3I9V2

Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, oxidized, 2 mol/asu
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
178
structure length
178
Chain Sequence
FFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHLQVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAGKRLEEIELPGKCGHHVHEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-quinone oxidoreductase subunit 1
publication title Structural basis for the mechanism of respiratory complex I
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 46
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature ec 1.6.99.5: Transferred entry: 1.6.5.11.
pdb deposition date 2009-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01257 2Fe-2S_thioredx Thioredoxin-like [2Fe-2S] ferredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1590 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3i9v201
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3i9v202
1R5AA 2V41A 2FLSA 2PMTA 3TKQA 4IHUA 4K2DA 1TRUA 2IFQB 2YNXA 2MMOA 1EV9A 2PGTA 2H0IA 4MLYA 3C7MA 5HR1A 1TRVA 5FWGA 3BCIA 1V58A 4QL7A 4E8EA 3N9JA 1ILOA 4N11A 4H86A 5GSSA 5B7CA 1JZRA 2LJRA 5ECRB 1PX6A 2I9HA 1FHEA 3IBHA 3EE2A 2H0HA 4ZBBA 1XPVA 2H75A 1TP9A 2QSIA 4MCUA 2E7PA 1X5EA 1T4ZA 1EGRA 1TJDA 3KH7A 3O3TA 5IMAA 2H71A 3MNGA 5DCHA 4OCEA 3DIEA 2C3NA 4MDCA 2PVOC 3F4TA 5IM9A 2VM1A 3MSZA 1OC8A 2VL2A 3GL5A 3PGTA 1Z7PA 5B8BA 3Q6OA 4HZ4A 3TJJA 4EE0A 4NV2A 3N5OA 3LYPA 1C72A 1ERUA 2HSHA 1UA5A 6GSUA 4JU5A 4KDYA 2PWJA 3GURA 1M9AA 1X9WB 3VK9A 3GKMA 3M9KA 4N0ZA 5EL8A 4MH3A 1AAZA 4MJEA 1QUWA 4PUAA 1SU9A 2OE3A 1FOVA 1ERTA 3BOAA 2AHEA 1AXDA 4JBBA 2LKUA 4HS1A 2MMZA 5ELAA 1A2LA 6GSVA 3ZIVA 5HR2A 2X8HA 5J41A 1A0FA 2R4VA 2BTOT 3ZL5A 2GQLA 2MBSA 4MPFA 1AQXA 3ERGA 1TI1A 1YY7A 1A24A 1F2EA 2H6YA 1TU7A 1QXHA 3QR6A 3QOUA 1J08A 4TOPA 2KP2A 10GSA 5CNWA 1B9YC 4Q5FA 4KDUA 1BX9A 5G5EA 2GZYA 2ES7A 2DMMA 3LGCA 1BAYA 4BL7A 3ZVJD 4F0BA 4OO4A 1J0FA 4KDXA 1ON4A 1WP0A 1ACVA 4GTUA 1G6WA 1PA3A 1SYRA 2MBTA 1BG5A 1QFNA 2C3TA 3UJ1A 3S9FA 1NHYA 4XCSA 3BJ5A 3E0UA 1M0UA 1ZYEA 1FB6A 3IDVA 3Q19A 4TKYA 5IQYA 2GSSA 1MD3A 4AJ6A 1OVNA 1WOUA 1T4YA 2DIZA 1G0TA 4GCIA 4LL1B 2F51A 3FR6A 1XCCA 4X0XA 4X43A 2FY6A 2I1UA 1GULA 2M80A 5FHIA 20GSA 2A2RA 2FD3A 3TRQA 1X9SB 4TVEA 3TKPA 1OAZA 3LORA 2DMLA 2G2QA 1KTEA 2R6KA 1VF1A 3IR4A 1HQOA 5ECLB 5G31A 4TN8A 2YN1A 4NXIA 3IOSA 4DSSB 5A4VA 1GUHA 3VI7A 2PUKC 3KCMA 3UL3A 2LEGA 4DSRA 4ECBA 4RQRA 2B7JA 3DEXA 1T00A 1UVZA 1OKDA 5DAKB 2LRNA 4NWYA 4BWQA 2R37A 4KX4A 4TRXA 2EIOA 2GQKA 2BMXA 4O5RA 4D73B 3WT2A 2E0QA 3D22A 5H5RA 3P90A 4F2IA 3C71A 2ON7A 5DVBA 3HDCA 4TW5A 2H19A 3ZTLA 2FWEA 1RQMA 3GKNA 1K0DA 3GIXA 2M72A 3KH9A 4KCAA 5ELGA 4N30A 1ZCPA 1GSEA 5FT3A 2B5XA 4EXJA 5C04A 4LMVA 1ABAA 2H8LA 2PPTA 3FHKA 3A5WA 5IOXA 3GKKA 3KM6A 1GSYA 5IMVA 2FA8A 1A2MA 3TOTA 9GSSA 2L57A 4HQSA 4XIHA 3VLNA 4YQUA 3VWUA 2B1LA 3M9JA 4KE3A 1FVKA 2CX4A 4ULXA 2RUEA 2FHEA 5ECIB 4POKA 2JZSA 3IAM2 4GSSA 2AAWA 5CRWA 2P5RA 5DJMA 2X64A 3DD3A 1U6TA 1WMJA 1OC9B 1ZOFA 3RPNA 2IMKA 2CZ2A 2CVDA 5DQYA 2H1BA 4FH8A 1PKZA 4OD7A 4O92A 5E59A 2E2MA 2RM5A 3FK8A 2IL3A 1PGTA 2P5QA 1MEKA 2GLRA 4MZCA 3I6AA 3J7Yk 2IIYA 3ZIJA 1O7UA 3VI5A 3UVTA 2RUFA 3A2WA 6GSXA 1GUMA 4MF6A 4PQHA 3CBUA 3PH9A 2WULA 2DIYA 1SD8A 1EOHA 11GSA 2DJKA 4BA7A 3UBKA 4ZBAA 1Z5YE 3WGXA 2WJUA 5DDLA 3F8UA 2Z9SA 2HRNA 1A0RP 1PMTA 3I43A 4HZ2A 4LL4B 4K7IA 1TU8A 2B3SA 5F07A 2TIRA 1X9MB 4NHWA 2VM2A 3LSZA 1XW9A 3VFIA 1ZMAA 2OA7A 2A2SA 4ZB6A 4FYUA 4HU7A 5CRGA 2YANA 2H74A 5IMDA 1A8LA 2QKEA 2VCZA 5DBQA 3TRXA 2VL9A 1ZGNA 2HNLA 2YWMA 3KD0A 4IJ3A 2LJKA 4TXOB 1DUGA 1PL2A 1SJ6A 4EL1A 2P31A 1TI3A 4NV5A 3HZ4A 1GNWA 4L5LA 4OFNA 1YDKA 4ECIA 3TJGA 1GRXA 4I2TA 3GKXA 4FO5A 1XVQA 1LBKA 1V40A 4MF5A 3SWLA 1PD21 3HYPA 1QK8A 1FW1A 5B6MA 1CQHA 3M0FA 2CX3A 1WIKA 2WFCA 2GDRA 1Z6NA 5EPFA 2YWIA 2PU9C 5ECKB 3VWWA 2TRXA 4GSNA 2PERA 4KUNA 5HFKA 4GQFA 1GSFA 4AJ7A 3F63A 2LNSA 4I6XA 1AQWA 4PXOA 5DALA 1V9WA 4AJ8A 4POLA 3HD5A 1R7HA 4RQXA 3IV4A 2OADA 1SKRB 3KTLA 1F3AA 3O76A 4HEA2 2WZ9A 1GTBA 2F8AA 4EVMA 4K8MA 3ZRDA 1U87A 1KEBA 4FYCA 4G2EA 4MH2A 2C0EA 4XS4B 1USBA 4HUAA 1AW9A 3WT1A 2VO4A 2VIMA 2I4AA 1ML6A 3QPMA 3JCML 4O7HA 19GSA 3CXGA 2LS5A 1X5CA 3QFBC 2CQ9A 5L71A 4HDEA 2E2GA 4YAVA 2C0GA 2MZCA 1O8XA 2VAFA 4ZL8A 1KBNA 1K3LA 5H5SA 1B4QA 2KUCA 2GQMA 5GZZB 1VGLA 3HZ8A 1SJIA 3W8JA 3GHAA 3ZFLA 3Q18A 2AYTA 3EMPA 3EWLA 4WKWA 1THXA 4JR4A 2OJLA 4XS1A 3DVWA 3KMNA 1E6BA 3QCPA 4KW6A 4CDOA 2HZEB 2K6VA 3FR3A 4ZB9A 3IE3A 3FEUA 2HFDA 2PVQA 2CA8A 1QMVA 2B5EA 1ST9A 1V2AA 2AB6A 4G19A 3H1NA 1XZOA 3L9UA 2V32A 1HD2A 3KIJA 1WE0A 2P0GA 3GTUA 1N8JA 4MK3A 2L6CA 3KZQA 4NAXA 3RDWA 3HVSA 4YH2A 14GSA 1EZKA 4WXTA 2R3XA 4EKZA 2GSTA 1B9XC 3L4NA 4I8BA 1Q98A 2DLXA 2F8FA 2GSQA 4V1Ap 3GH9A 2WRTA 3GA4A 2YZUA 5CRHA 2IN3A 1YJ6A 4ZBDA 3FZ9A 2YV7A 4ECCA 4ACSA 2VCVA 4WF5A 1AC1A 4XS6A 6GSWA 2DSAA 5A4WA 3QAGA 5GAPD 1XBSA 1T7PB 4TR3A 1V57A 2IPAA 2YCDA 3TKSE 3LXTA 1TOFA 1GNEA 1GL8A 1SD9A 4OCFA 2FCHA 5GSTA 2IMIA 1EP8A 5J9CA 3FZ4A 3ERWA 5D8IA 2NTOA 3US3A 5KN1A 3BCKA 2RM6A 3PINA 1K3OA 1PL1A 1TXXA 3HY2A 2D2ZA 2V6KA 2C4JA 5B6NA 2C80A 3WGDA 3ZZXA 4BVYA 3RHBA 4XTSA 5KEJA 