3IA0A

Ethanolamine utilization microcompartment shell subunit, euts-g39v mutant
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
111
structure length
111
Chain Sequence
b'KERIIQEFVPGKQVTLAHLIAHPGEELAKKIGVPDAVAIGIMTLTPGETAMIAGDLALKAADVHIGFLDRFSGALVIYGSVGAVEEALSQTVSGLGRLLNYTLCEMTKSLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ethanolamine utilization protein eutS
molecule tags Structural protein
source organism Escherichia coli
publication title Structure and Mechanisms of a Protein-Based Organelle in Escherichia coli.
pubmed doi rcsb
total genus 26
structure length 111
sequence length 111
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z, a, b, c, d, e, f, g, h, i, j, k, l, m, n, o, p, q, r, s, t, u, v
ec nomenclature
pdb deposition date 2009-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ia0A00
4QIEA 2A18A 3PACA 3I6PA 3DN9A 3SSSA 3DNCA 3NGKA 4LIWA 2EWHA 4OX6A 3CIMA 3NWGA 3MPYA 4DDFA 4OX7A 4OLPA 4P7TA 2G13A 4QIVA 4P2SA 4AXIA 4RBVA 5L38A 5DJBA 2A1BA 3SSRA 4OX8A 4PPDA 3IA0A 3BN4A 4AXJA 3H8YA 2A10A 3I96A 4RBUA 3MPWA 4RBTA 3SSQA 3CGIA 4QIGA 3VCDA 3N79A 4QIFA 4OLOA 4P7VA
chains in the Genus database with same CATH superfamily
4GKKF 1RWUA 1UL3A 1FNMA 2BZ2A 2JC1A 2K8GA 3CJRA 4PWDA 1KC8T 4QR0A 9ATCB 4O3OA 1WC5A 1GTEA 3F41A 3MM5A 4C8OA 2Z2YB 4LRFA 2M5YA 2RHSB 4P74A 2K06A 3MMCB 3OBIA 2BJDA 4TVAB 3UNYA 1QSYA 1YBTA 2WSFC 2BJ9A 3AJ1A 4ID8A 3UN5A 4H4KA 5KG7A 2VA2A 1RWNB 2DNGA 4YB5A 5AE3A 1RHJB 2QA4S 2ZDOA 2E5IA 3JS9A 1EKSA 1NJWA 2C28A 1HBMB 3ZTSA 4JI8J 2HMIA 1D8YA 1TVRB 1FD2A 5HN0A 2IIHA 4I64A 2WVEA 1MMNA 4LRBA 2CWKA 4QOTA 1GMUA 2M70A 1ZBTA 1NSQA 3H8YA 5D6GA 2V8VA 2V4RA 4YDDB 1S76D 4OL8A 1L3SA 2V69A 2J6TA 2FHMA 5KFIA 2OEMA 3TAMA 4WP8A 2GAHC 4KR0B 4RR5A 3PCOB 2DNNA 1MU2B 1V5IB 1FK9A 1K0VA 3DYAB 4OYXA 5IFMA 3UI3A 3PX6A 3D6HB 3PR4A 3GJTB 4TY9A 3C14A 4DPWA 3IG1A 1XR6A 1WC3A 4KGXB 2GZOA 4LF8J 2QL7B 4PG4A 5BYRA 1HQUB 2AD9A 1XWLA 2DYAA 2MKJA 1T05B 1RT1A 2BM0A 2CQ1A 2WOMB 1F9HA 3D9BA 3KJQB 1LKZA 3OQ2A 5F8HA 1KRPA 1LWCB 1RP5A 2EBGA 2WVFA 3GCXP 4AUKA 5EWGA 1TZ0A 4B9NA 1T9VA 2V6AA 2CQ0A 3OHBA 1E6YB 3ONQA 1YLXA 1SJQA 2NPFA 4CO2A 7FD1A 2LXIA 5KFMA 3BQ0A 3RRKA 5HJXA 3OSPA 4FYXB 2GVZA 4J7CA 2MZRA 1MWQA 5D0GA 2KU7A 3EVOA 2XMAA 3CGIA 2N4CA 3K7RA 3T9NA 3H5SA 1CG2A 2CZVC 4FN5A 1GX6A 3THTA 3HP6A 2PN6A 2BDPA 3H42A 4WKRA 4U7UK 1QE1B 1QSSA 2CDQA 2GGPB 1QD1A 2CQ4A 2G0CA 2YWFA 2I1RA 1W26A 2MSSA 4ZPCA 5HQMA 3CC2S 1RWMB 2GMLA 3CJSA 3MECB 1F6TA 3D66A 3UDLA 2W2OP 4C6AA 4IQMA 3R7SB 3M1VB 4RNNA 3IS9A 5D78A 7AT1B 2FPHX 1UWAA 3B78A 3DLGA 4DL2A 2UUTA 4KY3A 4O4GB 5LMNF 3OSNA 3DLHA 4B9UA 4FYVB 2VBXA 2CJQA 4GRSA 1TK5A 2Q43A 1TELA 3JTOA 1KFDA 4Y3CA 2G2YA 2OAUA 5KG4A 2LXFA 4Y6IA 2V2VA 4K0KJ 2C2ZB 4JI2F 1IR1A 1RJJA 4NA3A 3B8HA 4OYBA 4Y2MA 3AA8A 5B09A 3VAMA 4G1PA 2I5JB 4NLWA 3V81B 4HHHA 1RKJA 2YX7A 2H65B 3D6TB 2ZH2A 3LWLA 2ROGA 4JUZA 4ANCA 3M8ZA 5K8NA 3TJ8A 2HHPA 2W9AA 2KRRA 3SXLA 2DPJA 2XS2A 1RCOB 1HNZF 1BQNB 3NCPA 4B3TF 3ILJA 3ZZRA 2PC6A 3NWGA 4O3PA 4MK9A 3TA1A 4Q2LA 2RDJA 2D1CA 2IYIA 2LQ5A 4OFZA 1VGYA 1H73A 1N32J 3VZHA 4ECTA 3DLGB 3BSCA 1EIYB 1JLQA 4ATNA 2KYZA 1U4BA 2FDNA 1XERA 3MMBA 2ZE2A 4G1QA 2RQKA 3T1AA 2AYGA 4ZVOB 2R7RA 2NR0A 2K1RB 2OPRA 2ZOFA 4A46A 4CTAB 4UOCA 2ZKTA 2PFFB 3SSQA 5KT4A 2Q6BA 2MLXA 1FRMA 1T0TV 2VKRA 4PQUA 3Q8YA 4WFXA 3TUJC 4JI8F 3PO5A 1YBUA 4DL4A 1S7HA 3IWLA 4NEZA 1SKSA 3M7VA 1L3TA 3SCJE 2E44A 4LBPA 5B7WA 1Q1KA 1U47A 3QJLA 4YS2A 1UMJA 4KGVB 2R9LA 3QSIA 1C4CA 1NHUA 1TL1B 3CJ4A 2XHCA 1TUVA 1PILA 2V34A 2ZBIA 4OX9F 1XJWB 4FS2A 3X3UA 1OY8A 4TU8A 4C8MA 2L9WA 2DR7A 4USHA 1SL0A 1IM4A 3CULA 3OL8A 1Y0HA 4AD6A 4AYBD 3RB3A 1FEEA 4RNFA 4LREA 4EZ6A 4O44A 4JI2J 2HQIA 1NEEA 2MKHA 3QAUA 4X4SA 2RKIB 3GV7B 1MROA 4KFBB 2UUAJ 4F3QA 5CZXA 3ILOA 3DOLB 3IWXA 4A47A 5MLCV 2LQ9A 2XY7A 5C42A 2FYXA 2PT0A 2XZTB 1GNKA 2GQQA 4DL3A 4USWA 1M5PC 2HWHA 4C0BA 2QFIA 2MZTA 3CVKA 3EVWA 3PM9A 3QGIA 4HEA9 4YR3A 3HKZD 4DV0J 4KBIA 3THPA 1MNEA 2BX6A 2C3OA 3KG4A 4FXWA 3QQCD 1NXIA 1SV5A 2P6SA 2PMZD 3R8YA 5KFVA 2LECA 1U0HA 2IAJB 3QIDA 2VD3A 4NLTA 4C11A 1ZPWX 3HVRA 2LU1A 3HHLC 3BO2A 4JV5F 3HVTA 3GR1A 5L1JA 1QJHA 5C42B 4W98A 2JNJA 2DCUB 5CYQA 4HR2A 3R9LA 1KQSR 3M30A 1UJ6A 1MROB 4B3RF 4IOAQ 5SZTA 2HHSA 4J9RA 2DY9A 2R8IA 3DN9A 5FJ4A 2H48B 1EQ0A 4JI0J 2ALYB 3ZZOA 4I56A 4QWCA 2ILZA 2UXBF 2B7BB 5DETA 1ZM2A 1FDAA 3I87A 4DJBA 1IBCB 3WZ0A 2GFFA 2VL1A 5KG1A 4CO5A 3LAKA 3CMAS 4OYAA 3NEKA 2PO4A 5EX3A 2DR8A 3M6WA 1DTQA 3CWJA 4J9MA 4DQRA 2DHHA 2H5IB 2GS8A 1F9EB 5F9LA 3PIPQ 3OL9A 2XWXA 5CHCB 4JI4F 4ZVSB 4RBUA 4UUXA 1WG4A 1GK8A 5C2CA 1JJHA 2HLTA 5HROB 3OTOJ 2XMWA 3EGNA 2BBEA 1FDBA 1IWGA 1RADB 1HBUB 3FBBA 3MM8B 4P7VA 2F4VF 2FLNA 1SJRA 3T1HJ 4MTPA 1U24A 1V3SA 1WWHA 2WRMA 3MTJA 2MXYA 1VK8A 2DHAA 2NUUG 3I0RA 3N5BA 2BW7A 5K14A 5SUHA 3NRBA 2EFVA 4C11B 1RLDA 4J9OA 1BQMA 4NE9C 2UXCJ 3L7PA 1S1XA 5F9NA 5B0FA 3N5FA 3KFWX 4D3HA 2DY1A 3D2WA 3R5AA 2XY6A 2M8DB 1X9MA 2HLUA 1VQ4S 4HDHA 2MKSA 3MEDA 5F8IA 1VQPS 3H20A 1TKXB 3TEHB 1WI6A 2F1FA 4CH1A 3OHAA 1RBAA 2UUAF 4F4AA 3P49B 2ERRA 3R5BA 1AZSB 1ZPVA 3BGRB 3GIMA 2HMIB 3ZTPA 2DH7A 5T7LA 2XMKA 1TKXA 1RTJB 4DN0A 