3IA0A

Ethanolamine utilization microcompartment shell subunit, euts-g39v mutant
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
111
structure length
111
Chain Sequence
KERIIQEFVPGKQVTLAHLIAHPGEELAKKIGVPDAVAIGIMTLTPGETAMIAGDLALKAADVHIGFLDRFSGALVIYGSVGAVEEALSQTVSGLGRLLNYTLCEMTKSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Mechanisms of a Protein-Based Organelle in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural protein
molecule keywords Ethanolamine utilization protein eutS
total genus 26
structure length 111
sequence length 111
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z, a, b, c, d, e, f, g, h, i, j, k, l, m, n, o, p, q, r, s, t, u, v
ec nomenclature
pdb deposition date 2009-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ia0A00
2EWHA 3PACA 4OLPA 4AXIA 2A18A 4QIGA 3DNCA 4QIEA 4QIFA 3H8YA 3BN4A 4PPDA 4OX6A 2A10A 4OX7A 3DN9A 4P7VA 4AXJA 4QIVA 3MPWA 4LIWA 4P2SA 4P7TA 4RBUA 3VCDA 3CIMA 5L38A 3IA0A 4DDFA 3I96A 2G13A 2A1BA 4OX8A 3I6PA 3CGIA 3N79A 3NGKA 3NWGA 5DJBA 4OLOA 3SSSA 3SSQA 3SSRA 3MPYA 4RBVA 4RBTA
chains in the Genus database with same CATH superfamily
3UDEA 4L72B 2F9JA 3WZ0A 2QTWA 3G8TA 1RU1A 2F4VJ 2B6AB 3JB9k 3G86A 4O3SA 5B08A 4ZVQB 1S49A 2RSQA 1MROB 4M5HA 4QIFA 2I2YA 2GIFA 1URNA 4K4UA 3WIUA 3VGTA 2WW4A 3R7NB 3JSBA 3U1MA 4OJHA 2DY9A 2VDHA 1RHQB 2B7BB 4HHHA 2AMCB 4J9MA 3KTQA 2RHQB 1JLEB 1NSQA 3KK1A 2IBKA 4ITSA 4YEAA 2DNMA 4QZVB 1JNRB 1H7XA 4WKRA 3W1YC 2HVEA 2OPSA 3QZ8A 1V5IB 2DEJA 1H0HB 4P52A 5DETA 1KC8T 5DDRC 2JHEA 4U95A 4IQMA 2CWXA 2I1RA 3H59A 4OZ5A 1ZM4A 2Z2ZA 3H4BA 2RUSA 2CNOB 2Z30B 1NDPA 2CQ0A 2H51B 1EZZB 3IN5A 3B4DA 4DUZJ 4GKKF 4DZ6A 4WZQA 2XI2A 3RUBL 3DLLQ 3TVYA 5HI7A 2Y1LB 3HFKA 4KBIA 5CCMA 4ENOA 5A0YB 4JI1J 4LR8A 4HHUA 5F9LA 1QVGR 2VFUA 3BM7A 4LRDA 4C98A 1U6BA 2ZWPA 3V6DA 2RIJA 4RX6A 1H98A 4EBEA 3CC4S 4JV1A 3K59A 4UF4A 3M8SA 2YTCA 1ZZNA 5D0GA 4KHPF 3HKZD 4NX9A 2KYXA 3MECB 2V68A 5B0AA 1BXNA 1SKWA 2YNFB 3OLBA 4F3OA 4OZLA 3AAWB 4ZVEA 4EYHB 2FZGB 2L9WA 4WYWA 2LQJA 1MWYA 3BYPA 4CT8A 4Q8FA 4CCHA 2CQ1A 2HBZB 3C19A 4ICLB 1Q78A 4D3GA 4DL3A 4P73A 3TAQA 2XULA 3CGIA 2B8QA 3MM7A 4RBTA 3AA8A 3IWNC 4ZLNA 1PJ7A 4LFAF 2XM3A 3EGWB 4EMDA 2WVEA 1FEEA 4X64J 3CJKB 2KG0A 2PEBA 1RCXB 2BJ8A 3DRRA 3GR0A 3NS6A 3TUZC 2AGOA 4L75A 1GMWD 2P8IA 3M9NB 2M70A 2DNRA 3N6LA 4J9PA 3W64A 3BGFA 1CULA 4DCOB 1VMBA 3IAS9 4OHVA 2R7QA 3HHLB 4N47A 2GVZA 5KFOA 1SJ3P 4NCAA 4RKUC 5CD4A 2VG6B 3PFEA 4ZPCA 2RNEA 2DO4A 2HNZB 2D3O1 4DL0C 4K59A 3KK1B 4DUYF 2R7XA 4G1PA 2HHPA 4YDDB 3PY8A 1S59A 4AL5A 3FVYA 2GZOA 4DR7F 1GMUA 2DH7A 2E7VA 3EZUA 3FSIA 3C16A 1LW2B 1R8BA 3DXBA 3G82B 5DO2A 3R7SB 3NCQA 4DCJB 3LANA 3MAAA 4OYWA 3VZIA 1OY8A 4J9SA 2E5IA 4I4BA 2V4RA 2R2RA 4OV6A 4W92B 2FLNA 5HMZA 4YMEA 1LK5A 3RYLA 2AHOB 1NK4A 4LR9A 1FJGF 2HGLA 3CDUA 4NCGA 4C7QA 2V0NA 4FS1A 3NMAA 4ZPDA 4LF7F 2FLOA 1RYRA 1QJHA 4RZRA 1SJFA 2I6WA 3NS7B 3A4TA 3DRPA 4JP8A 4DBQA 2VJVA 1T3NA 2MKKA 1MN9A 1T3OA 4ES3A 2HHTA 1C1BA 1MROA 2QGFB 1JJ4A 2KB2A 3DI6A 3PRBA 3M30A 2O3DA 4HACA 5IC4B 2X7IA 2YQ0A 2AKWB 1KP6A 1NRKA 2J7WA 5ADZA 5I3PA 2EBEA 2W2NP 2XWYA 4K4YA 3T9NA 2B4UA 2ZM6F 3UN2A 2VODA 2XS2A 2FHKA 5KOXA 2GGPA 3MWBA 3VALA 4ED6A 2DR9A 3MEGA 4CLUA 3DFEA 3MAQA 2CJKA 2AGPA 1R0AB 1S0VA 2CPFA 2PC6A 4MFBB 3DOLA 4UT4A 4U7UD 2QIFA 2P9EA 4OIXA 2DNZA 1UAWA 4WE1B 4JV0A 3UE2A 5LJ5Y 2G1DA 1P6TA 4X62F 5AE1A 4QWCA 1V3RA 4J91A 3PZPA 4LMZA 2JRSA 2MMYA 3W2WB 2DNHA 4DOZA 1N8RT 1B7YB 2Z2MA 4NLYA 5G0RB 1D1UA 4ZJLA 2BX6A 2DIVA 3TJ8A 2RDJA 4PXBA 4NMXA 1E6YB 4F04B 3CW2C 1JLFA 3IFEA 1R31A 5IT0A 1BC6A 4ZPAA 1J5EJ 1LWFA 4RWWA 5J1PA 2XQCA 3FRYA 3I4PA 4FXDA 3HHKA 2DXDA 2AEFA 3R5JB 3KNAA 4C48A 4ED8A 2YKMB 1VRTB 3T1HJ 2EVZA 3M8QB 2HS3A 3CNQP 2LP4A 3TQEA 5GAGU 3CXCR 3I0SA 4C0HA 2A10A 3LPYA 3DLGA 1WOSA 2CADA 4ECUA 1FERA 1ZAWA 4TXSA 2M9KA 5LMNJ 1W26A 1HPZA 1ZETA 3KHRA 2BJEA 4WZMA 1QLNA 4ATNA 5EDWA 3QYYA 2HQCA 4USMA 4ALZA 1SB6A 1KHWA 1NAQA 4PG7A 2MQLA 2FJEB 4GKJJ 2CQ4A 5EHHA 1FHTA 4JB8B 1XMOJ 4R5PB 1IWAA 1NEEA 1HNIA 1RBLA 3QGIA 3CO9A 4BWJA 2NSCA 3C16B 1M5SA 4ZPWR 3UCZP 2GGPB 3I0SB 2VQFJ 1UJ4A 2LEPA 2BUNA 2FHMA 1W7WA 4HL9A 1RWWB 3DNCA 3MMAB 1XNQF 4KTQA 2DNGA 3FQKA 1FRIA 3RBXA 4HKQA 2GMHA 4ZDNA 4EO8A 4ED2A 2KO1A 2VONA 1T7PA 3ZTRA 2C2NA 1FRMA 3PYGA 3MCSA 4RW6A 4K4VA 3EWGA 3GYGA 4QWDA 3FNNA 3KLIB 2XO6A 5DDOC 2XO7A 3FMBA 4NA3A 1G1XA 3IGVA 2EG1A 1EB0A 1FKAF 2AX1A 2JLGA 2UU9F 5KFGA 1VJQA 2Z58B 5KFRA 1IKYB 4U9RA 3KG4A 1UVJA 1VHFA 1Y3KA 2KRRA 2ZNZA 4MMOA 3PFOA 3RG6A 3U7JA 1X5TA 1MMNA 1NNDA 1S5ZA 3UNYA 3P96A 1U1QA 3L3CA 4CLYA 1SUQB 2B51A 1HYSB 1CQMA 4OYBA 3RB6A 3BBBA 3D3BJ 4OLPA 3JQKA 2F5GA 2M5YA 3SQGA 4TQSA 2VPYB 3GILA 1RK8A 2VFRA 2HURA 3CJQA 1DQ9A 1D9DA 2RRBA 3NGSA 1IKXB 1IJEB 4NLRA 2CJXB 5JMNA 2NCKL 2C3YA 2QA1A 5H9FJ 1IN0A 1BD6A 1IXKA 1JMTA 1X7VA 3KOAA 1CVJA 1T95A 4LIWA 4X4OA 1LW0B 4DSJA 1N5YB 4N8NA 4DV4J 1Y10A 1PIEA 5HK4A 2L48A 3AA9A 3Q8VA 2WOMA 1WG1A 2GAGC 3CCQS 1X9WA 3AJ1A 2VF3A 4EUVA 4IKAA 2AD9A 3HHNB 2A0FB 4DV3F 3DRRB 3DRPB 2MKHA 2V8DA 2YNHA 3LAKA 5E3PA 4UW2A 2W24A 2OTLS 2L3MA 3V6JA 4NLGA 1QSLA 1DJ0A 3BBFA 1XN9A 2X51A 2WSCC 5FLXY 4OJGA 1GH8A 3NAHA 