1HNAA 1ML6A 1QHGA 1UA5A 4KDPA 2M4KA 4KSOA 3L9FA 1R7JA 3S3NA 3I9V2 1PUFB 3F4TA 2H01A 1WJKA 2EFQA 3DKXA 3HSFA 2O03A 3HRMA 5F6FA 3RZDJ 2MMZA 3D5JA 1XPXA 3F3RA 5DCGA 3BR0A 2J23A 3ISPA 3KEYA 4D1QA 2CQNA 3I4PA 2VBYA 4DSSA 1N77A 2ZKZA 3VODA 2LF7A 3LSPA 1WQ2A 5CVUA 2ZXWH 1A23A 3EQLF 5A2QK 2VLUA 4L5OA 5CLSA 2XPUA 4ILFA 2FE3A 2ZMEC 3VPRA 1P6RA 2L57A 4MJCA 4O5UA 5HFGA 2Y75A 1V98A 2L02A 2V41A 2HFDA 3RDIA 2QA1A 5AONA 2LJAA 4F2IA 4HSRA 2ELKA 4ZYAA 5EG0A 3ZYWA 5D93A 1E2YA 3DPLC 3CCVI 2K9LA 4HRIA 3HL2A 3DXBA 4HF1A 4BYYA 2L4MA 1WI3A 2WY8Q 5B5EC 5CRDA 2B7JA 1X9WB 5L3BA 1UCRA 4B8XA 2HOEA 2RM5A 4KCAA 4C3IJ 4ZZDA 1CQGA 2O61A 3FKFA 4KW6A 3N05A 2DODA 2RKHA 5E8GA 4EXJA 5HOOA 2C0EA 1PL2A 4KX4A 3CMAI 5E18F 3BROA 4NC6A 4IHYA 4XLAA 4KDUA 4IJ3A 4MTEA 1P2FA 2X8HA 2Z33A 3GNJA 5IMVA 3OS1A 4LL1B 5AGYA 4D73A 4JR4A 2KL4A 5HDGA 5LHIA 1U0JA 6GSSA 1DPUA 1BL0A 1OCZH 4XKBA 1WJAA 5F0CA 5LEJA 1PQNA 2BVMA 2KRFA 3BR2A 5H6QA 2LRTA 3VPTA 1QPMA 3EU4A 1P7JA 4ML1A 5B6MA 1GHCA 2Y9ZA 3F4RA 3GMFA 2ZJRF 1RNLA 2IS6A 3ZQCA 4F92B 5AISA 4RI7A 2K86A 1IRZA 1OE8A 3HJMA 1FC3A 3QCPA 2GAUA 4TN8A 5J47A 4F82A 5IO2A 3O8HA 2ICWG 3FZVA 2Z99A 1Z5YE 4V1Ag 4BJTA 1EOHA 2F6CA 2DDBA 3RIRA 2R7XA 3ONQA 3SDGA 5JLXA 1ZOFA 1THOA 1G7OA 3EUHA 1GT0C 3PJRA 1D8JA 4NHWA 3CRUA 3FEUA 2HWVA 4J57E 2OU2A 3W8JA 4ZH4F 5GSSA 2FOWA 4HJ2A 2HQNA 3WD6A 5D4SA 1M2DA 4L0WA 2OV7A 1NK3P 3RKWA 2HVSA 2QSGX 1SK1A 3S2DJ 4CZZA 4HOJA 4P3YB 5ECRB 3WGDA 3BR3A 2PQ8A 2KISA 3OV8A 1XVQA 2VIMA 1MNDA 2A2PA 5JCGA 4XHMA 4RB2C 4KCEA 2VLTA 2F9SA 5IYDJ 2O7OA 2BY2A 1I50J 4EM1A 1EGRA 2NVQJ 1LEAA 3PO2J 1ABAA 1U3IA 2ALBA 3KGKA 3ZQQA 2VODA 1ETKA 5DBQA 3T5XA 3L2QA 2XAGA 2BHYA 2RAEA 3E6MA 2AHEA 4RGSA 5K7FA 3UKGA 4ML6A 1Z7RA 4IF4A 5ECOB 2CZ2A 1ULYA 3LFKA 3UNGC 4IVNA 5E1WA 3SHFA 3TJKA 2LDUA 1JHFA 3HOSA 1BR1A 2QBYB 2CV4A 5H5QA 1ZN2A 5F27A 3VSLA 3M8JA 3D5LA 3F9UA 2IW5A 2KIMA 3QAHA 2O3FA 2IN3A 3TB2A 4EJVA 1X9MB 5KAIC 2VT3A 2FMYA 4NQWB 2KJBA 4FYUA 3VI7A 