3IA8A

The structure of the c-terminal heme nitrobindin domain of thap domain-containing protein 4 from homo sapiens
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
162
structure length
162
Chain Sequence
PPKMNPVVEPLSWMLGTWLSDPPGAGTYPTLQPFQYLEEVHISHVGQPMLNFSFNSFHPDTRKPMHRECGFIRLKPDTNKVAFVSAQNTGVVEVEEGEVNGQELCIASHSIARISFAKEPHVEQITRKFRLNSEGKLEQTVSMATTTQPMTQHLHVTYKKVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the C-terminal heme-binding domain of THAP domain containing protein 4 from Homo sapiens.
pubmed doi rcsb
molecule keywords THAP domain-containing protein 4
molecule tags Metal binding protein
source organism Homo sapiens
total genus 32
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08768 DUF1794 Domain of unknown function (DUF1794)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 3ia8A00
2KT4B 4N7DA 4AZMA 2RCTA 3ZUOA 1X8QA 4ZHCA 5EDBA 3D96A 3ZUIA 3O22A 5HTEA 1GT4A 5IO6A 4IMNA 3KFIA 2BLGA 4QGWA 2FS7A 2QO6A 4A60A 3PPTA 5H8TA 4ZFXA 1D2UA 2XKLA 5D4AA 1NP4A 5FENA 4DQ4A 2AT6X 3B2LA 3JS1A 4IAWA 1HBPA 5D48A 1I4UA 1JYDA 4QAEA 5HCEC 5KIDA 1X8PA 2ACPX 4M7MA 2NNQA 2HYSA 3TGAA 3KQ0A 2KTDA 1UZ2X 4QGXA 4AZNA 2QO5A 5BVSA 4TQ2A 1E5PA 4NLIA 4YMYA 1YP6A 1I06A 1KOIA 1LFOA 1U17A 2YG2A 3EM0A 3TF6A 5HZ8A 5AQ6A 1IFCA 1S44A 3EBKA 5H9KA 2WEWA 1MUPA 4ORUA 1GT5A 3BS2A 2A2GA 2RA6A 1LIDA 1FELA 1I04A 5H9AA 2JU8A 1LIBA 4KIIA 3S26A 2AMMX 1AQBA 1OEEA 4GNYA 5B29A 4IB9A 5C0NA 2K23A 1QY0A 3HWDA 1KXOA 4YDAA 4YFRA 3BY0A 1CRBA 1EUOA 2MO5A 3F8AA 3STKA 4AW8A 1B0OA 3FIQA 5H9NA 3P6FA 1B8EA 1EPBA 2ASNX 3IA8A 1KT7A 1G85A 2ANSA 3NQ3A 1CBRA 5BVQA 1DV9A 1FE3A 4ZHFA 3PP6A 2A3FX 3B2JA 1GKAB 1LF7A 4ALBA 3I0AA 1A2DA 1HMSA 4TLJA 2XSTA 4YH0A 4A8ZA 2WUTA 4IAXA 1TW4A 5EEEA 2L67A 4AZOA 4IMOA 3PH5A 3BSZE 4HPDA 3FEPA 1CBIA 1EXSA 5DPQA 5HBSA 2AT5X 1JJJA 1X71A 2LBVA 2WWPA 3STMX 5HCDC 1FENA 2ALLX 2P8GA 1EIOA 1G5WA 2X45A 3TGBA 3NR3A 3PH6A 2Q4NA 3O19A 1SXXA 4ZCBA 1LIEA 2WQ9A 3C77X 1DZMA 5IO5A 1NP1A 2POAA 3BU1A 4D6BA 2NP1A 3EMMA 2CZTA 4A1HA 4I3CA 