3I9V2

Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, oxidized, 2 mol/asu
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
178
structure length
178
Chain Sequence
FFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHLQVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAGKRLEEIELPGKCGHHVHEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the mechanism of respiratory complex I
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords NADH-quinone oxidoreductase subunit 1
total genus 46
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature ec 1.6.99.5: Transferred entry: 1.6.5.11.
pdb deposition date 2009-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01257 2Fe-2S_thioredx Thioredoxin-like [2Fe-2S] ferredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1590 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3i9v201
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3i9v202
1XVQA 1ZOFA 5DBQA 3BD2A 3Q6OA 2HE3A 3QCPA 1U88A 5J9CA 3DYRA 2FLSA 2FGXA 4TXOA 3LJRA 3TKSA 3FR3A 2PU9C 2X8GA 2BTOT 4ID0A 1DE1A 6GSYA 4KSMA 1S3DA 4IP6A 1A8LA 2DJ0A 1BG5A 4MLYA 3TJJA 4FIWA 4OD7A 5HR0A 2FA4A 4OFMA 2JSZA 3KTBA 4ECCA 2YZHA 1GNEA 3CBUA 3C73A 3FZ5A 2H76A 3CSIA 1GL8A 4MPGA 1EGOA 4TXVA 1N2AA 3N5OA 1THXA 4KNDA 1QFNA 5DAKA 1LJRA 4MABA 1ERWA 3I9V2 3BCKA 5IPHA 5F07A 2EIQA 1JFUA 4J57E 2M80A 4PX1A 1DE2A 3FKFA 4MPFA 5EVOA 2IFQB 1U6TA 1PKZA 5ECQB 1M7TA 5FWGA 1R26A 1ZGNA 3LFLA 5JWRB 1O6JA 4OFNA 1GSQA 2VAFA 3UBLA 4WXTA 2HZFA 3KH9A 3QPMA 2DBCA 2HI7A 2KOKA 2YP6A 4HS1A 4CW9A 2E2MA 2VL3A 3CMIA 1A8YA 2PN8A 3WT1A 1URMA 3QFBC 4MJCA 4V1Ag 4POLA 3F6DA 3GNJA 5F0GA 2O8VB 2QSIA 4AJ7A 2F51A 1R5AA 4L5LA 2KHPA 3EYTA 4ZXGA 4GCIA 4XTSA 2WRTA 5J4UA 2OE1A 4XRDA 3ISOA 2IMIA 4KSOA 2NBSA 2H73A 4JR6A 1K0NA 1F3BA 5J9BA 4I2TA 4I8BA 1V57A 3APQA 4QL7A 1G0TA 3GSSA 2YANA 2VLTA 3HA9A 2N5FA 4ZL8A 1PKWA 1TI1A 1EZKA 1PGTA 3UBKA 1YKAA 1OKDA 3HJMA 5GSSA 3IK7A 5H5SA 3BJ5A 4I2UA 1AXDA 5H5QA 4MZWA 3C7MA 3LSZA 1PA3A 4V2NA 4MCUA 4MF5A 3F3QA 1TRSA 2R3XA 3GHAA 5KN1A 2CT6A 1M2BA 1GH2A 3O6TA 3TB2A 1HNBA 4HOJA 18GSA 2VCWA 1NSWA 1GSDA 4NPBA 2B7JA 3EINA 2ZNMA 1HYUA 2VD0A 4XS1A 5DCHA 2GZZA 2DJ3A 3F63A 1GLQA 3P8WA 1X9MB 5F05A 4KX4A 2XHFA 2C3TA 3GTUB 4TKYA 3A2WA 2LQOA 4RUVA 5CAXA 1K0MA 5DALB 1T4ZA 3CXGA 5E4WA 3DGQA 3HCZA 4PQIA 3RPPA 2K18A 2K8SA 4PQ1A 1BX9A 1SL2B 1FOVA 3I6AA 2LUSA 1ABAA 1Q98A 3HJPA 4MJEA 4N0VA 2H66A 3H4KA 2G0FA 1C72A 4NAXA 4PGTA 4ECIA 5ECLB 1SJZA 2TIRA 2XPDA 5KEJA 1OE7A 3FRCA 1NW2A 4MH2A 4AGSA 13GSA 3VK9A 5HFKA 4HZ4A 2C3NA 1SJ6A 19GSA 4PUAA 1K0AA 2LNSA 3TKSE 2IWTA 2H8LA 2NVLA 3LEFA 3EWLA 2AJQB 3QAGA 3U5RE 1H4OA 2VO4A 2C0EA 4J56E 1XBSA 3HY2A 4TOPA 1J0FA 4EO3A 4G19A 3HVSA 4CHSA 3E0UA 4XCSA 2FNOA 3P2AA 2XC2A 4E8HA 1PX6A 1THOA 4TN8A 3ZIVA 1YKCA 4GRFA 1HQOA 5IOXA 2VL9A 3F8UA 3BOAA 4PQHA 1MEKA 2MZCA 5IQYA 3TJKA 5IMZA 3UVHA 2PMTA 3GKXA 2VIMA 14GSA 4NHZA 3U6VA 2FD3A 3KZQA 1T3BA 2IPAA 1B48A 2AV4A 2K8VA 2LSTA 2V6KA 4KE3A 3WYWA 4ZBDA 3WT2A 1TK5B 1M99A 4I5QA 4AJ8A 4PNGA 2H0HA 5GAPD 2RIIA 2F8AA 1WP0A 3GL5A 1MD3A 2VUPA 1M9BA 3LWAA 4ISDA 5CP1A 5B8AA 3TKSC 4MP4A 1WRYA 1X5EA 3H79A 2YJHA 2YPMA 4MF6A 3H1NA 2GT5A 4MZBA 4GWRA 5D9XA 1TRWA 4GQCA 3GURA 5AN1A 1OYJA 2LJKA 1V98A 4HZ2A 2L4QA 1Y25A 5H5RA 1ZMAA 3M3MA 1W89A 5DJMA 1GP1A 4AF2A 4IHUA 5KN0A 2R6KA 2YOIA 2DMLA 1NHOA 3KMOA 3MWHA 1M0UA 4MF7A 2L57A 2FWGA 1F2EA 3DIEA 4EXJA 1ZCPA 3KD0A 5G2ZA 1OC3A 3LXZA 3GFKA 5ID2A 4OFTA 2FWEA 2J9HA 1DUGA 5CRDA 4Q5NA 3CSJA 2GSRA 1MDIA 3IK9A 3L0HA 3GN3A 5G5EA 5DALA 1RW1A 3CYNA 5B6NA 4N0ZA 2PWJA 1VF4A 3WGXA 1EP7A 5HFIA 4MMMA 1ML6A 3C8EA 1M2AA 2LTKA 3L78A 5JCUA 5HR3A 1A23A 4E8EA 4O92A 1A0FA 3P7XA 2A2SA 3UMAA 3QFAC 1MTCA 2AB6A 1HD2A 4HJMA 3NOFA 4FYBA 1S3AA 1AUCA 2CAQA 4XS6A 3F4SA 3HKRA 4BPYA 2KUCA 3UOMA 2HSHA 2X8CA 4YQUA 2FWFA 1VF1A 3QD9A 3TGZA 2WZ9A 4NWYA 2WB9A 3ERGA 2ALBA 2OBIA 2GZPA 2EC4A 4IGJA 4JU5A 3LXTA 2DJ2A 1AC1A 4AJ6A 1CQHA 3F4TA 3RAZA 4HQZA 3I43A 4I97A 4EUYA 4F9ZA 2E7PA 6GSWA 1DSBA 1ERTA 4ILFA 5E59A 2IL3A 5ID2B 5IMVA 1SKWB 3ED3A 1AQVA 2MYGA 3IAS2 1R7HA 2H0GA 3APOA 1NM3A 3C71A 3DKSA 4XIHA 1CQGA 3ZIJA 4RI7A 3FY7A 4IS0A 3J7Yb 4K0GA 5HFGA 4EDYA 3ZFBA 3IE3A 5F06A 3GKMA 4IP1A 5IMAA 4K9ZA 4MA9A 1TK8B 3NZNA 1XZOA 1X5DA 2DSAA 1YY7A 1PN9A 3MSZA 1XWCA 3Q18A 5G5FA 2VL2A 1GLPA 1KNGA 3BBYA 4PURA 1GTIA 3ZZXA 3FYGA 2AAWA 1X5CA 3LGCA 2CVBA 3RHBA 1EOGA 1I5GA 3BCIA 1TXXA 3EURA 2GQKA 1KTEA 5C04A 4YH2A 3PH9A 1JZDA 2AHEA 2A2RA 6GSXA 4GSNA 4K6XA 2JL4A 2H70A 1ILOA 4JBBA 3HVVA 4MDCA 3M8NA 2CAIA 4X43A 3GKNA 5G31A 1T1VA 1SD8A 1U87A 5CRHA 4ZBAA 2M72A 2J23A 1LBKA 1QQ2A 2YV7A 3EE2A 1U3IA 1TK0B 3VI7A 3IDVA 3VWXA 3EVIA 1ZZYA 1Z9HA 5J3RA 1QK8A 3VURA 4DSRA 3M0FA 1OC9B 2OE0A 3G7YA 3VPQA 4XRAA 3ERWA 3LYKA 1TOFA 3QAWA 2CV4A 4YAPA 4EL1A 3TRQA 3KJYA 2P5QA 2O7KA 3UIWA 3UAPA 5L71A 6GSVA 1XFLA 1GNWA 4IKHA 5ELGA 2JACA 3EC3A 5DCGA 4QL9A 4EVMA 1TI3A 4HJ2A 1YEPA 4KGIA 1FAAA 1UN2A 2HRFA 3I69A 2LEGA 2F8FA 2FA8A 1X9SB 2WULA 1N8JA 4OO5A 4ULXA 1MD4A 3DVWA 3FR9A 5ECHB 2G2QA 2MBTA 4JR4A 2L6DA 5IM9A 1BQ7A 2GTUA 3KGKA 3RDWA 1IYIA 3CSHA 4ECBA 2JZRA 2CX3A 4YQVA 1VF3A 2KP1A 1XWBA 5D8IA 1R5PA 3DD3A 