2RIIA 4OMVA 2XC2A 3E3EA 3H93A 2O85A 1EEMA 2B1KA 3KMOA 4HOJA 4IQAA 1AQVA 4QL9A 3GYKA 1URMA 2H0GA 2EC4A 4EC0A 1SJZA 4D73A 3NOFA 2H66A 1H4OA 2F3MA 3L9SA 1HNBA 3F4RA 1M7TA 2LQOA 2V1MA 2GGTA 3D4TA 1TW9A 1B4PA 5CAXA 1I5GA 1EGOA 2X8GA 1XOAA 1K3YA 3ERFA 1SENA 4K0NA 3VWVA 3RHCA 3GL3A 1M9BA 5CO3A 5ECQB 1ZYQB 1A8YA 3QDNA 5J9BA 3F3RA 1NW2A 4IQ1A 2H76A 2NDOA 3A3TA 3TKSC 4G10A 1SK0A 4ZILA 5D9TA 2VLVA 4Q5RA 4I5QA 2B5YA 1N2AA 1J9BA 2JL4A 2DBCA 5A5KA 5H5QA 2H70A 3DRNA 2K8SA 2HE3A 1M2AA 4XHMA 4IKHA 2GVPA 4F82A 3ED3A 2YWOA 4J56E 2NBSA 1Y25A 4KGIA 5ECSA 4KCEA 1YKAA 3CSJA 1EEJA 1WJKA 1R5PA 2LRTA 2XPDA 4ZIJA 2L5LA 2QGVA 1QGVA 3EU4A 4XRDA 4ZB8A 3L78A 1OC3A 2ON5A 4IS0A 2YV9A 2OE0A 4MA9A 3ISOA 2H6XA 3CSHA 1OC9A 2DJ2A 3LEFA 6GSYA 3F9UA 2N5FA 1DE2A 3HA9A 5AIVA 2ZUPA 1YZXA 3IK9A 4JR6A 4GQCA 1K0OA 1EV4A 4ILFA 4V2LA 4WBJA 5IMZA 3O6TA 4ML1A 2O8VB 5G1LA 4F9ZA 2JADA 1V98A 4HQZA 4YAPA 1UC7A 2MMNA 1Z6MA 4WEYA 1X0RA 4RI7A 3ZITA 4GF0A 2CZ3A 2IMFA 1M99A 4MABA 3RPPA 3HVXA 3MDKA 5KN2A 1JZDA 2K8VA 2H6ZA 4IELA 1EWXA 1U3AA 2H30A 3G7JA 7GSSA 2WCIA 1VF4A 3UBLA 4KH7A 3LWAA 5D9XA 3GFKA 1JZWA 1U3IA 5F8BA 1F3BA 2VOCA 8GSSA 2J9HA 4N0VA 2I3YA 3QFAC 1GP1A 5IO0A 4PQIA 4RI6A 5JCWA 1GTAA 4K6XA 2CV4A 3HKRA 3EINA 2DJ0A 1S3AA 4FYBA 3EYTA 3KXOA 5CYYA 2FWGA 4L0UA 3U6VA 4TXOA 5F05A 3FZAA 4NHZA 3UOMA 4F03A 1XVWA 3TJKA 2VUPA 4GRFA 4FIWA 3M3MA 4POBA 1MDJA 3TRPA 1OKTA 1RK4A 3ZLPA 2LJAA 3Q74A 4HJMA 2C1YA 2IJYA 2A4VA 5JWQB 1OE7A 2VCXA 4KA0A 3TOUA 4YQVA 2BJXA 3H8QA 3F0IA 1YEPA 2H1DA 1F37A 3MWHA 3RBTA 5ECOB 3F3QA 2JZTA 4XRAA 2DC5A 5D9VA 1SKSB 1PN9A 4OWYA 3TJBA 3NIVA 4BVXA 5HR3A 2H1AA 5DCGA 1JHBA 1PSQA 4K7OA 1QQ2A 1T8EB 1SYXA 5LCZA 1Z3EA 2M46A 3U5RE 4PNGA 4BWSA 4E8HA 1MDIA 1ZZYA 3KEBA 4YQMA 4MF7A 3FZ5A 2N5BA 3H79A 4GSTA 4WETA 1K0NA 5ID2A 2IFQA 5J3RA 5HFGA 2WGRA 2VL3A 3NZNA 4XS4A 5COHA 1GH2A 1GSDA 4IW9A 1O8WA 13GSA 5IOWA 3OR5A 5JCUA 2YJ7A 2VLTA 3TKSA 3DVXA 4OFTA 2VCWA 2O89A 2L4CA 5HQPA 2VLUA 4MJBA 5D93A 1HNCA 5J5NA 4EUYA 1OE8A 3D21A 4NPBA 5CP1A 1DBYA 1U88A 5CREA 4P3YB 2VCQA 3HXSA 4MP4A 1SK1A 2L5OA 4V1Ag 2HXKA 4IP1A 2JSZA 1IYHA 3SBCA 3UVHA 1G6YA 4L0WA 5E4WA 1ERVA 3APQA 2GT5A 4JRRA 4V2NA 2TRCP 2FWFA 1XWBA 4IP6A 1Y6EA 4K1FA 3BBYA 2YPMA 3GV1A 3KGKA 4KSMA 3IAS2 2YJHA 1E2YA 3P7XA 1TTZA 3VPQA 2GTUA 3WGEA 4JZQA 3DWVA 2DJJA 2XBQA 5ECHB 1TK5B 3DKSA 2MMAA 1ERWA 2PBJA 2LUSA 1A2JA 1WWJA 3FW2A 3CRTA 4PUFC 5DALB 5CRDA 4GXZA 5EY6A 3P8WA 2OE1A 1JZOA 1TK8B 1XIYA 2K9FA 4TR1B 3IXRA 1XWGA 2H01A 2YOIA 1SKWB 4AF2A 4CHSA 3TCOA 4PX1A 2HLSA 2FA4A 1GSQA 1S3CA 1SL2B 4IJIA 1AUCA 2OBKA 2X99A 4EO3A 2WS2A 5G1KA 3I69A 4KAEA 1NM3A 1S3DA 4EDZA 2FNOA 3GH6A 5ENUA 2DJ1A 1THOA 3VWXA 1YF1A 2ZNMA 2LV3A 2ZCTA 4LMWA 2KHPA 5INYA 4MJCA 4WF4A 3GNJA 1TK0B 1VF2A 2QC7A 4ZL9A 3ZFBA 1R4WA 1BYEA 3HCZA 2FGXA 3IRAA 3TUEA 2L4QA 3A2VA 4KB3A 4DSQA 2HRFA 2LQQA 3CTFA 1W89A 1KNGA 3GX8A 4TR0A 2OACA 2O7KA 4GLTA 1OYJA 4V2MA 1SL1B 3LJRA 2REMA 1W4VA 1FO5A 3TGZA 2C8UA 4OO5A 3DMLA 3IK7A 1JLVA 3KJYA 3LFLA 5HR0A 1TRSA 1FB0A 5ECNB 2IMEA 1NHOA 4ZXGA 2I81A 2CT6A 4WR4A 2KP1A 1O85A 3K8NA 3UIWA 4G9HA 5ABRA 3GTUB 1Q4JA 1FAAA 4QQ7A 3PR8A 2FUG2 4DSSA 5ECMB 1F9MA 3IPZA 2C0DA 4NMUA 4X1UA 4LLRA 3WD6A 4MZWA 1FVJA 1XWAA 3CTGA 1EOGA 3M1GA 3DYRA 4J57E 3LG6A 1PRXA 4IVFA 3D5JA 16GSA 5DAKA 4ECJA 4F0CA 4RUVA 2R5GA 1WRYA 3FR9A 2EIQA 1GSUA 2FWHA 1TDIA 1JLWA 3EMXA 5G2ZA 5AGYA 2GT6A 1LJRA 4HJ2A 1K0CA 2N5AA 3BD2A 1TRWA 5KN3A 3W8SA 2C3QA 2ALBA 4MJAA 1NSWA 3MAKA 4ID0A 3IHQA 1O73A 3DGQA 2JSYA 4EDYA 2KOKA 4OFMA 4PGTA 5IIZA 4HU9A 3DXBA 5D9WA 1B48A 1YF0A 2WDUA 4WBRD 1RW1A 2XHFA 3LYKA 1GLPA 3TDGA 2HZFA 3APSA 4EF0A 1CQGA 4ML6A 3QAWA 1EP7A 2IMDA 3C1RA 4I2UA 3TJFA 5AISA 3QMXA 3ZVJA 5J4UA 3F6DA 3APOA 3RAZA 2JACA 3L9VA 4DVCA 3H4KA 2YZHA 2VCTA 3F6FA 5KN0A 3IA1A 2RLIA 2JZRA 3G9BA 3F4SA 17GSA 2KLXA 1B8XA 5EVOA 3D6IA 3G7YA 2VD0A 4J2FA 4K0GA 4K9ZA 1XWKA 6GSTA 2J23A 2WB9A 4ISDA 2OKAA 1PX7A 2HYXA 2PN8A 3C8EA 2EIRA 2CAQA 4MZBA 3FKFA 4TXVA 3QAVA 3R2QA 2GSRA 4N10A 5D73A 3V1WA 3UEMA 3CMIA 5GAND 3ME8A 3GSSA 4IN0A 1BQ7A 1WPIA 2HI7A 1HNAA 5ECPB 2LSTA 1PQNA 2H1GA 4DEJA 4L8EA 4ZL7A 3L0HA 5AIXA 3LQ7A 4WR5A 5IMFA 2H73A 1BJXA 2GZZA 3HJMA 1GLQA 2C0FA 3HJPA 2X8CA 3J7Yb 2VL2C 1T1VA 1YEXA 5HFIA 3I9V2 1GWCA 1FG4A 1R26A 1I9DA 5A4UA 2NVLA 3FYGA 3AY8A 3LXZA 3GN3A 1H75A 4Q5QA 1IYIA 5LD0A 3EURA 3ZMKA 3QD9A 2B7KA 1GTIA 3FY7A 4KSOA 2MYGA 4MPGA 4JEDA 4BPYA 1F6MC 5LNKe 1G7OA 5G5FA 5IPHA 1BEDA 3W6GA 4PURA 1M2BA 1M2DA 3HHVA 1TKDB 3P2AA 5B8AA 1DE1A 3TB2A 3EVIA 5F0GA 2L59A 5D96A 3ME7A 2LNTA 1MTCA 4KNDA 3ZREA 1X5DA 3A2XA 4IGJA 3C73A 3UARA 1XWCA 4JE1A 3ZMLA 1XW5A 2HSYA 4K7NA 2LRCA 1G7EA 2V2GA 1T3BA 2VD1A 5DQSA 5IMCA 3D0ZA 1GSSA 5IPGA 4L5OA 1LU4A 2NPBA 3VURA 3GRXA 4PQ1A 1PKWA 4Q5NA 1GUKA 3HVVA 1AIUA 3E9JB 2IWTA 2YWNA 2GS3A 5DJLA 2GZPA 1XW6A 1O81A 18GSA 4IBPA 2K18A 3WYWA 5G30A 4LA1A 2XBIA 3KP9A 5F06A 1HYUA 4Z7XA 2OBIA 3GMFA 3CRUA 5JWRB 1A23A 2B6MA 1GTUA 3CSIA 1K0BA 5C00A 3D4MA 2H72A 1XXUA 1K0MA 2L6DA 1XFLA 2G0FA 1JFUA 3VPTA 1XOBA 3CYNA 2XPEA 2JU5A 1YQ1A 1MD4A 4CW9A 3KTBA 3UAPA 2AUVA 2AJQB 3KP8A 1SL0B 1MDKA 3GSTA 3GUSA 4TR4A 5JCGA 3ZYWA 4AGSA 1K0AA 3HJOA 2AV4A 3IC4A 1O6JA 1Z7RA 2CVKA 5JWOB 2YP6A 2R2JA 2CVBA 1VF3A 4MMMA 3C1SA 2O87A 1DSBA 1VRSD 1ZL9A 2HT9A 3FRCA 2DJ3A 2F9SA 3GX0A 1UN2A 1YKCA 3TKRA 6GSSA 3EU3A 4PNFA 4O32A 1SK2A 2CAIA 3EC3A 3G7IA 4HI7A 22GSA 4GWRA 12GSA 2V6OA 4TR1A 4POMA 2LTKA 4I97A 5IO2A 3M8NA 3UMAA 2HZEA 1Z9HA 5AN1A 5ID2B