4BOEA 1ERXA 4YGZA 2AT0X 1ZNLA 4YCHA 3U9PC 3B2IA 3KFHA 1X8NA 3NPOA 3NADA 3CQNA 1RLBE 1YWBA 4XMFA 3CBCA 1TOWA 2GTFX 4DQ3A 1ZNDA 4HPCA 3FW5A 1QY2A 3O2YA 2OVEA 3NP1A 4ZR2A 5BVTA 3WXQA 3HWFA 2W2FA 1OPAA 1XCAA 2AH7X 1OEJA 4WFUA 4Y0QA 3HWEA 1DZKA 1BJ7A 5LJHA 1GT1A 1IKEA 5HZ6A 3AKNA 4YGGA 4UU3A 3QKGA 3BU9A 4ORRA 1LPJA 3VG2A 4NNTA 4ES7A 1QY1A 1B56A 4QZUA 4ZHDA 4LZVA 1O1UA 3P6HA 1ZNEA 1XKIA 2L9CA 5L8NA 5HWZA 2FWVA 3BRNA 3CR6A 4ORSA 5KHPA 1X89A 3FLLA 2A2UA 3FA6A 2OFRX 5F6ZA 3FR4A 3FENA 3P6DA 1MX8A 5K06A 1BRQA 3ELZA 3P6GA 4UU2A 1T0VA 2R73A 4NYRA 2A0AA 1YWCA 1PBOA 1U0XA 4BQUA 3MVFA 4YGHA 4ZHGA 1KQXA 1IFBA 2HZRA 1O1VA 3SAOA 2K62A 3WJDA 1ZNGA 2WQAE 2HLVA 1ICMA 1DZPA 1QFVA 1T68X 3APXA 4YDBA 4NLJA 4O9SA 1EW3A 1TVQA 4ODDA 5HZ9A 3VG7A 1FTPA 1JZUA 3DTQA 2O62A 1KGLA 2W2AA 1O8VA 2QM9A 3FEKA 5HCCC 1PMPA 3FA8A 3TZSA 4HPBA 1ICNA 2A13A 3PEDA 3VG4A 3OJYC 4ZH6A 2AT3X 1E00A 3BDRA 1E02A 2FRSA 4EFGA 4Y0SA 4AZQA 2Q2MA 2R56A 4YFPA 4QZTA 3CMPA 4NYQA 5LKEA 1YWAA 2CBSA 4ALOA 1RBPA 2L5PA 3EYCA 4EEJA 2W2BA 3K3LA 3WJEA 1OBPA 1D3SA 3T1DA 3C78X 3IFBA 4I9RA 2HMBA 1BM5A 1SY3A 3VG5A 5HZ5A 2JU7A 1HN2A 3JSQA 2FS6A 1VYGA 3BX8A 4YCEA 3I17A 4XMEA 2DM5A 2AT8X 3ZQ3A 3F9DA 1X8OA 4XMDA 4N7CA 2OZQA 4ZH9A 5LJDA 4TKBA 3BX7A 1SA8A 1Z24A 5D8JA 1IKJA 1ZNHA 3DSZA 1YP7A 1SY0A 1BEBA 5LKFA 3GAQA 1E06A 3FW4A 1MVGA 1LNMA 4LKPA 1ML7A 1SXUA 2CM4A 1A18A 3MBTA 4IB8A 3CQRA 3APUA 1EALA 3WBGA 1ACDA 4MVLA 1AVGI 3FA7A 1QG5A 2CM9A 5D47A 5HA0A 4XMHA 4I3BA 2JOZA 3B2HA 1EQDA 2WR6A 3D95A 2QO4A 4ORWA 1H91A 1BRPA 4GETA 1I05A 2G78A 2E4JA 2IFBA 2WEXA 3EBWA 4TJZA 3UEWA 2OVDA 5EPQA 2RCQA 5FAZA 5LJBA 1KT5A 1UREA 2CBRA 1A3YA 4HFOA 1QWDA 4I3DA 5LJEA 1G7NA 4AYHA 3WJBA 1S2PA 5L8OA 2G79A 1OEKA 1MDCA 4LKTA 5CE4A 2PY1A 4YKMA 3WJCA 1KZWA 4IB6A 4XMGA 1ZRYA 2Q2PA 1G74A 1BBPA 1AB0A 1GT3A 3STNA 3U03A 4TKJA 2F73A 2R74A 2WSJA 2OVAA 1VPRA 3PECA 4EDEA 1JV4A 2LBAA 5KICA 4YFQA 3VG3A 3Q6LA 3C76X 3CBSA 5L8IA 2Q39A 1KT4A 1DZJA 1YWDA 1FEMA 1SY1A 4AZPA 1GXAA 3WJGA 2EU7X 1S7DA 1R0UA 4QYPA 3B2KA 3FELA 3D97A 1KT6A 2ACOA 