2OJLA 2YJ7A 4J2FA 4KDXA 3SWLA 3IC4A 4HUAA 3GRXA 1Y6EA 3TOUA 1QUWA 1V58A 2R4VA 1OC9A 3H93A 3R2QA 4PNFA 5D73A 1J9BA 4K8MA 2LRTA 3PR8A 4GF0A 3A3TA 5ECSA 5ECPB 3ZLPA 1F37A 4D73A 3GL3A 4HDEA 2MMNA 3IXRA 4LMVA 1S3CA 4GTUA 4HU9A 4POMA 3KTLA 3HXSA 1FO5A 2MMOA 2N5BA 3IPZA 2H1BA 5FT3A 1Z6MA 1QXHA 5DJLA 5D9WA 1PX7A 1M2DA 4L0UA 2I3YA 2HT9A 3EU3A 2Z9SA 4K7IA 1TDIA 2C4JA 3FR6A 1SKRB 1U3AA 1USBA 1WOUA 4YQMA 5LNKe 2L5LA 2H6YA 3HZ4A 4WF4A 4TVEA 3TKPA 4L5OA 2ZCTA 2H1DA 2IN3A 3GTUA 2OE3A 4NMUA 4OCFA 4ZL7A 2PPTA 3ERFA 3UARA 2GQMA 1UA5A 3HHVA 2V1MA 1B9YC 5JWQB 1BAYA 3GYKA 2LJAA 3TJBA 3D22A 3KCMA 2A4VA 5F8BA 5GZZB 5D9TA 2C8UA 3W8JA 5CRGA 3Q74A 1ZYEA 4ML6A 1GUMA 2FWHA 3IR4A 4HEA2 4XS4A 4BVYA 5A4UA 2LS5A 2ZUPA 2K9FA 1ERUA 3F0IA 1QMVA 2R2JA 4WKWA 2WS2A 1EV9A 3LQ7A 2ON7A 2TRXA 2JU5A 2BMXA 1EV4A 2HFDA 3ZFLA 1GTBA 5DDLA 3FZ9A 1XOAA 1SKSB 1K3OA 4IN0A 3FHKA 2IMKA 2RM5A 2O85A 2YWOA 3TKQA 2HZEB 2VCZA 2X99A 3D21A 1XWGA 2PGTA 3IHQA 4DEJA 1W4VA 4DSSA 2CX4A 1I9DA 1R4WA 3GH9A 1EOHA 2B7KA 2LQQA 3PGTA 3DWVA 4Q5QA 1LU4A 2H72A 5EPFA 9GSSA 2E2GA 4NHWA 1A2MA 2IMEA 2V32A 4FYUA 2CZ3A 7GSSA 3L9VA 1WPIA 5G30A 5D96A 2GT6A 2WJUA 3VLNA 3WD6A 4NV5A 1ST9A 2P31A 3TJGA 4N30A 1SD9A 2PBJA 5AGYA 4XS4B 2VOCA 5A5KA 3TRXA 3IRAA 5B6MA 3NIVA 4TRXA 2VCQA 1JLVA 3KIJA 4BVXA 2OACA 3TUEA 3ZVJD 4JE1A 1XWAA 1YEXA 5HR2A 5ECIB 3ME8A 4EKZA 4DVCA 1KBNA 2TRCP 3V1WA 4OO4A 1SU9A 4Q5FA 1ZL9A 4WF5A 2YWNA 2E0QA 1A0RP 2MBSA 4I6XA 4GLTA 1GSEA 3DXBA 3J7Yk 20GSA 2L4CA 1E2YA 3M9KA 4BWSA 3MDKA 5KN3A 4TW5A 1YDKA 4K2DA 2HNLA 4IQ1A 3CRUA 2VCTA 1YF0A 3HD5A 3Q19A 2LRCA 3KEBA 3HZ8A 3FW2A 1B4PA 2EIOA 5CYYA 5GAND 3ZVJA 2O89A 5CNWA 1NHYA 1GUKA 3F6FA 5JWOB 5IMDA 2I81A 4DSQA 4EDZA 2IMFA 3IBHA 1ACVA 2IFQA 2GDRA 1EEMA 2LJRA 1RK4A 1OKTA 5LD0A 4IELA 2CZ2A 2QKEA 2OKAA 1SENA 2YV9A 4WR4A 4LMWA 3PINA 4FO5A 1XPVA 5IPGA 2JADA 5IMFA 4BA7A 2N5AA 5CREA 1O8WA 5CRWA 4NXIA 3G7IA 4MH3A 1O85A 1AQXA 3GV1A 4WBRD 1EP8A 4NV2A 1SYRA 1ON4A 5C00A 1JZWA 2HSYA 3ME7A 5DQSA 3ZRDA 1YF1A 2B5EA 3GUSA 5ELAA 5IO0A 3KMNA 4N10A 2GSQA 5IIZA 3A5WA 4KA0A 4EF0A 4F03A 1FVJA 5KN2A 3H8QA 2VM1A 1JZOA 5AISA 2RLIA 3MNGA 4V1Ap 2PVQA 3W6GA 2HXKA 4QQ7A 2L5OA 4KCEA 5AIXA 1GSUA 1WIKA 1RQMA 2C0DA 1V9WA 3CTFA 2C3QA 3UL3A 6GSUA 2RUFA 1PQNA 1GULA 5J5NA 5ECMB 16GSA 2DJ1A 3UVTA 1Z6NA 1TRUA 5COHA 2H75A 4WETA 1SK2A 1OAZA 3A2VA 5IMCA 4GXZA 4TR1B 17GSA 3C1SA 1A2LA 2YWMA 4EC0A 2WGRA 1YQ1A 4IW9A 4LLRA 1TU7A 1FHEA 1JLWA 2PERA 2H30A 4L0WA 1TJDA 3LYPA 4JZQA 2V2GA 2DMMA 5ECOB 22GSA 2ES7A 5AIVA 3S9FA 4LL1B 4MZCA 2L59A 1WJKA 1YZXA 4X1UA 5IOWA 2AUVA 4Q5RA 3IAM2 4RQRA 4KAEA 4LA1A 3APSA 3F9UA 3L9UA 1HNCA 3QOUA 1GUHA 1VF2A 2VCVA 1B9XC 3LORA 4P3YB 4H86A 1XOBA 2DJKA 4O5RA 1A2JA 4PUFC 1V40A 1EGRA 3L4NA 1FVKA 1J08A 1PSQA 4KCAA 4TR0A 3VPTA 4ML1A 4K0NA 4IBPA 1K3LA 1E6BA 4OCEA 3A2XA 1B4QA 4TXOB 1DBYA 2GQLA 5CO3A 5G1KA 3GX8A 1UC7A 3M1GA 5B8BA 1OVNA 2FY6A 1QGVA 3UJ1A 2XBQA 5DQYA 4KDYA 1TP9A 3ZMKA 1OC8A 2H0IA 1K0DA 1K0CA 3FK8A 1HNAA 3N9JA 2B1LA 4KB3A 4O32A 1AQWA 2V41A 4IJ3A 1GRXA 1F3AA 1BYEA 3TDGA 1GTAA 3ZREA 2FHEA 2LKUA 1Z5YE 1MDKA 4WR5A 3VWUA 3E3EA 4HQSA 1X0RA 2C1YA 4ZB6A 2HZEA 3KP9A 2VL2C 1WMJA 1XW5A 4RQXA 2LRNA 4XHMA 1SYXA 2R37A 4FYCA 1GTUA 1K3YA 1MDJA 3WGDA 2MMZA 4ZILA 1BEDA 3ZYWA 10GSA 3VFIA 1O8XA 2GSSA 1A24A 2KLXA 3AY8A 2H74A 2HRNA 1T8EB 3O3TA 1PL1A 3HJOA 2X64A 3VWVA 4DSSB 2XBIA 3GX0A 4Z7XA 4LL4B 5ECRB 2YNXA 1AW9A 3D4MA 4BL7A 2VLVA 1SK1A 2FUG2 2O87A 1TRVA 1UVZA 2F9SA 4RI6A 1EEJA 2H6XA 4ECJA 3VI5A 2YN1A 2OBKA 1GSSA 4OWYA 1TW9A 3ZITA 1PMTA 1FG4A 4ACSA 4ZBBA 2IMDA 4G10A 1PRXA 1XW9A 2I9HA 3L9SA 2K6VA 1XCCA 1FB6A 3GMFA 2LV3A 2VD1A 2DLXA 2GGTA 4ZL9A 3D6IA 5D9VA 1AIUA 2NDOA 1M9AA 3CTGA 2OADA 3TOTA 5G1LA 2H01A 4N11A 2HYXA 2XPEA 2C0FA 3VWWA 1YJ6A 4G9HA 4FH8A 4GSTA 1B8XA 3GH6A 1SJIA 2LNTA 3EU4A 4G2EA 1PD21 4HI7A 4KH7A 1TU8A 4F0CA 6GSTA 3UEMA 2B3SA 4KDUA 2H1GA 3DRNA 4K7OA 1G7EA 5IO2A 3DMLA 1Z3EA 1Z7RA 3GKKA 4TR3A 5ECNB 2L6CA 3RBTA 3D5JA 1OE8A 4X0XA 1XXUA 4JEDA 3KXOA 4MJBA 2B6MA 3OR5A 3TRPA 5D93A 1WWJA 2HLSA 3FZ4A 5LCZA 4ZB8A 4K7NA 1O73A 1GSYA 3JCML 3K8NA 4WBJA 1F6MC 4L8EA 2PUKC 4ZIJA 1XWKA 2GSTA 1XIYA 2B5XA 4YAVA 2CVDA 4KUNA 3IOSA 5B7CA 5A4WA 4V2LA 2QGVA 3M9JA 2C0GA 5JCWA 2M46A 1K0BA 3HYPA 2VCXA 1FW1A 3KM6A 3FZAA 3C1RA 2DJJA 5ECKB 3WGEA 3QAVA 3QR6A 3DVXA 3QMXA 1G7OA 1TTZA 3HDCA 4GSSA 3F3RA 1JHBA 1T00A 3GSTA 4JRRA 4BWQA 3EMXA 2JZSA 4MK3A 2ON5A 3TCOA 5ABRA 2YCDA 1SK0A 1K0OA 2H1AA 2I1UA 3CRTA 4O7HA 4HU7A 4MJAA 4F2IA 1F9MA 3FEUA 2VLUA 3G7JA 1KEBA 1AAZA 2V6OA 4ZB9A 5FHIA 3ZL5A 8GSSA 4TR4A 2YWIA 4V2MA 3IA1A 2JSYA 2CA8A 4IJIA 2KP2A 2GZYA 4KW6A 5DVBA 4EE0A 2H6ZA 2REMA 3O76A 5INYA 1T4YA 2GS3A 4OMVA 1VGLA 5GSTA 4GQFA 1V2AA 2WDUA 2C80A 2DIZA 2EIRA 2JZTA 2VM2A 3KP8A 1ERVA 2NTOA 2B5YA 11GSA 4D73B 4POKA 4TR1A 2GVPA 1FB0A 1PL2A 2CVKA 2FCHA 2IIYA 5HQPA 2DC5A 1IYHA 2WCIA 2P5RA 1XVWA 3DEXA 5ENUA 1GWCA 2X8HA 1EWXA 3RPNA 2RM6A 4POBA 2OA7A 3QDNA 2RUEA 1Z7PA 2NPBA 3ZTLA 2H71A 1H75A 2P0GA 5J41A 2YZUA 4F0BA 5HR1A 1O81A 1G6YA 1GSFA 2DIYA 5EL8A 5JCGA 1JZRA 3TKRA 2WFCA 3W8SA 1T7PB 3D4TA 3GA4A 2H19A 3SBCA 12GSA 3RHCA 1ZYQB 2PVOC 4K1FA 1O7UA 6GSSA 5DAKB 3LG6A 5A4VA 3F4RA 3P90A 3EMPA 2B1KA 2R5GA 2AYTA 1XW6A 3GIXA 3E9JB 3TJFA 1TKDB 1SL1B 3D0ZA 2QC7A 2D2ZA 4F82A 3KH7A 1BJXA 2BJXA 1G6WA 4PXOA 5EY6A 1SL0B 3US3A 4IQAA 1VRSD 2MMAA 2CQ9A 2IJYA 4WEYA 2F3MA 3MAKA 2GLRA 4CDOA 3IV4A 1X9WB 1Q4JA 4IVFA 3HVXA 2I4AA 1WE0A 3ZMLA 3G9BA