2EXUA 5HQMA 1KWMA 3K5NA 2E1MC 4ZIVA 4Q0BB 3GYXB 1NUEA 1B3TA 2B5JA 2G2ZA 1QAYA 1ZTWA 3NXZA 1FVQA 1M1GA 2IM3A 2P9GA 3RZAA 1WUUA 2HLTA 1Q53A 1ZA2B 2LQ9A 3QGGA 3SYZA 4IR1A 1QTMA 1VC0A 2UUBF 1N0VC 1ZAXA 1P1TA 2KZMA 1VGYA 3M2RB 4NRTA 1HBNB 5A6WA 2ZBQA 4NE9C 2MZSA 4OYXA 4ECSA 5B0CA 4M5GA 2UZAA 2AGQA 3IWXA 1V6HA 4ELTA 3DM2B 1Q7YT 2DGXA 2LQBA 2Y1IA 3R2DJ 4QWEA 5A8KA 1MU2B 3IS9B 1VIOA 5ETKA 2XMUA 3HM9A 2UUAF 3N6MA 2HVDA 1KONA 4UQGA 5HP1B 1QUPA 5HN0A 3N28A 2YWHA 2R7SA 2J76E 2OEKA 5DM7Q 2B0GA 1UVMA 4PWDA 3K8VA 1F2HA 4RWXA 4TY8B 5I4MA 3C6UB 1U1LA 4OX7A 1QE1B 4MK9A 4DU8A 3HFVA 1MMLA 3GE9A 3M4XA 4JI6J 4LF8F 2EK6A 3DDNA 4M5DB 2ZHOA 2UUBJ 3PO5A 2MPUA 1A0OB 1U48A 3J80U 2HK2A 3QO9A 2HRUA 1FKPA 2B4VA 1WF2A 4U7UK 2HHHF 4TQRA 4ZVFA 2C3UA 1PYTA 2YKNA 1U2CA 3AOBA 5HJXA 5KT3A 5IV3A 1RKIA 3VTIA 2JX2A 2BACA 4P9SA 4ANEA 5F8MA 2XCAA 4PG8A 1QSYA 2JEFA 2J9EA 3ILJA 4ER8A 1UZHA 3BGRB 3A13A 2K3KA 1JKHB 1PKUA 2CUYA 2R7OA 3NGRA 4DX6A 1TK0A 4B3MJ 1SJQA 1HQUA 3NAIA 2YX7A 4USVA 4DSEA 1AXQA 1CJUA 1KQFB 5IM0B 4HVZA 3W8PA 3BPSP 1TL7A 2ZE2B 4X66J 3B54A 1SL0A 4M94A 5KFVA 2HVHA 4ZP7A 5LMUF 3NNCA 3SXLA 2E1PA 4NPOA 1TTHB 3OL8A 2AV5A 2W2QP 4QYZJ 2I5JB 3C14B 4USKA 4CLTA 2JEIA 3VAMA 3N5BA 3PRVA 2JH3A 2ZUAA 3TAMB 4UUWA 5F8IA 2ASLA 3KK3A 3PW5A 3D54A 2BOPA 4A8MP 5GADI 4YY3J 2EEYA 4ICLA 3PIOQ 4G6VB 2BA9A 2ZVIA 4HI1A 2IFXA 2ZOFA 1KTQA 3EDRB 3WC0A 2ZH4A 3BEGB 2VKZG 4DF8A 4YN3B 1CC8A 2P2CB 4JI1F 4NASA 3VAKA 1TAQA 2OTJS 3J7YU 5CAAA 4X64F 5DRKA 1X4FA 1ZZFA 2PIIA 1MWZA 1S77D 3O44A 4C97A 3FCWA 4XIUA 5I3QA 1RWUA 2CQ2A 2HHHJ 2YNGA 2XTJP 2JOQA 3I4HX 2V8PA 1DURA 2CYYA 3IG1A 3JXOA 1JLQB 3B82A 3DKDA 2M2BA 4OYZA 4WPAA 1XMQJ 4CLPA 5BYSA 1G7CB 2Y3YA 4DPOA 4A8SA 4DWIA 1P1LA 2RF2A 5EUHA 4DS4A 3UDVA 4P7TA 4IOBA 2HIYA 5ETTA 3GIKA 2RU9A 4FN5A 2MY7A 3TZYA 3QSYB 1TUGB 3PJ9A 4V19J 1TKZA 3KJVA 4X4UA 3HZEA 4PG6A 2PMHA 3GSIA 4J9OA 1HW8A 2KT2A 3UWTA 3J7Z5 3T5JA 3DOMB 4O3RA 2ILYA 5KFPA 1XIQA 2GMLA 2EFGA 3IR7B 3MPUB 2B9YA 4NYOA 4OI4A 5IM0A 3PR4A 2DGVA 1H38A 1OQ3A 4WCEQ 1HWKA 2W2PP 3BGOP 4C2MA 1F3VA 3HT3A 1SIWB 3B78A 4IO1A 1U2RA 3T3FA 1D8YA 5D0EA 1REVB 4KV8B 2N82B 1VQ6S 2VIHA 4DLGA 3KK3B 5GAEU 1NH8A 2DHHA 3QWPA 2VC0A 4PWUA 2RE1A 2B9XA 3OFGA 4DV0J 2FHJA 2WTFA 2AIRB 1FTRA 3MD3A 1PILA 1X4AA 2X3DA 3OXFA 3QO9B 2D74B 5G0RA 1S9FA 1WG4A 2P5VA 2XB2D 3HHLD 4LSLB 3MR6A 1UEUA 1S7IA 4PCQA 4KGVB 3AD7C 4OV1A 1T8EA 4PYDA 5GAHI 3OL6A 3JYTA 2XSFA 1OY9A 4MKAA 3LWMA 1RTDA 4JV2A 3BGRA 1VR6A 2Q3PA 4PEOA 3RJMB 4OYOA 4FF2A 1TL4A 4DSKA 1Y00A 5CYJA 2HFUA 1U1MA 1R0AA 3FSXA 2OEJA 2HBQB 1FFSB 2GCFA 2ZKTA 1UEVA 2CPXA 2ZD1B 1IBLJ 3D7SB 1WELA 2FJXA 1UW4A 4KPYA 3KUEA 4QYRA 2IYGA 5KFMA 3BSOA 1K73T 2VA3A 4X62J 1HBUA 1RT3A 5D4LA 5DLGA 1BQNA 2QMWA 2ALZA 2UUTA 5DQIA 3E3XA 1H6KX 4Y34A 2LA4A 3MR5A 1J5EF 5C24B 3I6PA 2QV6A 3IAM9 3M2RA 2J5AA 2HFSA 2A2CA 2J9DA 1F60B 2N4DA 2ZZTA 2DY1A 1V3ZA 1DHMA 4ZPTR 5DJBA 1N5SA 2R3VA 4FF3A 3LGNA 4DF4A 4CLSA 1HNVB 1RWNB 1Y11A 3ENWA 5H1SV 1C0UB 1UWBA 2ZD1A 2BVZA 5GMEA 1Q5VA 2HZVA 2E7XA 2UVWA 4J9UE 4Q44A 1R0CB 4EEYA 2LYVA 4B17A 2VC1A 4P74A 1ZTTA 1GAOA 1X0FA 5DS7A 1RT2A 1B0PA 3T6BA 4JI0J 1RISA 1B4SA 1ICEB 1WEYA 4IH7A 2E1AA 4HI2A 1HHQA 1V3SA 5E5NA 7FDRA 4DV6F 3TA0A 1QSSA 1WTFA 3FZBA 2FPHX 3IBFB 4CLLA 4F0MA 5LOQA 1CJVB 3S7RA 1N56A 1HI1A 4NA1A 2KFYA 2IVMA 3W9IA 1CLFA 2A2DA 4LFBJ 3ONQA 4RW7B 3TI0A 3I96A 3LP2B 1ZAVA 2GO8A 2WCXA 2BM0A 3QWUA 4O3QA 3RRHA 1S76D 2CDRB 1SV5B 4QWAA 3NWGA 4RU2A 4X4SA 1RHUB 1JJHA 1YLXA 2ROEA 2UXBF 3H5SA 3HULA 4JI2J 2LXUA 2DXEA 1E6YA 3PEHA 3PYFA 5LXRA 2X1FA 4EZ6A 2ATCB 3SQGB 2QL7B 4A8KA 1K0TA 2VJUA 1UL3A 1OJ4A 1CJKA 3BN4A 4TKTA 4CH0S 4YS2A 5JVGQ 2DIUA 2BQRA 1K0VA 1DLOB 4XO0A 2BR0A 3R5BA 2HVZA 3RB4A 1ZA1B 4B9SA 5CA5A 3K5MA 2Q66A 4IG0B 1WC4A 4IYQA 5KG0A 3Q8SB 1K9MT 1HR0F 3LO3A 4Q45A 2DRDA 2MB0B 2XG8A 4Y28C 3BYRA 2G0JA 4I6WA 4UZBA 2VA2A 1EQ0A 1YBUA 4F8RA 3KLIA 1B64A 2AJ1A 5DGBA 2E5JA 2YWFA 3ENAA 4GC6A 1RJJA 2BKPA 1RT6A 2JNJA 4S0MA 4J9NA 4DQQA 5I3UA 1N34J 5SZTA 4CTAB 2LFVA 3CDWA 1KBRA 5J2MB 4CYUA 5JVHQ 3A8KA 4USUA 1DTQB 3CJRA 4P2FA 3KLGB 2XY7A 1T9YA 2YPYA 4QIEA 2OPPB 3MM6A 1PJ6A 4M5JA 1RTIA 2KXFA 4GVBB 1FJ7A 2E9RX 1U0HB 1S1WB 2DNOA 5D0RA 4UY85 1R0BG 1RAEB 1SXLA 1WC6A 2PEHA 3DXSX 1WTBA 2OPRB 3QFHA 5HQ8A 1RYSA 3IG1B 4KH1B 4Q43A 4DQIA 3IWLA 3DDKA 4NLVA 5KFXA 4C4WA 2J7UA 4NLOA 2JZ5A 3DLHA 2D41A 3K5PA 3I55S 2LMIA 3BR9A 1NJZA 4RLEA 2FGCA 4LRCA 3M6XA 3SEOA 5HLFB 4O4GA 1TELA 2ALYB 3CJ5A 1OIAA 4ZOSA 5JJBA 2BDPA 5ETMA 2CJ9A 4USIA 2F9DA 4QW8A 1RQ0A 1YVFA 3BSNA 1D8ZA 3CJSA 2D3UA 4KFBA 4ETXA 1S48A 1JLBA 3FZ2A 3GIMA 5A8WA 2HRYA 4ZCMA 2LXFA 3JSMB 2LDIA 2MHEA 3TAMA 3DYAB 3ZZZA 1S6UA 4U6PA 4RW8B 1H3DA 5DDPC 5KFTA 4ECYA 2C28A 4YHHF 2JLFA 3UVJA 2AW0A 3HMJG 1Y0HA 2CNLB 2X1BA 3THTA 1AFJA 2V6AA 4YR2A 5G4DA 3T41A 4I2PA 3UCUP 2QZ8A 2OPQA 4H4MB 3CJKA 3TRGA 1WHXA 1RI7A 3D67A 2W7AA 3W61A 3J7A1 4JI3F 1KFDA 2XMMA 4OZJA 1NKBA 2W2OP 1I6JA 1U4BA 1DY3A 3ZNUA 2UXCF 4J9KA 2CJAA 3M8YA 1FDNA 5CHCB 3ZZOA 3EMTA 2EWHA 3CJ8A 2LA6A 3MM9B 1Z4UA 1S1TA 3BBCA 2GV1A 3OJSA 5AXLA 4LF1A 4ILMA 4LRFA 3OR2A 4F36A 3HSJA 4JI8F 1GFWB 2H4WB 5KFIA 5AJ3J 4M5DA 4USTA 2OMLA 5GADU 3T1YF 3GMGA 1UZDA 2Q6CA 