chains in the Genus database with same CATH superfamily
2GZWA 3L00A 1R5AA 2V41A 2FLSA 5CJ9A 2VC0A 2PMTA 2QWWA 3CCSI 4IHUA 3TKQA 2XF7A 1TRUA 4K2DA 2IFQB 2WY7Q 2YNXA 2ID6A 2MMOA 4IHVA 1EV9A 3JRFA 2CW0F 1D8JA 2V1NA 4EJUA 4YEJA 1HF0A 4XK4A 4G0KA 2X1CA 3E6BA 3KYCB 2H0IA 2PGTA 4BJ6C 1PUFA 1LE8A 3C7MA 4MLYA 1WJFA 1TRVA 5HR1A 4I76A 2DYSH 5FWGA 1BR4A 4XSXF 3BR1A 3E1SA 4V2FA 3U2RA 4BQAA 1V58A 2MZCA 3BCIA 3N9JA 4UUSA 4QL7A 4E8EA 3A01B 1ILOA 4BHPA 1NK2P 2DI3A 3O2PE 3CF5F 1GVDA 3QODA 4RB2C 4Y7NJ 4EM0B 2O03A 4H86A 2K85A 4N11A 5GSSA 1MDMA 2Y30A 3SQNA 3H92A 4BJ5C 5B7CA 5J6XA 1JZRA 2LJRA 3FMQA 5E3NA 4EQQA 1QHGA 4N4OB 5ECRB 2LRDA 5EG0B 1PX6A 4OOIA 5J1RA 2DOAA 2I9HA 2KFDA 3K4BA 1FHEA 3IBHA 5E1ZB 2HPIA 3EE2A 4DZPA 2EINH 2O7OA 4ZYEA 4HNTA 3LSKA 2H0HA 2K4BA 4OAYA 1XPVA 3KLNA 1TP9A 2H75A 4ZBBA 3VWXA 2W7NA 4M3EA 3C2BA 4I0BA 1T39A 4A5MA 2QF7A 2QSIA 1D1BA 1XDSA 4ZYGA 2VASA 2M30A 1IO2A 1USTA 4MCUA 2E7PA 4EIPA 2EK5A 2HR3A 3GVAA 2XIGA 4HYEA 1X5EA 1TBXA 1R5ID 2HOAA 5FFXA 3CCYA 4C9YA 4FCYA 4E7LA 1DU0A 1T4ZA 3IH2A 5J4VA 1EGRA 4IQ4A 1TJDA 3KH7A 4HX7A 3T5XA 3O3TA 5IMAA 2H71A 4ICYA 1ZKGA 2O5RA 3J7AY 3A0BC 2MBFA 3MNGA 5DCHA 2F5CA 4OCEA 3DIEA 4HF1A 3E7LA 3RZOJ 2C3NA 1X4OA 2LP0A 3CLQA 2DA3A 4MDCA 4KFCA 2PVOC 3F4TA 2VM1A 4GFBA 3MSZA 5IM9A 1TWAJ 4Q5SF 1OC8A 1U8RA 3CJRB 2XDVA 2VL2A 3GL5A 5E3MA 1F9NA 2IP2A 3PGTA 1Y0UA 1Z7PA 3CJNA 2CFOA 3M3YJ 5CRGA 1PJRA 4M3BA 5B8BA 3Q6OA 4HZ4A 2IS1A 2KQRA 3BJOA 3OR1C 3TJJA 4NV2A 4EE0A 4KICA 3D1NI 2DK8A 4F92B 3LYPA 3OYFA 3N5OA 2ELKA 1ZLKA 1C72A 1ERUA 2HSHA 1F5TA 2Y9ZA 3K4CA 4NDLA 1UA5A 3MKYB 2D45A 6GSUA 1B8IA 4JU5A 4I02A 1B72A 2P4WA 2PWJA 4KDYA 4KMUX 5FJ8J 5IOZA 3GURA 2LMDA 1ZYPA 3J7YJ 1M9AA 5J1YA 1KU7A 1JTXA 1X9WB 3CP8A 4B3XA 3VK9A 2WV1A 3I54A 5DCMB 3GKMA 2V6CA 3BPXA 3S3NA 3M9KA 4N0ZA 2X6YA 1V5EA 5ED4A 5C44J 5EL8A 4MH3A 2ME6A 5HDNA 4HSCX 5CQGA 1AAZA 2ADUA 4A3MJ 4BYYA 4MJEA 2OJED 3OYNA 4A3IJ 1QPMA 3ZCOA 1W0TA 1QUWA 4ENNA 4PUAA 2JSCA 4WCGA 1G3TA 5IY5H 1FC3A 3BJAA 1SU9A 2L9RA 3GX0A 3E0JB 2OE3A 1YJNI 1RRJA 1N25A 1ERTA 3BOAA 2AHEA 4CYCA 1AXDA 2R0QC 1FOVA 4JBBA 5E8GA 3TW6A 1IC8A 1BI0A 1BW5A 1J2XA 1Y1VJ 2FMYA 2LKUA 4HS1A 2MMZA 4OMYA 2PLYA 5ELAA 1A2LA 4PJNA 3ASNH 1N77A 4DNCA 6GSVA 3ZIVA 2UXXA 1QZEA 3FZVA 4OIPF 5HR2A 2X8HA 5J41A 1A0FA 2DDBA 5FLXZ 2R4VA 2BTOT 3ZL5A 2GQLA 4P1WA 4PUSA 2MBSA 2CV1A 3FXRA 4MPFA 4YELA 1AQXA 2WBMA 4LMYA 1RUOA 3ERGA 1TI1A 3C1DA 4QTRA 1YY7A 2LREA 1EJ9A 1A24A 1ETXA 4G12A 3CF2A 1F2EA 2H6YA 3B02A 1ZELA 5LGUA 1BM9A 3CUQC 2A68F 2ZXJA 3PQJA 2G0EA 5B5EC 2KPMA 1TU7A 2BZTA 1QXHA 1P7JA 3QR6A 3QOUA 3DQVC 3OIQA 2LK2A 1J08A 4TOPA 1GV2A 1B6AA 2CU7A 2LFBA 4R8HA 2KP2A 3DF8A 2P5VA 4RLQA 3ESWB 3H35A 3G3ZA 4LOCA 4M6XA 3GTLJ 1BW6A 10GSA 2MFZA 2BOLA 3PNVA 5CNWA 2OZ6A 2D5VA 4LJZF 2XAHA 1USSA 4CCLA 1B9YC 2RAEA 3W6VA 3OYKA 2DFEA 1WJEA 4LGWA 4QSHA 4PJ0C 5IYCJ 2R7UA 4Q5FA 1MIJA 4KDUA 1BX9A 4B3AA 3D5SC 5G5EA 2GZYA 2ES7A 2DMMA 3FK7A 1TWHJ 3LSGA 3LGCA 5IOYA 1BAYA 3OYGA 4MIMA 1JUPA 1RUNA 4BL7A 4ZDLA 3ZVJD 2WAQN 4OO4A 3J80Z 4F0BA 1KQ8A 1WPKA 4KDXA 2BY1A 1ON4A 2GXBA 1WP0A 1J0FA 1ACVA 4GTUA 3S15J 1G6WA 4Z2UA 1P6RA 3BDDA 1SAXA 3AFHA 1SEUA 1PA3A 3R60A 2DU9A 1LNWA 1SYRA 1O57A 1BG5A 2MBTA 4XLAA 1Z21A 1QFNA 2C3TA 2YSRA 3UJ1A 3VYSB 1NHYA 4XCSA 1JT6A 3S9FA 2PMUA 3BJ5A 3GBGA 2DN0A 2DOEA 2M45A 3E0UA 1M0UA 4CZCA 4IRHA 2HVRA 1ZYEA 1FB6A 3IDVA 1UZCA 3JRDA 3SXYA 4ZYDA 1H0MA 3Q19A 2E1MB 1FSHA 2V4JC 4TKYA 3BR3A 5L3EA 4BE0A 2GSSA 1TWCJ 5E3LA 3FXMA 1MD3A 1YQAA 3GXOA 3H0GJ 1OVNA 4AJ6A 4BIKA 2Y9YA 1WOUA 1T4YA 2ID3A 2PMZA 2KLOA 2E1OA 3PFIA 2DIZA 1FBQA 1G0TA 4GCIA 1D0XA 2XHKA 1O7FA 1JKRC 1S7AA 2V1XA 4R79A 4Z2TA 2YU9J 3PFYA 2F4MB 4LL1B 2F51A 4AU7A 3FR6A 1XCCA 4X0XA 3MD2A 4X43A 2FY6A 3TBIA 1REPC 5D4SA 2I1UA 1D0ZA 5EZHA 4YRVA 1GULA 1PFOA 2M80A 5FHIA 20GSA 3S1RJ 2A2RA 3L2UA 2ZC2A 1IRGA 2FD3A 2L02A 2HVQA 5J1UA 1ZRDA 2HYJA 1R5HA 1ZH5A 3L9FA 3TRQA 5KOXA 1O7LA 1X9SB 4TVEA 3HL2A 3QP6A 3O8HA 3VSKA 3GTGJ 3TKPA 1FYLA 1OAZA 3LORA 2VT2A 5E79C 1R7JA 3HPHA 2W1OA 3L09A 3I71A 2CW8A 2VLAA 3BR6A 4X4JA 2DMLA 2WV0A 2G2QA 1KTEA 5ICCA 2BHZA 3V8JA 2NS8A 2R6KA 2VQLA 4BAYA 3ELKA 1HKTA 1VF1A 3IR4A 1HQOA 4AWXB 2MGQA 4CXFA 1S7OA 5ECLB 4Z2YA 5G31A 3OS1A 1I50J 2H6BA 2QYOA 3HHHA 2IT0A 5HDGA 3CMMA 4TN8A 2VOPA 2YN1A 3EUHA 4NXIA 3A1YA 3IOSA 2PFBA 9ANTA 4DSSB 5A4VA 3CMEI 3DEWA 3W3CA 3DBLB 2LR8A 2DCEA 2FEZA 3K1PA 1ZHFA 1UHMA 2DW4A 3BQZA 4IXAA 3JRGA 1GUHA 2PUKC 2OQGA 3VI7A 3HOYJ 3IRRA 2JA7J 3KCMA 5DUKA 4IEJA 1Z05A 4M72A 2BEOA 3UL3A 2LEGA 3I5UA 3WTSC 2JPBA 4V19K 2X6WA 1TP4A 3QPLA 4E6KG 4KDPA 5IPAA 5L3CA 3DLLF 1XDUA 2O9LA 5HS8A 2P5LC 4D5CA 3W2VA 2IA0A 3ONQA 1YRNA 1I6XA 2GAUA 1QNTA 2O6GE 3HB9A 1SFKA 3JRIA 4DSRA 4ECBA 4RQRA 2HNHA 1QHHD 2B7JA 3OYBA 3DEXA 5HLIA 3BG5A 2JRMA 3F72A 3GFIA 1OKDA 3K6GA 4NUBA 1R6RA 1T00A 1UVZA 5DAKB 5TJJA 5DCFA 1YI2I 2LRNA 4NWYA 1FY7A 4BWQA 5BQTA 2CUEA 1FEXA 2R37A 3PSFA 4EIQA 2PMZN 2DPDA 2OQRA 4KISA 