3GIRA 5AXNA 4IR9A 1NPRA 1NAQA 3ITHB 1P27B 1FTRA 1F5AA 3G96A 4QU7A 1HWIA 2UV8A 5FD1A 2DGWA 1S1XB 2WTFA 3R1LA 4DS5A 4Q44A 3DLKA 5KOWA 1NJZA 4O44B 1LV5A 4W90B 3PACA 4ED1A 1PAUB 1F2HA 1OY9A 3HULA 2J76E 3CPWR 5KFLA 1HHTP 3J7YI 4IDKB 1R7IA 5AJ3F 1YTYA 5D0EA 2W7OA 5L8RC 4LVNP 3TAPA 2GVZB 4ERDA 2G1DA 4L76A 4H4OB 4EUVA 1RHUB 5DDOC 4JI1F 1JMTA 3CB4A 3MAHA 1M0SA 3K59A 4H54A 2ZBCA 1I94J 3M2UB 3IA0A 1TR0A 3KG0A 3SMZA 1RISA 2F8EX 1HHSA 2XMJA 2RH3A 2OPSA 2H1YA 2DEJA 2RUGA 1IBKF 3MECA 2XS7A 3GZ7A 3R6LB 2XCPA 1KQGB 2HVIA 2FJEB 5BR8F 2FJXA 2CUYA 4FYWB 3O3LA 5J2MB 1NBEB 3WDOA 1P9YA 1S1WB 1BQXA 2PA8D 1DLOA 2DNYA 2RNEA 3AQPA 3MGJA 2R8HA 4ICLB 5EUHA 1REVB 4DL0C 2OJ3A 1MN7A 3C66A 2AYBA 4R8UA 3Q89A 4Q7AA 4PG7A 4N47A 1IKWB 1UFLA 1XMBA 2X7IA 1FRHA 1OYDA 4C97A 3UCUP 4DCPB 4XPEA 3P3DA 1ZAWA 3CO9A 3I56S 3GJRB 1KLNA 1IKWA 2HHVA 4Y0FA 1VQOS 2GQCA 2OMLA 1PBUA 1WC1A 4G65A 2E1AA 4U7CA 3K57A 1OSCA 2CJYB 2CPFA 4M5JA 4J9NA 2JLGA 1TL7A 3PW4A 2KJWA 1NJXA 4NYPA 3AB2B 3FBEA 4BC7A 5L1LA 3V81A 2E7VA 1O6XA 2VG7B 5DQGA 1HBUA 4LF2A 3PHTA 2W2QP 1KP6A 1S72S 3C6TA 3WX4A 4OYWA 3VGSA 3OTDA 3LP0B 4ZIVA 1UETA 3M2UA 1ZH5A 2ADCA 3MM9A 3H0PA 1M5SA 2JDJA 3U02A 3KLGA 4IFYB 1S1TA 3PYGA 4DV5F 4X4RA 4XDDA 4Y28C 1UZDA 3KK2A 1EB0A 2BA9A 3GILA 2C2OB 1WEYA 1NB2A 3SI8A 1VCTA 2QFJA 3KLIA 3VAIA 1ROFA 3OFHA 1YSJA 3QAEA 4WIIA 5J1EA 4X62J 2KXNB 3NBPB 2EK6A 3MR3A 4KQZA 4USVA 4J37A 3DLBA 1FHTA 3PVXA 3BGFA 1UPMB 4LF6J 5H9FK 2M9KA 2DIVA 1ZM4A 2DD8S 5AE1A 1NDKA 2ZVIA 5KFKA 1DBDA 1OMSA 4LFAJ 1HQEB 3RBEA 3CC7S 4B9VA 3PFEA 1FJGF 1U45A 1URNA 2WAQD 3H98A 4DMZA 2BANA 4ZJLA 4KRWA 3R97A 2CPEA 3O1LA 2MHNA 4H4MB 4OHWA 2K3IA 2MLZA 1CULB 2GIFA 3DRRB 3CCTA 3FSIA 8RUCA 1N33J 5IT9Y 3U7JA 4N76A 4DZDA 3UWTA 4Y2AA 3FK4A 3SQOP 1TKTB 4OQJA 3C8YA 2ZWPA 2MGZA 4IYQA 3BS9A 4MIBA 3QRQA 4YN3B 3PG9A 1S79A 1YQHA 1HIYA 1HPZA 2B5JA 4TLRA 2KI2A 5B0GA 3DM2B 5G4DA 2PI5A 1C0UB 1S48A 3TWZA 1Q16B 1U2FA 2A3JA 2A18A 2DNMA 1NB7A 1HD1A 4B9LA 5IV3A 3JQJA 3BH7B 4Q8FA 1RAHB 4K7QA 3UR0A 1HW9A 2HBYB 2ZHBA 3FCHA 5THWA 4O3RA 2H51B 2OMOA 4YR0A 3W5XA 3TUZC 2QL9B 3EMTA 1D0EA 1XNQJ 1TQLA 1SC4B 4ECZA 4ZPWR 2VH7A 5AT1B 3DI6A 4EFAC 2IC3B 2VASA 4F3MA 3LQVA 4RZRA 3PYDA 2QLBB 3A8EA 3T6BA 1JLFA 5EWEA 4F4YA 4QCLA 5LXYA 1ZZNA 1LW2A 5B0BA 4LSLB 4WK3A 1JXEA 2UUCF 2KXFA 2Z2MA 3KHLA 3GJQB 3HFVA 3M6UA 4RW8A 2DVIA 5JMNA 5A0YA 1B3TA 5LM7E 1H2VZ 2YKNA 3LP0A 4ES1A 3BJYA 1K1QA 3M1VA 3QRPA 2Z2LA 4G1IA 4B3MF 2HHQA 3ZFVA 3CEDA 1QTNB 1WKLA 2FZCB 1C0TA 3D3CJ 3JSMA 3HSZA 2LQBA 3EXCX 2W4PA 3E01B 3F73A 1RB0A 2XGPA 3U1MA 3DLKB 3K8WA 5HI7A 2O66A 3IFEA 1UFKA 2Q79A 4LR8A 3Q8PB 3PYFA 2MQLA 1VQ5S 1Q95G 4DSIA 2VG5A 2HNYB 3D0GE 3LH2S 4JI0F 1BE4A 3T1HF 1F1BB 1U7LA 3P5TL 4ZVRB 3G87A 3L09A 1IR2A 2MJNA 2W4DA 5KFRA 2KG1A 1HNVA 2DK2A 1JX4A 4JB8B 3M8WA 4DR6J 3O6QA 1UW9A 2CQBA 2YNHA 3IAM9 2FZGB 3E01A 1QAIA 2OIHA 2YNGA 2AGQA 5A8RB 1SI9A 2DISA 1NH8A 1X4FA 4NASA 3SEOA 1RT1B 2WOMA 3VZIA 4MFBB 3TI0A 1HD0A 5IV4A 3ZXWA 2QEXS 2QA2A 1JKHA 1Y00A 1S1WA 2DGOA 2NUHA 2W25A 2XEXA 3MCSA 4URGA 1D3WA 3W5YA 1HNWF 4HH0A 4ES2A 1S12A 4L72B 1G7CB 1RTHB 2OTLS 3CJKA 5IZHA 1HBOA 3D54A 3C6UA 2KRBA 4ZN1A 3T1YF 4DQIA 3W7BA 4P7TA 1U1NA 4X4VA 5D4PA 1LWEA 3RYLA 3AFGA 3AA9A 4HTIA 2HVEA 1I51B 3HHLA 3V6DA 4URSA 1KNZA 2XZDB 4PAAA 4DI6A 3KLEB 1M90T 2F8HA 4GKJF 3MR7A 4UY8T 2BJEA 3V5RA 1Y5NB 2JHEA 2V63A 3HCXA 5HQLA 1X5OA 2HGMA 2MY7A 4DF4A 2HZCA 3NLCA 4GVBB 1W25A 5KFEA 1I5OB 2YWHA 3CJKB 4YQWA 4DUYJ 1D9DA 1ZZFA 1RT4A 3D1HA 3LGMA 2Z56B 3CO0P 4CDIA 4R5PB 4DL6A 2FLPA 4EBCA 1SKUB 5IQ6A 1C4AA 3KDNA 1WC0A 1AYEA 2EFGA 2K1RA 2QC3A 3QT7A 4P71A 2AEMA 3BSAA 1MMLA 5ETLA 5HL7Q 2BQRA 5DG8A 1HNVB 5L9XA 4FXVA 5CABA 1SBRA 1VC5A 4FF1A 3PJ9A 3VAKA 2OP5A 2CNLB 4LRCA 4U95A 3H5YA 4Y2IA 3AQOA 3TARA 2MJUA 1H98A 2IM1A 3NP5A 3R5CA 1Y9OA 2C3PA 2M4MA 4NI2B 5ETQA 4F67A 4Q43A 2DPIA 4B3MJ 1FVSA 2GVDB 3T19A 2BKNA 3IR7B 1WOSA 4RNHA 3KLVA 2FJVA 3MHYA 2CQHA 2EW9A 4IG0A 3MEDB 3AODA 4Q45A 1ZS6A 1QUVA 3BM7A 1U1PA 1RT5A 4KYZA 1CJKA 4I0WA 3TJAA 4DU7A 5U47A 2LMIA 2BKPA 3VAHA 4DOZA 3FRZA 2NS1B 3ZZ0A 3CD0A 3VV2B 4ECQA 1J5OB 3R27A 4F26A 2MMYA 2MQMA 4NOHA 3CCMS 3V4IB 3LGHA 3IBWA 3MFHA 1NKEA 2UVUA 3D5MA 5GMKa 1YRTA 3HT3A 2R2UA 2V8PA 1M1HA 2R7QA 3DRYA 3FGVA 1B64A 4GVLA 2RQ4A 4NLDA 5A6PA 2KN4A 1LW2B 2MZQA 3DDKA 4PKDB 5I42A 3B54A 3UCZP 3NNCA 4C48A 2J9EA 1VIXA 2MQOA 2J0QD 4DSFA 3TEGA 1WOOA 1LOUA 3CJ0A 3QMQA 2BKOA 4O3SA 2E1PA 1BC6A 3ETOA 1X8DA 4OI1A 2C3UA 1S59A 2AGOA 1TL1A 3QBCA 4NXNF 1ZAXA 3FQKA 1WHWA 2GHWA 2FC8A 2XLIA 1AA1B 2GX8A 3OLBA 3GV5B 1JQGA 3PRVA 2MEWA 1UVNA 3DDIA 2RU3A 1N32F 4I2PA 4YHHJ 1UP1A 2GMHA 1K0TA 2RU9A 2ZVSA 3H59A 5CZVA 3OW2R 3ZZZA 5IT0A 4CLLA 1FT8A 1N34F 1IBMF 1N33F 5D8HB 1S1UA 4RWWA 3M32B 2CIMA 4TKTA 5I4MA 4DBQA 1M5OC 5F0UA 5E7OB 3CNQP 3RRGA 2B4PA 3BR9A 3ELHA 1Z2LA 2N3LA 2AJ4A 3NCQA 4JV2A 1YKWA 3HHNB 3EICA 1JLGA 4QPXA 2KB2A 4KKOA 4LQ3A 4I2PB 2LQJA 1KQFB 2HHUA 5HANA 3NGUA 3TZXA 2QTWA 4EEYA 3J81Y 4FKYA 1QM9A 3CW2C 3FC9A 3CCES 2KFZA 3M6VA 2XMVA 4P52A 2W9CA 2W1BA 2CJAA 3DOLA 4EYIB 2G4BA 1TAQA 2F7VA 3EVMA 1VQYA 2ZHAA 2X1BA 4QWAA 4QWBA 2RQMA 1JB0C 1B7FA 2DEIA 3Q2SC 4FF2A 1GMWA 2HWIA 3TX0A 1WKJA 3W2WA 1NUEA 3H7HB 