3GTOJ 2R3XA 3CXGA 1U5TC 2GQMA 4LOCA 4HUAA 2E7WA 2DJ1A 3OS0A 4KE3A 3IHGA 1USSA 4Y33A 4ESFA 3HM5A 1AQVA 2WB9A 2BY0A 2HZFA 3DU6A 1Y1VJ 4WF5A 3A4CA 2H0IA 3KM6A 3TEDA 1HLVA 3TDGA 3DEUA 2LV3A 2V1UA 4PGHA 2P7VB 2QZ8A 4GXOA 4UUVA 2QKMB 1FOWA 1VQLI 1HNCA 2V6OA 1KQ8A 2RDPA 4EVIA 1JFUA 1XB4A 3NEUA 4JX6A 5LGUA 6GSYA 5GADJ 2R7OA 2WJUA 5D5UB 1F43A 4HJMA 3KP2A 3ZFBA 3I64A 4O6JA 4MMMA 11GSA 4ITVA 2L7KA 4LGWA 5D5WB 5B7CA 2YWIA 2KHPA 1X2NA 4FIWA 4IOAF 2H75A 4BL7B 3HPGA 4I99C 2GZPA 2DT5A 1FAAA 3A01B 1TNTA 4V2MA 1TTZA 5CJ9A 5ECKB 2EFWA 4OCFA 2MYSA 1X9SB 2VCVA 5IPGA 3WGEA 4PUFC 1LFBA 2HYGD 3AG2H 4ZYHA 3CCUI 1GUHA 3WTWC 2FX0A 2NRAC 1T8IA 4JX5A 1FSHA 5HS7A 3OIOA 1R5GA 2IL3A 4GYIA 1VQMI 4BKXA 5FT3A 2DN0A 4XM3A 2NAZA 3ABLH 5L3GA 3V8LA 1FMWA 1ERTA 3KCMA 4MCUA 2TDXA 2YP6A 1YHQI 4PXOA 2DDAA 2P8TA 2K8VA 4B44A 4XTSA 1TQIA 1ZGAA 1CQTA 3ZL5A 2MD5A 3OL3A 4CUGA 1MSFC 2H72A 1S8NA 4NB5A 2QWWA 5K7HA 2HYXA 1OC9B 2VE9A 3ROUA 2DOAA 1WJ5A 1MMNA 3F63A 1MBHA 2VL9A 3HCZA 1V5EA 1WVRA 2OCEA 1RK4A 2C80A 2KIUA 5EDNA 2KLOA 5FFZA 3FZ5A 3HVXA 3HYPA 4MF7A 1JTYA 2HS5A 4I76A 3W2WA 3E5XA 1A5JA 2YOIA 5EY6A 1PUEE 3GBGA 2X1EA 3OYAA 2DCEA 3C2BA 4DEJA 2KHMA 4UXNA 4RAFA 2OA7A 3CSIA 2YR2A 3LW9A 4RGUA 2I9HA 2GSSA 4JE1A 1BI2A 4BACA 3LYPA 4V19K 2ID6A 3TBIA 3EMPA 4C2TA 4FE4A 5DEQA 2P7CB 4ZB9A 4BXXJ 1DUGA 3KD0A 4MH3A 3OMYA 4KYWA 1PL1A 4FQUA 2BBYA 3KETA 1ZELA 2CU7A 3ZR8X 2VOOA 3DVWA 3GO5A 2RUFA 1RPWA 3MCZA 2A6EF 3P8WA 4OMVA 2DFEA 2O8VB 1BR4A 4A5PA 4GFBA 2BGCA 3CCEI 3GLXA 4KN7X 5GPCA 4HU9A 3RYRA 4X43A 3ZZXA 5GSTA 3RCOA 1IRXA 1FJLA 1BA5A 2I81A 5ECQB 3F23A 2EZLA 5HNFA 2EA2A 4NHJA 3BLYA 1M7TA 4EDZA 1ERWA 3IE3A 4LK1F 2YWMA 1LB2A 5HODA 1Y39A 4OMYA 1GULA 2LRNA 2WV1A 1DBYA 2HPIA 1U9NA 3CF5F 3OL4A 1YI2I 2EBIA 4V2GA 3S1NJ 3ZQLA 3QAVA 2L7MP 2CW0F 3S15J 4RLFA 3VURA 4EMSA 1T3BA 3LEFA 4NXIA 4RQXA 3D22A 2KIQA 2JUCA 3B6AA 3HTSB 4XLFA 4P9UA 3E0JB 1SD8A 3VWXA 5DALA 4RGXA 3U9GA 3I6AA 4HU7A 1MJAA 4R8HA 