2NXJA 2V9KA 4RNHA 1GNKA 4DV6J 4WE1A 2R8IA 3V4MA 1L3UA 2KL8A 3P45B 4B3TF 1GEHA 2VBWA 4FYYB 1B0TA 4CP5A 4I69A 2U1AA 4FPRA 2AJQA 2LVWA 1FKPB 4Y2IA 1T9TA 5ETRA 4DV7F 4OHWA 4CO5A 4XTTA 3QSIA 4J9RA 3L9ZA 3CMES 3UW1A 4LFCF 4NCGB 4XAKA 2DNQA 4RW9B 1RWPB 1TU0B 1YJTA 2DK2A 2Q6BA 2ZVSA 3PTWA 3DYAA 5JXSA 2YNIA 3ZXWA 4NLXA 3SI8A 2CVEA 1S0MA 1NK8A 1S1XA 2IM1A 4C9DA 4Y6IA 3DI6B 4LQ3A 1TMMA 1QAXA 1ZYQA 1WD6A 4O3OA 2HWIA 1T03A 3BPDA 2AWZA 1SI9A 2F1FA 2QMXA 1Q16B 1RT7B 3BH6B 4H4KC 2MQMA 1RHRB 4F3MA 4P2SA 2R8GA 1KN6A 1Q7LB 2WVDA 2HGNA 4DR3J 5HBMA 4GVLA 5IOLA 3D6HB 3W65A 2R9LA 5HLFA 1L5UA 1VBKA 2HZCA 2HFNA 4B9UA 2DCLA 3K0JA 4ILLA 1Q1KA 5DLFA 3I5AA 4DL2A 2ZH1A 4DR7J 1KVKA 1F9FA 1RP5A 3GJTB 5ITHA 1KLNA 2J9DE 1TKXA 4GKKJ 3CCSS 2G4BA 2D69A 1VHIA 1SPBP 1YJVA 3R9LA 1IR1A 2UVRA 1OWXA 2HS0A 3I9V9 3I0RA 4DX5A 4ZHRA 2W9BA 1N54B 3ILLA 2P9CA 5KFDA 2CPDA 2V50A 2MHNA 3GJQB 4NI2B 1U0SA 4RO0A 1X4HA 4KAIA 3C6TA 3M7VA 3MR2A 4QW9A 4CYUB 2HVIA 4ECRA 3ITHA 2AQ4A 3KDNA 5CYMB 4GC7A 3HCXA 2JVRA 3LPEA 2Z56B 3VWSA 1RBOB 1S57A 5D3GB 2OHDA 2E9ZA 2HFOA 1M1HA 3S1TA 5DG8A 1DFDA 2ZHAA 2IYIA 4DFPA 4RW6B 2QYCA 2YKOA 2V5HG 3CTRA 3MF5A 1X5PA 2GIRA 2ZBIA 3RGIA 3UVJB 4C6AA 3QJJA 1ROFA 5HAOA 1RT5A 1V5VA 4MKBA 1PC4A 2Z2YB 3PACA 1WC0A 4DUTA 1XMBA 3UN3A 3G8SA 2DJWA 2H65B 4CWBA 2PMZD 1HARA 3OUYB 3Q83A 2Y1RI 3IRWP 4LSLA 4KFBB 3G6ES 1UPPA 3HSZA 2B56A 1X8DA 2ZDOA 1FJGJ 1EP4A 1YRUA 2X1GA 2VQEF 3A3OB 2N3OA 3D5MA 4MYUA 1HYSA 3FSYA 4OI2A 4Y2CA 3D6FB 1GT8A 3HVAA 1WF0A 1NSKL 3F44A 2C1EB 4DMZA 3X1LB 5F8LA 1WOPA 3TVZA 4BC7A 2XHWA 1FXRA 2A6OA 1XBWA 3MMAA 3OSNA 2E1RA 4TU9A 5F41A 1MLAA 3JTOA 3DGPB 4Q7AA 1W2IA 3MURP 2Q1LA 4M5MA 3OL7A 4OI6A 1Y5IB 3OTEA 2VD3A 4CLFA 4K8RA 2ZH8A 1BLUA 1R7IA 3RRGA 2FHJD 4QPTA 3DOKA 4C8KA 4YB1P 5KG4A 4X84A 1EIYB 2PGCA 1TK5A 2W9CB 3F73A 3KJVB 1OYEA 3T1HF 1RU2A 4UY8T 1UWAA 4PABA 4CT9A 1M5PC 2YNIB 2EFOA 3ISNC 4DX7A 1U1KA 2HGMA 2IVYA 2W4PA 2WONB 3D0GE 2BANB 3NEKA 3HX9A 1R6VA 4RW9A 5K14B 4AT1B 2BRLA 2FJVA 2ZFHA 1NB7A 3W5YA 3V6KA 3G96A 1HQEA 2JFKA 2ROPA 3GV8B 2L9DA 4KPCA 3SCLE 1JLQA 3I31A 5KT2A 3KLHB 3MEDA 4BHQA 2J6SA 3J81Y 2QSWA 3QIPB 2HFZA 4DXLA 1BQMA 2C2DA 1B0VA 5HMYA 3D6TB 4KR0B 3DMJB 1FRLA 3SCIE 3TX8A 4A48A 2C42A 4NA2A 2KT5A 3DRSA 3HHEA 4BDPA 1HFEL 2JFDA 1ZBTA 1RHJB 2VDIA 3ZNJ1 3D2WA 2V2QA 3GFXA 4MAKA 3KYLA 2RB7A 5B09A 2FYXA 1OO0B 2LQ5A 4LBPA 3MOZA 1SC4B 1AB8A 5E3QA 3SV4A 1SC1B 1XERA 2YX1A 3NNAA 1XTZA 1JLGB 1FTCA 3JAMY 5KG7A 3Q8QB 1S1TB 3ZTOA 2YXLA 5H9EJ 1IVZA 2JSXA 2WBMA 1WORA 4F0HA 2DR6A 4DR1J 4QR2A 4OZ1A 3B6BA 1KHVA 4ZCKA 4Y0FA 2BJ9A 1DLOA 3HZGA 3EGVA 3AT1B 4ZKAA 2G9OA 4QR1A 4B9TA 1CJVA 4JI6F 3UD3P 3TJ9A 1MWQA 1Q86T 1EARA 3HDSA 4L3KA 5A8RB 1DQ8A 5SUHA 3KLEA 3GONA 3BJYA 1T9UA 1KEKA 3CUNA 2FVQA 2QJ3A 2G2YA 2E29A 2ASJA 4IR9A 4JI5J 2Q43A 5ETOA 3GR1A 1IM4A 4I68A 2IHR1 1LXNA 2HYIB 1N34F 3FQLA 2G0CA 4AL7A 1PYOB 3R1LA 4PR6A 4Q8EA 2JWNA 2QLFB 2GJIA 1D9AA 3AODA 2IJFA 1BWEA 2MKJA 4KHMA 1HI0P 1JX4A 2J8SA 2BZ2A 4CO2A 4HH1A 5A2QY 1TFWA 1CSJA 5KG6A 4EFAC 1YBTA 3NLCA 1VI7A 1RBAA 1YGYA 4ID5B 4A46A 2HHSA 1CJTA 1VQOS 3AQOA 1T94A 1S97A 4QWBA 1LV5A 3VAJA 2U2FA 3QNWB 1U09A 3MDFA 2XSJA 4ZJQA 3QZ7A 4F4YA 5KFAA 2RUGA 4YB7A 1C1BB 5EGYA 1D0EA 2FZKB 2KN4A 3O5TB 4R0JA 2ZITA 1S7HA 2CWKA 2H5IB 2CQCA 1NMEB 4DV1F 1JLAA 4DV2F 1MU2A 3IS9A 3H90A 3D66A 4M63A 3MMBB 3OUYA 1U1RA 1VRQC 1S4EA 2ZOGA 3EXCX 2M0GB 4P2MA 1OYDA 4ZVTB 8ATCB 5MAOA 5CD4H 3H2LA 2RMLA 2EW9A 2OPPA 2VG6A 3OFEA 4PG5A 3DU6A 4OZ0A 4KJIA 3HHLA 1NPPA 5HJYA 2NZCA 2HMIB 4X4PA 2VPXB 2AJFE 1NHUA 3M1VA 5C42B 2FDNA 2R2UA 4DV4F 1LW2A 3G82A 3KNGA 5DM6Q 2P6TA 3I56S 5J2NA 1X4GA 2UU9J 4QIWD 1ZPVA 3TW0A 1PG5B 3PR5B 4OI3A 4PXCA 2FTRA 2XNQA 4F26A 3T1AA 3MR3A 1WOOA 2G1HA 2HNDA 1RAOA 2BJ1A 1U02A 1OPIA 3DMJA 3SMZA 3H42A 2GAHC 3L09A 4OYIA 3IXQA 4DU7A 1BQMB 3GJRB 1VJWA 1DARA 5B0EA 1WSRA 1SL2A 4AXIA 3MEDB 4QIGA 2R8HA 3TARA 2W4DA 1KRPA 4XPEA 1FE0A 4E98A 1RE1B 3TUPA 1TL7B 2ZE2A 1XQIA 2PMWA 2IMOA 2BRKA 3E51A 3FJ2A 4KGMA 4KB7A 4RNMA 2R42A 3PW7A 1I51B 1VQLS 3G6XA 2VICA 4RUAA 1UA0A 2YQ3A 4QYZK 3P5TL 3P4UB 4ID5A 2ZJRQ 4DQRA 2YQ1A 2PD1A 3FK4A 2CZ4A 2MEWA 3DLKB 5IC6B 2NREA 2HHVA 2M4MA 2YNFA 2NUUG 3QBCA 2KDOA 4RUCA 2ZH7A 2H48B 1WKKA 2RT3A 1TUWA 4KRWA 4CH7A 5KOWA 2DNKA 3GPAA 1VIXA 5B0FA 4ZA1A 3O3LA 5HMWA 1VC6A 3CC7S 2I9SA 1L3TA 4U67Q 9RUBA 2M8DB 1SC6A 4K0KF 4L73A 4TYAA 3BF4A 4ZS6A 1RHMB 3AD8C 3GCWP 4RJVA 3L4BC 4F4ZA 2HS4A 2LU1A 3C46A 1EX8A 2M52A 3HHDA 1LOUA 1FRKA 3HKWA 4KGZB 1LFWA 2D7SA 4YHHJ 1S6QA 5DG9A 1RT7A 2O67A 2RRNA 1NXIA 3KMQA 1E6VA 1XK8A 2QLWA 1IR2A 4NWBA 4LVOP 4RL1A 4DR6F 3GLJA 5L9NA 4F0KA 4L74A 4OHZA 1EKRA 2IIHA 1RTZA 1VRTA 2DNNA 3FC9A 3P3DA 1FDDA 1A6LA 1DTQA 1S79A 1WJ9A 2BE9B 4NLPA 5C24A 5A6PA 3J7YI 1NZAA 1RT5B 1SQFA 3VV2B 2LECA 2NXEA 4DL4A 4P6QA 2IDLA 3NBPA 1K44A 4PPZA 2LU2A 4IFVA 3A8EA 1I5OB 1O6XA 1LKZA 3PNIA 3OTOF 3PKYA 1XC9A 2F4VF 5AXMA 4OMFG 5E3AA 4YP3A 2E9TA 1IJFB 3W2WA 3MM9A 1N33J 1I94J 2ZZMA 2JJ4D 4WFXA 2V4QA 4OX6A 5D15A 1HNWJ 1IKVA 2XMJA 3NS5A 2HW3A 1U8SA 2Y9HA 5AE3A 1R8CA 3QLHA 1LNQA 2CG8A 5E3CA 3PHEA 1JNZB 4M8LA 3ETOA 4K4TA 4MKYA 1VK3A 3E8OA 3CIMA 1VYAA 2W2MP 2UXDJ 4PUOB 2E44A 1WC1A 3LQVA 