chains in the Genus database with same CATH superfamily
2WV1A 3HOXJ 1XVQA 4AF2A 2BXZA 1ZOFA 4F52A 3FF5A 2KRCA 2TCTA 5DBQA 2L7KA 3MKLA 4F91B 4Q5SF 3BD2A 3Q6OA 3J81K 4UHTA 2HE3A 3QCPA 1S8NA 1TT5B 2CSOA 4FT8A 1U88A 1JGSA 5J9CA 3DYRA 1D1AA 1P6RA 2FLSA 2FGXA 1KQ9A 1BR1A 4TXOA 3LJRA 1FOYA 3TKSA 3FR3A 5GTHC 4NQWA 3D0SA 1QZZA 3ESWB 2PU9C 1JUMA 2E5ZA 3ZQ7A 2X8GA 5C44J 4A0XA 4LIUA 2BTOT 4C9YA 1U5TA 4ID0A 1DE1A 6GSYA 1W36D 3HKZN 4HF1A 4KSMA 3V8JA 3EUHA 1S3DA 1ZG1A 3GTKJ 4IP6A 4KDPA 1A8LA 5J4VA 4M73A 1BG5A 3J7AY 2DJ0A 4IXAA 3JRIA 5J1YA 3SZPA 1G3WA 5FJ8J 1HW2A 3ZCOA 2R93J 2VC1A 1ZREA 4MLYA 1U8RA 2A6HF 3KYLA 4YRVA 5L3FA 1UCRA 5TRDA 2VKDA 3TJJA 2W84A 4FIWA 3L00A 2DN0A 4OD7A 2NNNA 5HR0A 2OTLI 2FA4A 1GT0C 4OFMA 1XMKA 2JSZA 4HLXA 3DKWA 4P9FA 3RKXA 3CF5F 3TMOA 3KTBA 4ECCA 1WJEA 3ZQCA 2YZHA 3LFUA 1GNEA 3CBUA 2FOKA 1JUSA 4RB0A 3PFIA 3C73A 4KICA 5LHHA 3V7CA 3DTKA 4L5IA 1ERDA 3FZ5A 2H76A 3CSIA 4L5EA 1GL8A 4MPGA 1E3PA 1ZAOA 3ZMVA 1D8JA 1YYVA 4IRHA 1EGOA 4TXVA 2HU9A 1N2AA 4MO7A 2V1UA 1THXA 4QSHA 2MYSA 3N5OA 1OCTC 3ZMTA 1QFNA 2YWOA 1VQKI 1LJRA 4KNDA 4MABA 5DAKA 3MMYB 5KHDA 5ILSA 3LSGA 2DFFA 2CJJA 2CW7A 1R23A 4Y52J 3OR1C 3ZQQA 4XLPF 1TNSA 3VYTB 1ERWA 3N4MA 3I9V2 1Z67A 2XAFA 4BEHB 1TW2A 2FMLA 5D5WB 2D5VA 3BCKA 5IPHA 4ZH4F 2V9PA 3TOAA 3ASNH 3IHGA 3AFHA 5EG0A 2YU9J 5F07A 3BCAA 2EIQA 1JFUA 2DFEA 2OUMA 2QCOA 4CSWA 1F9NA 1B8IA 2F5FA 2FBIA 5DM6F 3C2BA 4J57E 3HTSB 4I0BA 1N25A 4D7NA 1Y8RB 2M80A 2JT1A 4X6AJ 4PX1A 2LR8A 3FXJA 4MEXF 1DE2A 3FKFA 4MPFA 2JN6A 2FU4A 2O03A 2KFDA 3ABLH 5EVOA 2IFQB 2DMTA 1PKZA 1U6TA 2VI6A 1M7TA 2B9SA 3HOVJ 5ECQB 5FWGA 1R26A 1X19A 4A0ZA 4RGRA 1ZGNA 3LFLA 5J4YA 5JWRB 4KIGA 5K7ZA 4AM3A 1GSQA 1O6JA 4PJJA 2R7XA 2VAFA 4OFNA 1LEAA 2I5UA 3EQLF 1SFKA 4KN7X 5LBQA 4WXTA 2HZFA 3UBLA 1J09A 3I64A 1M3JA 2NS0A 1AOYA 3ECOA 1VZ0A 2R7SA 2EIKH 4MQ9F 2CUEA 4KN4X 1DP7P 3KH9A 2HQRA 1ON2A 4XSXF 2A07F 2Y30A 3QPMA 5D6EA 3ERED 2DBCA 2RAEA 2HI7A 2QQ9A 3W2AA 2KOKA 2YP6A 4KT6A 3IRRA 4HS1A 2O61A 1M1EB 4CW9A 1SEUA 2E2MA 2VL3A 5JVGF 3LSJA 3CMIA 3ZMDA 1A8YA 4LMYA 2PN8A 3VPRA 4MQVA 3CCUI 3WT1A 3ERMA 2KKOA 1URMA 3QFBC 2R5ZA 4MJCA 4V1Ag 2LK2A 1OR7C 1X3ZB 3CUQC 3MCZA 3TW7A 1YITI 3QD9A 4POLA 4ABZA 4WXCA 3F6DA 3GNJA 3L1PA 5F0GA 4AD9A 2O8VB 3DF8A 1Y0NA 4G6DA 2COBA 3M1EA 5DS9A 2QSIA 5J8CA 5L3GA 1W4MA 4AJ7A 4PSXA 1QU3A 2F51A 2F5CA 4HDVA 4CCMA 1S7EA 1WHUA 1YJWI 1R5AA 1MW7A 4A3EJ 1XGSA 4ESJA 2KHPA 4L5LA 4M6XA 2OBPA 3VYRB 3EYTA 5B1BH 3EUAA 3H9GA 3TW6A 1J9IA 4ZXGA 3LAPA 2JMWA 2EIMH 3CLOA 4GCIA 2OC6A 1WZ2A 4XTSA 2WRTA 1ZYPA 2CQKA 4XRMA 3P7NA 1O3RA 5J4UA 2W7NA 2E36A 1S9HA 1FTTA 1FBUA 2OE1A 4XRDA 2R5YA 3LSPA 2NVUB 1BBYA 1RKTA 3ISOA 4JYKA 2IW5A 2IXSA 3M4OJ 3SHFA 5IT9Z 2IMIA 1DQUA 2K02A 5GPCA 3IKVA 1TZLA 3G1LA 3PM1A 3T8TA 3TP0A 1HLVA 3Q9SA 3A1YA 3M8JA 3CCEI 4KSOA 1TBXA 1FLIA 2NBSA 2H73A 4CCJA 2E2IJ 1GXPA 4JR6A 4UB8C 1K78A 5DCFA 3HB9A 1K0NA 4HBLA 4I0AA 2VQGA 4H0EA 5AIQA 1F3BA 5J9BA 4G7HF 1YX3A 3JCUC 2WAQA 2VOPA 4I2TA 2XAJA 5J3LA 1T39A 1CGPA 4I8BA 4I6ZA 4HQMA 5F08A 3HEFA 1V57A 3CC4I 4RAYA 4O5QA 3NAUA 3G3ZA 2Y0SA 3APQA 4QL7A 3Q9VA 1G0TA 1HW1A 3GSSA 5HNFA 1X1AA 1MD0A 2ZSIB 2YANA 3U1DA 2W82A 2VLTA 4AIJA 3HA9A 2N5FA 4ZL8A 1WVRA 4CYDA 3CUOA 4UB6C 1PKWA 3L7WA 1TI1A 3LSHA 2KZGA 3G2BA 4AIDA 1EZKA 1PGTA 3S8PA 2MLGA 3UBKA 1YKAA 5L3CA 1OKDA 3HJMA 5GSSA 2V9VA 3GO5A 1PVEA 1DUXC 3BJOA 3JR9A 3IK7A 3HRMA 1X1CA 1LVKA 5ICCA 5H5SA 3BJ5A 4I2UA 3BOQA 2E7XA 3JRFA 2L7FP 1AXDA 3HSEA 4F55A 5H5QA 1W5SA 3WTWC 4MZWA 3C7MA 3LSZA 1PA3A 1SFEA 1XDSA 5FKNA 1KA8A 1YG2A 4DW6A 1CQTA 3BR0A 3FXKA 1O3SA 4V2NA 4MCUA 4MF5A 1MMDA 3F3QA 3HZJA 3W6JB 1TRSA 1R6RA 1TNTA 1YJ9I 2R3XA 3BROA 1FC3A 3KZIC 5FLXZ 3GHAA 5KN1A 2CT6A 1M2BA 2HPMA 1GH2A 1QPMA 1HNBA 3O6TA 3TB2A 4HOJA 4IRIA 2K9NA 2OQGA 1RIOH 18GSA 2VCWA 1NSWA 1R36A 2RC4A 4BAYA 5EF6A 1AU7A 1GSDA 4NPBA 1LFUP 3CF2A 1RC9A 1SMYF 3WHBA 2B7JA 5IP7J 1R71A 5DVBA 3EINA 5K5QA 2ZNMA 1UFMA 2MLKA 3MEXA 1HYUA 2VD0A 3CQFA 5F0HA 2GZZA 4XS1A 5DCHA 2DJ3A 1F5TA 3F63A 3K1MA 4ZYDA 1GLQA 3P8WA 2LRDA 2VL8A 2Z33A 4KX4A 2XHFA 5F05A 1X9MB 4A3DJ 2C3TA 1SD6A 1U5TC 1FX7A 1FY7A 3SDBA 4IELA 3GTUB 4G0IA 1IF1A 3A2WA 1GDTA 2HVRA 4TKYA 2YSRA 2RNJA 4M71A 3GTMJ 2H8WA 3OL4A 2LQOA 1K0MA 2STTA 4RUVA 5DALB 5CAXA 1Z7LA 1T4ZA 3CXGA 5E4WA 3DGQA 3HCZA 4PQIA 2BHYA 3M8FA 4RAZA 3RPPA 1JJ8C 2UV1A 3ASOH 4N0BA 4DYRA 2K18A 2LKXA 4NBQA 4TV7A 2K8SA 4YIIA 4PQ1A 1BX9A 1SL2B 1JJ6C 1ZLKA 5F0FA 1T33A 1FOVA 3QU6A 4KUMA 3I6AA 2JVHA 2ISYA 1ABAA 1Q98A 2LUSA 3GFMA 2W00A 3IL2A 3HJPA 2F5VA 4D5FA 3K70D 1VQ7I 4MJEA 4N0VA 4L9NA 2H66A 3LSKA 2O5RA 5LGTA 3H4KA 2G0FA 2XRNA 1C72A 3GX4X 2Z1DA 2IEKA 4NAXA 1P9QC 1WPKA 1X3UA 4G9YA 4PK4A 4PGTA 4ECIA 5ECLB 1P4WA 1ZYRF 1SJZA 5FRMA 2TIRA 3GLXA 1WKMA 2WBMA 2XPDA 3EPTA 5KEJA 2GXGA 2K4BA 1HW5A 3GW2A 1OE7A 2N8GA 3FRCA 3HIFA 1NW2A 4MH2A 4GO1A 4AGSA 5LEJA 5HDKA 13GSA 2F2EA 1JXSA 4HOBA 3VK9A 1NTCA 5HFKA 1WRJA 2JZYA 4XM3A 5K5RA 4HX4A 1FYLA 4HZ4A 