3BR6A 1QFNA 4I6XA 3ML6A 2YCDA 1JUMA 2VL2A 2DFFA 3OR2C 2E2GA 5G2ZA 2K3PA 3ECOA 3GCMA 1MW7A 3ZOBA 3GX0A 1TK5B 3IAS2 4TXOA 4OMZA 2ON7A 2LKXA 2LY2A 1XGSA 2FMLA 2PN6A 4IPAA 3C71A 1FOHA 1P92A 1ZRDA 1JZWA 2ME6A 3Q0VA 3SFIA 1TP9A 4BH9A 3QPTA 3DIEA 1OR7A 3LJRA 4N10A 1TDIA 1MH4A 2R7SA 2VCWA 2YWNA 4XOTA 3MSZA 1DU6A 4LL4B 5LD0A 3LA3A 3S8PA 4MPFA 2QSFX 2Z9OA 2BMXA 3OYFA 1EF4A 2UXXA 3A2VA 2QYOA 2DBCA 1IZ1A 2M2EA 4BDYA 1PDNC 1D0ZA 1R26A 1SD9A 1G59A 2V9VA 2GT5A 2PMUA 3BD2A 2MG4A 2H1KA 1U6GA 4RLQA 4UV8A 2XHFA 4CDOA 4EO3A 4L0YB 1ZYEA 2FQ3A 2OD5A 1T8EB 1RETA 2N5AA 2ES7A 2Y48A 5JFRA 2FF4A 1Z6RA 4GF0A 4M9SA 2PPTA 3ZIVA 1RI7A 4XLHA 1BC8C 2FNOA 1GVDA 2TRTA 2V2GA 4HLYA 2M5WA 5C3EJ 1PD21 1V5GA 3I4MJ 2L5OA 3MWHA 3CCSI 5LGNA 1YE9A 2K5CA 3DFGA 2YV7A 1N8JA 4BA7A 1DGWY 1SFKA 3DEWA 5LRSA 3IH4A 1XWGA 1R4WA 5HLIA 3HRTA 2VL2C 5EYRA 4OOIA 1XSDA 3C1SA 2IMDA 4E4HA 3CLOA 3EC3A 2LTPA 2YANA 3TO9A 4ZBDA 3ASOH 4LB5A 2LR8A 4P1WA 2P4WA 4WX9A 4ZB6A 4NBQA 1YRNA 2E2JJ 2GQKA 3BQZA 2JA8J 2HE3A 3WTUC 3UVTA 3H9JA 4II2A 1K6OA 2XSDC 2DJKA 3IDVA 4DBQA 1KU3A 1BM9A 4EVMA 3MAJA 1X4OA 2CRGA 4XNFA 2DMNA 3SYTA 3JRFA 2JRMA 2MH2A 3N97A 1AC1A 1F37A 2UZ8A 3GRXA 4BS9A 4FO5A 4BXFA 5F08A 2L7FP 1ZR4A 2IMEA 2R0CA 2XDVA 4XRDA 5HR2A 2CUJA 5HLGA 2C6YA 4I5QA 4ZXGA 5FJ8J 5FO5A 5IQYA 3TRXA 3FRCA 1W0UA 3HY2A 3P5JA 3FKIJ 2E1MB 2FGXA 1Y6IA 4YEJA 5HLTA 3IK9A 3Q6OA 4IRHA 2FCHA 3BBYA 3CDLA 1FSEA 4D5CA 1LFUP 3CDIA 2YS9A 1B4AA 2ZCWA 4O5VA 4XKCA 5A2QZ 2K9MA 4IHTA 2HNHA 2KFDA 3IH2A 3WU1B 2D5VA 1ETOA 4ESBA 1ZYNA 1EH6A 4NHZA 4O92A 3G1MA 1VQ9I 1V54H 3Q74A 5KN2A 2LUSA 2F5FA 1B9NA 2HRNA 2OC6A 1X1PA 1UHWA 2MMAA 1XXUA 3ERFA 4MZWA 4XRFA 2K9FA 4PTSA 4PZJA 5M5WJ 3PFIA 4PFPA 5EL8A 3BR5A 3AG3H 1K0MA 1BBYA 1YKAA 3TKSA 1TT5B 3CUQC 2CS3A 1B4PA 3G7JA 2DW4A 3H9GA 3FMRA 4Z2UA 2HR3A 1RUNA 1V3FA 5CRHA 2YZUA 4BL7A 2PN8A 3KPHA 4KMFA 2DTRA 2X48A 1V4RA 1KYWA 1YX5A 4MA9A 3A5IA 1SANA 2DJ3A 5F0FA 3BC8A 3VB2A 1RRJA 1SMTA 4C3JJ 2DKIA 