3BBFA 5A8KA 1C1CB 2M0GB 5JVGQ 2MQQA 3L3CA 2AGPA 2MKKA 1PJ7A 4ZKAA 2HFSA 1N36J 4X2BA 3FZ2A 3CDEA 2J6SA 2VZ9A 4QW9A 2BQ3A 1RWPB 4HL9A 1RYSA 1HI0P 4J91A 4DSKA 1FD8A 2LQ8A 3OFFA 3FVYA 4RBTA 5DGBA 2KZZA 4DR1F 2R7VA 1JJ2R 2EXUA 3IRWP 3HHEA 1UAWA 3HHLD 4DCJB 5KT5A 4EYHB 2IRUA 1S0NA 1Q5VA 2NYIA 4LFCJ 2MSTA 1SH0A 2ZC3A 3IMQJ 4MK7A 1YZ6A 3W2VB 3PO4A 1BWEA 3ITHA 4P2FA 3QZ8A 1U6BA 1YRUA 2D9OA 2WVBA 3CDBA 2KXHA 4X64J 1V3RA 1V9OA 3G9CA 3C16B 4DV7F 2FIUA 1KN6A 3N28A 2EI5A 1XMOF 1DZ5A 4KO0B 2HFNA 3AJ2A 1TAUA 1Q8BA 2MQ8A 2ZBPA 3EZ5A 2PSZA 4QWEA 1S0OA 3QWUA 3M8QA 3LPYA 3J7A1 1TL5A 1DQAA 1VBZA 2VJVA 2AHOB 1FXRA 1SQEA 3N6LA 4OYIA 2UXDF 1HFEL 2OFGX 4CLPA 5K8MA 4ECWA 4ED2A 1H2UX 1OSDA 3MM6B 2YNIB 4JV1A 3IWNC 3R2DJ 2XO6A 4ID5A 2DJWA 4PPZA 1LWCA 5J2MA 4K4XA 1SJ4P 2R8GA 1Q7LB 3EGVA 3D3BJ 4L3KA 4ED7A 2J6UA 3NMAA 2AX1A 3CTRA 3DRXA 3E3XA 3MAQA 2ATLA 1V5VA 1BLUA 4H4MA 4KC5A 1BY9A 4OZNA 5I3PA 1OJ4A 1NM2A 4JI6J 3KMQA 4WYLA 4ZPTR 1F2GA 4OX6A 3NAHA 3CIMA 2JSXA 1RWWB 2V0NA 3D4JA 3TA2A 4JI3J 5F8JA 1UEVA 4WKYA 4B3TJ 2C3YA 1QY7A 2Q1LA 3BR8A 4MJKA 5JJBA 5EDWA 4DR5F 4DS4A 3OTBA 3AJDA 1WF2A 4ALZA 2OEKA 3OL7A 3GYXB 2FD2A 3AXMA 4WFYA 4J90A 3A12A 4NCGB 4TY8A 4AQYJ 4DG1A 4OIXA 1D09B 2UV8G 5DZ7A 3KLHB 2FVPA 2DGXA 2FTRA 1QLNA 4OHYA 2IHR1 3FKBA 1URRA 2KVQE 3W9IA 3N79A 3I5CA 2B9XA 4B3OB 5ETOA 1YG0A 2ZH5A 1VI7A 2WBRA 3GSDA 2OGUA 3BQ2A 2GIQA 1RAJA 2BE7D 1Y3KA 3MI7X 1BGXT 1SH2A 3EPIA 1C0UA 2IDLA 2GGPA 2V50A 2W9CB 5ETNA 1F3FA 3MEEA 4TLQA 4ECYA 3QATA 3GV8B 1DAXA 1R0CB 5E5NA 1B4SA 1FRXA 1WEZA 1LFWA 4F3OA 2E5LF 2E5JA 2O01C 1PJ5A 1S6OA 1WJ9A 3CDAA 3MUTP 4USKA 2DRAA 2UVWA 4K59A 2OPQB 2RRAA 2DHXA 2PDAA 4EK2A 2RIJA 4DPXA 3SFUA 2LA6A 4PPDA 4DCOB 4RJVA 2MB0B 1U1KA 2DGTA 1FKOB 2D74B 3WQPA 1R0AA 4X62F 1K47A 1RHQB 1HQUA 4HHJA 4XPCA 2BACA 3Q24A 1RK8A 2O67A 2G0JA 2HGNA 3I0RB 2JFDA 2K2PA 4KFBA 2YNFB 5FDLB 5K14B 4DFMA 1JNRB 2YKMB 5LOQA 5E0OA 1FJ7A 4RW8B 1DLOB 4JP8A 1NHKL 1CJVA 3POTA 2R7TA 1MU2A 3CC4S 3QT6A 4RNMA 4DV3F 3KUHA 5K5MA 2VU5A 4NLVA 5H9FJ 3OTEA 1EETA 3DDNA 3PKYA 4DPYA 3HD1A 2PMWA 5ETPA 4DV4J 1VBYA 2ZEJA 2BJ8A 3VF0B 3R2CJ 2XB2D 1T3OA 1RAOA 2ATCB 2DNZA 2VHGA 2KL8A 1YGYA 4N7TA 5BR8J 3MR5A 5J2QA 4DR1J 3KUEA 1XK8A 1EQMA 2E9TA 4P2XA 1UJ4A 3NOGA 1E6VB 4I2QA 3BBBA 2XYHB 1FXDA 2FVCA 2O1PA 3KMSA 4NCAA 1DHMA 2WZ1A 5B0CA 4JV5J 1NK5A 1NH7A 1AFJA 3GU0A 2AMCB 2XCAA 2GO8A 2KTQA 1DQ8A 1OPIA 1XTZA 4USUA 5CYQB 4EO6A 3CCZA 5DGAA 1J5OA 3H25A 5IS2A 4DR5J 1HPZB 2B5JB 3KK1A 2VFRA 1T9WA 5FDLA 1Y5LB 2KHCA 1KFSA 3RR7A 1JKHB 3IM9A 1S9EB 4U7UD 4ZVPB 2AJ0A 3MPUB 3Q2TC 1OQ3A 2YWGA 3HMJG 1IJEB 3BBCA 3CE8A 1XNQF 5DRKA 1R43A 1REGX 5DZ6A 1J2VA 2ZOGA 3GLJA 2YQ1A 2RT3A 2GO9A 3ILLA 1HI1A 3TRGA 3M8PB 3TVKA 2FHOB 5HBMB 5DLGA 2NSBA 2MDAA 2XNQA 1XN9A 4WP3A 1LW0A 1KHWA 4YFUA 3J81U 1SKWA 2UVRA 2RE1A 4O0IA 1U02A 3VAJA 3G82B 2W9BA 3F44A 1WG5A 2XMTA 1DURA 3VR1A 4X66J 4M95A 1SL1A 2BV3A 1UVMA 4LMZA 4CYUB 1PCAA 4F4WA 2HKEA 4CM2A 2CQ3A 4JV0A 1XEZA 3FBCA 3MCMA 3TVYA 2Y9HA 2IJNA 3Q8RB 3S7RA 2CZ9A 3BSOA 1Q8IA 3H5XA 4DPTA 1VISA 4P6QA 2IVYA 3I5BA 5DDRC 2YBVA 2Z2ZA 5GADI 1NK0A 2MKYA 2I0XA 1RTZA 3NS7B 3NWRA 1CQNA 2CDRB 3EGWB 4R0JA 2VICA 2J8SA 2UXCF 2F9DA 4V19J 4NLOA 4PWUA 4DG1B 3KK3B 1RT6A 3NMRA 4ED5A 1IVZA 2LU2A 1NO8A 2QLXA 1AXQA 1XR7A 2YKOA 2Z8QA 4HLBA 4W4MA 3SFGA 2R8JA 1MWZA 1NZAA 2E1RA 1TMJA 3IO1A 1JIHA 1HBNB 4BHQA 3G71S 4KPCA 4UUWA 4DFKA 1FRKA 1YDLA 4C0OC 2VONA 4ANEA 4J9SA 2B4OA 4OJHA 2F63A 3WC0A 4EU0A 4WE1B 1ZYQA 4P73A 3PHEA 2AWZA 1S49A 2RF2B 2ZBRA 4LJMA 4Y34A 3M2RA 4ZVQB 4X4UA 1RT2A 2FY1A 1TL3A 1UWBA 4Z37A 3W65A 4R0EA 4X64F 2BJ1A 2AQ4A 4DV7J 3GFHA 3PTWA 1S6PB 4CTAA 4ZPDA 4QW8A 3M9OB 4NZ7A 2J0SD 2RDIA 2AKWB 4LFCF 2P2CB 5T41A 2XC9A 3TANA 1ZOTA 1SQFA 5HVHA 2ZWOA 1K44A 5DG9A 1HBNA 4UOHA 4UZBA 1RUSA 3SSRA 3SQGA 5DS7A 1VRTB 5E2QA 4FF3A 1TFWA 2X1FA 3C6UB 1BQMB 4A8OA 2OO4A 4KH0B 2QA4G 3MR6A 3NNAA 4NL5A 3K2YA 3J80U 4TQSA 3W1YC 4NCBA 4DV2J 2IM2A 2VDIA 1WSRA 5KFSA 4ECVA 2HZVA 2B51A 1X4CA 2X3DA 4RW7A 3MEGA 4M5DA 5J1NA 4JI5F 2OPSB 3MMJA 2EFOA 4O23A 4MK8A 3TAMB 1XC9A 1QAJA 4CZCA 3BDEA 1UPPA 2YKNB 1RT7A 2ZJRQ 3KXDA 4ED0A 2AX0A 3C3LA 3VTIA 1P6TA 4TU9A 3T1YJ 1U1LA 3M8YA 4CLZA 3FSXA 1CJTA 3K5LA 3GYNA 1JLBB 4RL1A 3ULHA 4CT8A 3OV7A 1R8PA 4DF8A 1YHQS 4FNHA 1VRUA 3KTQA 2HIQA 2B7CB 2J9CA 3DLJA 5KFCA 2HHXA 4IDKA 4FVMA 3PNIA 4LRDA 4LF6F 3TR5A 2XSJA 3QJJA 4UTGA 1AUDA 4ETXA 2MQNA 2Y8WA 3LP2B 4ZJQA 3IR6B 2AW0A 5E3AA 5CH7B 3Q83A 4ER8A 4FNIA 5HK4A 5F3ZA 1OWXA 2PE8A 4D3GA 4C3KA 1S9EA 1FKPB 1PSDA 4OZLA 1KR4A 3BPSP 4LRAA 2DGQA 4FKXA 4HTJA 4PEOA 1CVJA 4IFVA 9RUBA 1T9UA 2EPIA 2B6AA 1SC1B 4ZOSA 3TW0A 4DUZJ 3MF5A 2C3MA 4M5NA 2V68A 1WDDA 2HQGA 3BH6B 4LF8F 2EFNA 2H4WB 1C1BA 3I0SA 5MAOA 1J27A 4KT0C 2J7UA 4F4ZA 3QLHB 4IH5A 1U26A 2IJRA 2A1BA 2HRUA 3PW7A 1RA6A 1OPZA 2QMXA 4QR2A 4RW4A 3W8PA 4DV1J 4PUOB 3RW6A 1RT3B 1S6QB 5DDQC 3JAMU 4N56A 4ZS6A 1U25A 2VC0A 3I4HX 1RA7A 5KT7A 3BO3A 3JSRA 3HPOA 3PX4A 4JYAJ 2XTJP 4TXSA 3OJSA 3AOBA 3KHRA 4R8UB 3ZZPA 3IGNA 4U67Q 3IN5A 4KAIA 2ASYA 1KHVA 3AD7C 1PYOB 5E3PA 4XIUA 2GC8A 2AZ3A 1X9WA 3AXKA 3QYYA 5BXIA 3OT9A 1RACB 2YQ0A 1NPKA 2POKA 3GFXA 3PEHA 1N8RT 1YI2S 2LXUA 4Q0BA 2B0GA 3OR2A 2E7XA 