1MBFA 1I1GA 3IC8A 4K2XA 2STWA 3BCBA 2C3NA 1SJ6A 19GSA 1N77A 2X6YA 2DA1A 4P5OA 1FYKA 3O8GA 4PUAA 3H35A 1K0AA 2LNSA 4USSA 3TKSE 3E6CC 2IWTA 2MC3A 2DO7A 2KIQA 2H8LA 2NVLA 3LEFA 4XL9A 3MIXA 3IKTA 5J40A 3EWLA 3Q0WA 1Z1DA 3QAGA 2AJQB 3U5RE 3S3OA 2HRKA 1H4OA 3I55I 2VO4A 2C0EA 4J56E 5FKOA 3FBNB 1XBSA 2GZWA 3HY2A 3CCQI 4TOPA 2DU9A 2M9HA 3ZQFA 1T0FA 2ZNYA 1J0FA 1AA7A 4EO3A 2DKIA 2EFWA 2ELJA 4G19A 3HVSA 1LEBA 3PQJA 4BDZA 1K6OA 1SD5A 2XGXA 2M4GA 3OV8A 2EQRA 4FTHA 3DP7A 2RQPA 4JOMA 2NVTJ 1VQ9I 1RETA 3E6BA 3E0UA 2A6TA 2LREA 1I50J 2MD5A 2VKVA 4XCSA 4CHSA 1H89C 2FNOA 1BIAA 3OYHA 1T6SA 1PUFB 2DTRA 1ACIA 3P2AA 2YUSA 2XC2A 4E8HA 1MBKA 1IAWA 1PX6A 1THOA 1Q1VA 4TN8A 3ZIVA 2Q2EA 1U6GA 1YKCA 2DA2A 2FEZA 2ZCWA 1T95A 3H92A 2DMNA 2ME6A 3OSFA 3HDDA 2IA0A 1DP3A 1HQOA 4GRFA 5IOXA 3I56I 3JREA 2VL9A 2I10A 4QPQA 3F8UA 3HKZA 3QP6A 4I99C 1MJ9A 4OINF 3J80Z 2ADUA 3BOAA 1RNLA 4PQHA 1MEKA 2MZCA 5IQYA 2ZJQF 3TDZC 1XG8A 4XK4A 3TJKA 2O0YA 4L5JA 5LGNA 2ZMEB 1H9GA 4U0WA 1D8KA 1J59A 2JTVA 5IMZA 2HFHA 3KYDB 1OMIA 4ZYEA 3PPUA 3UVHA 2PMTA 5HNHA 1WI9A 1QVTA 2DW4A 1OCOH 5ICGA 4PFPA 1RR8C 3GKXA 2WA0A 1HKQA 2DA6A 2F6CA 1FJLA 4BE1A 2VIMA 4NHZA 14GSA 2IP2A 5FFZA 5ILUA 2ZJPF 1NK3P 3J7AO 2XHKA 2FD3A 2KUCA 3GWZA 2PQ8A 1T3BA 4DZJA 3KZQA 3U6VA 5E8GA 2IPAA 1KONA 1KQ0A 5HODA 3S15J 1F43A 1B48A 1B59A 3RPUD 3CTAA 4G6TB 5FO5A 3MFKA 2AV4A 2K8VA 3K4NA 4GFBA 3M8EA 2L7ZA 4NC7A 2LSTA 5E3MA 3TL4X 2QYOA 1UMQA 2V6KA 1HSJA 4KE3A 4MTEA 1W0TA 1BN5A 3WYWA 2CFOA 4ZBDA 1VQOI 4UY8I 3LW9A 2VBWA 3KZYA 4R79A 3D5RC 3WT2A 1TK5B 4BY7J 3OR2C 4NB5A 4ZYHA 1B72B 1M99A 3KP4A 4I5QA 4AJ8A 1ZARA 2FF4A 3W6KB 3JRBA 4PNGA 4JQFA 2JJ7A 3A5IA 2QBYA 1SFXA 2H0HA 1EH8A 2FBKA 1Z21A 3FKJA 4XLCA 3RKQA 1I1SA 2RIIA 2F8AA 1OQYA 5GAPD 2K86A 2Z99A 2LBFB 2CMPA 1Z0XA 3UR3C 2LMDA 3E6MA 3QPTA 3OS0A 1WP0A 1DPUA 1XGOA 4D0PA 1MD3A 4HZFA 3GL5A 3CJTB 4MHGA 4BXXJ 5BMZA 1G4DA 4J00A 2VUPA 1M9BA 3GBGA 4C3JJ 2M87A 3VWBA 3LWAA 3BR5A 2E1MC 1ZG3A 1Y1VJ 2EPFA 1LDKB 4ISDA 1BI1A 5CP1A 4I76A 5B8AA 1HA8A 2DJNA 1JTYA 4AYBA 1EF4A 1T08B 2L9RA 2A2PA 3CCRI 3TKSC 5EEGA 3I0TA 5E1WA 4N4OB 4UUVA 4D9JA 1WRYA 4MP4A 1BC8C 1D0XA 3OIQA 1X5EA 2Z9OA 2R0PA 1UJ8A 3H79A 3HSFA 2LSOA 1SVOA 4V2FA 2YJHA 2JA5J 3GTGJ 5CKTA 2ZSHB 3FWEA 2MD0A 4A0YA 2YPMA 3LSRA 3I3LA 2M8EA 2GT5A 3H1NA 4EMSA 4MF6A 4MZBA 4GWRA 1A6QA 5D9XA 4AIKA 1KYWA 3BZ6A 4KFCA 1TRWA 1SVLA 3ZN1A 1OPCA 3QYFA 1MH4A 5AIPA 3ZPLA 3HSRA 2EK5A 3SQNA 4F92B 2NOGA 2VBZA 3HJEA 5CVVA 3QYEA 5HDGA 2Y2ZA 4A5NA 4GQCA 3GURA 2HTJA 3HXLA 3MQ0A 3ROUA 3RTRA 1OYJA 1V98A 1O7LA 4I2OA 2LJKA 4HZ2A 2JPBA 4Y4RA 5CQGA 1SC7A 2ZMEA 3BP8A 2ETHA 3VFZA 1Y25A 2L4QA 5HVQC 2B7EA 5H5RA 1ZMAA 3M3MA 1W89A 4OIRF 2FNPA 1GP1A 4FQUA 4IHUA 4KJZA 4E4HA 5DJMA 3ZIJA 3H5NA 5KN0A 2R6KA 1X4PA 4X1EA 1K78B 1LVAA 3CDIA 2DMLA 2YOIA 3LQQA 2FX0A 1RUNA 3RPUA 1NHOA 3KMOA 4KA4A 3MWHA 5FD6A 2KIUA 1S6LA 5FFXA 4G12A 1M0UA 4MF7A 2FXAA 2BW3B 3TDUC 4CZCA 2FWGA 2L57A 3CCSI 4IOCF 1F2EA 3CUQB 4QLCU 2CRGA 3DIEA 3QU3A 2P4WA 3BR1A 3KETA 4EXJA 2ME0A 3HM5A 1ZCPA 5KAIC 3KD0A 1U9OA 3DLAA 5G2ZA 1D5YA 3S2WA 2NOJB 4YIRX 5LFAA 1OC3A 3LXZA 3GFKA 5ID2A 4OFTA 2FWEA 2J9HA 1BOAA 3CMAI 2M1BA 1DUGA 5CRDA 4EVIA 1XSXA 1DDNA 2XSJC 1NHAA 4Q5NA 3CSJA 2GSRA 1MDIA 3E6DA 3K69A 3IK9A 2BGCA 1Y1WJ 1JKPC 1QHHD 3VODA 1NH3A 2IPQX 1TLHB 2H8RA 2FBHA 4NUBA 3TOBA 4HNUA 1R1UA 3L0HA 1KGSA 3KEOA 4JX5A 3GN3A 2M34A 4U0VA 1A35A 5DALA 5G5EA 2W85A 1R5HA 5F1RA 4B3XA 1QNTA 4B3AA 2HEOA 3W2VA 1RW1A 3K9TA 3CYNA 2K3FA 3NWTA 1Z7UA 3SYTA 2AXTC 2QBYB 5B6NA 1OCPA 2Y48A 1HDPA 4EJOA 4N0ZA 3ABUA 2NVYJ 4LFUA 5ED4A 1WQ2A 2PWJA 1K6YA 2DFHA 1VF4A 1W7PA 2K85A 3WGXA 2LKPA 1EP7A 1HQCA 5HFIA 3IV5A 1ML6A 4MMMA 3C8EA 4XKWA 5IPAA 3HPGA 2M7BA 3M1CA 1WSUA 1S5LC 1MMSA 4B43A 1M2AA 4YFKF 1DGRM 2VLAA 4I7HA 1RR7A 2LTKA 4EQQA 3S1MJ 2VT2A 1YW8A 1L3LA 3L78A 2M0CA 5JCUA 5HR3A 1UELB 1A23A 5FLXK 1LDJA 4EV0A 3PSIA 4WX9A 4E8EA 4G7ZF 4O92A 1A0FA 3K4LA 3P7XA 4A69C 1LJ9A 2A2SA 3CMYA 4E70A 3KEYA 4FE4A 1DPRA 1G59A 1ZRDA 5BPIA 2L54A 3WE2A 1IN5A 1MTCA 3QFAC 2AB6A 3LSMA 3RPQA 2X1EA 5GTIC 3S14J 3F8CA 4II3A 5KCMA 4EM2A 1HD2A 1A5JA 4HAMA 4ENMA 4HJMA 3NOFA 4FYBA 1S3AA 5B5EC 1AUCA 2CAQA 3PO3J 3HOUJ 4XS6A 3F4SA 2R7DA 4E7SA 3HKRA 4BPYA 1R5ID 2QKMB 4XLNF 3LAJA 2RDPA 4PFOA 2HI3A 4A3FJ 3AL0B 2P5KA 2XPVA 3JRDA 3BPXA 3KZZA 2HSHA 2X8CA 3UOMA 5EG0B 4YQUA 2FWFA 3LNQA 1UG2A 1IZ1A 1MGTA 1VF1A 4JBAA 2L2OA 2H1LA 3IWZA 4PSWA 3H5AA 4CGZA 4RGXA 4IHTA 3NRVA 3A03A 5DCMB 2WZ9A 4DGWB 4EJUA 4NWYA 3TGZA 1QZYA 2QM3A 3F6OA 2V6CA 2WB9A 5D9WA 3ERGA 4LG0B 4KIFA 2ALBA 2GIZA 2OBIA 4WXDA 2GZPA 3LMMA 4A3MJ 2HVSA 2EC4A 3LXTA 4IGJA 4JU5A 4ZDPA 4XRSG 1PN0A 2DJ2A 1AC1A 2GWRA 5FKLA 4AJ6A 1CQHA 1GUUA 1KU2A 4XN3A 3F4TA 3WHCA 3NEUA 3RAZA 4HQZA 4M9SA 3I43A 3IH4A 4I97A 4EUYA 2CS3A 4HDUA 4IHWA 3TEDA 3BQZA 4G7OF 3OS2A 4F9ZA 2E7PA 3J7YJ 1OISA 1WJBA 1HSTA 6GSWA 4S04A 2HDWA 1DSBA 1ERTA 3E3VA 3DXJF 1Z3YA 1J7KA 2M8GX 4BIKA 2FA5A 4ILFA 1J2XA 4PJNA 2GLOA 5E59A 3JRCA 2CYYA 2XAGA 2IL3A 5ID2B 5IMVA 1SKWB 3ED3A 1AQVA 2MYGA 3IAS2 1R7HA 2H0GA 3APOA 1NM3A 1Q1HA 3ZQIA 4DYCA 1LE8B 2BY3A 2LLKA 3C71A 2DT7B 3SEQA 3RI4A 1MSFC 3V7SA 1VQ8I 3DKSA 4BL0B 4YFNF 4BQNA 2X85A 4XIHA 1SAUA 2HGCA 5FRNA 1CQGA 