2L7FP 4BQNA 4CA0A 1MBHA 4KX4A 4ESJA 4TRXA 2E7XA 2EIOA 2GQKA 4ZB6A 2BMXA 2EILH 4O5RA 5EYRA 4D73B 3ZMTA 3WT2A 4F7ZA 2ZXHA 4HX8A 1JJ8C 1U9OA 2E0QA 1XC5A 2FBKA 2M7BA 2O3FA 3D22A 2XASA 5H5RA 2L4AA 2DO7A 2K7LA 2KDZA 1VQ7I 3P90A 4U7DA 1FTZA 4F2IA 1KA8A 3C71A 3JREA 2ON7A 2M5WA 3HDCA 1FYMA 5DVBA 5JFRA 2M7AA 3S17J 4I09A 4TW5A 1IXCA 3G1MA 4KN4X 3PO2J 2CW7A 5GP9A 3V7SA 2H19A 4AM3A 3ZTLA 2HXIA 5LGNA 1JUSA 2FWEA 2LD5A 2UV1A 1RQMA 2NVUB 4PFOA 4RAGA 1K0DA 3GKNA 3GIXA 2H6CA 1FT9A 4XOPA 2IPQX 2YR2A 5LLQA 2M72A 2PQ8A 4K2XA 3KH9A 4KCAA 5ELGA 4K5SA 2XB0X 4FX4A 2V9VA 1P4XA 4N30A 1ZCPA 4W1UA 3LFUA 5LEJA 1GSEA 5FT3A 2FNPA 5KAIC 3BG7A 2B5XA 4DJAA 4EXJA 5C04A 5FKOA 4LMVA 1ABAA 3F6VA 2Y75A 3W6KB 1MSEC 2H8LA 2PPTA 3KFWX 4YFXF 2PG4A 2KIMA 1MKMA 3FHKA 3RIRA 2EBIA 5GADJ 3A5WA 4Q5NA 2VB6A 2VXZA 3T1BA 2XVCA 5H20A 2XPUA 1QRYA 4D9JA 4ZZLA 3GKKA 5IOXA 3S32A 1ETKA 2FJ1A 4UV8A 4HDUA 2H1LA 2MC4A 3KM6A 1GSYA 5IMVA 2FA8A 1A6IA 1ZAOA 2LSOA 1A2MA 2DA2A 1G3WA 2BY0A 1ERDA 4QPOA 3VYTB 4HA8A 3TOTA 4EJTA 3BZCA 3CCRI 1O3SA 9GSSA 4LFUA 4DYQA 3L2VA 2BYVE 3WTTC 3F21A 2L57A 4HQSA 4XIHA 3VLNA 4MTEA 2K9LA 2XKOA 3FKIJ 4YIRX 4J00A 3Q5FA 4YQUA 2H09A 1F43A 3PPUA 1LKXA 5F0FA 1TT0A 3VWUA 2LDUA 2B1LA 1OCTC 3M9JA 2VBZA 3V8LA 3W6JB 4KE3A 1FVKA 3AAFA 4I2OA 2W48A 1X2NA 2CX4A 4ULXA 4D7MA 5JVGF 2RUEA 2FHEA 4IKFA 1CQTA 2EFWA 5ECIB 1BI3A 2D1VA 3BP8A 3FXOA 3GO5A 4L5JA 4BXUA 4LLNA 2JZSA 2R0CA 3IAM2 2QUFA 2O61A 2ZJQF 3AL0C 4GSSA 3SFZA 2AAWA 3GW2A 5CRWA 2VKEA 3HKZA 1FOXA 4B09A 2AQEA 2KRCA 2QQBA 1WJDA 3BR2A 2LKXA 1ZR2A 4QIWN 2TRTA 4I0AA 1VQNI 2P5RA 5DUIA 3IWZA 2LBFB 2RKHA 5DJMA 2X64A 3H3VK 3HYIA 3DD3A 1U6TA 4G7ZF 1WMJA 1UELB 4POKA 2V7FA 1OC9B 4C30A 1YHQI 2XAUA 3F0CA 1ZOFA 2QZ8A 1JGSA 1MH3A 3RI4A 4BEHB 2JQ7A 4WF2A 2QA1A 2FOKA 1HDDC 4XR6A 5K5OA 2HGCA 1VQOI 4X0GA 2M4GA 2ZB9A 2DJIA 2Y2ZA 2BY2A 3KZIC 4JP0A 2W84A 3LL7A 3RPNA 1DDNA 1EH6A 1ORKA 2E2HJ 3HC7A 1ZREA 2IMKA 2DPUA 3VEPA 2W00A 2Q2EB 2QQ8A 3FXLA 2OC6A 2CZ2A 4QLCU 2CVDA 1HA8A 5DQYA 1JHHA 1FMWA 1V55H 5D6FA 2H1BA 4FT8A 1HKQA 2V79A 4I7HA 3PO3J 4FH8A 3ISPA 1PKZA 4IVNA 4OD7A 3OYIA 1V5FA 4EGZA 3J81Z 4FISA 4O92A 5E59A 2E2MA 2RM5A 3FK8A 3CC7I 2IL3A 2BY3A 1PGTA 5DYMA 4ZDOA 2P5QA 3TOBA 3WGHA 4S05A 1J59A 1MEKA 1TNSA 2XF5A 1ZARA 2GLRA 4MZCA 2ISYA 2J5OA 2QVOA 3I6AA 3R0AA 1RKTA 4S04A 1IN5A 2NOGA 3J7Yk 3REOA 1FIPA 2IIYA 3ZIJA 1WGXA 1O7UA 1JHFA 1Y1WJ 3UVTA 3CO6C 3VI5A 2EH3A 5DM6F 2RUFA 2STTA 3A2WA 6GSXA 1GUMA 1YOVB 4MF6A 1T0FA 2E7WA 1UAAA 2R7RA 4PQHA 3CBUA 4L0YB 4E7SA 3PH9A 5FO5A 5L3FA 3RPUA 2WULA 2DIYA 1SD8A 3GMEA 2M8GX 1MBJA 1EOHA 1I1GA 3H9GA 11GSA 2LVSA 2ICWG 2GOXB 2DJKA 3IH4A 4HLXA 4P9FA 4BA7A 3KZZA 1BI1A 4XL9A 4U7BA 2R7XA 3UBKA 4ZBAA 1Y8QB 3QYFA 2QSHX 1Z5YE 1JE8A 2AO9A 1LPQA 4KNYA 3WGXA 1ITYA 2W24A 4A3CJ 3OIPA 4UUVA 5GPCA 2WJUA 2P6SA 2EFQA 4KITB 2G7UA 3F8UA 5DDLA 2ELJA 1CF7A 5KCMA 2ELHA 4N0BA 2DTZA 5H6RA 2RDPA 2Z9SA 4L9VA 2HRNA 5DEQA 1IN7A 2FX0A 2VBYA 3JR9A 2IVMA 1A0RP 1D1CA 1PMTA 4AD9A 1U5TB 3I43A 2LY9A 2DMUA 3H9JA 5EGOA 4LL4B 2DMTA 1HC8A 3LW9A 2BVMA 4K7IA 4OIRF 3KP6A 1TU8A 3QU3A 4W97A 2B3SA 5F07A 2KKOA 2TIRA 3GZ5A 1GVJA 2P5KA 1X9MB 4NHWA 1K4SA 3ZMVA 2VM2A 3LSZA 1XW9A 1ULYA 4BL0B 2DXIA 3VFIA 1EF4A 1ZMAA 1XD7A 4NNJA 1DPRA 1FIAA 5B1BH 1RR7A 2A6EF 2OA7A 2PMHA 1X1BA 2VJIA 4E4HA 2DLLA 2LKSA 2A2SA 4FYUA 3GZNB 4LIVA 2FQ3A 2K9MA 2KT0A 2YANA 2LF7A 4F55A 4BGDA 4BY1J 1W7PA 3MQ0A 2VT3A 3F23A 2H74A 5EDNA 5IMDA 4WXTA 4PFPA 1A8LA 2QKEA 2X6XA 2VCZA 1BBYA 5DBQA 3TRXA 2GA1A 1O3QA 1ZGNA 2M1BA 2HNLA 2VL9A 3JRBA 3RCOA 4UVCA 2YWMA 3KD0A 4IJ3A 3LSPA 2JA5J 2LJKA 1D8KA 4Z2RA 4CO8A 1OJLA 3MKLA 2HQ5A 4LLLA 1NH3A 4TXOB 2MW8A 3WHBA 3HRTA 1FP2A 2ZXIA 1DUGA 1Z91A 4Q4ZF 1PL2A 1SJ6A 1WHUA 2P31A 3IHGA 4EL1A 4XRSG 2MLKA 1T38A 4XLHA 1W5SA 2PJRB 1SMYF 3IUOA 3FK6A 2L7KA 5HODA 3HOVJ 4HOBA 1TI3A 4NV5A 2PX9A 1JGGA 3HZ4A 1GNWA 3CCLI 4AVZA 4L5LA 4OFNA 2A5YB 1YDKA 1P4AA 4ECIA 3TJGA 4II3A 1GRXA 4I2TA 2VAFA 3WTWC 3GKXA 1R1VA 2M3AA 4FO5A 2VQHA 2EZIA 1XVQA 3BLYA 4S0HB 1LBKA 1V40A 4LG0B 4MF5A 4A5NA 3BJ6A 1B59A 3FHNA 2QCOA 3SWLA 4NBQA 4KMFA 4HSTA 3V4GA 1PD21 2BVLA 2EIJH 3HYPA 2WY8Q 1HW5A 1Z7LA 3EPZA 4KT6A 4DBRA 1FW1A 1QK8A 5B6MA 1CQHA 3M0FA 2CX3A 5KOWA 2XB5A 1BR1A 3KP7A 3SYTA 4ZH4F 1WIKA 2WFCA 1W36D 4UVBA 1IW7F 3OS2A 3F8BA 1Z6NA 2GDRA 3E5QA 5EPFA 2AXLA 2YWIA 4CY6A 1OKRA 2X4HA 3GWZA 1VZ0A 1VQ4I 2PU9C 2VC1A 3RPQA 5ECKB 4ZYAA 3VWWA 2TRXA 1PUEE 3EUHC 4GSNA 2M8EA 3TP0A 1X1AA 3F8FA 4G6TB 4OINF 5D8KB 1JI8A 2PERA 2OUMA 4KUNA 5HFKA 4PZJA 2JTVA 4GQFA 2E71A 1AWCA 1GSFA 4AJ7A 3I59A 2F6CA 2R5YB 4CH7A 3ABMH 3F63A 2LNSA 3LSMA 5FRMA 4O3MA 4I6XA 5FD5A 2FA5A 1AQWA 2QBYB 2OBPA 3PSIA 4PXOA 5DALA 3LFKA 3TDUC 1V9WA 3IWFA 4AJ8A 3M1EA 5IQYA 2OU2A 4POLA 3A02A 3HD5A 4UV9A 3VYUB 5M5WJ 3DU5A 1R7HA 2VKHA 1NHAA 2Z3YA 4RQXA 3IV4A 1MNEA 2OADA 1TW3A 1VQKI 3U21A 2Z5UA 1SKRB 3KTLA 3NWTA 1F3AA 2COMA 5BPIA 3E6DA 1IXSB 3LNQA 3O76A 4HEA2 1H88C 4D7NA 4KN7X 2VKVA 1DPUA 3A5IA 2BHYA 3CESA 5HNHA 2WZ9A 4MFEA 5TGTA 5E1WA 2KIFA 3Q9SA 1GTBA 1YTYA 5F64A 3TO7A 2F8AA 3MN2A 4EVMA 1XPXA 4K8MA 2DBBA 3NAUA 4E7JA 2ECBA 3OR2C 4XQFA 4CHUA 5JHFA 3ZRDA 1RETA 3ABKH 1U87A 1KEBA 2VI6A 3H1CA 4FYCA 4G2EA 4MH2A 1BOBA 2C0EA 4XS4B 