1D1UA 3M8PA 4K2JA 3W61A 3DXSX 1C1BB 3EX7B 3JTPA 4HH1A 1YX2A 2ZITA 2ZD1A 3QLHA 2VBZA 3DLEB 2KVIA 2GCFA 3CJ5A 3NG8A 3GONA 1HYSA 2WCXA 2AT1B 3S8SA 1EX8A 1HNXF 2V8HA 2FLOA 3ET6A 2R7UA 1LK5A 3DRSA 4FZVA 3IS9B 2MZ1A 4C2MA 2CJKA 4DX6A 3BN7A 1F9FA 2CKWA 4LSZB 4P10A 3W9JA 1SIWB 4NLGA 3R6GB 4OI4A 5ETTA 4QIWD 4MAKA 5F8MA 3P96A 4YY3J 4F2SA 1O8BA 3IR5B 5J1EB 3WBZA 1MWYA 1SPBP 4YOEA 2AJ2A 1CJUA 2PMHA 3VGUA 2XSJB 1FFWB 5EGYA 2WK4A 5GAHU 4JI7J 2P9GA 5EHHA 3TP2A 3DU6A 3K5NA 2I38A 3OR2B 2NSCA 1RSCA 1WELA 2V2KA 4NA1A 4DU8A 4N5SA 3T41A 1NJYA 1NJIT 3KOAA 2PFDA 4ZK7M 2CG8A 2ZH7A 2HVZA 4K0KF 4K4VA 4TN2A 2G2ZA 4CO0A 5A2QY 5GMDA 1N4LA 3MUMP 3EGZA 4FXDA 1AFIA 3H2UB 4DV4F 3UE2A 5A2QU 1TL7B 4ES3A 4AL7A 1VQLS 5H1SV 1NK7A 1JLEA 2MZJA 2R42A 5HQ8A 1YJWS 4NXMJ 1S77D 2QLFB 4WK1A 1IKXA 4FVCA 3DYAA 2D69A 2F5GA 2NYHA 3MM8A 2RQCA 5KG6A 1WHVA 1FKOA 1NNDA 2DHSA 3I9V9 5ETSA 3L7OA 4YR2A 3G4SS 2DNKA 2HFUA 3KG1A 2R7XA 2XYPB 4O4GA 2FVRA 1S6PA 4B9TA 3DOMB 3GG0A 3GSIA 3ZZTA 4DQQA 4ICLA 4KJIA 3RB0A 1YJ7A 4I7FA 4ZCMA 2HNDB 1TV6B 4DR6F 3BZQA 4KGZB 5DG7A 2M3DA 3QFHA 4B9SA 3G6YA 2GA7A 2B6AB 4QYRA 3TZYA 2JEFA 2CFXA 1NDLA 4M5GA 3J7AN 3MMCA 3EXYA 1R27B 3FCWA 2ILYA 2VFSA 4RLEA 4UT4A 4MYUA 3VGVA 4ZVUB 2HVDA 3DNCA 3SCKE 2FVSA 2XZWA 2VQFJ 1CBKA 3MMAA 4IG3A 2HS4A 3RB4A 1I1GA 1PBAA 5J2QB 5DDPC 1U49A 4YUDA 5KFGA 2HW3A 1PIEA 1JJCB 2BM1A 4PG6A 2HQFA 1ACMB 2BOAA 3S01A 1S4EA 3BO4A 1X4BA 2BW2A 4NCGA 1X5PA 2HK2A 3CSKA 4TY8B 2ZM6J 2CPDA 2H54B 4ITSA 3KK3A 2EVZA 1ZTTA 1ITPA 2PIIA 3CD5A 1UA0A 2LEAA 5DQHA 2B4VA 4ZHRA 4CIOA 2VC1A 2XULA 1EHWA 3I55S 1X60A 1CEZA 1S1VB 2DTJA 3ENVA 1JLBA 3OXGA 4K5RA 2IA0A 3F0NA 2YTCA 1O5JA 4JYAF 1H6KX 4PCQA 1ZM9A 3ISZA 1X4GA 5F8NA 4NYZA 3QGGA 1Z4UA 3BPDA 2A2CA 3PDNA 1NZ8A 2ZH8A 1FK9B 4IRCA 2QSWA 1YJ9S 4QU6A 2U1AA 5KFHA 3C15A 3NGKA 3NGDA 1VHIA 1OQ6A 2D41A 5GVQA 2ZH9A 2B9YA 3CCSS 1ELOA 4OV6A 1AROP 3RUBL 3G6XA 2QN6B 1EARA 3HHDA 3MEKA 4LF1A 2N82B 4USTA 4LFBJ 4A4JA 5KFQA 2XI2A 4I4BA 4L73A 4USJC 1DFDA 1JXVA 4CQ1A 4ZLJA 5DLFA 2VG5B 2MKCA 4JI6F 3MOJB 1X5TA 3CCUS 4B17A 4DQSA 3MDFA 2ZJPQ 5LT5A 2QYCA 2OI2A 3BGLA 3I4PA 3RBXA 1FI4A 1Y4ZB 2LDYA 3T5HA 3HI9A 4IUFA 1CQMA 2C42A 3BEGB 4WBFA 3GPAA 1Q86T 4KHMA 4CLKA 4M5HA 3PX0A 2V4JA 3CCWA 4A8FA 2HG4A 3ZZUA 5DO2A 3B82A 4CM0A 4C8YA 5B0DA 1RWVB 2H9ZA 4NWBA 4UF4A 5G0RB 2P8IA 3NXZA 2OSRA 5AXKA 5A0YB 1RI7A 1CS4B 1U2RA 4OYOA 3D6FB 4EBEA 3HVAA 1YJNS 3JQMA 2RHQB 5KFTA 1MG7A 2CVEA 2JLFA 1X4DA 2CG4A 3K17A 1VLOA 1SQGA 4ZVGA 4XTTA 4ZLNA 2DIUA 2GV1A 3OJUA 4L6V3 3C19A 2GQ2A 4DR2J 5KT3A 2XMUA 4DZ6A 4L75A 3K8VA 3Q86A 1XNRF 3S6EA 3UD3P 2C2NA 3VHQA 3RAXA 2ZH4A 1LFPA 5IC6B 1XBWA 4C8ZA 1HHQA 5DM7Q 3BF4A 4HKQA 3MPWA 1KKHA 4K4UA 3QGHA 2IBKA 1FO1A 2K3KA 1CC8A 2BUNA 2NPIA 3THVA 6FDRA 1U1QA 4YMEA 4WXWA 3O5TB 5D15A 2APOA 4ZDNA 2YNGB 3FQLA 1N6QB 1JLAA 2J9DA 2VFUA 2WSCC 4TU7A 4TQRA 1R8CA 2FY8A 2MY8A 2RKIA 2P9EA 2ZUGA 2DO4A 4IH6A 4QZVB 2CNNB 2JX2A 4ED8A 1G1XA 4WZQA 2KKHA 1WKKA 1YJTA 3FZBA 4OI3A 1N34J 2UXBJ 1Q8KA 2HS3A 5KFOA 4F02A 2IY5B 3LAMA 2HQDA 2ZKUA 1RT5B 1RWKB 4YDXA 2Y1JA 1SXLA 4KO0A 2R7WA 3U27A 5KTQA 4DR3J 2VODA 1CC7A 1WD6A 4PYAA 3TQEA 5CCMA 1Q7YT 2CWXA 2M8HA 5HP1A 3A3OB 3HVWA 5ETMA 4QWDA 2LKZA 4KV8A 5HO4A 3FMBA 2XLJA 1N5YB 1TUWA 5BJRA 2V94A 3HD2A 3BREA 2BOPA 2BANB 4WCEQ 1Y3JA 1VQ6S 1UTAA 2NZCA 2JWNA 3MD1A 1OIAA 3B4MA 2MYFA 3Q0AA 1H74A 1T95A 1V3ZA 4IO9Q 4AFFA 4ZCKA 3UDVA 5I3QA 1RHKB 4LSLA 1HMVB 3CIZA 3H40A 3GP9A 1VRQC 4J9QA 3T5JA 1WHYA 4R5PA 2UUBF 4C9DA 4PQUB 1BD6A 1VJQA 1P1LA 2GMJA 4X4OA 2W8KA 3WIVA 5AXMA 2I8EA 5A8KB 4L74A 2IM3A 3HDSA 3ZTRA 1S7IA 2CPIA 1N5YA 3MURP 3AD8C 3K58A 3IBCB 1CJTB 2NXEA 2KH9A 4IFYA 3KKFA 4ETZA 1X4EA 3LO3A 4OJ3A 4Y2CA 4M94A 1PG5B 1U6FA 3D68A 1B0TA 4FYYB 5GAEU 2ACYA 1I94F 2CQPA 1REVA 1C2PA 2UXDJ 3K0JA 2DR5A 2FLLA 2XBPA 2AU0A 2FQQB 4A8SA 2E9RX 1QAXA 3DFEA 3HK2A 4EBDA 2ZZNA 4LFBF 2HK3A 4QR1A 1KBRA 4RPFA 3ZNUA 2Y1IA 4LIRA 2ZE2B 4G1QB 1PC4A 1FNOA 3SQGB 1H0HB 1TKTA 2QMWA 1ZAVA 1KVIA 3M8SA 3TAQA 1MW7A 3LPEA 2W4CA 1AUSL 1H72C 3JAMY 3DRRA 2BE2A 3GIKA 2HHHJ 4CLWA 2Y0SD 5HVGA 4DV6F 2Q66A 1TP7A 2JC0A 4WIQA 1I6JA 5HATA 3I96A 3OVAA 1EP4A 2HS0A 1OO0B 4LBIA 1Q4RA 2XGQA 1F0XA 2JFKA 4AXJA 2RVJA 2YKQA 5IXUA 2BVZA 1IKVB 2XMMA 3FNNA 1RABB 1QTMA 3CDUA 3DHWC 1H3DA 4OYZA 1PKUA 4YP3A 4HYKA 2ZHOA 3RU0A 1YITS 1QE1A 3G86A 3R7BB 3DRPA 5J2PB 5LJ3Y 1FVQA 2HIYA 4NMLA 3S1TA 2NREA 5IWAJ 3OL6A 2RRNA 4PWDB 2YPYA 1G2EA 3OVBA 2V67A 3FUYA 4LUBA 4CLUA 3Q8QB 2KT5A 3OUYB 2F65A 1HYSB 2Z58B 4CRJA 3Q8SB 3N4WA 4HT7A 3BKTA 2BE9B 4KV8B 2BE2B 4ZP8A 3B6BA 3MUVP 3SZ2A 2YY3A 1VQKS 1IBLF 2ZZMA 3CD6S 3OUYA 3BGUA 4ZA1A 3G8TA 2AIRB 2F4VJ 1DJ0A 3OXLA 4C98A 4NPOA 2N4DA 3DI6B 2HBQB 2I2YA 5L1IA 3SV4A 1FE0A 5M2PA 3SDEB 1W2BR 4DWIA 2GHVC 2N7YA 1TK0A 5KG2A 4WZMA 1WOPA 1HA1A 1DTTA 5M2UA 2ZJQQ 4PUOA 4O4RA 1GFWB 3OR1B 4J9PA 2L41A 2VBYA 5F0WA 3PKMA 1NCLA 2RD5C 2W7PA 4EZ9A 4J9KA 4KSEB 3CT9A 4ED6A 1VRTA 3HLUA 5I3UB 4DXLA 3RRHA 3MTKA 1LK7A 3PIOQ 4PABA 4A8QA 5B0EA 3GTYX 1FKAF 2FVQA 1ZTWA 1P9QC 1HNIA 2B43A 4AXIA 1E6YA 3BYPA 3M4XA 2YXLA 1S6QA 4V1Ak 1B7YB 1H7XA 5KG0A 5HJYA 3M9MB 3UQSA 1WC4A 2XWYA 2H4YB 5IC4B 3FSYA 3LWMA 3V6JA 1X9SA 1CJUB 1ICEB 2F40A 3UR3C 