2P7VB 4U7DA 4KF9A 3V8LA 1ZGAA 2CQ7A 2DMQA 3FY7A 4U88A 4RI7A 4B4CA 4HYEA 4BGDA 2VBYA 4IS0A 3J7Yb 1V5EA 3BG5A 1R7JA 4K0GA 2GM4A 5HFGA 1MH3A 3R0AA 4EDYA 3ZFBA 3IE3A 4GYGA 4ETSA 4YG2F 5D5VB 1KU9A 4BKXA 1Z9CA 1LDDA 5F06A 3K4MA 3GKMA 4IP1A 2Z5UA 3QQAA 1USSA 2ZFUA 5IMAA 1OJLA 4G0LA 4K9ZA 2X1CA 4MA9A 2CUZA 2DA4A 2R7ZJ 1TK8B 3NZNA 1XZOA 4ICYA 2AXLA 1X5DA 2DSAA 1YY7A 2VBXA 2X6WA 3K6GA 1E2XA 4HNTA 2LF7A 4CUGA 5J8FA 1PN9A 1TC3C 3WG9A 5H6QA 1ITYA 3MSZA 3HRTA 2VN2A 4WK8F 2GXBA 1XWCA 3Q18A 5G5FA 3BG6A 4QIWN 2XKPA 2VL2A 1R22A 2MH9A 1GLPA 3PQKA 1KNGA 3BBYA 4PURA 2EWNA 4IQJA 1GTIA 1YS7A 3OYNA 5J1RA 3ZZXA 4PCQA 1MJBA 4FX0A 2MFZA 1W5TA 2F48A 3FYGA 2W57A 5E18F 3P5JA 4MIMA 4CH7A 1YLFA 2AAWA 1X5CA 3GZ5A 3LGCA 4MEYF 2J5PA 2CVBA 3RDIA 3RHBA 1IXCA 1EOGA 1GV2A 1I5GA 4AU7A 3B6AA 3ISPA 4RB1A 2HQ5A 3CDLA 3OOPA 4E7IA 4A3KJ 3MZHA 1TXXA 1U78A 3BCIA 2J5OA 3EURA 2X4HA 2Y0MA 2B0LA 2GQKA 3KP7A 1KTEA 3BG9A 5IOYA 2XC7A 2C6YA 4GDFA 3ERWA 3F8FA 5EEHA 5C04A 4YH2A 1SD7A 3PH9A 3FX3A 1XCVA 3I59A 3WODF 3PIOF 1JZDA 1XMAA 4X0GA 1C0WA 2AHEA 2FNAA 1ZR2A 2DFIA 2X1DA 5FROA 2A2RA 2HOEA 2R7FA 1V4RA 6GSXA 5M3FJ 2L9SA 5B3SH 4LG3A 3FXMA 1IC8A 2DMPA 3PO2J 4GSNA 1Y39A 2FJ1A 4K6XA 4A6DA 3LL7A 2V7FA 2LD5A 1E17A 1MBEA 2JL4A 2NS7A 2H70A 4XLHA 1KYZA 3R6SA 3DBHB 1JT0A 2R3SA 1ILOA 3AG1H 4M6VA 3I4NJ 3OYCA 3TQNA 4JBBA 5IP6A 3DEUA 3HVVA 5LRRA 4MDCA 1Y0UA 3GTQJ 2LF8A 4ENKA 2QA2A 1GVDA 3H36A 1YX5A 4BHPA 3M8NA 3PNYA 4CO8A 3C2GA 1ETQA 4FE7A 2CAIA 1A04A 3BT9A 3SXYA 4XQFA 4X43A 3HUGB 4IF4A 1YTYA 2QKLB 3GKNA 1G6NA 5G31A 3PIPF 4RBOA 2DT5A 3R4KA 1T1VA 1SD8A 1U87A 5CRHA 4ZBAA 2M72A 5F64A 4OWRB 2J23A 2KJBA 4FCYA 3KCCA 4MLOA 2O8XA 1LBKA 1QQ2A 2YV7A 4HA8A 2PBIA 3OYAA 4G94A 1ZRCA 3EE2A 2MABA 5BOXA 3F6VA 5TISC 1U3IA 2DA5A 5DV5A 4IOAF 5FGMA 2ICWG 1TK0B 2ZBKA 2YX4A 2JRMA 5F1JA 3VI7A 2FSWA 2KIFA 3CJRB 3IDVA 1LKXA 3VWXA 1ZTRA 2XAUA 4G0KA 3OSGA 4M3FA 3OYJA 3GTJJ 1KZHA 2R92J 5E3OA 3EVIA 1J75A 3DKXA 1ZZYA 4I98B 5A2QZ 1Z9HA 5J3RA 4C3HJ 2M45A 1QK8A 2VE9A 1BR4A 3ML6A 3HOYJ 4FQGA 2DA7A 3DPLC 3WTTC 2P81A 3G71I 3AG2H 3VURA 4DSRA 4AYBN 2HKXA 3M0FA 1OC9B 1REPC 2OE0A 3C3WA 3G7YA 2V26A 1R4NB 3VPQA 4QPOA 3BG7A 5FB2A 4XRAA 2XB0X 1I5ZA 3LA2A 3WGGA 2BOLA 3LA3A 3FM5A 4BH9A 1GLNA 4IPAA 4RB2C 3JTGA 3LYKA 1TOFA 4IHVA 3QAWA 3REOA 2CV4A 4YAPA 2DTZA 3BWGA 3S1NJ 4EE0A 4EL1A 5A2QK 5DUIA 1R4MB 1U2WA 5E1XA 3TRQA 3KJYA 2P5QA 2O7KA 3K4BA 4M6YA 3UIWA 3S16J 3UAPA 5JFRA 3H9JA 3RZDJ 5L71A 2M0MA 6GSVA 1XFLA 1X1PA 1JHFA 3GF2A 1GNWA 3EUKL 4IKHA 5ELGA 2JACA 3EC3A 2ZXWH 5DCGA 4QL9A 3ULQB 4P1WA 1TI3A 4EVMA 4HJ2A 1YEPA 1ETWA 4LK1F 4KGIA 3GTOJ 2ZNZA 1FAAA 1UN2A 2HRFA 4E6KG 3I59B 3I69A 2K9SA 2LKSA 2F8FA 2LEGA 2BHZA 5KOXA 4LLGF 2LP0A 2FA8A 2M4KA 2UXXA 3EUHC 1XSDA 4ASNA 3P9CA 3IH2A 5J6XA 1RKWA 2NVXJ 2VIXA 1X9SB 3I4PA 2WULA 5JLWA 5M5WJ 1N8JA 3PUBA 3CJQB 3SJMA 4OO5A 2O7OA 4ULXA 3FK7A 2E1NA 1MD4A 4S0HB 2R0QC 3DVWA 1Y56A 3NQOA 3TP3A 3FR9A 5ECHB 2G2QA 2MBTA 1PUFA 4JR4A 2L6DA 5IM9A 3V4GA 1BQ7A 2GTUA 5H20A 3DQVC 4BXFA 3F23A 4A6EA 3N05A 4FETA 4QWQA 2Y9ZA 5HLHA 1FP1D 1WGXA 2VOOA 3C2HA 2D1VA 1T2KA 3KGKA 3RDWA 1EH7A 2VQLA 1IYIA 3CSHA 4ECBA 2HOAA 2JZRA 2CX3A 1RI7A 2OZ6A 4Z2TA 5BMUA 4ZTFA 3PUFA 4L0ZB 2PN6A 2L7MP 4HSTA 1VF3A 2KP1A 1XWBA 2VXZA 3AG4H 4YQVA 1B1BA 4DYQA 5D8IA 3OYFA 1R5PA 2A4HA 3DD3A 2FOWA 5DD4A 2OJLA 2D1HA 1OLTA 3G73A 2G9WA 2YJ7A 4J2FA 4KDXA 3SWLA 4M74A 3IC4A 4HUAA 2EV5A 3GRXA 4Q4ZF 1Y6EA 4D5CA 3FZVA 3TOUA 3DTEA 1QUWA 1V58A 4RS8A 2R4VA 4EM0B 1VQ6I 4CCLA 2Q2EB 1OC9A 3H93A 2JSPA 3R2QA 4PNFA 5D73A 4LB5A 1J9BA 4K8MA 1B72A 3MWMA 2LRTA 5CVIA 2DKHA 3PR8A 2WAQN 4GF0A 1JKOC 1YE9A 4WF2A 1VQ5I 4C30A 4HX8A 3A3TA 2XGCA 4ESFA 5ECSA 2XB5A 2DPUA 5ECPB 1U8BA 4IHSA 3ZLPA 3K4KA 2QENA 1F37A 4D73A 2IT0A 2YS9A 5CLSA 2EA2A 3GL3A 4HDEA 4D7MA 5L3DA 2MMNA 4RGSA 9ANTA 2VT3A 3IXRA 2D2WA 1BR2A 4JX6A 2MBFA 4LMVA 5E17F 3FMSA 1YHQI 1NK2P 1VQ4I 2G0EA 1S3CA 2KDOA 4GTUA 4HU9A 1P92A 2F5DA 4I02A 3WU2C 4DIQA 4KISA 1PJRA 3KTLA 4POMA 5K1YA 3HXSA 1FO5A 1MZBA 2MMOA 2N5BA 3IPZA 1R49A 1R00A 2V1XA 2JA7J 2H1BA 2FCHA 5FT3A 3GFLA 2GBYA 1Z6MA 2V79A 2GQQA 1QXHA 1LE8A 1F1ZA 2ZJRF 1PX7A 3CUQA 2JUCA 5F27A 1YIOA 5DJLA 1TT0A 1R1TA 4XBFA 1M2DA 2I3YA 4L0UA 2RNGA 3A01A 1SMTA 3BR3A 2HT9A 1O4XA 3EU3A 2Z9SA 2OZUA 3H3VK 1TDIA 4K7IA 1VQNI 1R1VA 2C4JA 3FR6A 1X2MA 4BNCA 2CGPA 1SKRB 1BW6A 1A6IA 4NDLA 1U3AA 5M5XJ 1TW3A 1USBA 4ZYAA 1D0ZA 4CCNA 3BJ6A 1WOUA 4YQMA 5LNKe 2L5LA 5GAHJ 1HKTA 2H6YA 1ONVA 5HDNA 1JKRC 1FSHA 3HHHA 3GFIA 3HZ4A 2E60A 2XASA 5JI6A 2HOSA 4ZZDA 2HS5A 3QOEA 5IYCJ 4WF4A 4TVEA 3TKPA 4L5OA 2ZCTA 3HRSA 4KT5C 2X49A 3J81Z 3JRHA 2H1DA 2IN3A 3GTUA 1O7FA 1H0MA 2OE3A 5KK1A 4NMUA 4OCFA 4ZL7A 4M3DA 3PL8A 2PPTA 2QZ8A 3KLOA 3ERFA 5D4SA 5EEAA 3UARA 5KOWA 2CQQA 4GYIA 2VJJA 1IDYA 3HOTA 4IL6C 2GQMA 4BDYA 3BPVA 4OMYA 1UA5A 3HHVA 2V1MA 1IRGA 1B9YC 5JWQB 3OYKA 1BAYA 2CVKA 5E3LA 5E8IA 2IIYA 3GYKA 2LJAA 3TJBA 2HDCA 1W0UA 1D1CA 3JAMZ 3H5RA 3D22A 5D5XB 3O2PE 1SVMA 2XF7A 3MKYB 3KCMA 2XAQA 1V55H 2KHMA 2A4VA 5F8BA 1QA6A 5F0CA 5GZZB 5D9TA 1T8IA 3MZ8A 3FIWA 4XLAA 2C8UA 3QWLA 1X1DA 4L9TA 3G1OA 3W8JA 2DODA 5CRGA 1T56A 4IHYA 1T98A 2WAEA 1HC8A 3Q74A 2M5WA 4A3GJ 2FQ3A 3A02A 1MIJA 3UNGC 2ELKA 