3RQIA 5LGTA 1USBA 4HUAA 2QSGX 1AW9A 2VO4A 3WT1A 5LHHA 2VIMA 1Y6IA 2RV8A 2X9DA 2XRNA 3OYDA 2I4AA 2OCEA 3OOPA 4V2GA 1ML6A 3ECOA 2NNNA 2FMLA 2ZJRF 3QPMA 1I27A 3JCML 4O7HA 3F8CA 3BR0A 19GSA 3CXGA 2LS5A 3S1QJ 1X5CA 3QFBC 2CQ9A 1OYYA 5L71A 1ZK8A 5L3GA 3E97A 4HDEA 2IA1A 3MZYA 2E2GA 4YAVA 2DT7B 2QKLB 2AQFA 2DOFA 4N9IA 1O8XA 2C0GA 2V1UA 4YIFA 1I39A 1ZTRA 3VPRA 4AIHA 4BQQA 4C3JJ 4YFNF 5DDGA 1K3LA 1KBNA 5H5SA 3KYDB 2UUZA 1B4QA 5BNGA 2KUCA 2EZHA 3ZN1A 1I5ZA 2HRKA 4XIDA 4I98B 3OY9A 3S2DJ 1E0EA 2JJ7A 1A5JA 2GQMA 4JOMA 2BW3B 2VE8A 2FOWA 5GZZB 1YYVA 3ERED 4Y33A 2FXAA 1VGLA 3V7RA 4EJVA 3HZ8A 1MH4A 1SJIA 3ERMA 3W8JA 2ECCA 4X1EA 1T6SA 1YS7A 3GHAA 1W1WE 1GT0C 4PCQA 4IRIA 3Q18A 3ZFLA 4EM1A 2MLGA 1KYWA 2MA3A 1ZQ3P 4PSWA 2AYTA 3EMPA 2EFOA 2GOMA 3ZOBA 1S8NA 2R7FA 2XSJC 5BMZA 3EWLA 1R1UA 3GUDA 1THXA 4JX6A 4WKWA 4EATA 4JR4A 2OJLA 4XS1A 2K3PA 3M8EA 3DVWA 3ASOH 4ZC3A 3KMNA 4M71A 3E6MA 1E6BA 4DW6A 3QCPA 1AU7A 2VUMJ 4KW6A 4RDUA 2GXGA 1UMQA 4MNNA 2ETHA 4IX7A 2FQ4A 5D5WB 4CDOA 2HZEB 5FD6A 2K6VA 3FR3A 4XLNF 3SFIA 3HRSA 4L18B 4ZB9A 3K4NA 3IE3A 4DGWB 2BE5F 3FHZA 1TQMA 3VWBA 5E20A 4MEYF 1AA7A 3QU6A 2HFDA 2PVQA 3FEUA 2FRHA 5E17F 4PK4A 4UNOA 3KP3A 2V9KA 2AXTC 2CA8A 1QMVA 1SMTA 1XTAA 1SFEA 2B5EA 3G73A 3K0LA 4LLGF 1ST9A 5KHDA 2CQQA 4Y52J 2L01A 3FXKA 1V2AA 5EZGA 1PUFB 1LE8B 5EJCA 3AG2H 2AB6A 4G19A 3H1NA 2N8GA 5LEKA 3LA2A 3IHUA 1XZOA 3L9UA 3U9GA 4UUSB 2QGUA 4TV7A 2V32A 2IXSA 3RJPA 4HW0A 4HNVA 2HOEA 3WE2A 1B9MA 2RREA 1HD2A 3KIJA 3BTCA 1WE0A 2P0GA 3GTUA 1N8JA 1MJAA 4FTHA 1Y8RB 4N9HA 4RBOA 4MK3A 2ZMEC 4O6JA 2L6CA 3KZQA 2Y0SA 4NAXA 4BUPA 3RDWA 3HVSA 3TW7A 4G94A 1DGWY 1OQYA 3K70C 4NB5A 1IRFA 2FU4A 3L2RA 2VJ5A 3GYHX 3N05A 3TGNA 2KRHA 2HQRA 3QP5A 4M3DA 4LB5A 4A3LJ 4YH2A 5CQEA 1XMKA 4XRMA 4KA4A 1EZKA 2R3XA 1FOWA 5HDKA 2VIXA 3CJQB 3LA3A 4EKZA 4NC6A 1YG2A 2HYGD 3VOEA 2CUFA 2GSTA 4CUGA 1B9XC 2A2PA 1KU9A 3L4NA 3PIOF 4I8BA 4U0VA 1Q98A 2K27A 1XMAA 4LK1F 3H36A 4IOAF 2DLXA 2F8FA 2VBWA 4MFDA 2GSQA 1OFCX 4FASD 1AHDP 3RSNA 3SJMA 2R7ZJ 2WRTA 2YZUA 3GA4A 3J80K 2OPTA 5CRHA 4OU0A 2Q1ZB 4UB6C 4LK0F 2IN3A 3RKYA 1XG8A 1YJ6A 4ZBDA 3N4MA 3FZ9A 3EQLF 2OTJI 2YV7A 4ECCA 4ACSA 1EV7A 2IGMA 4XOTA 3CQZJ 3WGGA 4CCNA 2XAJA 2HEOA 2VCVA 4WF5A 5LD2C 5GTHC 2VODA 1AC1A 1MNDA 1XGSA 5CVJA 5E3OA 1T08B 2ISZA 1MBKA 1LFUP 4XS6A 2DSAA 2DQLA 6GSWA 3ZMSA 4F52A 5A4WA 1T33A 4C2MJ 5F08A 2R0GA 5B66C 1T0FC 5C4JJ 3KPHA 2DJNA 3Q0VA 1J5YA 4PDKA 1ON2A 5M5YJ 4X6AJ 3QAGA 5GAPD 1QQIA 1XBSA 4HQEA 1B8IB 1T7PB 4MGRA 1B9NA 4YIIA 4TR3A 3QOPA 1V57A 3HTUA 3EYIA 2IPAA 2YCDA 3TKSE 2TCTA 3ZQGA 1P2FA 3BOQA 1OPCA 2ZNYA 1IGNA 3FMSA 3LXTA 3LQRA 3MZHA 3A03A 1GNEA 1TOFA 1GL8A 1HBXG 1SD9A 1WQ2A 3NQOA 2CRGA 5FB2A 2P7VB 4OCFA 2VL8A 2FCHA 5GSTA 2IMIA 2EQRA 1EP8A 4M6VA 4BE1A 5J9CA 3FZ4A 3ERWA 3MZ8A 2JRTA 4A3EJ 5D8IA 2MYSA 2DQRA 2NTOA 1U9NA 2CMPA 3US3A 1ZG5A 2ZNZA 3AKZA 5KN1A 3BCKA 3KZYA 1M1EB 2JPCA 4IRGA 3BG9A 3B6AA 5ERIA 2K9SA 4CYCB 4A3BJ 4XRFA 2RM6A 2RGVA 2R7SA 3PINA 2MD0A 3EUAA 1K3OA 3I56I 1PL1A 1U3EM 1TXXA 3R61A 1YIJI 3HY2A 2D2ZA 1LB2A 2V6KA 5ILSA 3CP2A 2E1CA 4C2UA 2C4JA 4PTSA 5B6NA 1X1DA 3HGYA 2C80A 5L3DA 3WGDA 2Y0SN 3ZZXA 4BVYA 3RHBA 4XTSA 2CQKA 3IP4B 1X3ZB 4G7OF 5KEJA 3HOSA 2Q8KA 2RIIA 4OMVA 1LEBA 3LOCA 1ZG3A 1ZGJA 1BOAA 2PN6A 3J7AO 2XC2A 3PQKA 5FROA 3IKTA 3OSGA 3E3EA 3H93A 3I64A 3KYLA 1FOKA 4BJTA 3E3VA 3FDYA 4BU2A 2VE9A 2VOOA 4ZL8A 4M73A 2VN2A 1Z3XA 1S7EA 4NHJA 2O85A 1ETOA 4Y3OA 3H9QA 1EEMA 2B1KA 3KMOA 2ZSIB 4HOJA 4IQAA 2ME0A 2HZDA 1AQVA 5F27A 2NS0A 2FBHA 4QL9A 2NXNB 1E17A 3GYKA 1QVTA 3K10A 3CD6I 1URMA 2HDDA 2H0GA 1QGPA 3BT9A 2EC4A 4YKFA 4EC0A 3ZRGA 2WB1A 1S5LC 3PL8A 1SJZA 1XGOA 4A3FJ 4K2EA 1P9QC 2OAZA 2GQQA 4D73A 2L5QA 2H66A 4KYWA 1YO5C 4AIJA 4HX4A 1H4OA 3NOFA 2F3MA 2WA0A 3L9SA 1HNBA 3F4RA 2A07F 1M7TA 3ZQ7A 1AKHA 3HIFA 1S6LA 5IP7J 3I4NJ 3JSPA 2GGTA 2LQOA 2V1MA 2CV0A 3VYRB 3ZQHA 4B4CA 1DP3A 5F0CA 3JAMZ 1TW9A 4PGHA 2KISA 1HSJA 1B4PA 1X4PA 4ZZDA 1R1TA 3SDGA 5CAXA 3GLXA 1I5GA 2DFHA 2J5PA 1U6GA 5IT9Z 1DQUA 1EGOA 3CCQI 1PP8F 2LYCA 1J7KA 2R3SA 2GT6A 1SAUA 4IOCF 1K3YA 1XOAA 2X8GA 2P81A 1XN7A 3LWFA 1SENA 3ERFA 4K0NA 1MZBA 3VWVA 4HZ2A 3RHCA 1HW1A 3HUGA 3GL3A 2RN7A 1M9BA 5CO3A 5ECQB 3HDDA 3DKXA 4F3QA 4AIDA 1F1ZA 1ZYQB 4BNCA 1A8YA 3QDNA 5J9BA 3F3RA 1NW2A 2LY1A 4GYIA 4IQ1A 2DMNA 4B1RA 2H76A 1UHSA 2NDOA 3A3TA 2YS9A 5FFZA 3GTQJ 4GGGA 4HSRA 3AG1H 2RVCA 3LSIA 3TKSC 2HQNA 4KIGA 4IL6C 2JUCA 5B1AH 4G10A 2R5ZA 1J9IA 2VQGA 3CDHA 5H6QA 1SK0A 3EPTA 2VLVA 5D9TA 4ZILA 4Q5RA 1R49A 4I6ZA 4I5QA 1FP1D 2JVGA 4Q47A 1MJ9A 1T98A 2B5YA 2QA2A 2IGKA 1J9BA 4L0ZB 1N2AA 2JL4A 5F0HA 1FWZA 3IC7A 3MCZA 2DK5A 2DBCA 4OWRB 5H2FC 3BCAA 5A5KA 4DIQA 4BE2A 2HOSA 1R4MB 5H5QA 1Q1HA 1MNMC 2PBIA 3S2HJ 4G6DA 5F1JA 3FXUA 3DPTA 2H70A 2NVTJ 3DRNA 2K8SA 4KIFA 2JT1A 2HE3A 3SDBA 1MD0A 5A2QZ 2H27A 2VQCA 1M2AA 2IRFG 4C2TA 4XHMA 1S9HA 3P7NA 4LIUA 2CV2A 2EB7A 4IKHA 2F5FA 1SC7A 2GVPA 4RGXA 4F82A 3ED3A 3B6CA 2YWOA 5FKMA 4J56E 3LSRA 4IO9F 2NBSA 2HSMA 3ZP5A 2KZGA 1Y25A 1MMAA 4KGIA 4ASNA 5ECSA 4KCEA 1ODDA 4PJMA 1ENHA 4ZDPA 2X85A 1YKAA 2CO5A 3RKQA 4DQ2A 1H9GA 3TO9A 3CSJA 1EEJA 3CJTB 3CO7C 4LB6B 4XKCA 1R5PA 4MQ9F 1WJKA 1OCPA 2LRTA 5J47A 2XPDA 1OYWA 3OYEA 3G6EI 2L5LA 