3TA1A 2COLA 2LEBA 1FX2A 3IRXA 3US5A 3OR2B 4DZDA 1RAAB 3J80Y 3M8QA 4UUXA 3VZHA 1KQGB 3IM9A 4OLOA 2RQCA 2RDIA 4IOAQ 3M2VB 4C8LA 1SJ4P 2PDAA 4RW8A 1IKWA 4ZVRB 3FCVA 1UKUA 5EWEA 3OL9A 2RD5C 3BV8A 2H3EB 2PA3A 4F4WA 4IRCA 2H5JB 1FFWB 2DO0A 1C1CB 6FDRA 3KJQB 1M5VC 1LQ9A 5KT6A 1KLMB 1S9GA 2F65A 2OLWA 3IC1A 3A3PB 4F67A 5AXNA 3CD7A 2RS2A 2DPJA 2R2SA 1NK6A 3QJLA 2D9PA 1RDRA 1T9WA 1PBAA 4F7VA 1SH2A 5C2CA 4LSNB 1VDHA 3MD1A 4Y2AA 4AL6A 1R6YA 1RTHA 1W25A 3ISND 2W1BA 2R8JA 3HK2A 4QU7A 2XMKA 2EKYA 2BKNA 5L39A 5F9NA 3D6MB 3ETMA 2NYIA 4DV5J 1Q5YA 1X4EA 1ZS6A 2Z2LA 4Z2XA 1UVNA 2OMOA 2BM1A 1RSCA 4ECQA 2DBBA 4TVAB 4B08A 1SKUB 2LCWA 5KFUA 1OMSA 5MLCV 5L1KA 4LF6F 2ZH6A 2BJ3A 2ASYA 1TVRA 1LK7A 2HZAA 2MLZA 1NJYA 3PV8A 5IWAJ 1HKAA 1DTTA 4B3MF 4IQXA 2Z57B 3CIZA 2KHCA 3CSKA 3KLGA 1WSVA 3H8YA 5BYRA 2LLZA 2W9AA 2HNZA 2J8AA 2OELA 4X66F 1YZ7A 4V1Ak 4R8UA 3LH2S 1LWEB 3CJTA 1ZPWX 1P9QC 3BGLA 4CNYA 2DGOA 1CULB 4I64A 2MZTA 1Q81T 1FXDA 2E5HA 2IRUA 1LXJA 1YKWA 1AZSA 1RTJB 4ZIWA 3GYNA 4PQUB 4CO3A 1QD1A 1FVSA 4LJMA 4Q2LA 3NP5A 2GFFA 3NGDA 4AYBD 2DPIA 1RAJA 3R2CJ 3RW6A 3PDNA 3HD2A 3F56A 2Y8YA 2GMJA 1QY7A 2F8EX 1AW0A 3VAFA 4DR2J 3JYTB 1EQMA 2OEMA 2XZTB 3AJDA 4RUHA 5D8HB 4WF9Q 1WDDA 4RR5A 3DU5A 1R89A 3HD1A 4KC5A 3BH7B 4LR7A 2UP1A 3W66A 1N6QB 5H9EK 1N33F 1HQ2A 2W8KA 4KO0A 1KNZA 4UTGA 3HT0A 2IY5B 2QYGA 1VQ7S 4I67A 1XR6A 1WC5A 4ZVHA 2OJ3A 3AB2B 3KDOA 1BUXA 5D4OA 3QPIA 2XGPA 3QQCD 1NDCA 1M5OC 2E66A 3GSDA 1F5CA 3CDAA 4DS5A 2H4YB 1S9EB 4J7CA 4HH0A 4U8YA 4IO9Q 1AROP 1PBUA 2YBVA 3EXYA 3NRBA 4RBUA 4HTJA 2KJVA 2YX4A 2XMVA 3GIIA 3H25A 2ZH5A 3GP9A 3RAMA 3CVKA 4OYMA 2QLBB 3JTNA 1TZ0A 1N32F 1HW9A 2BE2A 3M2UB 2HQFA 4UZCA 1IQZA 4ED0A 1N6QA 4U7CA 3HO1A 3CCLS 1IBKF 3CD6S 4KSEB 1TKTA 5KFKA 2ADCA 5LSRA 3O8WA 3MM5A 3OTOJ 5LJ3Y 1YRTA 2BOAA 1A9NB 2HKEA 4CM2A 1PCAA 4DPWA 3DHWC 3KUGA 1VBYA 4I6YA 3QGPA 2DRAA 1VQNS 4C0BA 4FKYA 1HBOB 2L08A 8RUCA 3PW4A 4PQUA 3BKFA 4O4RA 3CDBA 5B7WA 2GHWA 5A8KB 3BO3A 4JI7J 2G0IA 2VFVA 1RTIB 3PJXA 4HHJA 2HQGA 4BCAA 4YFUA 1VLYA 4TU8A 3NY0A 3MCMA 4HT7A 3TUIC 2QO3A 2XHCA 3IO1A 4HACB 4PQAA 2XMAA 5D77A 2ABYA 3EE3A 3SSSA 3T5LA 5HQLA 5K8NA 1PYSB 3NWRA 3DLGB 2HHQA 1FEHA 1GTEA 4L6V3 4IH6A 2X3GA 1QTNB 2AF6A 2H9ZA 1YX2A 4FYWB 4IH5A 2XS5A 2BBEA 2K1RA 1UCNA 1O0PA 2DGSA 2FVCA 3AY0A 1G3OA 4KHRA 5HO4A 3G6YA 3EYZA 3J7ZT 3EICA 2ZJQQ 4QQBA 1TK8A 5KFEA 1QAJA 5IS2A 1RWXB 2FD2A 4DX8H 4C3KA 2PE8A 2NXUA 1TP7A 1IKWB 4RNFA 3OTCA 4IDKA 4DQSA 1RWKB 1NPKA 1X5SA 4C0OC 2CZVC 4LF4J 3G8QA 3CCWA 2O5DA 1XNRF 1RTHB 1VQSA 2DGWA 2OD6A 3ET6B 3AXKA 2CQPA 3D28A 3KG1A 1S1UA 1GXTA 2QA4G 1KVIA 2BE2B 3M2UA 4I1TA 3PX6A 1UJ6A 4P2XA 4I2PB 3POTA 4JI0F 3FCHA 3CT9A 3NOCA 3CMQA 3MPVA 3EGZA 3ZFVA 3UPFA 3OHAA 2B6AA 4HR2A 3BS9A 4MT1A 5F3TA 3JSMA 2WVFA 5KFCA 2FQQB 4B3SF 1GK8A 2AT1B 3M2VA 4ZLLA 4E8UA 1F1BB 2IBOA 3U1LA 2QE5A 5L8RC 4DPTA 4WP8A 4M1KA 3N6NA 5HVFA 3ET6A 3R5GA 1F5AA 3TNVA 4ECVA 2MDAA 2VBZA 3GU0A 3H5YA 2R2TA 4NRUA 2KZZA 2SXLA 4U8VA 4UQTA 2J6TA 2ILZA 1VQ5S 3UN5A 1NSPA 3C6UA 3KWMA 1X4BA 4G65A 2M7SA 3UI3A 1Q95G 5LSLA 2ZC3A 4NEYA 1RACB 3R5AA 2CPEA 5HATA 3JQMA 1VK8A 3HJVA 4H4OB 4KGKA 4KKOB 2R4FA 3NKYA 4P75A 5FD1A 1F6TA 1RT1A 2V34A 2GIQA 3MMJA 4Y2KA 5B0DA 1UVIA 1EJ7L 1KSPA 2JEGA 4L76A 3TEHB 5CYQA 3V81A 2VKRA 4IG3A 2DISA 4NLUA 1R43A 3DOMA 3CD5A 4A8WA 4ZN3A 5F8HA 5E33A 4M5NA 1VQ8S 2YWKA 4DPYA 4DHVA 1TKTB 1S12A 4LFBF 4YOEA 2W4CA 1BQNB 2VUGA 4URQU 1SKRA 1X31C 1YTYA 4DN9A 4F02A 3MUVP 4DFJA 2RF2B 5D4PA 1S6QB 3UDLA 1DAXA 3VF0B 4W90B 1NCLA 1S1VA 2MKCA 2J7KA 4DFMA 4UOGA 4E2FB 1U25A 4BS2A 3CCRS 1SIZA 1S6OA 1NDKA 2DH9A 1VRUA 3DGPA 3FUYA 2BE7D 3LA0A 5BR8J 3I9ZA 1NHKL 3SQOP 1PSDA 1M90T 3LW5C 1TL3B 4JI5F 3JSYA 4OI1A 1U1NA 1U7LA 3TJAA 1SQEA 1Q79A 4EK2A 4PPDA 4PAAA 3HJFA 2CPZA 3BQ1A 1M1KT 2D1CA 4FNHA 1HWIA 2R7VA 2HNDB 4AXJA 4N8OA 1FD8A 2N7YA 2QL5B 1NHVA 3WIVA 3C6TB 2FUG9 4DCPB 2I8EA 3ZZTA 2LEAA 5IWAF 3PEJA 5KTQA 2C22A 3LP2A 1M5HA 4FNIA 5ETSA 1UPMB 2OI2A 3EVOA 3EZOA 4RUBA 2BKOA 3Q2SC 3W63A 3HF5A 4NXMJ 4IFYA 4ZVOB 3RAQA 2BQUA 3I5CA 2V2KA 1N0UA 1O51A 3O2IA 3ZZPA 3ZTQA 3KK2A 4KH0B 1F0XA 5DQHA 4OX9F 1HR0J 1QE1A 4DUZF 4IG0A 2PA8D 3K8WA 5T7LA 1UMJA 2AYMA 5DDQC 3EJMA 3R5DA 2CPJA 2VBXA 2VB6A 3TEGA 3K89A 3EUNA 4Z37A 1NJIT 3CO0P 4F2RA 2XLKA 2R7RA 3D1OA 1YI2S 1HLWA 2UV8A 1U49A 1GXLA 2CPYA 1T03B 1RT4A 1S0NA 4OFZA 4FKXA 1REGX 4KIAA 3CE8A 5DGAA 3RAXA 3LALA 1SBRA 2UUWA 2KJWA 1Y5NB 3EPGA 4DFKA 4IUFA 1SV5A 1OS5A 1U24A 3DC2A 3ELHA 1HBMB 5L1IA 3V6DB 2DVIA 4PWDB 4RW7A 3BSAA 2WSEC 3NGKA 4OZ2A 2GA7A 3UQSA 2JEJA 4NLQA 2PI4A 3N01A 3R97A 3V2UC 1E6VB 3VAHA 2QLXA 5EWFA 1KVJA 5KFQA 3DRXA 3I0RB 1VCTA 2ZWOA 1JJCB 1N5QA 2CQGA 4I2QB 3PW0A 4GMKA 4QBUA 2K7JA 3J81U 4N76A 4K5RA 2XS7A 1UFKA 3R6LB 4XK8C 1RT2B 3QAEA 3QT8A 4EBCA 1RTDB 2ZJPQ 2VL1A 4YR3A 3DN9A 4B3RJ 4FYDA 2K06A 1L3VA 2YKPA 3AJ2A 1HIYA 5F8GA 2RAQA 3WQPA 1P8GA 4H4KA 4WK3A 1NLKL 3TVKA 3LP0B 5J2QB 3MPWA 4TN2A 1FD2A 1VOMA 2EG2A 4IFYB 5ETLA 1Y4ZB 3VCDA 2MZQA 1C1CA 3Q8RB 4LRAA 2IVFB 1YITS 1U26A 4JBCA 1Y3JA 5J1EA 2XC9A 3T5KA 3W3SA 2B43A 3N9UC 4K2XA 3Q0AA 1GMVA 1XEZA 1S99A 2APOA 2CDQA 2CQHA 2HQ3A 3H0PA 1YJRA 4YDXA 2MJUA 3DCAA 3H98A 1DRZA 5JUMA 4JI8J 1NBEB 