1EV4A 2I10A 1BG5A 2VM2A 1GUMA 3QOUA 2OCCH 5L3CA 3P2AA 4XBFA 5JI6A 2HSYA 2GM4A 5E79C 1K0AA 4K7NA 1XCBA 2K3FA 2DIYA 2DT6A 1JJ8C 4WXHA 1RUOA 1M9BA 3JSOA 1YTYA 5ICGA 4CSWA 3RHCA 2DQRA 3O76A 2P5QA 1J0RA 2VL3A 4IW9A 4LG3A 5JHFA 3WT2A 2RQPA 5DUIA 1K3LA 1SKWB 1W5SA 5L3DA 3BCIA 4DW6A 1L0OC 3SWLA 2M0MA 4EL1A 3I4NJ 3A0HC 1YJ9I 3H92A 1TQMA 2XAQA 3HG9A 4XKWA 4QSHA 2L6CA 4TR0A 3OSGA 4ZDPA 1IN7A 4ISDA 2OE1A 4X1UA 2E2HJ 1UJ8A 3JRCA 2PFBA 4BEHB 1ZK8A 3FXQA 4HV5A 1GUUA 2GS3A 3GX8A 1SD7A 5JCWA 4FHTA 1ILOA 4DSRA 1TW3A 1R23A 3LQRA 5B1BH 4XRMA 2YWOA 2D1VA 3R0JA 1USBA 4YFNF 2R7WA 5GAPD 1HYUA 4DYCA 2LREA 2ISYA 2E2MA 5H20A 2IA0A 1XWCA 4W97A 1VGLA 1QA6A 2ZFWA 2LP0A 1MDJA 4HSTA 1OKTA 1D1BA 5H6RA 2WGRA 2M30A 2WBMA 2X4HA 3HOTA 4QWQA 5JWQB 3QWLA 3J7Yb 1QVTA 1ST9A 1L3LA 1K0DA 1M3IA 1DPRA 1B8IA 3LAPA 3FWEA 2CMPA 3NWSA 3A1YA 3K4BA 3KMOA 1UZCA 2L01A 3KMNA 2F3MA 2ZJQF 3MYDA 3DRNA 3JTGA 1X5CA 5CPRB 4MQ9F 1V55H 2VOCA 1O85A 2L4QA 2HZEA 1T39A 3FXMA 1LJRA 2JSPA 3QOPA 3I58A 1K61A 4FYCA 2R93J 5B8AA 4RAGA 4L5IA 1G4DA 1BX9A 1VF9A 3BCBA 2EB7A 3TL4X 2JA5J 2CFXA 1A2LA 1WSUA 2CX3A 3NARA 4HQSA 4NV2A 2R0GA 3GF2A 4EF0A 3REOA 2CQ9A 1V57A 3U6VA 3P9KA 2HI7A 2CYYA 2VKVA 3PIOF 2DA3A 3H3ZA 3WODF 4HF2A 3E0UA 3VWUA 1IRFA 2PMHA 4ENKA 3KP6A 4KN4X 2P0GA 2DAOA 3GYKA 1F3AA 4G7ZF 3DKWA 2EINH 4DGWB 3QU6A 3L7WA 4GXZA 2DXIA 2X64A 2VUMJ 3GKNA 4J01A 4S0HB 3QRFF 2O9LA 2R92J 2O7KA 1U87A 1K4SA 3VI5A 1W7PA 2WAEA 1LVKA 3TO6A 1KU9A 1ZCPA 3FMQA 4K6XA 4WWCA 3M1EA 4ZIJA 1NSWA 2ESNA 2BW3A 4EKZA 3WTXC 3CMIA 2A07F 3JAMZ 5JVTA 1SYRA 4G2EA 3I5UA 4RB0A 4XLCA 3ZIJA 4XS6A 2J5OA 2GIVA 2B5YA 1LE8B 3L2RA 1IC8A 3VEPA 4M3DA 3Q3SA 3PUFA 1TL8A 2RC4A 4NUBA 4B4CA 2F48A 1XMXA 2ZFUA 4KIBA 4HX7A 1U3AA 3BTIA 3TKPA 3EPZA 3KZQA 4IX7A 1KQ0A 1VQPI 1QZEA 2ZMEA 3O6BB 1OYWA 3VYRB 6PAXA 2VT2A 2CQ7A 3GTJJ 4JBAA 3DXJF 1YW8A 1ZZYA 2IMIA 1FX7A 3L9SA 5F06A 4PK4A 3AFHA 2H8RA 5J6XA 1LPQA 5FLXK 4MPGA 5IP7J 5IMDA 4PGGA 4BWQA 2PLYA 3GTUA 