4A3LJ 1ZYEA 4ML6A 2P8TA 2IGOA 1GUMA 2FWHA 3IR4A 3BLYA 3FDYA 4HEA2 3CCVI 5DD8A 5IT9K 3DBRB 1A36A 4XS4A 2E1CA 4YIFA 4BVYA 5A4UA 1V3FA 2LS5A 5IY5H 3FXUA 2ZUPA 2CU7A 2K9FA 1ERUA 3F0IA 4CXFA 1MDMA 1GHCA 3ZN0A 1QMVA 3M3YJ 1TP4A 2CV1A 3CJNA 4DOZA 2R2JA 4WKWA 2X9DA 2WS2A 1EV9A 1DGWY 4A5MA 4U7BA 3JSPA 1SAXA 2VKHA 2ON7A 3LQ7A 5ICEA 2TRXA 3SDGA 5J47A 2JU5A 1WJ5A 4BE2A 1ZR4A 1EV4A 2BMXA 4LIVA 4LB6B 2HFDA 3CMMA 3ZFLA 2IS1A 2L9VA 3WGIA 2CFXA 3E97A 1GTBA 5DDLA 3FZ9A 2LYCA 1XOAA 1SKSB 3V42A 1BW5A 4MFDA 1K3OA 3FHKA 4IN0A 2IMKA 1FTZA 4ZYGA 1WJAA 1IRZA 1ZYNA 2ZXHA 1OYYA 1HBXG 1GXQA 1ON1A 4I09A 2RM5A 3CD6I 2O85A 1X4OA 5LHGA 2EA4A 3HC7A 1BL0A 2O3FA 2R5YB 2HZEB 4OAYA 3WGHA 2VCZA 2Y75A 3I58A 2ID6A 2X99A 3D21A 4WCGA 1XWGA 3RIRA 2PGTA 3H3ZA 3EYYA 2P0WA 4R8HA 3ZMZA 5D8LB 1HKSA 3IHQA 4DEJA 1W4VA 3QPSA 4DSSA 2K40A 2K9LA 4RAFA 4LOCA 2O9LA 1MKMA 4RLFA 3BR2A 3K10A 1G2HA 2LOOA 2CX4A 2L01A 2VB6A 1I9DA 1O3QA 4HQEA 1R4WA 3L2QA 3OY9A 3GH9A 2EFOA 3N97A 3F21A 2AS5F 2XDVA 3E0JB 1EOHA 4NHJA 3O3KA 2B7KA 1EKEA 2IGMA 2IS2A 5HOOA 2DK8A 2VE8A 2LQQA 3PGTA 3DWVA 1X3WB 4Q5QA 2X6OA 3S3MA 1W36C 1LU4A 2H72A 1ETOA 4HSCX 4K5RA 2BY1A 5JVTA 2XRLA 5EPFA 2K9MA 9GSSA 2KZVA 2P5LC 4N9IA 5B66C 1ZHFA 4AUXA 1BI2A 4Y15A 2E2GA 1D1BA 2FE3A 2E2JJ 4NHWA 2W1OA 1A2MA 3WG7H 1XS9A 2XF5A 3C1DA 2IMEA 2V32A 1IJWC 3MZYA 4FYUA 2CZ3A 2NVQJ 7GSSA 3QOPA 3JSOA 2ZXJA 1WPIA 3L9VA 1UG0A 3BG3A 1IDZA 4OU0A 4MTDA 2W25A 5G30A 3RJPA 5D96A 2OQRA 2GT6A 2WJUA 3VLNA 1QHGA 1FPQA 3DU6A 3S1QJ 2DOFA 3WD6A 5K7HA 3P9IA 4NV5A 4M3GA 1ST9A 3BTCA 2P31A 3K2ZA 4ITVA 3CCMI 2R0GA 1MNEA 4N30A 3CZ6A 1SD9A 3TJGA 2XV4S 1M3IA 2ID3A 2PBJA 5AGYA 1T0FC 1VQLI 1OCCH 2WY8Q 5ICFA 3H0GJ 3KP6A 3TKYA 2LC2A 5TJJA 5JLXA 2UWMA 2VOCA 1K7AA 4C2TA 3HHGA 5A5KA 3TRXA 2V9KA 3F0CA 1B8IB 4B48A 3JAMK 1X2NA 1MSEC 3IRAA 5B6MA 4GGGA 4CA0A 3HTUA 3NIVA 4TRXA 4N4NB 2R7WA 2VCQA 4BVYB 1JLVA 1ORKA 3KIJA 2OACA 1H8AC 3TUEA 3ZVJD 3ZQHA 4BVXA 4JE1A 1XWAA 2MW8A 1I3QJ 3H1CA 1YEXA 5HR2A 4LITA 5ECIB 1MNDA 5M3MJ 3ME8A 3ECHA 2HQAA 2CV0A 4EKZA 2EZIA 2EZHA 3BJAA 2QEXI 2IJLA 4DVCA 3HOWJ 1KBNA 1FSEA 3QP5A 2TRCP 1IO2A 3WTZA 3NARA 3HOZJ 4RDUA 3IUOA 3U21A 3WTUC 4X4JA 2QF7A 4OO4A 3V1WA 2YR2A 3A0BC 1SU9A 2P6SA 4AVZA 2DOEA 3COAC 1FZPB 2K27A 1TWAJ 4F93B 4Q5FA 1ZL9A 4WF5A 2L3DA 2YWNA 2EIJH 4W1UA 1A0RP 2E0QA 2MBSA 5DEQA 4I6XA 2JUGA 4GLTA 1GSEA 3DXBA 3BTLA 3LOCA 2QSFX 20GSA 5GPAA 2L4CA 3J7Yk 4L9JA 2XROA 1E2YA 4AWXB 1UHSA 1Z6RA 1B9NA 3M9KA 3CDHA 1ETXA 1EH6A 2IGNA 4BWSA 2VXDA 4IHXA 2DOAA 4IQ4A 3MKZA 2DAOA 3WU1B 5CJ9A 3D1NI 3MDKA 5KN3A 4CHUA 3QPHA 4TW5A 1V54H 1YDKA 2K5CA 4K2DA 2HNLA 4IQ1A 4Q48A 3CRUA 2H94A 3B73A 2VCTA 4GXOA 1FP2A 3ZMUA 1YF0A 1ZQ3P 3AKZA 3HD5A 5BPDA 2W48A 3B02A 4XN0A 4BQOA 3Q19A 2UUZA 5F6FA 1IN6A 4EATA 2VJ4A 2LRCA 3KEBA 4HV6A 5KVRA 3HZ8A 2K4JA 4AIHA 2HPIA 1UAAA 2ZMEC 3FW2A 3K4CA 1B4PA 2EIOA 5CYYA 4QTRA 3I71A 1RZ4A 3H0DA 4P55A 4A3IJ 5GAND 4BBSJ 1TL8A 3ZVJA 2O89A 5E79C 3L2RA 2QLZA 3ZXSA 1GUKA 1NHYA 5CNWA 4BVXB 2EH3A 3HPHA 4IO9F 3F6FA 1LB2A 5EJCA 5JWOB 2KISA 3OYDA 5IMDA 3F8NA 2I81A 2F4IA 2CW0F 4EIQA 1YS6A 4DSQA 3W2WA 4BJ6C 1BJZA 5BS6A 5CPRB 3ZQGA 2GA1A 1P2FA 4O5UA 4EDZA 4HF2A 3KX2A 2IMFA 2VJ5A 3IBHA 4DBRA 1ACVA 1OR7A 2E19A 2IFQA 5HQPA 3LFKA 2E1OA 2GDRA 4P9UA 4HV5A 1EEMA 3R3EA 1R58A 2LJRA 1WI3A 4M72A 2QQ8A 2RN7A 1OKTA 1RK4A 2NYXA 2ZB9A 4N9HA 5GP9A 2CZ2A 4I01A 2OKAA 1SENA 3GTPJ 2QKEA 2YV9A 4EGYA 4UUSB 4WR4A 4XOTA 4UV8A 3PINA 4LMWA 2DI3A 4FO5A 3DU5A 2XSDC 1XPVA 5F04A 3TO7A 2AQFA 1ULYA 3LWFA 1KU7A 5IPGA 4MNUA 5D5UB 2JADA 5IMFA 2R7OA 3EDPA 4BA7A 2N5AA 5LD2C 1BOBA 2XVCA 3F9KA 5CREA 1O8WA 1H9TA 5CRWA 3CP2A 2KL4A 3GCMA 3F8BA 1FWZA 2KT0A 2XPUA 4BJ5C 2DDAA 4HNVA 1FOXA 3G7IA 2O6GE 4MH3A 1O85A 4NXIA 5EGOB 1AQXA 2LBFA 2DYSH 2GOMA 1S72I 2PMHA 3GV1A 4WBRD 3CCYA 3FHNA 1HXDA 2MA3A 2NXNB 1XGMA 2V1NA 3L2VA 4KNYA 1EP8A 3DV8A 4NV2A 1SYRA 1ON4A 3H9QA 5C00A 2HXOA 5CQEA 1JZWA 2HSYA 3ME7A 5DQSA 3WTSC 4IRGA 2HVQA 3T0YA 3ZRDA 2ZKZA 1Y8QB 2E2HJ 5B1AH 1YF1A 4ZJZA 2B5EA 3K1NA 1K4TA 3GUSA 5ELAA 1U0JA 2DDBA 3KP5A 3KYCB 5IO0A 3K2AA 3KMNA 4N10A 1E3HA 4XORA 2GSQA 4RLQA 1FIAA 1XG1A 4XR6A 2VUMJ 4Z2UA 5IIZA 2PMZA 1K61A 3A5WA 4KA0A 4EF0A 1RRJA 2AHQA 4L18B 4F03A 2BXYA 4JX4A 1FVJA 2B63J 5KN2A 1WWXA 3H8QA 3V7RA 2VM1A 1LUJB 2DMUA 3X2QH 1JZOA 5AISA 2RLIA 4IVNA 1V5GA 4HRIA 3MNGA 4DNCA 4V1Ap 2PVQA 3W6GA 2LG4A 2HXKA 3NWSA 4QQ7A 2L5OA 4KCEA 1IUYA 5AIXA 1P4XA 2R7VA 1HDDC 1GSUA 1U3EM 1RQMA 1WIKA 1XN7A 1VTNC 4XRSA 4HPQA 3L9FA 4EIPA 2C0DA 5DCMA 1QPIA 3S32A 1ENHA 2R7TA 2VASA 1X58A 3RQ4A 1TWGJ 1LFBA 3DWLE 4YFXF 4BU2A 3TGNA 3QRFF 1R9TJ 1V9WA 2C3QA 3CTFA 1IN4A 3UL3A 2E5NA 3DPTA 6GSUA 2HR3A 1WJFA 3GZNB 3ABMH 2RUFA 3JRAA 4CCKA 1PQNA 2PMUA 1MJAA 2JVGA 4PUSA 3F22A 1IG7A 2JPCA 1GULA 5J5NA 1FOKA 1MDMB 5ECMB 2ZJ2A 2BZTA 16GSA 2DJ1A 3UVTA 2A69F 2IVMA 2K7LA 4HLYA 1Z6NA 4U87A 1TRUA 5COHA 1IV8A 1W5CC 3L09A 4GCVA 3GUDA 4UVCA 4OIQF 2PEXA 2H75A 1SK2A 4WETA 1OAZA 4ESBA 3MYDA 1DU6A 3L2UA 2EFQA 2JA2A 4A12A 2QA1A 3QYBA 3A2VA 3SZTA 5M5YJ 3VB2A 5IMCA 2HYJA 1P4AA 1J0RA 3F8MA 1BA5A 4PGGA 2HTSA 4IKFA 4GXZA 3ABTA 4TR1B 17GSA 3C1SA 2ZO4A 2HYFA 4AC0A 2MGQA 5GAGJ 1A2LA 2YWMA 2YPRA 1XD7A 4EC0A 2X6XA 4UUSA 1LQ1A 4LK0F 