2QGVA 4ZIJA 2JA2A 1QGVA 2E34A 3EU4A 4XRDA 3RYRA 4ZB8A 1RIOH 2LBFA 3GF2A 1OC3A 3L78A 4FE4A 2ON5A 2HQAA 2YV9A 2OE0A 4IS0A 3ISOA 3GTKJ 4MA9A 4L9NA 3WODF 1FTTA 2H6XA 2LC2A 3CSHA 1OC9A 4CCOA 2DJ2A 3LEFA 4LG3A 6GSYA 3Q9VA 4Y4RA 3F9UA 3RTRA 1S3JA 3P9IA 3T8RA 2N5FA 1DE2A 3HA9A 5AIVA 3I3LA 2ZUPA 1QBJA 1YZXA 3IK9A 4V1Ap 1TL8A 2PJPA 4JR6A 3LMMA 4GQCA 3UNGC 1I3QJ 6PAXA 3WU0A 4PSXA 2Q2EA 2KDOA 4G8XA 1EV4A 1K0OA 2F5VA 4ILFA 2ZFWA 4V2LA 3TEDA 4WBJA 5IMZA 3HTSB 3O6TA 4WXDA 2O8VB 4ML1A 5EEHA 5HNFA 2XF6A 1R22A 5G1LA 4A0YA 4F91B 3HRUA 4F9ZA 1BC8C 2JADA 2UXNA 3QRFF 1U78A 2ZKZA 4M9XA 4CY8A 1V98A 1IV6A 4BDZA 3DKYA 4HQZA 1UC7A 5K7ZA 4YAPA 4DOZA 3PIPF 2MMNA 4XN3A 1ZGWA 1Z6MA 5BOXA 3K9TA 4WEYA 1FLIA 1SVMA 1X0RA 2D1HA 5M5XJ 4RI7A 3ZITA 4HZFA 2CZ3A 5B3SH 3MKZA 4XKBA 4GF0A 1ZLJA 1HOMA 2IMFA 1W7PD 1MBEA 2E35A 3TDZC 3C7JA 1PYVA 2GM4A 1M99A 3GLLA 3L2QA 4MABA 3RPPA 4HLYA 3BCBA 2DAOA 2EFNA 1Z77A 4E7HA 3GZ6A 3HVXA 3MDKA 3TQNA 1ZG1A 5KN2A 3Q0UA 1I6HJ 4Y15A 4CSWA 2ZMEA 1JZDA 2DA1A 1SFOJ 2K8VA 1UCRA 2H6ZA 1KGSA 1H89C 2TDXA 1JUMA 4NQWA 1NG7A 1L0OC 4IELA 1HCRA 1EWXA 1U3AA 1UG0A 5J3LA 1K78A 2H30A 3WHCA 3G7JA 7GSSA 2PEXA 4CYDA 2WCIA 1VF4A 1ETYA 5K5RA 4KH7A 3HOWJ 3UBLA 4NC7A 3RZDJ 3LWAA 5D9XA 3GFKA 1H8AC 2HVSA 4M3FA 3BY6A 2DDAA 1BR2A 1JZWA 3I55I 1U3IA 1GHCA 1MGTA 5F8BA 1F3BA 3M4OJ 1T8IA 2M0CA 2VOCA 1VF9A 8GSSA 1IAWA 4WX9A 2J9HA 4N0VA 2H8WA 1IJWC 4N4NB 5HLGA 2I3YA 3LSTA 1LJRA 4MNUA 1MMSA 3QFAC 4UUTA 1GP1A 3KEOA 5IO0A 2JSPA 1R9TJ 1YW8A 4PQIA 2R7WA 4E7IA 4RI6A 1G6NA 3E5UA 5JCWA 3W2WA 2A6TA 1GTAA 2CV4A 4K6XA 3HKRA 3EINA 5GAGJ 2E1MC 2DJ0A 4QPQA 1S3AA 1SD5A 3KEQA 3OSFA 3BR5A 1X2MA 3EDPA 2A6HF 2A05A 5FKNA 3I0TA 3EYTA 4FYBA 2CG4A 3IL2A 3KXOA 5CYYA 3IRQA 2FWGA 1WWXA 4L0UA 1X1PA 1HW2A 1OMIA 3F8MA 4ZJZA 3R6SA 2GIVA 3U6VA 2GXAA 1E3PA 4TXOA 4L5IA 3FZAA 5F05A 3KETA 2R93J 2I10A 1TNTA 4NHZA 1YJWI 5JVTA 3UOMA 2GLOA 4F03A 2E2IJ 4BXFA 1ON1A 1FPQA 1W5CC 3SHFA 3CCUI 2RQPA 1Y39A 1L3LA 2PJRA 1XVWA 3TJKA 2VUPA 4GRFA 1ACIA 2HWVA 3OL4A 1WJAA 4FIWA 4ANJA 2STWA 4G0LA 3MWHA 4CDGA 1RESA 3M3MA 3WU1B 4POBA 1R4NB 2KIUA 3DU6A 3QYEA 1MDJA 3TRPA 5HS9A 2VONA 3MIXA 1FZPB 2QENA 1IDZA 1ZN2A 1LQ1A 1OKTA 3ROUA 1RK4A 3ZLPA 1HLVA 3BROA 1DGRM 5F6FA 5FKLA 2LJAA 2Y69H 3Q74A 3HKZN 2C1YA 4HJMA 2IJYA 2A4VA 4AYBA 3IV5A 4B47A 5JWQB 3A2KA 3JCUC 1OE7A 4G9YA 2VCXA 4KA0A 3TOUA 4YQVA 3WTZA 2IA2A 3HOZJ 2BJXA 3H8QA 2L3DA 2K9NA 4IPAA 3F0IA 2QQAA 1TW2A 1BA5A 1YEPA 2H1DA 5EEGA 3G1OA 3HZJA 5K7FA 1VNDA 3S3MA 1F37A 3GTMJ 3F3QA 2R7QA 1IV8A 2JZTA 3MYDA 5ECOB 2HI3A 3DV8A 1WH5A 2WC2A 5IYDJ 2P7CB 4XRAA 2WADA 1A6QA 2DC5A 5D9VA 1SKSB 5F04A 1WRJA 1GDTA 1O3RA 1PN9A 2LTPA 4M74A 4Y17A 2A4HA 1OCOH 2X6OA 3NRVA 5E1XA 5CLSA 1VQPI 4A0XA 4CCKA 1YITI 1X19A 4IHWA 3NIVA 3TJBA 1HXDA 4BVXA 3CUQB 5HR3A 2H1AA 3A4CA 2W4SA 5DCGA 1IZ1A 1JHBA 2X0LA 2LLKA 1KZHA 3WTXC 1PSQA 1TQPA 3KEYA 4IF4A 2UZKA 1QQ2A 4K7OA 3FM5A 2VJ4A 2W57A 4JX4A 1SYXA 1T8EB 5LCZA 1PDNC 1Z3EA 2M46A 3U5RE 4PNGA 4BWSA 4E8HA 2QQ9A 3QQAA 2OA4A 5BS6A 1MDIA 1ZZYA 3KEBA 3RBTA 4JYKA 5CKTA 4YQMA 5D4RA 2IAIA 3IC8A 4MF7A 3GTJJ 4OWYA 2QKMB 3FZ5A 2N5BA 3H79A 3LAPA 4GSTA 4WETA 3DTIA 1K0NA 2Y31A 1VQ5I 5D5XB 4BKXA 2CQ7A 5TISC 2JWTA 2DT6A 4Y13A 5ID2A 4RLFA 3L2WA 1E3OC 5ILVA 2AS5F 4GDFA 2IFQA 4A3DJ 5J3RA 3BPVA 1PP7U 4M6YA 5HFGA 1QO0D 3IKVA 2WGRA 4HU7A 1WKMA 2QSFX 3VODA 2LH9A 2VL3A 3NZNA 1VTNC 2HTSA 1IG7A 4XS4A 5COHA 3BTJA 2E5NA 1GH2A 3DPUA 5L3BA 1V5GA 2DMQA 3MMYB 3MVPA 5EGOB 1A35A 1GSDA 3A01A 4B8XA 4IW9A 1YLFA 4R1HA 5J8CA 3K4MA 1RR8C 3HSRA 3KLOA 13GSA 1O8WA 2E60A 1T56A 4PGGA 2X49A 5IOWA 3OR5A 5JCUA 1FSEA 2ZJ2A 4XNFA 2YJ7A 2VLTA 1R00A 3TKSA 3PJRA 3KP5A 1JT0A 2R7OA 4IHXA 3DVXA 1KONA 4PJJA 4OFTA 2VCWA 2DFIA 2HZTA 2O89A 2L4CA 5EG0A 1K4TA 2HFHA 2H8RA 5HQPA 2COBA 3ULQB 4A6EA 4AYBN 4HDVA 1VQ6I 2VPLA 2VLUA 4MJBA 1UG2A 4O5VA 2XGXA 1JKPC 5D93A 1I1SA 1HNCA 5BMUA 2OD5A 2F2EA 3V42A 5J5NA 4EUYA 3OIOA 1OE8A 3D21A 1X3WB 3M9AA 1GV5A 4BHBA 4P5OA 3N97A 4XMYA 4NPBA 5CP1A 2X51A 4A3KJ 1DBYA 3VDXA 3R4KA 2MH2A 1U88A 2OCCH 5JR3A 4RGUA 2Z16A 5CREA 4P3YB 1SVLA 2VCQA 3HXSA 5K1YA 4MP4A 1K83J 3H5AA 3ZQIA 1SK1A 2L5OA 4V1Ag 2HXKA 3ZQFA 4GO1A 5K7HA 1M3JA 4IP1A 4YKGA 2JSZA 1IYHA 3SBCA 4ZTFA 3UVHA 5LFAA 1G4DA 2EPFA 2LY2A 1G6YA 4L0WA 4CZZA 2ZJPF 5E4WA 1ERVA 4I99C 3APQA 3FM3A 5D8LB 2W82A 3H0DA 2GT5A 5HVQC 4JRRA 3TP3A 4V2NA 3F6OA 1Z0XA 4L9TA 3OWTA 2LG4A 2TRCP 1R58A 2HDWA 2FWFA 3RQ4A 3S14J 3HBLA 3F22A 1XWBA 4IP6A 2L0KA 1Y6EA 2FD5A 4GYGA 4K1FA 3BBYA 1YX3A 2XAGA 2YPMA 1OCZH 1WI9A 1MJBA 1MBGA 1A31A 2DA6A 1SD6A 3GV1A 3KGKA 5CYVA 3OYCA 4KSMA 2E19A 4OIQF 3M7GA 3DEUA 4RB1A 3IAS2 1EH8A 4MQVA 2YJHA 1E2YA 3P7XA 4FQUA 1TTZA 3VPQA 5CPRB 5DCMA 1DP7P 4G0IA 3CCVI 1WZ2A 2GTUA 3WGEA 2WWYA 1P92A 4ENKA 4JZQA 4FX0A 3VSLA 1TWFJ 2V9PA 2HKOA 3DWVA 3P9KA 3R0JA 5KVRA 4KUMA 2DJJA 2XBQA 5ECHB 1TK5B 2M4KA 3DKSA 1WJCA 2MMAA 1BJAA 1ETQA 1ERWA 2LOOA 1VQMI 2LUSA 3QYBA 2DODA 2PBJA 1A2JA 3DCFA 4A12A 4XSZF 5IP6A 2L9NA 3I59B 3K4KA 4WXCA 1IN4A 3J7ZI 3JSOA 5JLWA 2O8XA 1WWJA 2MC3A 4WXHA 2EZKA 3CRTA 1JKQC 3FW2A 2F5EA 3MFKA 2Y0MA 4KIBA 4PUFC 2Z2SB 3WTYC 5DALB 5AIPA 5CRDA 1RPWA 3DP7A 4GXZA 3SZGA 2NVXJ 5EY6A 3P8WA 2OE1A 3HSEA 1R71A 1JZOA 3ZQLA 