2PBIA 1AU7A 2CQXA 3OYMA 4XS1A 3A0BC 3PQKA 1S7OA 1YFHA 2VI6A 1IUYA 4O7HA 1T7PB 1U5TB 4XONA 3QD9A 5BPIA 1A0FA 2K9NA 5D4RA 2A6HF 3LA7A 2D1HA 1U78A 4IHWA 1BR2A 2Z5UA 1NW2A 1I3QJ 2EH3A 4HX4A 3UIWA 2IA2A 1HKSA 1S6LA 3PSFA 2ZXIA 1WKMA 3LSTA 5HR1A 3K4NA 1R49A 3G1LA 1GTBA 1AQXA 3KZYA 1QUWA 5A4VA 3GHAA 2DT7B 3GFKA 1D3YA 5J4VA 3O6TA 4XRSG 3H1NA 2NNYA 5FLVA 3OIPA 1THXA 1CF7A 2QKEA 3A2WA 3S1RJ 1JLVA 4GRIA 2AQEA 3E3VA 4OINF 3ERED 2DJ0A 2R2JA 2X1DA 3HD5A 3I43A 5B6NA 2FBIA 2EIMH 5E1XA 5HNHA 2MD0A 4CYCB 2I3YA 4RA2A 2K27A 2GA1A 1LFPA 1DP7P 1X0RA 2ZNYA 3DD3A 4LK0F 5DQSA 1QXHA 3ZMDA 1J7KA 4TXVA 4R79A 2XPEA 1DU0A 4EJTA 1CQHA 1Z3XA 4A2UA 2REMA 3J7Yk 1BN5A 3HGYA 4DYQA 1ERDA 4E7ZA 4HA8A 1UHMA 3PGTA 1QZZA 1LUJB 2HPMA 1JKQC 2V1MA 1MDKA 3V1WA 1PKZA 1K79A 4M3BA 4D0PA 1PP7U 3IP4B 2MBFA 4LMWA 3HRUA 2DSAA 2P5VA 3S32A 3VDXA 2VO4A 2HT9A 2OADA 3BR1A 3PH9A 1X4PA 1TWHJ 3JRHA 3ELKA 1XWAA 1SU9A 2A2SA 5EGOA 5C44J 4XLPF 4UVBA 2E1MC 2K8SA 3KP3A 4R1HA 4BHPA 2EQRA 1ZH5A 2V6CA 3K8NA 1NG7A 5J5NA 2JACA 5DCMA 4F52A 2W1OA 3BY6A 2L9RA 4RB1A 1G2HA 2VCTA 2Z2SB 2N5BA 2PJPA 2P5LC 4ZYEA 3FR3A 4J19A 1I1SA 2FA8A 3DCFA 4MEYF 2HGCA 3GXOA 5IYBJ 1FOVA 4IBPA 3I69A 3OYKA 2BY3A 3WTSC 1FIPA 2G0EA 4PQ1A 2LF8A 1Y0UA 2DJIA 2ZXHA 2ZXJA 4OAZA 4ABZA 2FUG2 3IRAA 4ICYA 4MGRA 1P4XA 2FD5A 2KQRA 5ELAA 1MBEA 3R61A 1G8XA 4YIRX 3M3YJ 3G1OA 1LVAA 4L5EA 3M4OJ 4RI6A 3ED3A 2PERA 1Y8RB 4MLYA 4M9XA 2ESHA 1LNWA 2FJ1A 1E3HA 2VBWA 1AW9A 4G0LA 3EUAA 2F4MB 2X0LA 1S5LC 3IXRA 2QBYA 4F9ZA 3TKYA 2B63J 3UARA 1XMKA 3QU3A 4IHXA 2OKAA 1VF2A 3MIXA 3FZAA 5J8FA 3MQ0A 1VQ7I 4KAEA 3HOWJ 4Y15A 4MZBA 3HXSA 5D96A 1GH2A 4CA0A 4N9HA 3ZQIA 3ZMSA 2L3DA 4JOMA 2PVOC 2ZO4A 4PJNA 3ECHA 4NMUA 1BJXA 2H74A 2W25A 4LMYA 1OQYA 1NHYA 5FLMJ 2CA8A 2MYGA 3PSIA 1ZAOA 4MO7A 1B1BA 3ZP5A 1ZHFA 2V32A 4L8EA 3WT1A 2DYSH 2FOKA 3L00A 5KHDA 2F4IA 2KDZA 2VQHA 4MLOA 1FYKA 2GZWA 4K7OA 4TR1B 4Z6YA 4L9NA 1WCMJ 1K6YA 4ECJA 4DJAA 4KA0A 1F9MA 3M07A 1WJCA 3CYNA 