4IOBA 1WDTA 1TL3B 1UWBB 2W2PP 3DOKB 5ETRA 4IQXA 2W2MP 3MCNA 4DLEA 1GMVA 1FWKA 2OUGA 1K8AT 1VC6A 1DRZA 2CPZA 4BWMA 5KAKA 5D3GB 3ADAC 3RBDA 2RDDA 1FCAA 3QT5A 4WYWA 3FMWA 1Q0NA 4RW9A 5KFZA 3SSSA 4V19X 3KNAA 1N5VA 1S0VA 3TUIC 5IQQA 1K1SA 1HQEA 4ANDA 1PO6A 1QUPA 4ZP6A 1RTDB 4KGKA 4WFZA 5JUMA 3PEJA 2OKQA 4MH8A 3CMQA 1VR6A 3GR0A 5GADU 1RLCL 3UFCX 2CPHA 1X31C 2BMBA 2RUSA 2ZD1B 4PG8A 5GMEA 2KT2A 3CCRS 2HNZB 4A8MP 4LF7F 1U48A 2QLJB 3GB0A 2IC3A 1Q79A 4PXBA 2HAIA 4I69A 3F56A 3FBFA 2BYCA 4BC9A 3KLFB 1W2IA 1JLEB 2HNZA 4DX5A 4PXCA 2FC9A 5LJ5Y 1RCXB 5L1KA 3HFZB 2FJAB 2CPJA 5J2NA 2AJFE 3E8OA 4X84A 2VQEF 2QX0A 2X1AA 4DV1F 1WG1A 4URQU 2HBRB 1J5EF 3NY0A 2VPYB 3W66A 5HLFA 3UD4P 2K7JA 3J7ZT 1GEHA 2B4UA 2C1EB 4WWSA 2RRBA 3IBFB 4O3QA 3AAWB 5CD4H 4DEZA 3BSNA 2E29A 5AJ3J 1R0AB 2IA6A 3MFIA 4MIWA 1WORA 1HL6A 2AEFA 1U0HB 2QL5B 1H2TZ 3OFEA 4P2SA 2QT7A 2KDOA 1P1TA 4DSLA 2GVDA 3TNVA 3QFWA 4MYTA 2LP4A 4OMFG 2I9SA 2NXJA 3VQSA 3HZEA 3V4MA 3EZOA 3V6HA 4MT1A 4LF5J 4DR7F 1T11A 1F5BA 1B70B 3D1OA 3I0SB 3AB4B 3GE9A 3M32A 2ZC4A 1T9TA 2CQDA 1IN0A 3ENWA 4MKVA 1YZ7A 3RJMB 3FDSA 3UDCA 3KDOA 4AT1B 4U96A 2MKIA 4ZLLA 1Q5YA 3A3NB 5GAEI 1TFYA 3AY0A 3R1HA 1XMOJ 5A76A 5K20B 2V4JB 4K2XA 4DPOA 3SV3A 1U2CA 2WW8A 2CQIA 4MKYA 2J0XA 1VQSA 3MZIA 4UQGA 5K8OA 1SJFA 4E8UA 1ZA2B 4OJGA 2R7SA 2ZZTA 1CPZA 2CVIA 1FDDA 2HFVA 2UZAA 1LWEB 2Y8YA 2QYGA 1X0PA 3TA0A 3TOQA 1RDRA 3HHLB 3MPVA 1NDPA 4I1TA 5F3TA 4X4QA 3V6DB 1VC0A 2ASLA 2A10A 1RT6B 2IRXA 5D4NA 1R0BG 2B9EA 3MPDA 1U1RA 1VBKA 4NLPA 1BQNA 2DBBA 3IM8A 3KWMA 4RU2A 3ZTQA 4LBHA 5HSPA 5CD4A 3ISND 4DSEA 1N36F 5KOXA 4LR9A 3DRPB 3ILIA 1Z2ZA 2DRDA 4DR3F 2LFVA 3VVUA 2ZNZA 3CCQS 2NXUA 5HVFA 4DV0F 3VAFA 1HNWJ 2EC0A 2HPUA 1LXNA 1ULRA 2OFHX 2KHDA 1S5ZA 1G3OA 1S1VA 1RTJA 2DNRA 2MLYA 4NMXA 2FZKB 2LEBA 2B9WA 2VFTA 2IVFB 5C25A 1U6ZA 5HBMA 4Q5VA 2L3MA 3LF0A 1T7PA 1BMQB 4OZ1A 5M2RA 1WHXA 4RUCA 2R2SA 2ALZA 1GXUA 5HLFB 2C2EA 3C15B 2HQCA 4LR7A 3CXCR 2X3GA 2YKPA 4AQYF 2YPZA 2DT9A 1SKRA 3ETMA 4P72A 1FE4A 5LSOA 4ILRA 3IC1A 3Q22A 1JNZB 5CA5A 4I67A 2BJ3A 3ZZYA 4CLYA 1R6YA 2P5VA 3J81j 1RT4B 1LQ9A 2VV5A 5KFUA 3WC2A 1JXLA 4IRDA 1OS5A 2RS2A 3NKYA 2VPXB 2UUWA 3H5UA 4ZHRB 1JLFB 3BKFA 2E1CA 3R5DA 4JI5J 3VVTA 2CJXB 1IWAA 1S1TB 2EFPA 1YJVA 3CCJS 1V6HA 2DH8A 3DCAA 2RB7A 2BRKA 1RHMB 2EC2A 2VQEJ 3C6TB 4F36A 1FF2A 4IG3B 4Z7YA 3G2XA 1WF1A 3D1QA 2G1HA 3QO9A 4M5KA 4P9SA 1FRJA 4ILLA 2HHHF 1S57A 1SVDA 1VQNS 1HWKA 5T14A 1HMVA 2BEFA 2OD6A 2UP1A 5ITHA 5IT4A 4WJBA 5KFWA 2HNDA 1VFJA 4MMOA 1UEUA 4CYUA 2J9DE 4ILMA 4K4YA 3ICLA 5A8RA 4QQBA 4IH7A 1JLCA 1U8WA 1RGVA 4YHHF 1N5TA 3NS6A 2V4QA 3DM2A 4G3IA 3FEZA 3HVTB 3DU5A 1UKUA 4RW4B 3FRYA 4I6WA 3C16A 2CRLA 1VHFA 3QIPB 1Q8LA 2FGCA 4WF9Q 3G6ES 2WONA 3BDPA 2JLEA 1HR0F 2NXNA 2HHWA 2A0FB 3ZO7A 4UOGA 1G6BA 1VDHA 4X4NA 2U2FA 4GO5X 3PV8A 4ECUA 3Q23A 2IM0A 3ENAA 1H7WA 4CO4A 2EG1A 5D4LA 3MM5B 3W63A 2X51A 4NEYA 1CLFA 1KOOA 2NLWA 2ZM6F 3OVSA 3EE3A 5E3QA 3UNGC 2EWHA 3ZTOA 3CF5Q 3CCLS 1FESA 2CPXA 4DFJA 4QYZJ 3HZGA 3N6NA 4U8VA 2A6OA 2D3OR 1U0SA 3EYZA 4HI1A 1N0VC 1O0PA 3KLIB 3M2VA 4QPTA 2HGLA 2W2NP 4DL5A 1HNZJ 4IR1A 4M1KA 4DLGA 3O2IA 3W2WB 3KNGA 3RGIA 3NBPA 3CJTA 4ZIWA 1NSPA 4EI2A 3QRRA 2E5HA 1VYAA 4DR4J 4C7QA 3M2VB 4DUYF 2FJBB 2XO7A 3T5KA 3WX8A 1RWOB 4UQTA 4OHZA 1KDNA 4K5SA 3HT0A 4Q0BB 2YX4A 1VQ9S 5J2PA 1EETB 3H4DA 1FFSB 2DNQA 4IOCQ 2J5AA 3OLAA 5LSLA 3CUNA 2VG6A 2AF6A 4UZCA 1WTBA 1S6UA 3BYRA 1QAYA 2W8LA 1NSKL 1CS4A 5HMWA 2ABYA 1BWVA 1RXOB 2LLZA 1LW0B 2UU9F 4WFAQ 2OLWA 5DQIA 2PD1A 4RU9A 3JYTA 2WONB 3CD7A 4HT5A 1FDNA 1HI8A 4U9RA 3BV8A 4B9MA 1GT8A 2OEJA 5DM6Q 1T05A 4ELVA 3UCGA 2IMOA 3A13A 3QT8A 5DJBA 2DH9A 1R8BA 3IGVA 2IAJA 1HWUA 1PYTA 1S1UB 2Z57B 4M5MA 4ED4A 5LXRA 2N3OA 4RKUC 1KSPA 4IKAA 4OV1A 4LF7J 3C14B 3BGOP 2KYXA 1Q78A 2HZAA 2W24A 3VCDA 3JYTB 4PZVA 1SC3B 3LGNA 2L9NA 4RX6A 1KVKA 5F8GA 3I31A 4NZ0A 4DR4F 3LP1B 4JI7F 4ECXA 2HSEB 1XMQJ 4KGMA 2DNOA 4Z7CA 3E51A 1XQIA 4DV5J 2VJUA 4CT9A 3TUPA 3P45B 2WVDA 3MM7A 3OR1A 2LYVA 3PRDA 3T6JA 1TVRA 1MN9A 2EK1A 3J7YU 4NXMF 5FLXY 1VS3A 1TUGB 3SDEA 4I68A 4RBVA 4GO7X 4ZVEA 3D6MB 3VWSA 2IJFA 3K5OA 4J5OA 4FDFA 1J5EJ 2OPPB 1VQ7S 2VDHA 1HLWA 1L3KA 3CDWA 1WC6A 1C1CA 3FFIB 3MOZA 4YB7A 4GKKJ 3DXBA 2JEIA 2DXEA 1QVGR 3QNWB 2LEPA 1VLYA 2R4FA 3M6XA 1FEHA 1T03B 1RTDA 5C7PA 2VOPA 4FS1A 2HRYA 3BKUA 3HKWA 4DR7J 1UEKA 1UW4A 3ET6B 3RR8A 1IJFB 2DGUA 4LSNA 4ZVFA 3MMAB 5A8WA 2HYIB 3H4BA 2XI3A 4C8KA 1Q53A 1SC6A 3DLEA 4B3SJ 3R7NB 1R31A 1JWWA 3I32A 4S0MA 5KT6A 5HP1B 1U1MA 3HSJA 2OH2A 4RO0A 3SCLE 2R2RA 1SV5B 2G13A 2O5DA 2OPRB 2QZ8A 3ISNC 4TNOA 2YWKA 2YH1A 2E1MC 3FCVA 4IRKA 1JLQB 1N5SA 4DSJA 4KTQA 5KFXA 2DNPA 1FRIA 2JRSA 5ADZA 5HMZA 1N6QA 1UVJA 1RHRB 1C0TB 2JOQA 2Q3PA 3KYLA 2DR9A 2AYMA 2ZBQA 3R3TA 4LSNB 2V2ZA 3EPGA 1BHNA 1A7GE 4OYPA 1EAYC 5GAHI 3C46A 4CLFA 4BDPA 5EX0A 4Q8EA 1R3NA 2DR6A 4CCHA 4F0KA 1R89A 2HEKA 4F50A 2DCLA 3X1LB 3MAAA 3QO9B 1Y10A 4HHUA 5LMNJ 2LDIA 2CJBA 1VQ8S 3FFIA 1VIOA 5K9FA 2YKAA 5IM0B 1OY6A 3VAGA 2DXFA 4DUZF 2YWWA 1DTQB 2V8GA 3Q8UA 4ZPAA 4P2MA 5CAAA 7FDRA 5KFDA 1FWLA 1E6VA 4I2QB 4C8NA 1VMBA 4A8XA 2VQFF 2UVVA 4DQPA 2XHWA 2GAGC 4ZPVR 5C2GA 2OELA 1X5SA 2GJFA 4MKAA 2C2DA 1UVIA 1TMMA 1IKYA 