1LDDA 3LQQA 3VFZA 2NS7A 4ETSA 1TK8B 1XIYA 2WAEA 3BZ6A 2K9FA 1YS6A 4HBLA 4DZJA 4M9SA 4TR1B 3KP4A 1FX7A 1TZLA 1X1CA 3KCCA 3IXRA 4A3GJ 1XWGA 4I01A 5HLHA 2H01A 2YOIA 1SKWB 2CWEA 4JBAA 1KU3A 4K5RA 4AF2A 2MD5A 2OF7A 3TCOA 4CHSA 4PX1A 2DKHA 2HLSA 2FA4A 5FLXK 5KAFC 1GSQA 1S3CA 3AG3H 3K69A 1SL2B 1MSFC 4BY7J 2HKXA 4IJIA 1AUCA 2OBKA 1IF1A 2R7VA 2RQQA 1OCCH 1TTYA 2X99A 3GTOJ 2X1DA 4EO3A 2WS2A 5G1KA 4AVPA 3I69A 2L7MP 3U1KA 5TRDA 4KAEA 3QPSA 1NM3A 3HPGA 2CUZA 5AONA 1S3DA 2WAQA 5LHGA 5M3FJ 4EDZA 1B4AA 2FNOA 1SD4A 4BBSJ 3ZXSA 5DS9A 2M0MA 4G7HF 4ZYHA 1MDMB 2DKIA 3GH6A 3HOTA 2DJ1A 1THOA 4O5QA 5ENUA 2OV7A 2EV5A 1G3YA 2YUSA 3PNYA 5LRRA 3RYPA 1X58A 1YF1A 2A3SA 2ZNMA 1TWGJ 1WJBA 2LV3A 2ZCTA 1U8BA 4EJOA 4LMWA 2XAQA 2XKPA 1IDYA 2KHPA 5INYA 3PM1A 4MJCA 4WF4A 3WU2C 4G6QA 3GNJA 1TK0B 4MHGA 1VF2A 2QC7A 2G7HA 3ZFBA 4ZL9A 1YW9A 1R4WA 2E36A 1U5TC 1FNNA 2UWMA 5FLMJ 3BZKA 1BYEA 2W85A 4U0WA 3I4PA 3HCZA 2HDCA 2FGXA 3IRAA 2RC4A 4E70A 1Z67A 2L4QA 3A2VA 3TUEA 4A5PA 3BTIA 4KB3A 2ZCWA 1RI7A 3TOAA 4DSQA 5JI6A 1RZ4A 2HRFA 2LQQA 3CTFA 4RM2A 2ZFUA 2F4OB 1KNGA 1W89A 3GX8A 4TR0A 2MG4A 2JA8J 2OACA 2O7KA 4GLTA 1OYJA 1D5VA 4V2MA 2M2EA 1VFCA 2P0WA 1SL1B 3HJEA 3LJRA 1I3AA 3FXJA 1G2HA 1Z7UA 2E5ZA 4AUXA 2REMA 3UR3C 1W4VA 1QVUA 1FO5A 5KNLA 2K5CA 4Q48A 2C8UA 4OMZA 4J01A 3TGZA 4OO5A 3DMLA 2DMPA 2BXZA 5GTIC 2XUBA 2IS6A 3LAJA 2QM3A 3KX2A 1GUUA 4XN0A 2JVHA 1X3UA 1JLVA 3AL0B 3IK7A 3KJYA 4AGSA 3LFLA 2VXDA 5HR0A 3EUKL 1F4KA 4U87A 1B72B 1TRSA 1TQIA 1FB0A 5ECNB 2XAFA 4EV0A 4B48A 4A2UA 1T95A 2IMEA 4RAYA 1NHOA 1XS9A 2QLZA 1WCMJ 2FE3A 4B43A 1VI0A 2JK3A 3BQYA 4HNUA 3MWMA 4DYCA 3TKYA 1ZR4A 4ZXGA 1FBUA 4XKWA 2JA6J 2CT6A 1KQ0A 2I81A 1BIAA 2KP1A 4WR4A 4A0ZA 1YJ9I 4BS9A 2DT5A 2KMUA 1O85A 1OYIA 2A69F 3I58A 1IUYA 5M3MJ 3K8NA 3UIWA 3VB2A 1GXQA 4G9HA 4P9UA 4EGYA 2B63J 3GTUB 1K79A 1Q4JA 5ABRA 1LDJA 1RC9A 2K02A 1FAAA 1CGPA 4QQ7A 2XGEA 1XCBA 3DXJF 3OYMA 3PR8A 2FUG2 4FQGA 2HYFA 4IQJA 3Q0WA 5BRTA 3BWGA 4XKVA 1WH7A 2JUGA 2XPVA 1MW7A 2E2JJ 4DSSA 5ECMB 4B44A 5C4XJ 3BG6A 2ZO4A 1F9MA 2UZ8A 1XSXA 3M8JA 3SEQA 3IPZA 3C18A 2AHQA 2C0DA 5FRNA 3CTAA 2IGOA 2IJLA 4NMUA 4X1UA 4LLRA 3ECHA 3WD6A 1LFPA 4EEFG 5LBQA 2Z99A 3V7CA 1WSUA 4MZWA 1N75A 1FVJA 1E2XA 4XM3A 4MO7A 4JX5A 2XGCA 3JAMK 2K9QA 4HRIA 1XWAA 3SZPA 2F48A 5FKKA 3F9KA 5D5UB 4ENJA 1VQLI 1EOGA 3CTGA 14GSA 1D3YA 3PUFA 3OMYA 4RA2A 2YX4A 5IT9K 3M1GA 3W2AA 3DYRA 4J57E 3O8GA 1S72I 3LG6A 1PRXA 5ICEA 4IVFA 2JZYA 1HSTA 3D5JA 1ZYRF 16GSA 5DAKA 4ECJA 4F0CA 1LFBA 1QZYA 4RUVA 3JRHA 1UHWA 2R5GA 5J4YA 1WRYA 4MEXF 1EH7A 3FR9A 2EIQA 2L2OA 1GSUA 1Q1VA 2GIZA 3T0YA 1HKSA 4U0YA 1ZRFA 2FWHA 5FLVA 1TDIA 1JLWA 3EMXA 5G2ZA 5AGYA 2QEXI 1QA6A 2GBYA 2Z1DA 3DLAA 2CYYA 3CZ6A 3FBIB 3JTGA 1V54H 4BACA 4HJ2A 2JMWA 5F1RA 3PNTA 2LF8A 1K0CA 1OR7C 4ON0A 3C3WA 3LA7A 3S1MJ 2N5AA 3BD2A 1TRWA 1WVRA 3DBRB 1UFMA 5KN3A 2KJBA 2C3QA 3W8SA 2Y48A 3K7AJ 1XSDA 2ALBA 4MJAA 2W25A 4BL7B 2EWNA 1Y56A 1NSWA 4FHTA 3E5XA 3MAKA 4O5UA 4ID0A 2F5DA 3V8KA 2VJJA 3DWLE 2R0PA 3IHQA 1V4RA 2FSWA 2NVYJ 1O73A 3DGQA 2JSYA 1IN6A 2VPRA 2KJCA 4LITA 3S8PA 2KOKA 4EDYA 4OFMA 4PGTA 5IIZA 4HU9A 3DXBA 5D9WA 1BJZA 1B48A 1YF0A 2VKDA 3BC8A 4EMSA 4D1QA 2XSDC 1D5YA 2KHMA 2X48A 2WDUA 2LNBA 4WBRD 2JN6A 3CDLA 3H5NA 4E7KA 4IHTA 4HQMA 5A2QK 2DTRA 4MTDA 1RW1A 2XHFA 1GXPA 1NK3P 3LYKA 1BN5A 1YE9A 3H3ZA 3M07A 1GLPA 3TDGA 4HV5A 3ML6A 3HM5A 2HZFA 1LUJB 1U0JA 5HS7A 1EA3A 1GLNA 1QU3A 3APSA 1P7IA 2O0YA 3FF5A 1ZRCA 4EF0A 4HV6A 2L7ZA 3LSJA 4BVYB 3D5LA 3QAHA 1CQGA 3FKJA 1YIOA 1OLTA 2WAFA 4ML6A 4XLFA 3QAWA 3D5RC 4H4KC 3K70D 1EP7A 2KRFA 2IS2A 2IMDA 3C1RA 1YX5A 4M9ZA 1STZA 2EA2A 1PVEA 2CS3A 3HXLA 4I2UA 5HLTA 3CQFA 1R36A 2F4IA 3TJFA 3P5JA 5AISA 1W4MA 2YPRA 1BC7C 3QMXA 3ZVJA 5J4UA 4ITVA 3L7WA 2ZSHB 1OISA 1KQ9A 4DYRA 2V26A 3F6DA 3S16J 3APOA 2JACA 3CCEI 3FMRA 3RAZA 3L9VA 2NNYA 4DVCA 3H4KA 5CVVA 2ZBKA 2YZHA 3WGIA 2VCTA 3IH3A 3F6FA 3P9CA 1W5TA 2V6EA 5KN0A 3IA1A 4ABZA 3ZQCA 4D5FA 1QZZA 1DUXC 1MMGA 2RLIA 3BG3A 2JZRA 4WK8F 3F4SA 3G9BA 3HOXJ 2EV0A 3ZQQA 17GSA 2GA2A 2KLXA 2WB1N 3JRCA 1AKHB 1B8XA 4UY8I 3K4JA 5EVOA 2FNAA 3EYYA 2E1NA 3D6IA 1POGA 4RAFA 4ESFA 3G4SI 1JXSA 3G7YA 1KYZA 3E6CC 1R5GA 2V1DA 2VD0A 4J2FA 4K0GA 3RDIA 3S1NJ 4K9ZA 1XWKA 3D4TA 5AN1A 6GSTA 3G1LA 2J23A 2EJRA 2WB9A 4ISDA 2OKAA 1Y0NA 2KZVA 1PX7A 2QA4I 2R7DA 3RPUD 3CLOA 1SANA 2NVQJ 5E8IA 4RAZA 2YX7A 2XROA 1IUFA 3A0HC 2A61A 3U1DA 2HYXA 2PN8A 3TO6A 3FIWA 3QPHA 3C8EA 2H94A 3HUGB 4KF9A 4BEHA 2EIRA 2CAQA 3D0SA 3FKFA 2EFPA 5JHUA 4MZBA 4TXVA 2P8TA 1G59A 4UHTA 3QAVA 3R2QA 2L54A 2GSRA 4N10A 4USSA 5D73A 3V1WA 1OCRH 4A69C 2EV6A 4LD5A 4BXXJ 3UEMA 3CMIA 5EEAA 2B0LA 3HG9A 4XLEA 5D5VB 1TLHB 1YRNB 2H1KA 2ZXWH 1VQ8I 5GAND 2R5ZB 1A04A 3ME8A 1T2KA 1MMNA 3GSSA 2BBYA 4IN0A 1BIBA 1BQ7A 4CGZA 1R23A 4OAZA 3L1PA 1WPIA 1K6OA 1MMDA 4DBQA 2HI7A 5ILUA 5CVUA 3QWLA 1HNAA 5EF6A 5ECPB 2K3FA 3DFGA 4KT5C 2LSTA 1E3HA 1PQNA 4JK1X 4YG2F 2RNJA 4IHSA 1XGMA 2CJJA 2CGPA 2H1GA 4DEJA 4L8EA 3HRMA 4A3JJ 4BDYA 1W0UA 4ZL7A 2NOJB 3L0HA 5AIXA 4A93J 3LQ7A 1XSVA 4WR5A 5IMFA 5GAEJ 1Z3YA 1AOYA 2H73A 2CSOA 2BGCA 4GCVA 2NAZA 3OS0A 2HPMA 4OIOF 3J81K 3C2GA 4J19A 2OTLI 1PN0A 1BJXA 3S93A 2GZZA 3HJMA 4CCJA 1ONVA 2I5UA 1W36C 1GLQA 2C0FA 