2R7FA 3U2RA 2I1UA 1X3UA 4A3IJ 1Q98A 3HJOA 4RBOA 1O81A 1WH7A 2AYTA 2FWFA 2VJIA 3GA4A 5AN1A 1S29A 2V1DA 2EV5A 4J56E 4KUMA 1GLNA 4EJUA 4N0ZA 2HZEB 2R7DA 3JRBA 4WETA 4PFOA 2A2RA 5HR0A 1TKDB 1MIJA 1HDDC 1V5FA 5IMAA 2XKOA 3K4KA 1XTAA 5J40A 5FKMA 4ZYGA 3EUHC 2Q1ZB 2VXDA 3CO7C 3A01A 2Y69H 3CO6C 1A8LA 2O89A 2H0GA 3QOEA 3JREA 1Z7UA 17GSA 3CZ6A 1W5CC 4Y7NJ 3RKQA 1JE8A 3T0YA 3L2WA 4GGGA 3D0ZA 2OJED 4JZQA 3IPZA 3ISOA 4IQAA 3IOSA 3V42A 4X1EA 1FY7A 5FKOA 3HHVA 3TKRA 3K4MA 2QA4I 3HZ8A 1MTCA 2FNAA 1N78A 1WJFA 1QVUA 1DQUA 1R4NB 2QEXI 4YQMA 4G7OF 3WGGA 5DYMA 2F5EA 3J80Z 2JPCA 3IHUA 4PNFA 5CYVA 3ZMVA 2X8GA 3VLNA 4CW9A 2E1NA 2JVHA 2B9SA 3GX4X 3LWFA 4HZFA 1HF0A 2GVPA 3T1BA 4F93B 2L9VA 2V6KA 5J1RA 1WPIA 2HVQA 1GP1A 3NOFA 2XGEA 3MKYB 3FK7A 4NNJA 1REPC 1K0BA 1YEXA 3ABTA 1SFXA 2RREA 2YV9A 2CV2A 1JKOC 2XAUA 2GA2A 4K2EA 2Y0MA 4CCLA 3EYIA 2ZUPA 3ZVJD 1EGOA 2K9SA 1IYIA 4QQ7A 4A0XA 2E34A 2IGOA 4AU7A 4AIJA 1TU7A 2JU5A 2DC5A 2LNBA 4CY8A 1RR7A 3H3VK 1BI3A 4BJ5C 1XGNA 3LFUA 3UBKA 3GN3A 4MDCA 3S3OA 5ED4A 2VD0A 3BJ5A 2G7HA 2H6YA 2MZCA 3M1CA 3KTLA 1MD4A 2ACJA 5G5EA 4YKGA 6GSUA 2AXTC 5FD6A 4IO9F 4U88A 3QR6A 3SBCA 1B4QA 2ZCTA 3CTAA 2R4VA 3L2UA 3LXTA 4A5NA 1YYVA 2WRTA 5AIQA 3CC2I 5E59A 3O8GA 3SDBA 4M3EA 2F51A 1K7AA 2RN7A 1JZDA 2DMUA 4DBRA 1WZ2A 1U8BA 2A5WA 9ANTA 3LSHA 4ZB8A 2EIQA 4JRRA 4I7HA 4XSXF 3L0HA 2PU9C 3M9KA 3LSRA 5IM9A 3LFLA 1DE2A 3GFIA 4V2NA 1XX5A 1SFUA 3TGZA 3W3CA 1YJ6A 5H5RA 2OZUA 1PVEA 4EGYA 2M80A 3F8MA 1MEKA 1J5YA 2P81A 3QYBA 4Q5QA 3KCCA 4E7KA 2M7BA 2G0FA 3U1DA 3QMXA 4TW5A 4JU5A 1HBXG 4L9JA 1KU7A 1QK8A 1FYMA 2L7ZA 2VUPA 4ACSA 3GL5A 1JGSA 1E17A 5INYA 1A35A 4BHBA 2L54A 2LEGA 4II3A 4F55A 2ZB9A 3JAMK 1S72I 1Z6MA 4QL9A 1X5DA 2YX4A 2WZ9A 2AUVA 2H1AA 4IKHA 2GSRA 2QQ8A 4HQMA 1ZTRA 3VWVA 4PSWA 4JK1X 2R3SA 3KYDB 4MP4A 2FNPA 3KH7A 4UV9A 4A5MA 2H0HA 3IC4A 5DQYA 1YS6A 3G2BA 3GUSA 1BI0A 3L2VA 1FT9A 3H79A 3WE3A 3QDNA 3K1MA 2K4BA 4USSA 1IXRC 5D9WA 3GUDA 2LS5A 