4GC7A 1NPPA 4FBTA 1WNEA 1MSWD 2CPYA 4N77A 1B0PA 4UW2A 3V2UC 1K73T 4YEAA 2EKNA 2G9OA 1PC5A 4OLOA 3PW2A 3EUNA 2WW4A 5J1PA 2RJZA 1D8ZA 5K8PA 2Z30B 3KHHA 1UA1A 1RE1B 4LIWA 1TK8A 3MM6A 1A6LA 2JH3A 2YX1A 4TYAA 1PJ6A 4O0NA 4PQAA 5BYQA 1HWLA 3GIJA 3UDEA 3UW1A 1NK8A 1D9FA 1VRUB 2XY5A 3M8QB 4DV3J 1KD1T 4KE5A 3N6MA 5T7LB 3EZUA 1KQKA 3E2EA 3K5MA 4A48A 1HWJA 3M8RA 2KFNA 1SL2A 2IDEA 2JJ4D 2EKYA 3GWCA 4NZ6A 3NGRA 1UJ5A 4F04B 4PYDA 2MTLA 1FFGB 4LF9F 3G8QA 2OPQA 2QA1A 4EGLA 1SJ3P 4LQ9A 3KJFB 4HDGA 2C2RA 2VOOA 2OHDA 3KJVA 1F3VA 4PWWA 4QIEA 5CQGA 3UN3A 1EZZB 3IXQA 1XNRJ 2MHEA 1PYSB 3PJXA 1TU0B 2DNLA 4Z2XA 1HQ2A 1Y5IB 3W8GA 3PW0A 4RUBA 1WTFA 5D4OA 1JJ4A 3C2PA 3ZNJ1 1N54B 1NLKL 3AT1B 4B3OA 2V5HG 3PRBA 4M5LA 4BWJA 5CXTA 2ADBA 4I6AA 2HHTA 1RT3A 1Y11A 2WB1D 1RAEB 4OZJA 2DB1A 3KLEA 4E0DA 3JTNA 1SB6A 5I42B 2ZH1A 2VIHA 2PI4A 3QWPA 3BN4A 5KFAA 4ZCLA 3B4DA 4NLRA 1H38A 3AD9C 4F4XA 4NLSA 1AT1B 3NGTA 4ZVTB 2V8DA 2DO0A 8AT1B 4ECSA 1KS2A 2QJ3A 3QPIA 5RUBA 2WVCA 1S4FA 3JQKA 3GJSB 3A3PB 3MAAB 1TL4A 3HSGA 4E98A 4UY85 4I7FB 3T9ZA 4C0HA 3HJVA 4PXEA 1LWXA 1FA0A 1GQEA 3M05A 5FIIA 1FERA 2HRTA 5EN1A 1GAOA 5BYSA 3TVZA 2DRBA 3TX8A 1UVLA 3A4TA 2UUBJ 2Y1LB 1SIZA 4ID5B 1N52B 1U09A 1YWXA 1NDCA 2QV6A 2YNHB 3PJWA 4NLXA 1ZA1B 5L38A 2QE5A 2IFXA 1NHVA 3MMBB 1IXKA 3CCVS 3HSDA 1JLCB 4C8LA 1IKXB 3DGPA 4MIAA 4TYBA 5HAOA 2KZMA 5B0AA 4NI2A 2XM3A 1RBOB 3KUGA 4NLYA 3TYTA 2V9WA 4CH0S 4ENOA 2LA4A 1O51A 2OSQA 2N7CA 1PGZA 2ZFHA 4PXDA 4QIFA 3ENQA 3W64A 5HMYA 5EWFA 1NRKA 3G6VA 1FRLA 4CNYA 5IT9U 2XSFA 2CADA 1YBAA 1DTTB 1YRXA 2M2BA 2VPWB 3G82A 2VBWA 3I5AA 1OYEA 3EWGA 4N8NA 2W9BB 1NK6A 3W9HA 5KT2A 3L95X 3MEGB 4HI2A 4M5DB 3US5A 4K4SA 1L3VA 1FTCA 1FNXH 3L7UA 2I5JA 2W01A 4K4ZA 2DHGA 1IKYB 3DC2A 3SYZA 1BXNA 1WI8A 3DMJA 1EJ7L 4RW6A 4AE5A 3RG6A 1FWPA 4X65J 3HHKA 3JB9k 4FBUA 4C4WA 2HVHA 3N9UC 3HFKA 4QJVA 2W7AA 1W7WA 1WF0A 2AP6A 3OTOF 2B8PA 5CCLA 3QZ7A 5JVHQ 3MEEB 4RW9B 5D0RA 4IFVB 1R6VA 4IO1A 6AT1B 3J7Z5 3H2VE 4USMA 3M9NB 5L39A 4Q2MA 5KG5A 3HF5A 2KJVA 4MFBA 1SUQA 1P8GA 3AHPA 2SXLA 4WE1A 5LL6d 1S97A 1S9GB 2A6MA 3H90A 2H5JB 3LTOA 1SJ1A 1T9XA 3MWBA 3KLHA 4OLPA 1AZSA 3BGRA 4ZVHA 3NS5A 1WSVA 4OJ1A 2EBEA 1UVKA 1S9FA 3RZAA 3W3SA 3DOMA 1RU1A 3LANA 1KTQA 3J80Y 3NAIA 4CNZA 2KFYA 3LW5C 1X0FA 3MR2A 1XIQA 2GNKA 6FD1A 5H9EK 4H4KC 1CSJA 4WXOA 2HBZB 4N8OA 2C22A 1T3NA 1M5HA 4PG5A 4XDCA 3Q8VA 4ZCIA 2ASDA 1S9GA 2RMLA 4OI6A 2VB6A 2YNFA 1N56A 4NLQA 4RW7B 1APSA 2R8KA 3SCIE 4ZP7A 3NGSA 4CO3A 1CULA 4DPUA 2VUGA 1JK9B 1IBLJ 2KM8B 4LF4F 1PAEX 3OD2A 1KWMA 4K4WA 2NXCA 4E2FB 5A8WB 3W62A 4DR2F 3OPKA 4PR6A 4DX8H 5ETVA 3GQCA 4GC6A 3UVJA 1YIJS 1IBMJ 4OHXA 4NYOA 3T5LA 5D0HA 2COLA 2FJDB 4G6VB 3RW7A 2EFQA 4YY3F 1XMQF 1AW0A 3KJNB 3OXFA 5E33A 3HXMA 2D3ZA 2HAFA 2CA9A 4XAKA 2HWTA 3GIIA 1FXLA 2GJIA 3MXHP 2ROEA 4WTOB 2ASJA 4AL6A 1HKAA 3DLLQ 3HX9A 4WFBQ 2QRRA 5JXSA 1LWFA 2QSFA 4RUAA 2L9DA 4KB7A 1SUQB 1YJUA 2UUCJ 1S0MA 2PEBA 2AEJA 5D77A 2HFZA 4U8YA 1EKRA 1FKPA 1Q81T 2FHJD 3PR5B 2KM8C 3OTCA 4X65F 2XQCA 3IP0A 3I6PA 3LP2A 3EDRB 3UO0A 3AH6A 3KK1B 4OX9J 1T03A 3A8KA 1YK9A 4KHPF 3LP1A 1QSLA 4DHVA 2Z0GA 4QBUA 2A2DA 3UPFA 2MQPA 2GW8A 4YB6A 1IUJA 1M5VC 3WHIA 1CJKB 3G8SA 2DXDA 4ZPBA 1I3OB 2P6TA 4FYDA 4P75A 1IQZA 1RWXB 1NSAA 2WSEC 3JXOA 3RBZA 4R25A 5L46A 2JEGA 2Y0BB 3CJ2A 1RT7B 5KFFA 3LUYA 4ZJOA 3I9ZA 1FJEB 1HR0J 1RAAB 1T9YA 3MM7B 3UD5A 1RAIB 3U1LA 1HNIB 4O3NA 1X4HA 4CWBA 3AOCA 4OZ3A 1JLAB 4LF5F 3IG1B 4Y65A 4M8LA 5I3UA 3P8BB 5IOLA 2OD4A 4HACB 2ZH6A 4WPAA 2WBMA 3P4UB 1UZHA 4PRFA 4QYZK 3LALA 2FGOA 5J2NB 4BBYA 4YB1P 3L9ZA 2VA3A 1FJCA 3GMGA 4HACA 1UCNA 2R2TA 1AB8A 2O3DA 4KIAA 4DX7A 2KT3A 2V9KA 1FX2A 2D3O1 2NCKL 4F25A 2DGSA 5AXLA 3TZWA 5B08A 5LSRA 2LCWA 3FJ2A 3CJQA 4ZN3A 4LF4J 1NU4A 3AOAA 1L5UA 1RBLA 2LVWA 3GCWP 3HO1A 2CXEA 1GXTA 4F0MA 4B3RJ 1T94A 2OTJS 3IAS9 3SBMA 2YWEA 1RT2B 2WHOA 3CJ3A 3N0VA 4H4OA 3LA0A 2FHJA 5C5JA 4CP5A 3FEYB 1UFWA 3EM1A 2ZOMA 1T8EA 2CZ4A 3P6YC 4ELTA 2DNHA 4Y00A 1RTHA 4NRUA 5A6WA 2M7SA 1LEOA 4JBCA 3QGPA 2JL9A 3BB5A 1U1OA 4EWTA 3DRSB 5KFJA 2BJ7A 2FB0A 2MGZB 2IVMA 3MCOA 4KHRA 1N0UA 3JSBA 3DMJB 4RW6B 2Y3YA 3DGVA 2EG2A 4WU3A 3A1YG 2ROPA 1WUUA 3H2LA 3ZC4A 3KHGA 3WIUA 1LWFB 2J7WA 4F0HA 5GAGI 1R8HA 4EO8A 4Y2KA 4EMDA 1KLMA 4OI0A 3NOCA 4BS2A 2J8AA 5F8LA 4NXNJ 3BQ1A 3D28A 1Q82T 2BXJA 3NCRA 1RZMA 2IBOA 4JI4J 2HNYA 1Y7PA 1IBKJ 2H3EB 2KO1A 4WP9A 3PXGa 1HARA 4CH7A 4K50A 1ZM3A 2BRLA 3W60A 3V4IA 2HURA 4K4TA 3MD3A 4DV6J 1GH8A 1SH3A 3U1NA 3UVJB 5FLXU 2D3UA 2M52A 4AL5A 4NA2A 1MLAA 1LXJA 2FHKA 1IM6A 1F5CA 3KJVB 1B99A 2K7KA 2XLKA 4FPIA 4A8KA 2MPUA 1RKIA 2CQ2A 4KPYA 2E5LJ 1JLGB 2QGFB 3D0HE 1HW8A 2QO3A 2RS8A 3A8IA 3QIPA 2Z4PA 3O8WA 5KG3A 1GX5A 2F4FA 3UN2A 5KFPA 3NL0A 2BABA 4C3MA 1QVFR 4KHPJ 1B0VA 1GMWD 1TKZA 2JVRA 2R3VA 3KLGB 3K5PA 2ZDPA 4OX8A 1HNXJ 1KEKA 1NK9A 3FEXB 1KTVA 2JZ5A 1FX4A 3IRXB 4CI0B 4X4PA 3HM9A 3PW5A 3PY8A 2GHPA 3HJFA 4ELUA 2DITA 5G0RA 4OHVA 4A8YA 1HBOB 4DFPA 2AJQA 2HQ3A 4M5IA 5KFYA 3TO8A 1K9MT 2L48A 2MZSA 4NX9A 3PYEA 2AYEA 3EJMA 4RWXA 2GJ2A 3QJPA 1IKVA 3P5BP 2YQ3A 2RILA 4JI1J 3JSYA 1TV6A 2D7SA 5LMUJ 4GVBA 2XYGB 4OZ5A 2RF2A 2EEYA 3NNHA 1BUXA 3DHXA 1Z1ZA 2QMUB 3MPYA 4B08A 4F7VA 4ZLPA 2VF3A 4WFNQ 