4C8MA 5F3ZA 4ED4A 4LF9F 1HHSA 1SC3B 1WKJA 2CJYB 4DR1F 4B3OA 1O8BA 5A8RA 3KLEB 2M88A 4HDGA 1NK0A 2QC3A 4A47A 4F50A 2RS8A 4O0NA 2QEXS 2FJWA 4NL5A 4J5OA 1SQGA 1EKSA 2B3TB 4N77A 2EI5A 1PAUB 3GB0A 4DV1J 1HMVB 1PJ5A 3TZZA 1N52B 4MFBA 5L9XA 2WVCA 2ZBCA 1HWUA 2BQ3A 1X5OA 2DHSA 2GNKA 2VH7A 3AOAA 4KGXB 4M5LA 2N4CA 4J9QA 1H74A 5E3RA 3CCUS 1NKEA 2FVPA 2DNYA 1PC5A 1WACA 2HLUA 2KT3A 3KHLA 1UP1A 4CO4A 2UXBJ 1IWGA 2YKAA 3JS9A 4RW4A 1YIJS 5D6GA 1FNOA 2FLPA 2EKNA 4ZPBA 2EC0A 3MPYA 2EFQA 1WI6A 1T9VA 4B9NA 4N5SA 2FHOB 2BEFA 1ULRA 4W98A 4MYTA 1FF2A 3RU0A 3W7BA 3E2EA 4TY9A 2PI5A 3UDCA 2MGZA 2OH2A 3GQCA 1K47A 3MAHA 2KTQA 2FY1A 3CC2S 3FBBA 4G1IA 4EZ9A 2AJ2A 2OPQB 4H4MA 4LFCJ 2VG7B 4FVMA 1TL3A 4PXEA 1K1SA 3AB4B 3TQ1A 4B9MA 2KRBA 3H2UB 3R7BB 3FEYB 3MR7A 5KFHA 4FBUA 2FC8A 3BZQA 4AFFA 1RUSA 3OFFA 5DQGA 1VLOA 3I87A 2C2OB 2XSJB 3MFHA 1TKZB 1FJEB 5H9FK 3HFZB 5FLXU 2OPSB 3MM8B 1GQEA 4LFAJ 1N36F 1OSDA 1CJTB 3M8WA 4LBHA 5EX0A 2C2MB 3KLFB 2KVIA 2IAJA 1IBKJ 3OVSA 1R8HA 1EHWA 1FKOA 2WVBA 3I5BA 3N0VA 2MJNA 2CNNB 2CQ3A 4WFAQ 3MMCA 1ACMB 4P10A 4WYLA 2YKMA 2ACMA 2MYFA 4WJBA 2RKIA 1NKCA 1XNRJ 3A1YG 4ED5A 3DHXA 3I82A 4I0WA 3S8SA 1U6FA 4Q2MA 1GX5A 3P49B 1KOHA 3SDEA 3D0IE 2IA0A 2H1YA 4WTYA 4GO5X 2HG4A 8AT1B 3QRRA 3LUYA 3VQTA 2B7CB 1HPZB 1RWOB 3M9MB 2FY8A 2ZBRA 2K8GA 3ZZ0A 4RW4B 4EWTA 4JUZA 1EP4B 4A8XA 2IC3A 4OX8A 4DEZA 2IMWP 4D3HA 3NNHA 3KUHA 4RU9A 2XWXA 1D9FA 1YQHA 2M3DA 4J37A 2HWHA 4JOUA 3SSRA 1YJWS 1ZM2A 3Q89A 3UR3C 1OY6A 1HWLA 1YSJA 2D3ZA 3CWJA 4ZVUB 2CFXA 4NI2A 3ULHA 1FI4A 3BKUA 1Q82T 4JI7F 2MKYA 4TLQA 2ROGA 4CZCA 3T5HA 4YR0A 3A12A 3FEXB 1FA0A 2LKZA 5HSPA 2XYHB 3EVMA 4B3OB 2YWEA 3TZXA 4JI4J 2QG9B 3DM2A 2KM8C 4URSA 1IBMJ 2XNRA 4MKVA 3SCKE 1TFYA 1IQTA 4A8QA 2DH8A 1WG5A 3PM9A 3WDOA 4JV5J 3OW2R 3PXGa 5B0GA 5K5MA 4DDFA 2POKA 3H2VE 4RNNA 3AFGA 4K0KJ 4F25A 3O6QA 3TR5A 2HBRB 4KO0B 3G6VA 4F2SA 2VG5A 2NZ4A 2D3OR 1HNVA 2QFIA 2QN6B 4ZVPB 3Q86A 1HBOA 6AT1B 4NXNF 4XDCA 4V19X 4FS2A 4KHPJ 4Y2MA 4AE5A 5KAKA 1WHVA 4WXWA 3VVUA 5IQ6A 1F3FA 1XR7A 1GTHA 2FB0A 3FBFA 3IBWA 3S01A 3LF0A 3H5XA 4Q0BA 4JYAF 3EM1A 2IDEA 3IR6B 3S6EA 2EK1A 3HP6A 3L7OA 3L7UA 5THWA 4WKYA 3CCVS 3TYTA 3ENQA 4I7FA 4WU3A 2E5LJ 4WIIA 3MAAB 4P7VA 2CQBA 4CRJA 5HMXA 4K4XA 5EWGA 1VQPS 3MXHP 4Z7YA 1P9YA 5K20B 4LF8J 3ENVA 2I38A 2JL9A 2MQ8A 5A2QU 4ECXA 4LF4F 2KG1A 1RHKB 1U6ZA 5DZ7A 2OO4A 3DOKB 1TUVA 2VU5A 2RQKA 3ADAC 3K17A 1VS3A 1KTVA 3R5CA 4OZ3A 5C2GA 2RILA 3Q24A 1YG0A 4QU6A 1HA1A 4OI0A 5E7OB 4FVCA 4O3PA 1HNWF 3W5XA 2JC0A 4X2BA 3K2YA 2V69A 5J2PB 3QJPA 4DQPA 4LSZB 1WEZA 3WBZA 5HROB 3HHLC 1UWBB 1S6PA 1TVRB 1B70B 4TYBA 5ETVA 3MFIA 5RUBA 4XPCA 1TAUA 1TMJA 4DR5J 2GS8A 2V63A 1F2GA 5F8NA 2JLEA 1FRJA 3HI9A 4I56A 3GV7B 1SUQA 2DB1A 2EPIA 1FXLA 3CD0A 3MM7B 4NCBA 3QLHB 1QDUB 2KKHA 1XWLA 2DXFA 3C15B 1IKVB 2KFNA 1CS4A 5LMNF 5D4NA 4LQ9A 5LXYA 5KFNA 2Z8QA 2MSTA 1TQLA 2NS1B 1Y9OA 3LTOA 4FZVA 3G9CA 3LGMA 1RWMB 4QR0A 4UOHA 3RW7A 1S10A 3EVWA 4CM0A 1QUVA 2C3MA 1R8PA 1YBAA 3PJWA 5F0WA 3HVRA 1RKJA 1HHTP 3D3CJ 4C8OA 4RBVA 2V8GA 2EFNA 1VISA 4GO7X 3ILIA 1B99A 1WHYA 2CVIA 3GG0A 4DR5F 1YHQS 4X4QA 2DR5A 5GVQA 3Q2TC 3NCRA 2AJ4A 1CBKA 4O3NA 3UNGC 3PRDA 5M2RA 3IBCB 5KFZA 2MZJA 1FKOB 3GFHA 2B4OA 1H73A 4M5KA 3DLJA 2CXEA 2KVQE 1ZM3A 2B4PA 2CZ9A 1PAEX 3JQJA 4Y65A 4F3QA 1VQKS 3FKBA 1LWCB 2VZ9A 5L38A 4OHYA 4USJC 5KT7A 3V4IA 1FK9B 4OX9J 3H4DA 3EPIA 2WAQD 2J0WA 3JSRA 4DR4F 4EI2A 1YJ7A 3UO0A 3VAIA 5GAGI 3R3TA 4ZMMA 2UVVA 1BWVA 1F5BA 1SJRA 4ES1A 5HL7Q 2AZ3A 1C0TA 2DITA 3ICLA 3JAMU 4B3SJ 1HBMA 1Z1ZA 3I32A 4M5IA 4Y00A 1R8AA 4DJBA 4Q5VA 3G71S 3RR8A 2PSZA 5B0BA 4ECTA 1K1QA 3IGNA 4HEA9 3CCTA 4ED1A 1LWFB 2ZH3A 2UUCF 4PRFA 1T02A 4ZVSB 3W8GA 2IM0A 1Y5LB 2KH9A 2ADBA 1YWXA 2AU0A 3AXMA 3FRZA 3EGNA 4ID8A 1NO8A 2HHUA 5EX3A 2O66A 4EO6A 2E5GA 2VASA 3DDIA 1DQAA 3W60A 4TNOA 1BE4A 4TU7A 4PUOA 2CJBA 4LF7J 4WTOB 2DYAA 2DR7A 2YNGB 3VGSA 1NH7A 3GCXP 1C2PA 2IRXA 1U2FA 3M05A 3Q8YA 2LDYA 4DG1A 2XY6A 1FESA 4CH1A 3QT6A 4J9LA 4DR6J 3G4SS 1RT6B 2DHGA 2KU7A 5IT9Y 1N88A 4ZJOA 1HD0A 2LXIA 3MEKA 1KLMA 1RAIB 4NZ0A 1Z2LA 2V94A 2BXJA 1S6PB 2V2VA 3CCZA 3SFUA 4AUKA 4YY3F 1HNXF 4G3IA 3OVBA 2HMIA 1CJUB 2VPWB 3C15A 5J2PA 1FCAA 3HVTB 3MEEA 1FWPA 3M32A 5KFWA 2CAJA 1RABB 5ETNA 4ZN1A 2C2RA 2XLIA 3D1QA 4WP9A 4IOCQ 5J1EB 2HK3A 3PVXA 3R1HA 5IT4A 3POTB 1WNEA 2GW8A 3LP0A 5I42B 5LL6d 5HP1A 2HAIA 3D1HA 2HHXA 4WU2A 2GHPA 2OD4A 2GC8A 3BQ2A 1M0SA 2C3PA 2OAUA 4ERDA 4KQZA 4WFYA 4NYPA 3NOGA 1NK5A 4FF1A 1AUDA 1D09B 3MTJA 2BYCA 2VFSA 4NLWA 4A4JA 1ITPA 1AFIA 3FFIB 3SV3A 3SFGA 2GQCA 1UEKA 2CQDA 4WBFA 2K7KA 4LIRA 1JLBB 4CLWA 3IM8A 3LGHA 3JTPA 1N36J 2FLLA 5D78A 2VG5B 3M1VB 3DLKA 5C42A 1VQMS 3PKMA 2BW2A 2Z4PA 4DL5A 4I7FB 3KXDA 4F4KA 2DNPA 4DPXA 2R7UA 3BQ0A 3HVWA 5KT5A 4RPFA 1Q4RA 1WEXA 2VQFF 4CO0A 1W2BR 2ZDPA 2GJ2A 2PO4A 2UV8G 2L41A 3CCJS 1H7WA 1I1GA 1TR0A 3HSGA 4PZVA 4EU0A 1VC5A 4DR4J 4YB6A 1MSWD 1IUJA 1HBNA 5D0HA 2YNHB 4CLKA 2QMUB 2MZRA 4KY3A 3AHPA 4ED7A 1UTAA 1H2UX 4ZCIA 1EETB 2C3OA 4OZNA 4ANCA 3HXMA 3BO4A 1U0HA 3PG9A 2I0XA 3GIJA 1D3WA 2CPHA 2B5JB 2EBGA 3BKTA 3LWLA 3E01A 4F4AA 2YH1A 5KG5A 3H7HB 1JXLA 3C2PA 4C8YA 2K2PA 3N5FA 3FEZA 4LF6J 3HVTA 5E0OA 2YY3A 1AT1B 3IR5B 