4Z7XA 3TO7A 5ID2A 1G6NA 4A0ZA 4PSXA 1JT0A 2DIZA 2PMTA 2QC7A 4K2XA 1NM3A 4BWSA 5IPHA 3HJEA 4LFUA 4I98B 2HYJA 4HQZA 1QMVA 4Y17A 2L59A 1WH5A 2HOTA 2YU9J 1SL1B 3HUGB 4S04A 4BIKA 3OS2A 4IQ1A 2HQ5A 4H4KC 5TGTA 2XC2A 3DVXA 1KZHA 3ZQHA 3W8SA 3F72A 1OCCH 3SJMA 3CUQA 4AIDA 4XK4A 5JHUA 3V7RA 2NVLA 5F05A 2XAHA 1PMTA 1T33A 3LXZA 3OSFA 2B1LA 4ZL8A 1X2MA 3FX3A 3Q9VA 4BUPA 3SXYA 2V6EA 2IS4A 1BI1A 2R7QA 2DPDA 4WCGA 3QFBC 1GTUA 1YRNB 1XOBA 3ZQGA 4UHTA 3LNQA 4ESJA 2M0CA 3EURA 4E8HA 1ZL9A 1ZYQB 4XN3A 2PJRB 5L3EA 5IP6A 2EWNA 3HGGA 3HXLA 4Z2YA 1GSEA 2PBJA 3VYSB 4IP6A 1MMGA 3PPUA 3PFYA 3ZMUA 3R6SA 1RKTA 3GTGJ 2RNJA 2EZKA 2E35A 5J3LA 1D5VA 2CX4A 3OYLA 2RLIA 1KNGA 3QPHA 3K70C 2YPMA 4Q5RA 1XDSA 3BDDA 2ZSHB 3G6EI 3KLNA 2VAFA 2XBIA 1LBKA 3TJJA 3LYKA 1Z7PA 3S1MJ 3S9FA 3PM1A 5BQTA 2JZRA 2PVQA 4AYBN 5JWRB 4G19A 9GSSA 5FHIA 5HR3A 2A4VA 4ZDOA 3ZGKA 2OTJI 3M9JA 3W6JB 1O57A 2ELJA 1TWCJ 5FKNA 2GT6A 2GWRA 1VRSD 5J8CA 5IOYA 2VLAA 1VF1A 2MMOA 1GSUA 3BJAA 4WKWA 1IV8A 1ZKGA 4DVCA 4BE0A 1K78A 4M9ZA 1TZLA 5CRGA 5FKLA 2V9KA 3WTVC 2K02A 1P9QC 4RAZA 2LBFA 3OIQA 2XBQA 5F8BA 3VK9A 5IMZA 1UG2A 2MABA 3L09A 2X6OA 2DLLA 3OYNA 3HOZJ 1OE7A 2TRCP 2X99A 3D21A 3KTBA 5DVBA 2FEZA 1PJRA 1ZREA 1FTTA 1GV5A 4B43A 4FTHA 2JSCA 2CZ3A 4TR1A 4UVCA 3PNTA 3CCLI 3BWGA 3KP4A 4MEXF 4IOCF 1DUXC 3QPSA 2Q8KA 2GLOA 3ZLPA 10GSA 3A02A 4EGZA 4C2MJ 1QZYA 3IK7A 4A3EJ 4QTRA 2JZYA 4UY8I 4AYBA 1U6TA 5G30A 1JUSA 2L6DA 2STTA 3CJQB 2DOFA 2LQOA 4Q5NA 1BC7C 1Q1VA 1ZLKA 1EWXA 2VIXA 5HS9A 3C3WA 3WU0A 4E7SA 1GSQA 4DZPA 1YQ1A 4W1UA 5J9CA 2B5EA 4BQQA 2DMMA 2L5LA 1SK0A 4OIRF 3BPVA 2AQFA 5F0GA 1G3TA 1K83J 3I55I 1R1VA 1J75A 1ZQ3P 4KGIA 2BE5F 3ZMTA 4DOZA 1SFOJ 3GL3A 5DCHA 5CVVA 4Z2TA 2M45A 3SQNA 4E7IA 4EATA 4LD5A 2AAWA 3P7XA 4PJMA 3EU3A 3HKRA 4PURA 4B1RA 4EUYA 2H6BA 1POGA 3J80K 5IYCJ 1KYZA 2IMKA 4KA4A 4KISA 2LFBA 1BEDA 2HNLA 2R0QC 1MJBA 5ICEA 3U21A 1SVLA 4F0CA 3AG4H 5B3SH 3BPXA 2IFQA 3DPUA 1TOFA 3ZMLA 1BIAA 1Z3YA 5FFXA 