2X8CA 3HJPA 3J7Yb 1NG6A 1NTCA 4FETA 1WFXA 3SEZA 2PI0A 4JQFA 1IRXA 2VL2C 3WG7H 1BL0A 3OOUA 3JW4A 4UB8C 3NWSA 3HOUJ 2Q0OA 1T1VA 1XB4A 1IXRC 1YEXA 2IGNA 1RNLA 3KIOA 4Z6YA 5HFIA 3I9V2 1GWCA 1FG4A 4EJWA 1I9DA 1R26A 5A4UA 3FBNB 2NVLA 3FYGA 3K2ZA 3CCMI 2K86A 3CMAI 4XORA 3AY8A 3LXZA 4RGRA 5IYBJ 3GFJA 3GN3A 2DYRH 1H75A 5DD4A 2XPWA 3ABUA 4HG2A 4Q5QA 4P96A 2M87A 3EETA 3FX3A 3HHGA 1IYIA 4L9JA 4ZTJA 5LD0A 1P4WA 3EURA 1U5TA 3QD9A 3ZMKA 5FGMA 2B7KA 1GTIA 2G9WA 1LVAA 3FY7A 3DKWA 4KSOA 4BHCA 4RM3A 3K1MA 3ZMDA 3FMWA 3JTHA 4XICA 4A6DA 3RKWA 2C6YA 3Q3SA 3S2WA 2MYGA 4MPGA 3FXQA 3CMYA 3OL3A 4JEDA 4BPYA 4RGSA 1Z6TA 1F6MC 2L9SA 4FE7A 5LNKe 4BQOA 1JKOC 1M3IA 5G5FA 1WI3A 2EIKH 1G7OA 4C3IJ 4RMNA 3GX4X 5IPHA 1BEDA 1KU2A 3ZPLA 1J75A 2KP6A 1SFUA 4HAMA 3GFMA 5HOOA 1LEAA 1FYKA 4RS8A 2Z9OA 1TC3C 3W6GA 1XX5A 1XMXA 2I8DA 4PURA 3WE3A 1H9TA 1K7AA 1QPIA 3ZMUA 1M2BA 2CUJA 2MSYA 1SVOA 5LHIA 3MEXA 4IZZA 3OYJA 2HU9A 3RKXA 4MLOA 3L2CA 3CUQA 1M2DA 3HHVA 2EIMH 1TKDB 3P2AA 2DA4A 5B8AA 1DE1A 1S29A 3TB2A 5J40A 4D0PA 3G2BA 2P6TA 4XLCA 3EVIA 2XV4S 5F0GA 2L59A 3OYHA 5D96A 3KE2A 3G71I 2LNTA 1MTCA 3ME7A 2EZLA 2Z33A 3ABTA 1FMVA 4KNDA 4KJZA 3ZREA 5IT3A 3GEZA 5GAHJ 4XLPF 1N78A 1X5DA 3A2XA 1K61A 4IGJA 2NRAC 3C73A 4IJAA 3UARA 1XWCA 1UJ8A 4JE1A 1XW5A 3ZMLA 2HSYA 3LSHA 2DA7A 2GWRA 2M34A 1LJ9A 2KIQA 4K7NA 2LRCA 3WTUC 3TMOA 1G7EA 4LG0A 3UKGA 1FOHA 2X4AA 3QPTA 4QWQA 2V2GA 1T3BA 2VD1A 5DQSA 2ZMEB 3GTPJ 5IMCA 4U88A 3D0ZA 1GSSA 3NARA 1RKWA 5IPGA 3CDIA 1Z6RA 1FBSA 4NQWB 4L5OA 1LU4A 2NPBA 5D6EA 2CFXA 3COAC 1K78B 1XG1A 3GRXA 3VURA 2WTEA 4PQ1A 2HRAA 1PKWA 2IBDA 1ZYNA 2R7TA 2BV6A 4AC0A 3GCMA 4RB0A 2HS5A 1J09A 4CCMA 3SZTA 5C3EJ 1GUKA 4NC8A 3HVVA 1YFHA 1AIUA 1APLC 4M3GA 4YFKF 3E9JB 1VQ9I 2IWTA 2IEKA 2YWNA 2GS3A 5DJLA 1S3RA 4E7ZA 2GZPA 3C2HA 3K2AA 1XW6A 2CQNA 3F3XA 1O81A 2CH0A 3DBHB 2R5YA 1ETVA 3BTLA 5BPDA 1ZGAA 3FWEA 18GSA 4IBPA 3HEFA 1V3FA 2K18A 2HXOA 3T8TA 3F8NA 3WYWA 2QBYA 4XRSA 1LDKB 5G30A 2B7EA 4UVAA 1C0WA 4XONA 3CC4I 2CQXA 2K40A 4LA1A 2XBIA 2DFFA 3KP9A 1XGNA 3ZR8X 4F93B 1HYUA 1HQCA 5F06A 4Z7XA 2OBIA 3R3EA 3ZGKA 3ABLH 2A5WA 2RNGA 3QOEA 4ENMA 3GMFA 3JRAA 2M9HA 2KL4A 4BH9A 1MBFA 2DA5A 1OR7A 1SFXA 5K5QA 4WWCA 1A36A 3CRUA 5JWRB 1A23A 5CVIA 4EM2A 4L5EA 2B6MA 5DV5A 2XGDA 2FBIA 5AIQA 1GTUA 4GXOA 3X2QH 1SD7A 3CSIA 4UXNA 1K0BA 5C00A 4EVIA 1XCVA 1K6YA 2D2WA 3K4LA 1BI2A 3D4MA 5IP9J 2H72A 1O3TA 5DD8A 5GPAA 1XXUA 1CF7B 1F36A 2IS4A 1K0MA 1IN8A 1XFLA 2L6DA 2G0FA 1JFUA 3VPTA 1XOBA 3B73A 3CUOA 3CYNA 4XBFA 3OYLA 1EKEA 2JU5A 1YQ1A 1J0RA 1FOYA 2XPEA 3DTKA 1MD4A 4CW9A 3AG4H 1YW7A 5E18F 3KTBA 3UAPA 4CICA 1U2WA 3PUBA 2NYXA 4GRIA 2AUVA 1UB9A 4H0EA 2AJQB 3KP8A 1G3SA 3HSFA 3ZN0A 2O8KA 1D0YA 2XRLA 3O6BB 1MDKA 1SL0B 2L4MA 4BBRJ 3GSTA 3DEEA 3GFLA 1JJ6C 3GUSA 4HF2A 4TR4A 3K1NA 3NEUA 2HOTA 1K0AA 5JCGA 3ZYWA 2MH9A 2L9VA 3HJOA 5ICGA 5JLXA 5CVRA 2AV4A 1FJLA 3IC4A 3OYAA 2OZUA 3ZMZA 1O6JA 4II2A 3I4MJ 4C3HJ 3MKWB 2VBXA 1HDPA 1W7PB 2YU3A 2LKPA 2R92J 1Z7RA 2CVKA 5JWOB 1TT5B 2B9SA 2EA4A 2YP6A 2R2JA 3MAJA 3CC2I 5J8FA 2CVBA 2ESHA 1VF3A 4MMMA 5DTDA 3C1SA 4BVXB 2BW3A 3HGGA 1D1AA 2ESNA 2K4JA 1DU6A 2O87A 1DSBA 3FISA 4P55A 1VRSD 1ZL9A 3HVNA 5ICFA 5DM7F 2XC7A 2HT9A 3FRCA 1IRZA 2FF4A 5LRSA 1O4XA 3I53A 1UN2A 5KK1A 1YKCA 2DJ3A 2F9SA 2R4GA 4HF0A 3EU3A 1Z9CA 3TKRA 3H5RA 4PNFA 6GSSA 3S3OA 4O32A 2BXYA 3KP2A 3M1CA 1SK2A 2CAIA 3WTVC 1Z1DA 3H3UA 3EC3A 3G7IA 4HI7A 4PJLA 22GSA 2ACJA 4AIKA 3GH9A 4GWRA 2X1EA 3OV8A 3TL4X 4RB3C 2HTJA 12GSA 1WJ5A 2V6OA 3CCJI 3O3KA 4POMA 4TR1A 1G8XA 1JTYA 2IW5A 4HPQA 4ESBA 1B1BA 2LTKA 4I97A 1LVKA 2MABA 5IO2A 3DTEA 3M8FA 3M8NA 3DPLC 3WG9A 1ETWA 3UMAA 2HZEA 1Z9HA 4IHYA 5ID2B
chains in the Genus database with same CATH topology
1R5AA 2V41A 2FLSA 2PMTA 3TKQA 4IHUA 2XF7A 1TRUA 4K2DA 2IFQB 2WY7Q 2YNXA 2MMOA 1EV9A 2V1NA 4YEJA 4G0KA 2X1CA 2PGTA 2H0IA 4BJ6C 4MLYA 3C7MA 1WJFA 1TRVA 5HR1A 5FWGA 1BR4A 3BCIA 3E1SA 1V58A 4QL7A 3N9JA 4E8EA 1ILOA 3QODA 4N11A 4H86A 5GSSA 4BJ5C 5B7CA 1JZRA 2LJRA 1QHGA 4N4OB 5ECRB 2LRDA 1PX6A 2I9HA 2DOAA 3K4BA 1FHEA 3IBHA 2HPIA 3EE2A 4HNTA 2H0HA 3LSKA 4ZBBA 4OAYA 1XPVA 2H75A 1TP9A 2W7NA 2QSIA 1D1BA 2VASA 4MCUA 2E7PA 4EIPA 1X5EA 4C9YA 4E7LA 1T4ZA 1EGRA 4IQ4A 1TJDA 3KH7A 3O3TA 5IMAA 2H71A 4ICYA 2O5RA 3J7AY 3MNGA 5DCHA 4OCEA 3DIEA 2C3NA 4MDCA 1X4OA 2PVOC 3F4TA 5IM9A 2VM1A 3MSZA 1OC8A 3CJRB 2XDVA 2VL2A 3GL5A 3PGTA 1Z7PA 2CFOA 1PJRA 5B8BA 3Q6OA 4HZ4A 2IS1A 2KQRA 3OR1C 3TJJA 4NV2A 4EE0A 3N5OA 4F92B 3LYPA 3OYFA 1C72A 1ERUA 2HSHA 3K4CA 1UA5A 3MKYB 6GSUA 4JU5A 4KDYA 2PWJA 3GURA 1ZYPA 1M9AA 1X9WB 3CP8A 4B3XA 3VK9A 3GKMA 3S3NA 3M9KA 4N0ZA 2X6YA 1V5EA 5EL8A 4MH3A 5CQGA 1AAZA 4MJEA 3OYNA 3ZCOA 1QUWA 4PUAA 1SU9A 3E0JB 2OE3A 1FOVA 1ERTA 3BOAA 2AHEA 1AXDA 4JBBA 2LKUA 4HS1A 2MMZA 5ELAA 1A2LA 4PJNA 1N77A 6GSVA 3ZIVA 5HR2A 2X8HA 5J41A 1A0FA 2R4VA 2BTOT 3ZL5A 2GQLA 4P1WA 4PUSA 2MBSA 2CV1A 4MPFA 4YELA 1AQXA 2WBMA 3ERGA 1TI1A 1YY7A 2LREA 1A24A 3CF2A 1F2EA 2H6YA 1ZELA 1TU7A 2KPMA 1QXHA 3QR6A 3QOUA 3DQVC 3OIQA 1J08A 4TOPA 2KP2A 4RLQA 3H35A 10GSA 2MFZA 2BOLA 3PNVA 5CNWA 4CCLA 1B9YC 3OYKA 1WJEA 2R7UA 4Q5FA 4KDUA 1BX9A 3D5SC 5G5EA 2GZYA 2ES7A 2DMMA 3LSGA 3LGCA 1BAYA 3OYGA 4BL7A 4ZDLA 3ZVJD