4CNZA 2CIMA 4U96A 2OKQA 2ZC4A 3F0NA 1HBUB 1RT3B 2XBPA 2X1AA 1FNXH 5IXUA 2RRAA 4GKJF 3NGTA 1FO1A 2NXCA 2RU3A 2CA9A 1U8WA 2MQNA 2RHSB 2YWGA 1CEZA 5BXIA 5M2UA 4ZVGA 5BJRA 9ATCB 2CNKB 2WOMB 3FFIA 1HD1A 2V4JA 1AUSL 4BBYA 1MNEA 1LW0A 4O44A 4C11B 3M8RA 1REVA 4ZCLA 5L1JA 3OLAA 2GVZB 4DL7A 1NB2A 3H5UA 2MQPA 2E7WA 1S0OA 1V9OA 2VFTA 2W25A 2V67A 2IC3B 1SJ1A 4J90A 1UFLA 3NCPA 4ILRA 4NEZA 4NLDA 2ATLA 1VBXA 3K58A 1YK9A 4FP9A 2HHWA 4NLTA 5IT9U 1O5JA 1U47A 3NGUA 3EX7B 2XGQA 2HPUA 2BANA 5K14A 1NDLA 3X3UA 1MW7A 1R27B 4X65J 4M95A 1HI8A 2DHAA 4WFBQ 1NSAA 2FGOA 1IKXA 2V4JB 4R25A 2W9CA 2K1RB 3CCES 1YDLA 4B9LA 3SCJE 1U45A 1FDAA 1P27B 5J2NB 3M8ZA 3F41A 2AEMA 1AZSB 1TL5A 2Q79A 4FDFA 3GTYX 5FJ4A 3KFWX 5HANA 2NLWA 4LVNP 3KLFA 2QFJA 1JJ2R 4OL8A 3GV5B 1NM2A 2HQIA 3MM6B 1TL1A 1JLCA 1LWEA 2QLJB 1KDNA 1X60A 2GQQA 3LOUA 2H5EA 3ISZA 3M8PB 5FDLB 4ZP9A 4O0IA 1LWCA 1OPZA 1VRUB 3E01B 1RLDA 3QIPA 4CTAA 2RKIB 3V81B 3MUTP 4QJVA 3KLHA 5I3UB 4QPXA 1KS2A 2C2ZB 1JLAB 3PX0A 1HQEB 1S1WA 4X65F 2GQ2A 3TO8A 4KKOA 1OQ6A 4JYAJ 4NOHA 2N7CA 3D0HE 2MKIA 2N3LA 2DGUA 1RWVB 4ECWA 7AT1B 4DL6A 2XZWA 4MIAA 4A8OA 2KXHA 1PGZA 4Z7CA 3CDEA 1TV6B 4FYXB 3RBZA 3K5LA 4NXNJ 4ZP8A 4YUDA 4FF4A 1JQGA 1HNZF 4W4MA 3QMQA 3M8PA 3ZZUA 1FRHA 3Q8PB 1KD1T 3DRYA 2ZZNA 3GJSB 4B02A 3AD9C 4NZ7A 2LQ8A 4ETZA 4PKDB 2IRYA 2BABA 4LT6A 2A18A 4HDHA 2ERRA 3BDPA 1HQUB 3FGVA 2Y8WA 1RAHB 3DGVA 2Y1JA 3RTVA 3SBMA 2DHXA 4WWSA 1SL1A 2YVSA 2V8VA 2DGQA 5A76A 5C25A 2GO9A 4CIOA 1J27A 2J0XA 2RQMA 4WP3A 2KFZA 1WHWA 1TKDA 2J6UA 1EAYC 4TLRA 4MK8A 3G87A 3KJFB 2RJZA 3ZC4A 2GX8A 4CQ1A 1FWKA 4IRDA 5C5JA 2PN6A 3IRXB 5U47A 3OTDA 3NG8A 5DG7A 3KJNB 5KG1A 5HROA 2MXYA 4B9VA 2A3JA 4PYAA 3T19A 4LRBA 3MGJA 2RH3A 1S72S 4N41A 2HQDA 3VGVA 2MZ1A 3HPOA 3CF5Q 4MH8A 4FXVA 3DOLB 2NSBA 2WBRA 3THPA 4DLEA 1N32J 1NK7A 2ZNYA 4OQJA 5GAHU 1EETA 3MZIA 4KT0C 4N56A 4K2JA 1F9EB 1JXEA 1RTJA 4BC9A 1VQYA 3CB4A 1IM6A 1NZ8A 6FD1A 3MUMP 3DLEA 3D68A 1UVLA 3ZTSA 2ZH9A 2W7OA 1T0TV 2BV3A 4P71A 5E2QA 2DNLA 2YWWA 1ZH5A 5CABA 1APSA 5HVGA 3U02A 1ZOTA 1DTTB 1ZM9A 1I94F 5CZXA 5KT4A 3MI7X 3OD2A 4WFNQ 3WC2A 1FNMA 3WHIA 3SIPB 1CQNA 1OSCA 3Q23A 2F7VA 2PFDA 2IPOB 1NU4A 4OHXA 5J2QA 3PO4A 4ZHRB 3GFYA 2EFVA 4ED3A 2UXDF 1AA1B 2KYZA 5CH7B 4C3LA 2NPIA 3ILOA 2HFVA 4PG4A 5LMUJ 2IM2A 2D9OA 2F3JA 3FBEA 1T11A 2HNYA 2HSEB 3BGUA 4K4WA 2EFPA 1XMOF 2UVUA 2Z0GA 4OJ3A 1TL1B 3P5BP 5KFFA 2C2EA 2XMWA 1C0TB 2G2OA 3KK2B 1VQ9S 4JI4F 1BQXA 2OP5A 3VQSA 2KI2A 3GIRA 2HWTA 3IMQJ 3W2VA 4C8ZA 1YJNS 3K5OA 3QRQA 3OTBA 3NL0A 1KR4A 1UJ5A 1FFGB 1FK9A 1UVKA 1YZ6A 3CJ2A 1N4LA 1MG7A 3CMAS 3J81j 1HL6A 1S1XB 4CLZA 1HNZJ 2XZDB 3IP0A 1N48A 4OYPA 4WIQA 3SSQA 2FJBB 3VVTA 3OVAA 4WFZA 5HVHA 1JIHA 1RT4B 1J2VA 2MKSA 3R27A 5KFSA 4F4XA 1Q8LA 3T9ZA 1NJXA 4KE5A 2DEIA 2W9BB 1KFSA 3BREA 2VV5A 4XDDA 3VAGA 4FXWA 4LUBA 2VPZB 1TKXB 1MMDA 2VBYA 5KFYA 1URRA 2QX0A 2AX0A 4HYKA 1N5YA 2FVSA 1U1PA 4NLSA 3L95X 4C11A 3V6HA 3TX0A 3PHTA 2WSFC 1C4AA 3CULA 4BWMA 2F63A 3K57A 4EYIB 1RZMA 3MCOA 4LBIA 3WX8A 5GAEI 3TA2A 2PT0A 4L3NA 2KXNB 2KHDA 4DR2F 3G2XA 3L7PA 2YPZA 2AYGA 3H20A 1KQSR 1XR5A 3NBPB 4EGLA 1IBLF 4MIWA 1XMQF 1UW9A 3ITHB 2DR8A 1B7FA 1SVDA 4J9VA 2OSQA 3NMRA 1RADB 4ZLPA 3OJUA 2J9CA 4QCLA 4H54A 1JWWA 5CZVA 3BB5A 3D9BA 3W9JA 4OJ1A 3C3LA 3OHBA 3ZZYA 5AJ3F 3AH6A 5BYQA 1CC7A 2BJ7A 1JK9B 1LEOA 2J0SD 1F9HA 4B3RF 3MMBA 1LFPA 1LWXA 2WB1D 1GX6A 4MJKA 2ACYA 5LM7E 3W2VB 1RT1B 5ETQA 5IZHA 3HLUA 5LT5A 3V4IB 4DV0F 3RR7A 2V9WA 2ZUGA 3VR1A 2AYEA 1BMQB 3ZZRA 3SDEB 1WF1A 2A6MA 3K7RA 1FRXA 1FDBA 1JLCB 1KQKA 3H40A 2F4FA 4E0DA 3UD5A 1RGVA 5IV4A 4IRKA 1VFJA 2B9WA 1HNXJ 2VOPA 3BDEA 1Y7PA 1WKLA 3MMCB 2YKQA 2C2KB 1SH0A 4A8FA 5DZ6A 1FT8A 2O01C 2XMTA 5CQGA 2R7TA 2OUGA 3N4WA 4X4TA 2FC9A 2QA4S 1WI8A 4FBTA 4O4GB 2AZ1A 4X4NA 2OFGX 2YH0A 3GFZA 2NXNA 1SKSA 1HWJA 1KOOA 1XJWB 4DN0A 1NJWA 4R0EA 4DV3J 5KFJA 4LF2A 2WRMA 2J0QD 2FJDB 5CYQB 3PIPQ 2CKWA 2E1CA 4JI2F 4DR3F 2R8KA 2OPRA 4K5SA 3DLEB 4C8NA 1CJKB 3RRKA 3QT5A 1FX4A 4O23A 4URGA 4C3MA 4DV5F 3V5RA 2ZH2A 1UFWA 2G13A 1X4DA 2AP6A 2CPIA 1S9GB 4GVBA 3PW2A 4B3TJ 3CJ0A 1RLCL 4PWWA 1JKHA 4PXDA 2AYBA 4O44B 4ELUA 4DV7J 2ZKUA 4NXMF 4TY8A 4DI6A 4USHA 4ECZA 5L46A 3W9HA 5A8WB 2M8HA 2NPFA 4ZP6A 1JLFB 3BN7A 2QRRA 1JLGA 3TUJC 3U1NA 4CI0B 2UUCJ 1RCOB 2WB4A 1WWHA 3B4MA 4K7QA 2FVRA 4IFVB 1L3KA 3VHQA 4MTPA 4QIVA 3TWZA 2WK4A 4AQYF 1CS4B 1Q8BA 3A8IA 3GZ7A 3OQ2A 2GVDB 3RBDA 2W01A 4QOTA 3WX4A 2V2ZA 3ZTPA 2NQPA 5GMKa 3IA0A 2PFFB 1T05B 2P6SA 3EDQB 2R7WA 1Q8IA 2HRTA 3N79A 1FWLA 3O1LA 3TP2A 1S1UB 5T14A 3OR1A 4YQWA 1L3SA 4K4SA 2UXCJ 2RDDA 3KMSA 5T41A 2HIQA 1BHNA 3FDSA 4G1QB 5GMDA 3MHYA 3DRSB 1NK9A 3QT7A 3QGHA 2EC2A 5FDLA 5AE2A 5KG2A 3QRPA 2F8HA 3FBCA 5J2MA 1DBDA 1X0PA 2WHOA 5CCLA 3M30B 3OBIA 1K8AT 5F8JA 1Z2ZA 3TZWA 3KLVA 3LAMA 1ELOA 4LREA 1IBMF 2BJDA 1IBCB 3OV7A 4LF5J 1Q8KA 1HNIB 1RXOB 2AEJA 1QVFR 2WONA 4CO1A 5K8OA 3KHHA 3Q8UA 3AOCA 2F40A 2O1PA 4GRSA 1QAIA 1UETA 3M6WA 3MM5B 5FIIA 4OYAA 1X9SA 1BY9A 1SH3A 4DSFA 5L1LA 2OFHX 5KG3A 4LF9J 1FE4A 4I2QA 3QAUA 4NYZA 3U27A 2V8HA 4ELVA 3LP1B 1J5OA 1X4CA 2HAFA 2ZOMA 5K8MA 3QFWA 2RVJA 4X4RA 2XY5A 2DD8S 1S4FA 4AQYJ 3UD4P 1UA1A 1DZ5A 1PO6A 2XYGB 3RB0A 2IJRA 3QATA 2QSFA 