3M30B 2DKOB 3PZPA 2V2QA 1N88A 3RB6A 1X7VA 1R8AA 1RAGB 2R7OA 2AV5A 2B8QA 1TKZB 2CNKB 4B3SF 5ETKA 4J9UE 3QSYB 2E9ZA 2Y1RI 1KONA 4N41A 4CO1A 3K89A 4ZP9A 3I82A 4X66F 3CMES 4DUTA 4FP9A 1VQMS 2YVSA 4ZMMA 1A0OB 1TKDA 2D9PA 3R5JB 2F8MA 3V6KA 3VGTA 2CNOB 2WB4A 1VBXA 3O44A 4LF9J 5KFBA 1RAFB 4CLSA 3LOUA 1U8SA 1NKCA 3GG1A 2NZ4A 4L3NA 4DL7A 2AJ1A 2CQCA 4CLTA 4W92B 4ECRA 5H9EJ 2IPOB 4IG0B 2P9CA 4LT6A 2B3TB 5HROA 1S99A 4OX7A 5C25B 4JOUA 3D0IE 1KLMB 1QDUB 1YJRA 2ACMA 2DGVA 1HBMA 4LVOP 5E41A 1N48A 2RAQA 5E3RA 2VPZB 4KKOB 2J0WA 1G4CA 2J7KA 3RAQA 2B56A 3GFZA 4FPRA 2X1GA 4X4TA 2AZ1A 4I6YA 4NLUA 2CJ9A 1NMEB 4U6PA 5CYJA 1KOHA 1MMDA 1YVFA 4OYMA 1M1KT 2G0IA 4WU2A 3R5GA 2CAJA 2H5EA 1M5KC 2ZNYA 2ZH3A 1F60B 1NKBA 2ZUAA 2C2MB 4KH1B 2PA3A 2JVOA 3VQTA 2Q6CA 4A8WA 4MKBA 1TTHB 3VALA 3EDQB 3D67A 2VFVA 3GYGA 3M2RB 4BCAA 2CQGA 4ED3A 1N5QA 1EP4B 1WEXA 3N01A 2JEJA 2XG8A 4F8RA 5HMXA 1DY3A 5C24A 2PEHA 2FUG9 2VG7A 3T3FA 2IMWP 4DDFA 5D3GA 2F9JA 1S10A 1WACA 2OPPA 1GTHA 3A8JA 1X4AA 1LNQA 1SCJB 4OI2A 5CYMA 2UU9J 3IRXA 3SIPB 1DARA 2G2OA 4F4KA 3DOKA 2FJWA 1RTIB 4LFAF 2QG9B 1FJGJ 1M1GA 5IM0A 2L08A 4USIA 2BQUA 1VJWA 4DV2F 4RUHA 2IYGA 1VOMA 2C2KB 3DKDA 3TJ9A 1ZETA 4ZITA 8ATCB 1KVJA 4QIGA 4B02A 3W5ZA 4GKJJ 2E5GA 1IR0A 2XS5A 3PFOA 4C3LA 1RQ0A 4F2RA 5KFNA 2QLWA 1CJVB 3POTB 4OZ0A 5GAGU 5L9NA 3GFYA 2YNIA 1VK3A 2IRYA 5F41A 2VG6B 1RU2A 2YKMA 3OFGA 1T02A 4J9VA 4XO0A 2HFOA 1IQTA 5IWAF 2BR0A 4NRTA 2I6WA 4UOFA 2VKZG 4JI3F 4RNOA 4QIVA 3RTVA 2M88A 1A9NB 2NQPA 3KLFA 1RTIA 4DN9A 3DGPB 4K8RA 5LMUF 2YH0A 1DQ9A 4HVZA 4BLGA 4J9LA 1NK4A 4FF4A 3D7SB 3CJ8A 1RYRA 2PGCA 5CYMB 1L3UA 2E66A 5AE2A 3KK2B 1XR5A 2CYYA 4OZ2A 3RAMA 2GIRA 3L4BC 2KG0A 3W2VA 5C24B 2QIFA 3JSMB 2RSQA 4WTYA 4M63A 3TZZA 2E7WA 4XK8C 3MM9B 2F3JA 4GMKA 5E3CA 2XNRA 3TQ1A 1D9AA 1GXLA
chains in the Genus database with same CATH topology
4GKKF 1RWUA 1UL3A 1FNMA 2BZ2A 2JC1A 2K8GA 4PWDA 1KC8T 4QR0A 4O3OA 3F41A 1GTEA 3MM5A 4C8OA 2M5YA 3MMCB 3OBIA 2BJDA 1QSYA 2WSFC 3AJ1A 4ID8A 4H4KA 5KG7A 2DNGA 4YB5A 5AE3A 2QA4S 2ZDOA 2E5IA 1NJWA 1HBMB 2HMIA 1D8YA 1TVRB 1FD2A 5HN0A 4I64A 4QOTA 1MMNA 5D6GA 2M70A 1ZBTA 2V4RA 3H8YA 1S76D 2V8VA 4YDDB 4OL8A 1L3SA 2J6TA 2FHMA 5KFIA 3TAMA 4KR0B 1K0VA 2DNNA 1MU2B 1FK9A 3DYAB 5IFMA 3UI3A 3PX6A 3PR4A 4TY9A 3IG1A 1XR6A 4PG4A 5BYRA 1HQUB 2AD9A 1XWLA 2MKJA 1T05B 2DR7A 1RT1A 2BM0A 2CQ1A 2WOMB 3OQ2A 5F8HA 1KRPA 1LKZA 1LWCB 1RP5A 2EBGA 4AUKA 4B9NA 5EWGA 1TZ0A 2CQ0A 3OHBA 1E6YB 3ONQA 1SJQA 2NPFA 4CO2A 7FD1A 2LXIA 5KFMA 3BQ0A 3RRKA 3OSPA 2MZRA 2KU7A 3CGIA 2N4CA 3K7RA 3T9NA 3H5SA 1CG2A 2CZVC 4FN5A 1GX6A 3THTA 3HP6A 2PN6A 2BDPA 4WKRA 4U7UK 1QE1B 1QSSA 2CDQA 2CQ4A 2G0CA 2GGPB 2YWFA 2I1RA 2MSSA 4ZPCA 3CC2S 2GMLA 3UDLA 3MECB 4IQMA 3M1VB 4RNNA 3IS9A 5D78A 2FPHX 4DL2A 3B78A 3DLGA 2UUTA 4O4GB 5LMNF 3OSNA 3DLHA 2VBXA 2CJQA 1TK5A 2Q43A 3JTOA 4Y3CA 1KFDA 5KG4A 2OAUA 2LXFA 4Y6IA 4JI2F 4NA3A 1RJJA 3B8HA 4Y2MA 3AA8A 5B09A 3VAMA 4G1PA 2I5JB 4NLWA 3V81B 1RKJA 2YX7A 2ZH2A 3LWLA 2ROGA 4JUZA 5K8NA 2HHPA 2W9AA 2KRRA 3SXLA 2DPJA 2XS2A 1HNZF 1BQNB 3NCPA 4B3TF 3ZZRA 2PC6A 3NWGA 4O3PA 4MK9A 3TA1A 4Q2LA 2RDJA 2D1CA 2IYIA 2LQ5A 4OFZA 1VGYA 3VZHA 4ECTA 3DLGB 3BSCA 1JLQA 4ATNA 2KYZA 1U4BA 2FDNA 1XERA 3MMBA 2ZE2A 4G1QA 2RQKA 3T1AA 2AYGA 2R7RA 2NR0A 2K1RB 2OPRA 2ZOFA 4A46A 4CTAB 4UOCA 2ZKTA 2PFFB 3SSQA 5KT4A 2Q6BA 2VKRA 1FRMA 4PQUA 4WFXA 3TUJC 4JI8F 3PO5A 4DL4A 1S7HA 3IWLA 1SKSA 1L3TA 3SCJE 2E44A 5B7WA 1Q1KA 1U47A 3QJLA 2R9LA 1UMJA 1C4CA 1NHUA 1TL1B 3CJ4A 1TUVA 1PILA 2ZBIA 4OX9F 4FS2A 3X3UA 4TU8A 4C8MA 2L9WA 4USHA 1SL0A 1IM4A 3CULA 3OL8A 1Y0HA 4AYBD 3RB3A 1FEEA 4RNFA 4EZ6A 4O44A 2HQIA 1NEEA 2MKHA 3QAUA 4X4SA 2RKIB 3GV7B 1MROA 4KFBB 4F3QA 5CZXA 4A47A 3DOLB 3IWXA 5MLCV 2XY7A 2LQ9A 5C42A 2PT0A 1GNKA 2GQQA 4DL3A 1M5PC 2HWHA 4C0BA 3QGIA 2MZTA 3CVKA 3PM9A 4HEA9 4YR3A 3HKZD 4KBIA 3THPA 1MNEA 2C3OA 3KG4A 4FXWA 5KFVA 2VA2A 1SV5A 2P6SA 2PMZD 1M5VC 2LECA 2IAJB 3QIDA 2VD3A 4NLTA 4C11A 1ZPWX 3HVRA 2LU1A 3HHLC 3BO2A 4JV5F 3HVTA 3GR1A 5L1JA 1QJHA 5C42B 5CYQA 2DCUB 1KQSR 3M30A 1UJ6A 1MROB 4B3RF 4IOAQ 5SZTA 2HHSA 4J9RA 2R8IA 3DN9A 5FJ4A 3ZZOA 4I56A 4QWCA 2ILZA 2UXBF 2B7BB 5DETA 1ZM2A 1FDAA 3I87A 4DJBA 3WZ0A 2GFFA 2VL1A 5KG1A 4CO5A 3LAKA 3CMAS 2DR8A 2PO4A 5EX3A 3M6WA 1DTQA 3CWJA 4J9MA 4DQRA 5F9LA 3PIPQ 3OL9A 2XWXA 5CHCB 4JI4F 4RBUA 4UUXA 1WG4A 1JJHA 2HLTA 5HROB 2XMWA 3EGNA 2BBEA 1FDBA 4P7VA 3MM8B 1HBUB 2F4VF 2FLNA 1SJRA 4MTPA 1U24A 1V3SA 1WWHA 2WRMA 3MTJA 2MXYA 1VK8A 2DHAA 2NUUG 3I0RA 3N5BA 5K14A 5SUHA 2EFVA 3NRBA 4C11B 4J9OA 4G3IA 1BQMA 3L7PA 1S1XA 5F9NA 5B0FA 3N5FA 3KFWX 4D3HA 3D2WA 2XY6A 3R5AA 2M8DB 1X9MA 2HLUA 1VQ4S 4HDHA 2MKSA 3MEDA 5F8IA 1VQPS 3H20A 1TKXB 1WI6A 2F1FA 4CH1A 3OHAA 2UUAF 3P49B 2ERRA 3R5BA 1ZPVA 3BGRB 3GIMA 2HMIB 2DH7A 5T7LA 2XMKA 1TKXA 1RTJB 4DN0A 5AXNA 4IR9A 3ITHB 1NAQA 3G96A 1P27B 1FTRA 1F5AA 4QU7A 1HWIA 2UV8A 5FD1A 2DGWA 1S1XB 2WTFA 3R1LA 4DS5A 4Q44A 3DLKA 5KOWA 1NJZA 4O44B 1LV5A 4W90B 3PACA 4ED1A 2J76E 3CPWR 5KFLA 1HHTP 3J7YI 4IDKB 1R7IA 5AJ3F 1YTYA 2W7OA 5L8RC 4LVNP 3TAPA 4ERDA 2G1DA 4H4OB 4EUVA 5DDOC 4JI1F 1JMTA 3CB4A 3MAHA 1M0SA 3K59A 4H54A 2ZBCA 3M2UB 3IA0A 1TR0A 3KG0A 3SMZA 1RISA 2F8EX 