3L1PA 4GO1A 1G0TA 4BEHA 3J7AO 3ERMA 2V1XA 4HDEA 2H6CA 3TUEA 2F8AA 1B48A 1KONA 1VQ4I 2RM6A 1GRXA 1R5ID 2Z1DA 3LSJA 1Z91A 2NXNB 4E7HA 4M6VA 4A93J 5IT9K 2X85A 5EGOB 1H75A 2C3TA 4G12A 2V26A 2H1GA 2C3QA 2KT0A 4IKFA 1FP1D 4X0XA 1O3QA 1FIAA 3H1CA 5F1JA 3AKZA 3S1QJ 2PUKC 5DCMB 1TP4A 4BPYA 3QP5A 2HQRA 3RDWA 2XVCA 2LBFB 4OWRB 2W48A 5CVIA 1AWCA 1R4MB 3CJTB 1QGPA 4K7IA 2KZGA 2K40A 2X1CA 3TW6A 2XKPA 5ECIB 4LG0B 2BOLA 3CCYA 2H76A
chains in the Genus database with same CATH topology
4CH7A 2PWJA 2W00A 1GLPA 3FKJA 1A2MA 2LC2A 4IN0A 4N11A 2W7NA 3VWBA 2X6YA 2GQLA 4OD7A 4LITA 4YAVA 1AQWA 1V9WA 2M4GA 3TMOA 3LMMA 1MD3A 2PMZA 4TOPA 4PJLA 4GSTA 2QKLB 4CCOA 5J3RA 2W4SA 2HSMA 4HPQA 1KTEA 1PN9A 3DGQA 2OBIA 5CAXA 2E5NA 1OYJA 1W89A 1AA7A 4NWYA 1T95A 5B8BA 2A4HA 3UAPA 4PJJA 3NZNA 3MMYB 1OC9A 4BDZA 2NBSA 4EC0A 2F8FA 1EP7A 2V4JC 4IGJA 7GSSA 3RPUD 4MH2A 1X1BA 1URMA 4C30A 4FYBA 2M7AA 2R7UA 2E7PA 2AB6A 3R3EA 3J7AY 2KZVA 13GSA 1TOFA 2PU9C 5JWOB 3DWLE 5C04A 1OC8A 4CCMA 4YELA 4K0NA 1EV9A 1Z9HA 2OE3A 4LLRA 4OFMA 4QPQA 2IWTA 2ZNMA 5ECHB 1OR7C 3F0IA 2MBTA 5DALB 1FVJA 3EPTA 3VFIA 1ZGNA 3CMMA 2WAQA 3IAM2 2R5GA 5ECMB 3UBLA 4AJ6A 4N30A 4ZBBA 2NPBA 1J0FA 1S3DA 3IA1A 1K3OA 1TRUA 3Q18A 2OBKA 1PYVA 3C2HA 4HNUA 1WRYA 1ZMAA 4K5SA 3W6GA 5IMCA 3PNVA 3H0DA 1I9DA 3H93A 4G9HA 2HDWA 3APSA 3HJPA 3MAKA 3PL8A 3RAZA 5EPFA 4KT6A 3QPMA 2B7KA 2L5QA 1O6JA 1SENA 2FWGA 3AL0B 1TT0A 1WWJA 1FMVA 4CZCA 2LRCA 2IXSA 1JZOA 4XIHA 2WULA 3K6GA 1QGVA 1XWBA 5KOWA 1NG6A 5LNKe 2KRHA 1OKDA 3KH9A 4GQFA 4CHSA 1T4ZA 5D8IA 2JL4A 3H5AA 2Y0SA 2BJXA 4LIVA 5AIXA 5D9XA 4MZCA 2LTKA 3KXOA 1E6BA 12GSA 1PA3A 3ZMKA 4KH7A 1Y6EA 1W36D 1ON4A 3IHQA 1Z7LA 5BMUA 2DJ2A 4LA1A 3EUKL 4K1FA 4WBJA 1YX3A 1Z21A 3D5SC 5IO0A 2NOJB 1T00A 2JSYA 2LKUA 4E6KG 3LL7A 2DLXA 4KDXA 3VSKA 2HRKA 1RW1A 3UR3C 1J08A 2EC4A 1TK0B 3F9KA 2E5ZA 4WR4A 1XW5A 1H4OA 5CP1A 2OJLA 3RTRA 2FWEA 3IUOA 3CRTA 4BVYB 4HG2A 2RQQA 2WAFA 4L0UA 2B5XA 2IJYA 4RMNA 4J2FA