4X4VA 1S9EA 4ANDA 1VBZA 3W5ZA 2NYHA 3T6JA 2QA2A 3TOQA 5C25B 2W7PA 1IKYA 4DPUA 3C66A 4KV8A 3TANA 1KKHA 3BR8A 4HTIA 4WXOA 4CDIA 2XCPA 4FYVB 2GHVC 1GXUA 3UCGA 3ZO7A 4ZK7M 3SZ2A 2VOOA 2NR0A 2RQ4A 4N7TA 3M9OB 2DT9A 5BR8F 2JDJA 2XEXA 2MY8A 3R8YA 2DGTA 3TAPA 2FJAB 3UFCX 2DTJA 1NPRA 5AT1B 4ZITA 3PYDA 2CJQA 1FJCA 2MLYA 5CYMA 5F0UA 2MQQA 2ZM6J 2ASDA 2DRBA 2UUAJ 3P6YC 5T7LB 4K50A 1MN7A 2HNYB 1H2TZ 1YRXA 1TV6A 1HMVA 2B8PA 3R6GB 5A0YA 5K9FA 4UOFA 3MCNA 1N5VA 3OSPA 1RAGB 2Y0SD 3PX4A 3GG1A 4K4ZA 1RB0A 3OXGA 3VGUA 2K3IA 1A7GE 1C0UA 4NMLA 2OGUA 3MEGB 4P72A 4ZLJA 3CJ4A 3MECA 4HLBA 4R5PA 1U1OA 4DSLA 4Y3CA 3UR0A 4JV5F 3C8YA 1H72C 3MPDA 3MM8A 1I3OB 4R8UB 4FPIA 4KYZA 3BSCA 3RBEA 3EZ5A 4DV2J 5M2PA 1X9MA 1JLEA 2DKOB 3A8JA 2QT7A 5ETPA 5KFBA 2IJNA 2MSSA 5AXKA 3T1YJ 4IG3B 3OFHA 1RA6A 1C4CA 2B9EA 3PCOB 5K8PA 1QM9A 4RNOA 2H54B 2VG7A 2VHGA 3OT9A 4UOCA 2QL9B 1VQ4S 3DLBA 3LP1A 1J5OB 5IFMA 1SCJB 3MOJB 2AJ0A 1CG2A 2XI3A 4NZ6A 1G6BA 2MGZB 2IA6A 3J7AN 4ES2A 2ZEJA 2IAJB 5KFLA 1T05A 2WW8A 5E41A 4HT5A 4MK7A 3KHGA 4WK1A 2CG4A 1RA7A 1WC3A 2OSRA 4JI3J 2HBYB 5HBMB 1T9XA 1S1VB 1BGXT 4LF5F 2MLXA 5J1NA 2JVOA 4DUYJ 2L9NA 4A8YA 2WZ1A 3CJ3A 5CXTA 2DCUB 2VQEJ 2JC1A 2CQIA 1IR0A 3OPKA 1RAFB 4I6AA 3MEEB 5EN1A 3QIDA 2GVDA 5C7PA 3HSDA 1GMWA 2BMBA 3CEDA 4G1QA 5IQQA 4LSNA 1M5KC 3OR1B 4YB5A 2NUHA 2YKNB 3KKFA 5D3GA 2GJFA 3CPWR 5I42A 4H4OA 3THVA 3GWCA 1G4CA 4MIBA 3MTKA 2XYPB 1N5TA 2E5LF 4ZPVR 1JB0C 5LSOA 4DSIA 4DG1B 2MQOA 2OIHA 2FZCB 1Q0NA 3AQPA 2XLJA 1AYEA 3W62A 4IDKB 4BLGA 1R3NA 3M6UA 3RB3A 1WDTA 3P8BB 1JXVA 4AD6A 7FD1A 1G2EA 3M32B 1H2VZ 2ZBPA 1CPZA 3B8HA 2FIUA 3D4JA 2I5JA 3C14A 3FMWA 3M6VA 4USWA 2KM8B 2ZHBA 3Q22A 3PYEA 2A1BA 1XNQJ 3OXLA 3BO2A 4EBDA 2W8LA 2BW7A 2MTLA 1YJ9S 3KG0A 2F8MA 1YJUA 2Y0BB 3CCMS 3A3NB 2HEKA 2CRLA
chains in the Genus database with same CATH topology
4L72B 2F9JA 3WZ0A 3G8TA 2B6AB 3JB9k 3G86A 4O3SA 5B08A 1S49A 2RSQA 1MROB 4QIFA 2I2YA 1URNA 4K4UA 3JSBA 3U1MA 4OJHA 2B7BB 4J9MA 3KTQA 1JLEB 3KK1A 2IBKA 4ITSA 4YEAA 2DNMA 4QZVB 1JNRB 1H7XA 2OPSA 3QZ8A 1KC8T 1KQSR 1H0HB 5DETA 5DDRC 2JHEA 4IQMA 2I1RA 3H59A 4OZ5A 1ZM4A 3H4BA 2CQ0A 3IN5A 4GKKF 4WZQA 3B4DA 2XI2A 3DLLQ 3TVYA 5HI7A 3HFKA 4KBIA 5CCMA 5A0YB 5F9LA 1QVGR 2VFUA 3BM7A 4C98A 1U6BA 3V6DA 2RIJA 4RX6A 1H98A 4EBEA 3CC4S 4JV1A 3K59A 3M8SA 2YTCA 1ZZNA 4KHPF 3HKZD 4NX9A 2KYXA 3MECB 5B0AA 1SKWA 4F3OA 2YNFB 3OLBA 4OZLA 3AAWB 4ZVEA 4EYHB 2L9WA 4WYWA 2LQJA 1MWYA 4CT8A 4Q8FA 4CCHA 2CQ1A 4DL3A 4ICLB 1Q78A 4D3GA 3TAQA 2XULA 3CGIA 3MM7A 4RBTA 3AA8A 3IWNC 3EGWB 1FEEA 3CJKB 2KG0A 2AGOA 3DRRA 3NS6A 3GR0A 3TUZC 3M9NB 2M70A 2DNRA 3N6LA 4J9PA 3BGFA 1VMBA 3IAS9 4OHVA 2R7QA 3HHLB 4N47A 5KFOA 1SJ3P 4NCAA 4RKUC 2VG6B 3PFEA 4ZPCA 2RNEA 2DO4A 2HNZB 4DL0C 4K59A 3KK1B 4DUYF 4G1PA 2HHPA 4YDDB 3PY8A 4AL5A 3FVYA 4DR7F 3EZUA 2DH7A 3FSIA 1LW2B 1R8BA 3DXBA 5DO2A 3NCQA 3LANA 3VZIA 4J9SA 2E5IA 4I4BA 2V4RA 2R2RA 2FLNA 5HMZA 4YMEA 1LK5A 3RYLA 1NK4A 1FJGF 2HGLA 3CDUA 4NCGA 4C7QA 2V0NA 4FS1A 3NMAA 4ZPDA 4LF7F 2FLOA 1RYRA 1QJHA 4RZRA 1SJFA 3DRPA 4DBQA 1T3NA 2MKKA 1T3OA 4ES3A 2HHTA 1C1BA 1MROA 1JJ4A 2KB2A 3DI6A 3PRBA 3M30A 2O3DA 1NRKA 2J7WA 5ADZA 5I3PA 2EBEA 2XWYA 4K4YA 3T9NA 2B4UA 2ZM6F 2VODA 2XS2A 2FHKA 5KOXA 2GGPA 3MWBA 3VALA 4ED6A 2DR9A 3MEGA 3DFEA 3MAQA 2CJKA 2AGPA 1R0AB 1S0VA 2CPFA 2PC6A 4MFBB 3DOLA 2QIFA 2P9EA 4OIXA 2DNZA 1UAWA 4WE1B 4JV0A 3UE2A 5LJ5Y 2G1DA 1P6TA 4X62F 5AE1A 4QWCA 1V3RA 3PZPA 4LMZA 2JRSA 2MMYA 4DOZA 2DNHA 1N8RT 2Z2MA 4NLYA 5G0RB 1D1UA 2DIVA 2RDJA 4PXBA 1E6YB 1JLFA 3IFEA 1R31A 5IT0A 1BC6A 4ZPAA 1LWFA 4RWWA 5J1PA 3FRYA 3I4PA 4FXDA 3HHKA 3KNAA 4ED8A 2YKMB 1VRTB 2EVZA 3M8QB 2HS3A 3CXCR 5GAGU 3I0SA 4C0HA 2A10A 3LPYA 3DLGA 4ECUA 1FERA 1ZAWA 4TXSA 2M9KA 1HPZA 1ZETA 3KHRA 2BJEA 4WZMA 1QLNA 4ATNA 5EDWA 3QYYA 4ALZA 1SB6A 1KHWA 1NAQA 4PG7A 2MQLA 2FJEB 2CQ4A 5EHHA 1FHTA 4R5PB 1NEEA 1HNIA 3QGIA 3CO9A 4BWJA 2NSCA 1M5SA 4ZPWR 2GGPB 3I0SB 1UJ4A 2LEPA 2BUNA 2FHMA 4HL9A 3DNCA 3MMAB 1XNQF 4KTQA 2DNGA 3FQKA 1FRIA 4HKQA 2GMHA 4ZDNA 4EO8A 4ED2A 2KO1A 2VONA 1T7PA 4K4VA 1FRMA 3MCSA 4RW6A 4QWDA 3FNNA 3KLIB 5DDOC 2XO7A 3FMBA 4NA3A 1G1XA 3IGVA 2EG1A 1FKAF 2AX1A 2JLGA 2UU9F 5KFGA 5KFRA 1UVJA 1IKYB 4U9RA 3KG4A 1VHFA 1Y3KA 2KRRA 2ZNZA 4MMOA 3PFOA 3U7JA 1X5TA 1MMNA 1NNDA 3P96A 1U1QA 3L3CA 1SUQB 2B51A 1HYSB 1CQMA 3RB6A 4OLPA 2M5YA 3SQGA 4TQSA 2VPYB 3GILA 1RK8A 2VFRA 1DQ9A 1D9DA 2RRBA 1IKXB 1IJEB 4NLRA 2C3YA 2QA1A 5H9FJ 1IN0A 1BD6A 1IXKA 1JMTA 1X7VA 3KOAA 1CVJA 1T95A 4LIWA 4X4OA 1LW0B 4DSJA 1N5YB 4N8NA 2L48A 3AA9A 3CCQS 2WOMA 1WG1A 1X9WA 3AJ1A 4EUVA 2AD9A 4IKAA 3HHNB 4DV3F 3DRRB 3DRPB 2MKHA 2V8DA 2YNHA 3LAKA 5E3PA 4UW2A 2W24A 2OTLS 2L3MA 3V6JA 4NLGA 1QSLA 1DJ0A 1XN9A 2X51A 2WSCC 5FLXY 4OJGA 1GH8A 3NAHA 3K5NA 4Q0BB 2E1MC 3GYXB 2B5JA 1ZTWA 1QAYA 1FVQA 2IM3A 2P9GA 3RZAA 3QGGA 2HLTA 1Q53A 2LQ9A 3SYZA 4IR1A 1QTMA 1VC0A 2UUBF 1N0VC 1ZAXA 1P1TA 2KZMA 1VGYA 3M2RB 4NRTA 1HBNB 5A6WA 2MZSA 4ECSA 5B0CA 2UZAA 2AGQA 3IWXA 1V6HA 4ELTA 3DM2B 1Q7YT 2DGXA 2LQBA 2Y1IA 4QWEA 5A8KA 1MU2B 3IS9B 1VIOA 3HM9A 2XMUA 2UUAF 3N6MA 4UQGA 1KONA 5HP1B 1QUPA 5HN0A 3N28A 2YWHA 2R7SA 2J76E 5DM7Q 2B0GA 1UVMA 4PWDA 3K8VA 4RWXA 4TY8B 5I4MA 