1HHSA 2XMJA 2RH3A 2OPSA 2RUGA 1IBKF 3MECA 2XS7A 3GZ7A 2XCPA 1KQGB 2HVIA 2FJEB 5BR8F 2FJXA 3O3LA 5J2MB 3WDOA 1S1WB 1BQXA 2PA8D 1DLOA 2DNYA 2RNEA 3AQPA 3MGJA 2R8HA 4ICLB 5EUHA 1REVB 4DL0C 2OJ3A 3C66A 2AYBA 4R8UA 4Q7AA 4PG7A 4N47A 1IKWB 1UFLA 1XMBA 4C97A 1FRHA 3UCUP 4XPEA 3P3DA 1ZAWA 3CO9A 3I56S 1KLNA 1IKWA 2HHVA 4Y0FA 1VQOS 2GQCA 2OMLA 3K57A 2E1AA 4U7CA 1OSCA 2CPFA 4J9NA 2JLGA 3PW4A 2KJWA 1NJXA 4NYPA 3AB2B 4BC7A 5L1LA 3V81A 2VG7B 5DQGA 1HBUA 1S72S 3C6TA 3WX4A 3OTDA 3LP0B 1UETA 3M2UA 1ZH5A 2ADCA 3MM9A 3U02A 1M5SA 2JDJA 3KLGA 4IFYB 1S1TA 4DV5F 4X4RA 4XDDA 4Y28C 3KK2A 2BA9A 3GILA 1WEYA 3SI8A 2QFJA 3KLIA 3VAIA 1ROFA 3OFHA 1YSJA 3QAEA 4WIIA 5J1EA 2KXNB 3NBPB 2EK6A 3MR3A 4KQZA 3DLBA 4J37A 1FHTA 3PVXA 3BGFA 2M9KA 2DIVA 1ZM4A 2DD8S 5AE1A 5KFKA 4B9VA 1DBDA 1FJGF 1HQEB 3RBEA 3CC7S 3PFEA 1U45A 1URNA 2WAQD 3H98A 4DMZA 2BANA 4KRWA 2CPEA 3O1LA 2MHNA 4H4MB 4OHWA 2K3IA 3DRRB 3FSIA 3CCTA 5IT9Y 3U7JA 4N76A 3UWTA 4Y2AA 1TKTB 4OQJA 3C8YA 2MGZA 4IYQA 3BS9A 4MIBA 1S79A 1YQHA 1HPZA 2B5JA 4TLRA 2KI2A 5B0GA 3DM2B 5G4DA 2PI5A 1C0UB 1S48A 1Q16B 1U2FA 2A3JA 2A18A 2DNMA 1NB7A 1HD1A 4B9LA 4Q8FA 3UR0A 1HW9A 2ZHBA 3FCHA 5THWA 4O3RA 1D0EA 2OMOA 4YR0A 3TUZC 1TQLA 4ECZA 4ZPWR 2VH7A 3DI6A 4EFAC 2IC3B 2VASA 4F3MA 3LQVA 4RZRA 3A8EA 3T6BA 1JLFA 5EWEA 4F4YA 4QCLA 5LXYA 1ZZNA 1LW2A 5B0BA 4LSLB 4WK3A 1JXEA 2UUCF 2KXFA 2Z2MA 3KHLA 4RW8A 3M6UA 2DVIA 5A0YA 1H2VZ 2YKNA 3LP0A 4ES1A 3BJYA 1K1QA 3M1VA 2Z2LA 4G1IA 4B3MF 2HHQA 3ZFVA 3CEDA 3JSMA 1C0TA 2LQBA 3EXCX 2W4PA 3E01B 3F73A 2XGPA 3U1MA 3DLKB 3K8WA 5HI7A 2O66A 3IFEA 2Q79A 3Q8PB 2MQLA 1VQ5S 4DSIA 2VG5A 2HNYB 3D0GE 3LH2S 4JI0F 3T1HF 1U7LA 3P5TL 3L09A 2KG1A 2MJNA 2W4DA 5KFRA 1HNVA 2DK2A 1JX4A 3O6QA 2CQBA 2YNHA 3IAM9 1QAIA 3E01A 2OIHA 2YNGA 2AGQA 5A8RB 1SI9A 2DISA 1NH8A 1X4FA 3SEOA 1RT1B 2WOMA 3VZIA 4MFBB 3TI0A 1HD0A 2QEXS 2QA2A 1JKHA 1Y00A 1S1WA 2DGOA 2NUHA 2W25A 2XEXA 3MCSA 4URGA 1D3WA 1HNWF 4HH0A 4ES2A 4L72B 1G7CB 1RTHB 2OTLS 3CJKA 5IZHA 1HBOA 3D54A 3C6UA 2KRBA 3T1YF 4X4VA 4DQIA 3W7BA 4P7TA 1U1NA 5D4PA 1LWEA 3RYLA 3AA9A 4HTIA 3HHLA 3V6DA 4URSA 1KNZA 3KLEB 4GKJF 1M90T 2F8HA 4UY8T 2BJEA 3V5RA 1Y5NB 2JHEA 2C28A 4DF4A 1X5OA 2HGMA 2MY7A 1TKDA 2HZCA 3NLCA 5KFEA 1W25A 4YQWA 2YWHA 1N5YB 3CJKB 1D9DA 1ZZFA 1RT4A 3D1HA 3LGMA 4DL6A 2FLPA 4R5PB 4EBCA 5IQ6A 1C4AA 2EFGA 2K1RA 3BSAA 1MMLA 5HL7Q 2BQRA 5DG8A 1HNVB 5L9XA 4FXVA 1VC5A 1SBRA 4FF1A 3VAKA 2BR0A 2OP5A 3TARA 3H5YA 4Y2IA 3AQOA 2MJUA 1H98A 2IM1A 3NP5A 3R5CA 1Y9OA 2C3PA 2M4MA 4F67A 4Q43A 2DPIA 1B7FA 1FVSA 3T19A 3IR7B 4RNHA 3KLVA 2FJVA 3MHYA 2CQHA 2EW9A 4IG0A 3MEDB 4Q45A 1QUVA 3BM7A 1U1PA 1RT5A 4I0WA 5U47A 2LMIA 3VAHA 4DOZA 3FRZA 2NS1B 3ZZ0A 3CD0A 4ECQA 1J5OB 3R27A 4F26A 2MMYA 2MQMA 4NOHA 3CCMS 3V4IB 3IBWA 3MFHA 1NKEA 2UVUA 3D5MA 5GMKa 1YRTA 3HT3A 2R2UA 2R7QA 3DRYA 3FGVA 1B64A 2RQ4A 4NLDA 5A6PA 2KN4A 1LW2B 2MZQA 3DDKA 4PKDB 5I42A 3NNCA 3UCZP 2J9EA 1VIXA 2MQOA 2J0QD 4DSFA 3CJ0A 1LOUA 3QMQA 4O3SA 1BC6A 3ETOA 1X8DA 4OI1A 2C3UA 2AGOA 1TL1A 4NXNF 1ZAXA 3FQKA 1WHWA 2GHWA 2FC8A 2XLIA 3OLBA 2GX8A 3GV5B 1UVNA 2RU3A 1N32F 4I2PA 1UP1A 2GMHA 1K0TA 2RU9A 2ZVSA 3H59A 5CZVA 3OW2R 3ZZZA 5IT0A 1N34F 1FT8A 1IBMF 1N33F 5D8HB 1S1UA 4RWWA 3M32B 2CIMA 4TKTA 5I4MA 4DBQA 1M5OC 5F0UA 5E7OB 3RRGA 2B4PA 3BR9A 1Z2LA 2N3LA 2AJ4A 3NCQA 4JV2A 3HHNB 1JLGA 4QPXA 2KB2A 4KKOA 4LQ3A 4I2PB 2LQJA 1KQFB 2HHUA 4EEYA 3J81Y 3CCES 1QM9A 2KFZA 3M6VA 2XMVA 2W9CA 2G4BA 2CJAA 3DOLA 4EYIB 1TAQA 2F7VA 1VQYA 2ZHAA 2X1BA 4QWAA 4QWBA 2RQMA 1JB0C 3Q2SC 4FF2A 2HWIA 3W2WA 5A8KA 1C1CB 2M0GB 5JVGQ 2MQQA 3L3CA 2AGPA 2MKKA 4ZKAA 4X2BA 3FZ2A 3CDEA 2J6SA 2VZ9A 4QW9A 2BQ3A 4HL9A 1RYSA 1HI0P 4DSKA 1FD8A 3OFFA 3FVYA 4RBTA 5DGBA 2KZZA 4DR1F 2R7VA 1JJ2R 3IRWP 3HHEA 1UAWA 3HHLD 5KT5A 4EYHB 1S0NA 2IRUA 2NYIA 2MSTA 1SH0A 2ZC3A 4MK7A 3W2VB 3PO4A 1BWEA 3ITHA 1U6BA 3QZ8A 1YRUA 2D9OA 3CDBA 3G9CA 2KXHA 1V3RA 1V9OA 4DV7F 2FIUA 1KN6A 3N28A 2EI5A 1XMOF 1DZ5A 4KO0B 2HFNA 3AJ2A 1TAUA 1Q8BA 3EZ5A 2PSZA 4QWEA 1S0OA 3QWUA 3M8QA 3LPYA 3J7A1 1TL5A 1DQAA 1VBZA 1FXRA 1SQEA 3N6LA 2UXDF 1HFEL 2OFGX 5K8MA 4ECWA 4ED2A 1H2UX 1OSDA 3MM6B 2YNIB 4JV1A 3IWNC 4ID5A 2DJWA 4PPZA 1LWCA 5J2MA 4K4XA 1SJ4P 2R8GA 1Q7LB 4ED7A 2J6UA 3NMAA 2AX1A 3CTRA 3DRXA 3E3XA 3MAQA 2ATLA 4H4MA 1BLUA 4OZNA 4KC5A 1BY9A 5I3PA 3KMQA 4WYLA 4ZPTR 1F2GA 4OX6A 3NAHA 3CIMA 2JSXA 5F8JA 2V0NA 3TA2A 1UEVA 4WKYA 2C3YA 1QY7A 2Q1LA 3BR8A 4MJKA 5JJBA 5EDWA 4DR5F 4DS4A 3OTBA 1WF2A 4ALZA 3OL7A 3GYXB 2FD2A 4WFYA 4NCGB 4TY8A 4DG1A 4OIXA 2UV8G 3KLHB 2FVPA 2DGXA 2FTRA 1QLNA 4OHYA 2IHR1 1URRA 3N79A 3I5CA 2B9XA 4B3OB 2ZH5A 1YG0A 3BQ2A 1VI7A 2WBRA 3GSDA 2GIQA 1RAJA 1Y3KA 3MI7X 1BGXT 1SH2A 3EPIA 1C0UA 2GGPA 2W9CB 3MEEA 4TLQA 4ECYA 2JEFA 3GV8B 1DAXA 4F3OA 5E5NA 1FRXA 1WEZA 1LFWA 2E5LF 2E5JA 2O01C 1S6OA 3CDAA 3MUTP 2DRAA 2UVWA 4K59A 2OPQB 2RRAA 2DHXA 2PDAA 2RIJA 3SFUA 2LA6A 4PPDA 2MB0B 1U1KA 2DGTA 1FKOB 2D74B 1R0AA 4X62F 1HQUA 4HHJA 4XPCA 2BACA 3Q24A 1RK8A 2O67A 4KFBA 2HGNA 3I0RB 2JFDA 2K2PA 5FDLB 2YNFB 5K14B 4DFMA 1JNRB 2YKMB 5E0OA 1FJ7A 4RW8B 1DLOB 3POTA 2R7TA 1MU2A 3CC4S 4RNMA 4DV3F 5K5MA 4NLVA 5H9FJ 3OTEA 1EETA 3DDNA 3PKYA 3VF0B 2XB2D 1T3OA 2DNZA 1YGYA 3MR5A 5J2QA 1XK8A