2QVOA 2QWWA 2WGRA 1YQ1A 3P9KA 4CY8A 1YO5C 4J01A 1VQMI 2JRTA 4NC8A 1K4SA 4IW9A 4LLRA 1TU7A 1FHEA 1JLWA 5E20A 4XKCA 1OFCX 4M9ZA 4BACA 2H30A 5D4RA 2PERA 1IRFA 4L0WA 1TJDA 1I3AA 2CW8A 1BI0A 4G8XA 4E7KA 2QSGX 1I6XA 2BVLA 4YEJA 2E7WA 2AO9A 3DTIA 3LYPA 2V2GA 4JZQA 2VODA 5D8KB 3HL2A 3OS1A 2RKHA 22GSA 2DMMA 5ECOB 2JWTA 4BHCA 3RCOA 2ES7A 1WJDA 3QPLA 2X48A 3HGGA 1ZH5A 5AIVA 4LL1B 3S9FA 2G7HA 4MZCA 4DJAA 5C3EJ 2L59A 1XDUA 3FKIJ 2MH2A 2DT6A 2Y9YA 4W97A 4BEHA 2XIGA 1E3OC 1WJKA 1YZXA 4X1UA 1SFOJ 5IOWA 2GAUA 3R60A 2AUVA 4Q5RA 2HSMA 1BIBA 2QQAA 3U1KA 5HS9A 2RQQA 1Y6IA 3IAM2 2HDDA 2FD5A 3S2HJ 3WTYC 4PJLA 2HNHA 2BV6A 2IS6A 2EINH 2XUBA 3PJRA 4MGRA 5AN1A 4RQRA 1G3TA 1MNMC 2ZFWA 4KAEA 2OCCH 4LA1A 3U9GA 1STZA 3HUGA 1QQIA 4Y33A 1ZG5A 3APSA 3AL0C 3F72A 5JHFA 1UHWA 1LPQA 3F9UA 1B9MA 1HNCA 3L9UA 3QOUA 2KMUA 2W4SA 3CCJI 2K3PA 1L0OC 3DLLF 1EV7A 2Q0OA 2RREA 3GEZA 3ZR8X 3JRGA 4BQAA 1S29A 1GUHA 5ILVA 5L3EA 2JQ7A 1VF2A 2VCVA 1B9XC 4LLNA 3LORA 4P3YB 4L9VA 3W6VA 3PSFA 1XMXA 4FHTA 1UB9A 2FRHA 1HCRA 4H86A 3PFYA 4LGWA 2ACJA 1XOBA 2HWVA 2HZTA 3BC8A 2DJKA 4O5RA 1ZGJA 1A2JA 4PUFC 3CCLI 1LFPA 4HF0A 2IS4A 3E5XA 1V40A 1QGPA 1EGRA 3L4NA 3IP4B 3BY6A 3HYIA 1N78A 1GV5A 1FVKA 3HBLA 1J08A 2Q8KA 2IRFG 1PSQA 3RSNA 3HOSA 4KCAA 4TR0A 4Z2RA 4IX7A 3K1PA 1UHMA 3VPTA 5AONA 3WU0A 4ML1A 4K0NA 5EDNA 4IBPA 5CVJA 2X51A 4ZTJA 2RGVA 1K3LA 2A05A 3LQRA 1E6BA 4OCEA 3A2XA 3ABKH 2D45A 1YW7A 1PUEE 2DXIA 3AG3H 2GQLA 3AAFA 4TXOB 1B4QA 1DBYA 2M3AA 2BBYA 2H1KA 3O8HA 5CO3A 3A2KA 3DFGA 3FHZA 5G1KA 3M07A 3GX8A 2XF6A 2P6TA 1Z91A 3PNVA 1UC7A 3HVNA 3M1GA 3S17J 4Z6YA 3FBIB 5B8BA 1OVNA 2PJRB 2FY6A 3CC2I 1QGVA 3BR6A 3UJ1A 1XTAA 4ZZLA 2XBQA 5DQYA 2HYGD 4S05A 1XCBA 4A93J 4KDYA 3EYIA 1NG7A 1TP9A 3GZ6A 3ZMKA 3BQYA 1J5YA 1OC8A 2H0IA 2DLLA 2LTPA 1K0DA 3GMEA 2L4AA 1K0CA 5ERIA 4WXHA 3FK8A 1HNAA 3N9JA 1F36A 3RQIA 2B1LA 1Z6TA 1X1BA 3IC7A 4KB3A 4O32A 1AQWA 2NRAC 3GYHX 2V41A 4IJ3A 1IXSB 3E5QA 3KE2A 2JK3A 2EZLA 1GRXA 1BJAA 3OYBA 2DBBA 1K83J 1F3AA 2E35A 3CESA 4Q47A 3BTIA 1N75A 1BYEA 1HF0A 3TDGA 4R1HA 3MKWB 1P7IA 4RA2A 3SEZA 1GTAA 3CMEI 3ZREA 2CQNA 4B47A 5DTDA 2FHEA 2LKUA 1VF9A 1Z5YE 1MDKA 2CO5A 4WR5A 1Z3XA 4EJVA 1S3JA 2XKOA 3BDDA 4G6QA 5C4XJ 2JA8J 1GVJA 3KFWX 2WTEA 1Z05A 1I39A 3L2WA 3VWUA 2A5WA 1XX5A 3E3EA 2Y31A 4HQSA 1QBJA 1X0RA 2C1YA 4ZB6A 4UUTA 2QSHX 1XSVA 3VYUB 3C7JA 2HZEA 3KP9A 4XNFA 3DEWA 4Z2YA 4EJWA 2VL2C 1WMJA 4BS9A 2XGDA 3JTHA 1AKHA 1TWHJ 1XW5A 4RQXA 4EJTA 1WH5A 1KU3A 1XB4A 1VI0A 5IOZA 2LRNA 4UVBA 4M3BA 3BZKA 4XHMA 5K5OA 1SYXA 2R37A 1GTUA 3J7ZI 4FYCA 1K3YA 1RPWA 5IYBJ 3S1RJ 3OYMA 1F4KA 2PLYA 4FX4A 3PNTA 4Y7NJ 4E7ZA 4E7LA 1MDJA 2LY9A 2CV2A 1ETVA 3MD2A 3WGDA 2MMZA 4Y13A 2I8DA 1BEDA 4ZILA 3ZYWA 2OA4A 1PP8F 2O8KA 2DK5A 2KPMA 2A5YB 10GSA 2LDUA 2L9NA 2EJRA 3VFIA 1O8XA 3FXOA 4K2EA 1AWCA 4A3JJ 1YFHA 2GSSA 4O5VA 3C18A 3RKYA 5HS7A 1A24A 3VSLA 3DEEA 3LSTA 3K70C 4MFEA 2KLXA 1VNDA 2L0KA 3AY8A 4ON0A 3KPHA 3KEQA 3A01B 2H74A 2HRNA 2P5VA 1T8EB 4BYYA 3O3TA 5C4JJ 1PL1A 3HJOA 3E1SA 3Q0VA 2X64A 3ZMSA 5EGOA 1H88C 3G1MA 3SFZA 3F3XA 3VWVA 2WWYA 1WFXA 2XAHA 2M7AA 2XBIA 3GX0A 4Z7XA 4DSSB 1JHHA 4WWCA 1ZELA 4LL4B 3OOUA 1JTXA 1YQAA 5LLQA 4J19A 2MC4A 2FQ4A 4II2A 5DM7F 2F5EA 2YNXA 1AW9A 3D4MA 5ECRB 4BL7A 3RYPA 2VLVA 2V4JC 2LH9A 1SK1A 1ETYA 2FUG2 1W7PB 3DBLB 5FD5A 2XPWA 1TRVA 1UVZA 2F9SA 2O87A 3E7LA 4RI6A 5LD0A 3K7AJ 1EEJA 1B4AA 2ECCA 1ZLJA 4FASD 2H6XA 4ECJA 1IGNA 3VI5A 2R5ZB 2YN1A 2MSYA 2OBKA 2KRHA 1GSSA 5DDGA 4OWYA 3SFIA 2H09A 3ZGKA 5E1ZB 1TW9A 3ZITA 4FISA 6PAXA 3QAHA 1PMTA 2P7CB 3BZCA 1FG4A 4ACSA 4ZBBA 2IMDA 3FXLA 2NS8A 1CF7B 4G10A 1U9NA 1FOHA 1PRXA 2RVCA 3FISA 4UVAA 1XW9A 3CLQA 2I9HA 4XKBA 2Q1ZB 2DQLA 2PG4A 2IAIA 2EV0A 3L9SA 2K6VA 1XCCA 3CQZJ 1S3RA 3VYSB 1OYWA 2WB1N 2OF7A 1FB6A 3GMFA 1ZN2A 3FM3A 2CQXA 2DA3A 2L5QA 2DLXA 2LV3A 2GGTA 2VD1A 4XLEA 4ZL9A 4PJMA 4BHBA 3D6IA 5D9VA 1FNNA 1WCMJ 4IEJA 3KP2A 2JA6J 1AIUA 1BC7C 3M9AA 2CG4A 4CDGA 1M9AA 2NDOA 4KIBA 2DJIA 3VEPA 2NNYA 3CTGA 2PMZN 3UMAA 2E34A 4BUPA 1S7OA 1DU0A 2IA1A 2IGKA 2OADA 3TOTA 5G1LA 2KDZA 1XGNA 3WTXC 1WJCA 3RKWA 2H01A 4N11A 2H6BA 3ZRGA 3CP8A 2R0CA 4F7ZA 3L2CA 2HKOA 4A2UA 2KP6A 2HYXA 2XPEA 2XGEA 2A6EF 3MVPA 4ZC3A 2C0FA 1USTA 3VWWA 2KQRA 2ECBA 1ZGWA 2OCEA 4MNNA 3ZP5A 1YJ6A 4ANJA 5LEKA 3WTVC 4G9HA 1JI8A 3S3NA 4FH8A 4GSTA 3S93A 3T8RA 1B8XA 3GH6A 1YOVB 1SJIA 5GAEJ 3Q0UA 1OYIA 2LNTA 1TWCJ 5CYVA 3EU4A 2WB1A 4CCOA 1E0EA 4G2EA 1U5TB 5IYDJ 1PD21 4HI7A 5IP9J 3G6EI 1TU8A 4KH7A 4F0CA 3UEMA 6GSTA 1IV6A 3GXOA 3DPUA 1JT6A 1VQPI 2R7UA 4NQWB 3EETA 2B3SA 4KDUA 2QUFA 4LLLA 2VPLA 2H1GA 3DRNA 3A4CA 3ZOBA 4K7OA 4Y3OA 1G7EA 5J1UA 1OCRH 2OAZA 2BY0A 4H4KC 2Z2SB 4DBQA 5IO2A 4V19K 3DMLA 4BXUA 1Z3EA 1Z7RA 4P96A 1QRYA 3GKKA 3U2RA 4O6JA 4TR3A 5ECNB 2L6CA 3RBTA 4BJTA 2OPTA 3ELKA 3D5JA 2VONA 2EZKA 2WV0A 1OE8A 3LSIA 3SZGA 5H6RA 5EYRA 2EILH 3Q3SA 4X0XA 4M9XA 1XXUA 4JEDA 3KXOA 4MJBA 4E7JA 2B6MA 4O3MA 3H3UA 2Z3YA 4M3EA 4XIDA 3OR5A 1POGA 5D93A 3TRPA 1ETKA 2BVMA 3O6BB 2ESHA 2JSCA 2F4OB 2VPRA 1MMAA 2CUFA 3FXQA 4LG0A 1WWJA 2HLSA 3FZ4A 5IT3A 5LCZA 4U0YA 2L4MA 2BYVE 4K7NA 4ZB8A 3FMQA 1O73A 4HX7A 1GSYA 5EZHA 3K8NA 1XC5A 3JCML 4WBJA 4YKGA 1F6MC 4CZZA 4L8EA 2VQHA 5JR3A 3J80K 2M30A 