3C6UB 1U1LA 4OX7A 1QE1B 4MK9A 1MMLA 3GE9A 3M4XA 4LF8F 2EK6A 3DDNA 4M5DB 2ZHOA 3PO5A 2MPUA 1U48A 3QO9A 2HRUA 1FKPA 2B4VA 1WF2A 4U7UK 2HHHF 4TQRA 4ZVFA 2C3UA 2YKNA 5KT3A 1RKIA 3VTIA 2JX2A 2BACA 5F8MA 2XCAA 4PG8A 1QSYA 2JEFA 2J9EA 3BGRB 2K3KA 1JKHB 2R7OA 1TK0A 1SJQA 1HQUA 3NAIA 2YX7A 4DSEA 1AXQA 1KQFB 5IM0B 4HVZA 2ZE2B 2HVHA 1SL0A 4M94A 5KFVA 4ZP7A 5LMUF 3NNCA 3SXLA 3OL8A 4NPOA 2AV5A 4QYZJ 2I5JB 2JEIA 3VAMA 3N5BA 2JH3A 3TAMB 4UUWA 5F8IA 2ASLA 3KK3A 3PW5A 3D54A 2BOPA 4A8MP 5GADI 4ICLA 3PIOQ 4G6VB 2BA9A 4HI1A 2IFXA 2ZOFA 1KTQA 3WC0A 2ZH4A 3BEGB 2VKZG 4DF8A 1CC8A 4JI1F 2OTJS 3VAKA 1TAQA 3J7YU 4X64F 5DRKA 1X4FA 1ZZFA 2PIIA 1MWZA 1S77D 3O44A 4C97A 4XIUA 5I3QA 1RWUA 2CQ2A 2YNGA 2JOQA 3I4HX 3IG1A 1DURA 2CYYA 1JLQB 3B82A 2M2BA 4DWIA 5BYSA 1G7CB 4A8SA 4DPOA 1P1LA 2RF2A 5EUHA 4DS4A 4P7TA 4IOBA 3GIKA 2RU9A 4FN5A 2MY7A 4V19J 1TKZA 3KJVA 4X4UA 3HZEA 4PG6A 2PMHA 4J9OA 1HW8A 2KT2A 3UWTA 3J7Z5 3T5JA 4O3RA 2ILYA 5KFPA 2GMLA 2EFGA 3IR7B 2B9YA 4NYOA 4OI4A 5IM0A 3PR4A 2DGVA 1H38A 1OQ3A 4WCEQ 1HWKA 4C2MA 3HT3A 3T3FA 1SIWB 3B78A 4IO1A 1U2RA 1D8YA 1VQ6S 2HHXA 1REVB 4KV8B 4DLGA 3KK3B 5GAEU 1NH8A 3QWPA 4PWUA 2VC0A 2RE1A 2B9XA 3OFGA 2FHJA 2WTFA 1FTRA 3MD3A 1PILA 1X4AA 3QO9B 3OXFA 2D74B 5G0RA 1S9FA 1WG4A 2P5VA 2XB2D 3HHLD 4LSLB 3MR6A 1UEUA 4PCQA 4OV1A 1T8EA 5GAHI 3OL6A 3JYTA 2XSFA 4MKAA 3LWMA 1RTDA 4JV2A 3BGRA 4FF2A 2Q3PA 1TL4A 4DSKA 1Y00A 5CYJA 1U1MA 1R0AA 3FSXA 2GCFA 2ZKTA 1UEVA 2ZD1B 2CPXA 2FJXA 1WELA 4KPYA 1UW4A 4QYRA 2IYGA 5KFMA 3BSOA 2VA3A 1HBUA 1RT3A 5D4LA 5DLGA 1BQNA 2QMWA 2ALZA 2UUTA 5DQIA 3E3XA 1H6KX 4Y34A 2LA4A 3MR5A 1J5EF 5C24B 3I6PA 2QV6A 3IAM9 3M2RA 2J5AA 2N4DA 2A2CA 2J9DA 1F60B 4ZPTR 5DJBA 1V3ZA 1DHMA 1N5SA 4FF3A 3LGNA 4DF4A 2N82B 1HNVB 3ENWA 5H1SV 2UVWA 1C0UB 1UWBA 2ZD1A 2BVZA 2E7XA 4Q44A 4EEYA 2LYVA 4B17A 2VC1A 1X0FA 1ZTTA 1GAOA 5DS7A 1RT2A 1B0PA 3T6BA 1RISA 1WEYA 4IH7A 1QSSA 2E1AA 4HI2A 1V3SA 5E5NA 7FDRA 4DV6F 3TA0A 1WTFA 3FZBA 2FPHX 3S7RA 1N56A 1HI1A 4NA1A 2KFYA 2IVMA 1CLFA 2A2DA 3ONQA 4RW7B 3TI0A 3I96A 3LP2B 1ZAVA 2GO8A 2WCXA 2BM0A 3QWUA 4O3QA 3RRHA 1S76D 4QWAA 1SV5B 4RU2A 3NWGA 4X4SA 1JJHA 2ROEA 2UXBF 3H5SA 2LXUA 3PEHA 1E6YA 2X1FA 5LXRA 4EZ6A 3SQGB 1K0TA 4A8KA 1UL3A 3BN4A 4TKTA 4CH0S 5JVGQ 2DIUA 2BQRA 1DLOB 4XO0A 2BR0A 3R5BA 2HVZA 3RB4A 4B9SA 5CA5A 3K5MA 2Q66A 4IG0B 3Q8SB 4IYQA 5KG0A 1K9MT 1HR0F 3LO3A 4Q45A 2MB0B 2XG8A 4Y28C 4I6WA 2VA2A 4F8RA 3KLIA 1B64A 2AJ1A 5DGBA 2E5JA 2YWFA 4GC6A 1RJJA 1RT6A 4J9NA 4DQQA 5I3UA 5SZTA 4CTAB 5J2MB 3CDWA 5JVHQ 1DTQB 2XY7A 3KLGB 4QIEA 2OPPB 3MM6A 1RTIA 2KXFA 1FJ7A 2E9RX 1S1WB 2DNOA 4UY85 1SXLA 2PEHA 3DXSX 1WTBA 2OPRB 5HQ8A 1RYSA 3IG1B 4DQIA 4Q43A 4C4WA 3IWLA 3DDKA 4NLVA 5KFXA 2J7UA 4NLOA 2JZ5A 3DLHA 2D41A 3K5PA 3I55S 2LMIA 3BR9A 1NJZA 4RLEA 2FGCA 3M6XA 3SEOA 5HLFB 4O4GA 4ZOSA 3CJ5A 1OIAA 5JJBA 2BDPA 2CJ9A 4USIA 2F9DA 4QW8A 1RQ0A 1YVFA 3BSNA 1D8ZA 2D3UA 4KFBA 4ETXA 1S48A 1JLBA 3FZ2A 3GIMA 5A8WA 2HRYA 4ZCMA 2LXFA 3JSMB 2LDIA 2MHEA 3TAMA 3DYAB 3ZZZA 1S6UA 4U6PA 4RW8B 1H3DA 5DDPC 5KFTA 4ECYA 2C28A 4YHHF 2JLFA 2AW0A 3HMJG 1Y0HA 2X1BA 3THTA 1AFJA 4YR2A 5G4DA 4I2PA 3UCUP 2QZ8A 2OPQA 4H4MB 3CJKA 3TRGA 1WHXA 1RI7A 2W7AA 3J7A1 4JI3F 1KFDA 2XMMA 4OZJA 1NKBA 1I6JA 1U4BA 2UXCF 4J9KA 2CJAA 5CHCB 1FDNA 3ZZOA 4WKRA 2EWHA 2LA6A 3MM9B 1Z4UA 1S1TA 2GV1A 3OJSA 5AXLA 4ILMA 3OR2A 4JI8F 5KFIA 4M5DA 5GADU 2OMLA 3T1YF 3GMGA 2Q6CA 2V9KA 4RNHA 1GNKA 4WE1A 2R8IA 3V4MA 1L3UA 4B3TF 2VBWA 1B0TA 4I69A 2U1AA 4FPRA 2AJQA 2LVWA 1FKPB 4Y2IA 4DV7F 4OHWA 4CO5A 3CMES 4J9RA 3UW1A 4LFCF 4NCGB 4XAKA 2DNQA 4RW9B 2Q6BA 1YJTA 2DK2A 2ZVSA 3W2WA 1PO6A 5JXSA 3DYAA 3SI8A 2YNIA 4NLXA 2CVEA 1S0MA 1NK8A 1S1XA 2IM1A 4C9DA 4Y6IA 3DI6B 4LQ3A 1QAXA 1ZYQA 1WD6A 4O3OA 2HWIA 1T03A 3UCZP 2AWZA 1SI9A 2F1FA 2QMXA 1Q16B 1RT7B 4H4KC 4F3MA 2MQMA 1KN6A 2R8GA 4P2SA 1Q7LB 2HGNA 1L5UA 5HBMA 2R9LA 5HLFA 4B9UA 2HZCA 2HFNA 2DCLA 4ILLA 1Q1KA 5DLFA 3I5AA 4DL2A 2ZH1A 1F9FA 1RP5A 5ITHA 1KLNA 2J9DE 1TKXA 3CCSS 2G4BA 2UVRA 1YJVA 1OWXA 2HS0A 3I9V9 3I0RA 4ZHRA 2W9BA 1N54B 2P9CA 5KFDA 2CPDA 2MHNA 1X4HA 4KAIA 3C6TA 3MR2A 4QW9A 2HVIA 4ECRA 3ITHA 2AQ4A 5CYMB 4GC7A 2JVRA 3VWSA 5D3GB 2E9ZA 2HFOA 3S1TA 5DG8A 1DFDA 2ZHAA 2IYIA 4DFPA 4RW6B 2QYCA 2YKOA 2V5HG 3CTRA 3MF5A 1X5PA 2GIRA 2ZBIA 3QJJA 1ROFA 1RT5A 4MKBA 1PC4A 3PACA 1XMBA 3G8SA 2DJWA 3OUYB 2PMZD 1HARA 2Y1RI 3IRWP 4LSLA 4KFBB 3G6ES 2B56A 1X8DA 2ZDOA 1EP4A 1YRUA 2X1GA 2VQEF 2N3OA 3D5MA 4MYUA 1HYSA 3FSYA 4OI2A 4Y2CA 1GT8A 3HVAA 1WF0A 4DMZA 3F44A 3X1LB 5F8LA 3TVZA 4BC7A 2XHWA 1FXRA 1XBWA 3MMAA 3OSNA 2E1RA 4TU9A 5F41A 3JTOA 4Q7AA 1W2IA 3MURP 2Q1LA 3OL7A 4OI6A 1Y5IB 3OTEA 2VD3A 2ZH8A 3RRGA 4C8KA 1BLUA 1R7IA 4LFAF 2FHJD 4QPTA 3DOKA 4YB1P 5KG4A 4X84A 2PGCA 1TK5A 2W9CB 3F73A 3KJVB 3T1HF 4UY8T 4CT9A 1M5PC 2YNIB 2EFOA 3ISNC 1U1KA 2HGMA 2IVYA 2W4PA 2WONB 3D0GE 2BANB 4RW9A 3HX9A 5K14B 3W2WB 2BRLA 2FJVA 2ZFHA 1NB7A 3V6KA 3G96A 1HQEA 2JFKA 2ROPA 3GV8B 2L9DA 3SCLE 1JLQA 3I31A 5KT2A 3KLHB 3MEDA 4BHQA 2J6SA 3J81Y 2QSWA 3QIPB 2HFZA 2C2DA 1BQMA 1B0VA 5HMYA 4KR0B 3DMJB 1FRLA 3SCIE 3TX8A 4A48A 2C42A 4NA2A 2KT5A 3DRSA 3HHEA 4BDPA 1HFEL 1ZBTA 2JFDA 3D2WA 3GFXA 4MAKA 3KYLA 2RB7A 5B09A 1OO0B 2LQ5A