4RM3A 3Q5FA 1YI2I 2PUKC 1D5VA 4BY1J 1XWKA 1JE8A 2GSTA 4ZIJA 2KRFA 1XIYA 4YELA 2B5XA 5GADJ 1KQ8A 1IN8A 4YAVA 2CVDA 4KUNA 4ZDOA 2DQRA 4HG2A 3WE3A 3IOSA 2LY2A 5B7CA 1OKRA 4K5SA 1JUPA 5A4WA 4V2LA 5DYMA 4ENNA 2QGVA 3M9JA 2C0GA 1JGGA 4OOIA 4XLFA 2KJCA 1G3SA 2MG4A 3B6CA 3IWFA 2ISZA 1XPXA 5JCWA 1YW9A 2M46A 1FMVA 1K0BA 3HYPA 2VCXA 1FW1A 3KM6A 3OIOA 5BNGA 2V6EA 3FZAA 3C1RA 3D5SC 2DPDA 3I53A 2DJJA 5ECKB 2WAFA 3WGEA 1K79A 2EFNA 2PJPA 3TBIA 3QAVA 2WC2A 3QR6A 4B44A 1FMWA 1R5GA 5LHIA 4PTSA 4A3CJ 1QZEA 3DVXA 3QMXA 1G7OA 1TTZA 1I6HJ 3CO7C 3HDCA 4GSSA 2M2EA 3F3RA 1JHBA 3OYEA 1IN7A 4LJZF 1T00A 3GSTA 4JRRA 4BWQA 3EMXA 1G3YA 2JZSA 4EEFG 2ON5A 4MK3A 3TCOA 4D1QA 5ABRA 1FIPA 1O57A 1SFUA 3T1BA 4A3BJ 2YCDA 2A3SA 1TQPA 2TDXA 4NNJA 1K0OA 1SK0A 2H1AA 3A0HC 2LVSA 2I1UA 3CRTA 2BW3A 2DCEA 4HW0A 3KLNA 4O7HA 1IW7F 4HU7A 4MJAA 3I54A 3TKQA 2VQCA 4F2IA 1A31A 2YU3A 1F9MA 3R0JA 3K0LA 3E5UA 2VLUA 3FEUA 3G7JA 5FLMJ 1MMNA 5DUKA 4XONA 2GXAA 3M7GA 2QQBA 2PJRA 5L3BA 1O3TA 1KEBA 2LY1A 1YRNA 3VSKA 4BBRJ 1AAZA 2E71A 2V6OA 1ODDA 3IRQA 3UKGA 3FK6A 1MBJA 3V8KA 4ZB9A 2A61A 2COMA 4PGHA 2R7RA 2RV8A 2G7UA 5FHIA 3ZL5A 8GSSA 4XRFA 1FT9A 5TGTA 4XSZF 2EV6A 4CYCB 4TR4A 2UZ8A 1BM9A 3TO6A 4C3IJ 1PFOA 2YWIA 2A68F 3GVAA 3IH3A 4V2MA 1EJ9A 4UV9A 3JW4A 4Y17A 2OJED 1VFCA 1FBSA 3IA1A 2UZKA 2AQEA 2JSYA 1FOWA 3HG9A 1SANA 3KIOA 2VKEA 4F3QA 2CA8A 2GZYA 1AKHB 2KP2A 4IJIA 1B6AA 2GOXB 2BEOA 1ZK8A 5K7FA 1MMGA 4KW6A 2Y0SN 1QVUA 3RZOJ 2OD5A 2H6ZA 3I4MJ 2REMA 3O76A 5INYA 4BQQA 3T5XA 5BRTA 2LFBA 5HLGA 2X0LA 1T4YA 5LGUA 2GS3A 4OMVA 2R4GA 5FKKA 2V1DA 2FMYA 1VGLA 5GSTA 4GQFA 2DYRH 5KNLA 1V2AA 2IA2A 3MN2A 5HLIA 2WDUA 1FBQA 4C2MJ 1MBGA 3OL3A 2EB7A 1YJNI 1FYMA 1HOMA 2C80A 2DIZA 2EIRA 2JZTA 2VM2A 2GIVA 3KP8A 5CVUA 4IZZA 4IJAA 1ERVA 4OIOF 3DKYA 2NTOA 3W3CA 1IUFA 1NG6A 2B5YA 2OV7A 4D73B 4EGZA 11GSA 2QGUA 5KAFC 1TTYA 4B8XA 4POKA 4TR1A 2GVPA 3RYRA 2BE5F 4BL7B 2CWEA 3QODA 4XICA 1PDNC 3OYIA 1T38A 3VDXA 4E7HA 1S7AA 2ZC2A 1FB0A 2VJIA 3FMRA 3OYGA 1TWFJ 3EPZA 1PL2A 1QO0D 3S2DJ 2NAZA 2OU2A 1PYVA 1MBHA 2IBDA 4NC6A 4EM1A 2E1MB 2HOTA 1APLC 2WY7Q 2DC5A 3D5LA 4BE0A 5EZGA 4RB3C 3ONQA 1IYHA 4CICA 2GA2A 2WCIA 2P5RA 1W7PD 2PFBA 5HS8A 3DCFA 2HZDA 2F4MB 1XVWA 3DEXA 5ENUA 1GWCA 2X8HA 3CC7I 4XS4B 1EWXA 3RPNA 4CY6A 2RM6A 1YRNB 4POBA 3KP3A 3CO6C 2OA7A 2RUEA 3QDNA 4UXNA 1Z7PA 2NPBA 3ZTLA 4KYWA 2H71A 1H75A 2ESNA 3GFJA 2CUJA 4RMNA 3K4JA 1D0YA 5H2FC 2P0GA 1TQMA 5J41A 4JK1X 2YZUA 1P7JA 2HXIA 2K9QA 4ENJA 3FXRA 5JHUA 1CF7A 1W1WE 3R61A 4F0BA 1IXRC 5HR1A 1G8XA 3HGYA 1O81A 1G6YA 2CH0A 4GRIA 1GSFA 2DIYA 4UNOA 1JKQC 1OCZH 2OTJI 3G4SI 5E3NA 5EL8A 5HLTA 1IRXA 4AVPA 2YX7A 2PI0A 4L0YB 1JZRA 5JCGA 3TKRA 3IHUA 4LD5A 2KLOA 2WFCA 3W8SA 1T7PB 3TO9A 4OAZA 2TRTA 1YIJI 1PP7U 3D4TA 4RM2A 1SD4A 3GA4A 4OIPF 2H19A 3SBCA 1LNWA 3HRUA 12GSA 3RHCA 1ZYQB 4PZJA 2PVOC 4K1FA 3OWTA 1V5FA 4V2GA 1O7UA 4B1RA 3ZQLA 6GSSA 5DAKB 3LG6A 3OIPA 2W24A 5A4VA 4HSRA 3F4RA 3P90A 1ZKGA 3VOEA 1BI3A 4KITB 1FEXA 2X4AA 3EMPA 3FMWA 1RESA 2B1KA 2R5GA 4RAGA 2KIMA 2H6CA 2Z16A 4DZPA 4RGUA 4CYCA 2AYTA 1XW6A 2EFPA 3GIXA 3E9JB 1D3YA 3OYLA 3TJFA 2EBIA 2PX9A 1EA3A 1SL1B 1TKDB 3D0ZA 5LRSA 2QC7A 2D2ZA 1ZRFA 4F82A 3KH7A 2L02A 1BJXA 2BJXA 1UZCA 5D6FA 2WADA 4PJ0C 1RUOA 1G6WA 4PXOA 4XMYA 4XOPA 5EY6A 1Z77A 4OMZA 2BY2A 4KMFA 4A5PA 5CVRA 1SL0B 2UXNA 3US3A 4PDKA 4IQAA 1VRSD 4JP0A 3GLLA 5BQTA 2CQ9A 2IJYA 2MMAA 4WEYA 2R7QA 5FLVA 3GTLJ 3OMYA 4DQ2A 2HQNA 4XKVA 2F3MA 3I5UA 3MAKA 4YKFA 3LA7A 2GLRA 3IV4A 4CDOA 3MAJA 1Q4JA 4IVFA 4B09A 3HVXA 1X9WB 1I27A 2I4AA 2H27A 2VC0A 1WE0A 2LNBA 1TQIA 3BTJA 5FKMA 2HRAA 2Y69H 1AHDP 1WH7A 4KMUX 3ZMLA 2ZXIA 2ELHA 2QA4I 4C2UA 3G9BA 4ZDLA
chains in the Genus database with same CATH topology
1XVQA 1ZOFA 4F52A 2KRCA 5DBQA 2L7KA 4F91B 3BD2A 3Q6OA 2HE3A 3QCPA 1U88A 5J9CA 3DYRA 1D1AA 2FLSA 2FGXA 1BR1A 4TXOA 3LJRA 3TKSA 3FR3A 2PU9C 2E5ZA 2X8GA 4LIUA 2BTOT 4C9YA 4ID0A 1DE1A 6GSYA 1W36D 4KSMA 1S3DA 4IP6A 1A8LA 2DJ0A 1BG5A 3J7AY 3ZCOA 4MLYA 3KYLA 4YRVA 2VKDA 3TJJA 4FIWA 4OD7A 5HR0A 2FA4A 4OFMA 2JSZA 3TMOA 3KTBA 4ECCA 1WJEA 2YZHA 3LFUA 1GNEA 3CBUA 3C73A 1ERDA 3DTKA 3FZ5A 2H76A 3CSIA 1GL8A 4MPGA 1EGOA 4TXVA 2HU9A 1N2AA 3N5OA 1THXA 2MYSA 4KNDA 1QFNA 5DAKA 1LJRA 4MABA 3MMYB 5KHDA 3LSGA 2CW7A 3OR1C 3ZQQA 3VYTB 1ERWA 3I9V2 4BEHB 3BCKA 5IPHA 3IHGA 3AFHA 5F07A 3BCAA 2EIQA 1JFUA 2OUMA 4CSWA 4J57E 2M80A 4PX1A 1DE2A 3FKFA 4MPFA 5EVOA 2IFQB 1U6TA 1PKZA 5ECQB 1M7TA 5FWGA 1R26A 1X19A 1ZGNA 3LFLA 5JWRB 1O6JA 4OFNA 1GSQA 4PJJA 2R7XA 2VAFA 1SFKA 3UBLA 4WXTA 2HZFA 1J09A 1VZ0A 2R7SA 3KH9A 3QPMA 2DBCA 2HI7A 3W2AA 2KOKA 2YP6A 4KT6A 4HS1A 4CW9A 2E2MA 2VL3A 3CMIA 1A8YA 2PN8A 3WT1A 1URMA 3QFBC 4MJCA 4V1Ag 1OR7C 4POLA 3F6DA 3GNJA 5F0GA 2O8VB 2QSIA 4AJ7A 4PSXA 1QU3A 2F51A 4CCMA 1R5AA 1MW7A 4L5LA 2KHPA 3VYRB 3EYTA 3EUAA 3H9GA 4ZXGA 4GCIA 2OC6A 4XTSA 2WRTA 1ZYPA 5J4UA 2W7NA 1S9HA 2OE1A 4XRDA 3ISOA 2IXSA 2IMIA 1DQUA 1TZLA 3A1YA 3M8JA 4KSOA 2NBSA 2H73A 4CCJA 4JR6A 1K0NA 2VQGA 1F3BA 5J9BA 1YX3A 4I2TA 2WAQA 4I8BA 1V57A 4O5QA 2Y0SA 3APQA 4QL7A 1G0TA 3GSSA 5HNFA 1X1AA 2ZSIB 2YANA 2VLTA 2W82A 3HA9A 2N5FA 4ZL8A 1PKWA 1TI1A 3LSHA 3G2BA 1EZKA 1PGTA 3S8PA 3UBKA 1YKAA 1OKDA 3HJMA 5GSSA 3IK7A