4XMCA 2JU3A 3HWGA 5H9LA 4K19A 1BSYA 2LB6A 4BVMA 1GX8A 3TGCA 3NQ9A 5EEDA 4D6AA 3P6CA 5F6BA 1SY2A 1SXWA 1T8VA 4OMXA 4WBKA 2Q9SA 1BSQA 4GNWA 1GKAA 4TKHA 2GJ5A 1TXLA 4WFVA 4Y0RA 2HZQA 4ORYA 1A57A 2AKQA 4OMWA 3WVMA 3BLGA 2N93A 1TOUA 1ZNKA 3ELXA 4IB7A 3KFGA 4RUNA 4AZRA 2FT9A 2FLJA 5HZQA 1ALBA 1HMRA 3FA9A 1GGLA 1HBQA 5HTDA 2CZUA 3NX1A 4Y0PA 1CBSA 4EXZA 1L6MA 1JYJA 4OS8A 5DG4A 1P6PA 3RZYA 2LFOA 3WJFA 1BWYA 1DFVA 4TNNA 5JR8A 1KZXA 4ORXA 3FR2A 1PM1X 5LJGA 4ARHA 2NNEA 4YKOA 3UEXA 1OBUA 1X8UA 2L68A 4IBAA 3APWA 5EDCA 1EPAA 2NNDA 1IW2A 1LKEA 3VG6A 1YIVA 3KFFA 3HK1A 1LIFA 4YBUA 1B4MA 4ZGUA 3KZAA 1PEEA 4NP1A 4GKCA 2QOSC 1VYFA 4GH7A 4RUUA 4HPAA 1QQSA 1MX7A 4GRJA 3AKMA 3UEUA 4OS0A 1SXYA 4CK4A 5B27A 2HNXA 2RQ0A 1AELA 1CBQA 1OBQA 2MM3A 3FMZA 4M6SA 1GX9A 1HMTA 1ERBA 1N0SA 4R0BA 1FDQA 3RSWA 1KT3A 5LJCA 4A1YA 2JN3A 1BSOA 3APVA 1NGLA 5EZ2A 5F1EA 1ADLA 1JBHA 1EIIA 3NX2A 2FR3A 2MJIA 1KQWA 1JJXA 3FR5A 2GC9A 5FFHA 5IO7A 4PSQA 1OPBA 5LJKA 1BLRA 2OFMX 4QYNA 1YUPA 2FTBA 4I9SA 3UEVA 4QGVA 3L4RA 3U0DA 1DF3A 4MVIA 4OS3A 5HAEA 4ZJ0A 2G7BA 2RD7C 4YBPA 4MVKA 3G7XA 1QFTA 1GM6A 2AL0X 3CWKA 1IIUA 4LZUA 1CJ5A 1HQPA 4ZHHA 2LKKA 2X46A 5F7GA 4GE1A 4NNSA 5F58A 2FR2A 1DC9A 5HA1A 5D45A 1LICA 1QABE 3P6EA 1U18A
chains in the Genus database with same CATH superfamily
2VFBA 3VE1A 3JQOA 2KT4B 4N7DA 2I5VO 3Q34A 1MOYA 2RCTA 2RTOB 4QQ1A 3SLTA 4AZMA 3ZUOA 1X8QA 4ZHCA 1EI5A 1LUQA 5EDBA 3D96A 3ZUIA 1Y9TA 3O22A 2IZBA 1GT4A 5HTEA 3PQSA 3ZWEA 4IMNA 4CPHA 5IO6A 3KFIA 2BLGA 3HOLA 4QGWA 2FS7A 2QO6A 1RSUB 3PPTA 5H8TA 4A60A 4ZFXA 1D2UA 2XKLA 5D4AA 1NP4A 4GJSA 4ID2A 4NV8A 2RTMA 2ZAIA 5FENA 4DQ4A 2AT6X 3B2LA 3JS1A 4IAWA 5FQ7E 1HBPA 5D48A 1I4UA 1JYDA 4QAEA 1LCVA 4KH8A 1DF8A 3LHNA 1X8PA 5HCEC 3VHIA 4YVBA 5KIDA 1JMZA 2ACPX 4M7MA 2NNQA 2HYSA 3TGAA 4Z2PA 3KQ0A 2KTDA 1UZ2X 2QMIA 4QGXA 4AZNA 2QO5A 5BVSA 4TQ2A 3WZOA 1N7YA 2BS5A 1E5PA 3AUMO 4NLIA 4YMYA 1SLFB 1I06A 1YP6A 2BS6A 1KOIA 1LFOA 1U17A 2Y32A 2YG2A 3EM0A 4U3QA 3TF6A 5AQ6A 1IFCA 1S44A 3EBKA 4GZVA 5H9KA 4NV7A 1VWFB 1SRGA 2WEWA 1MUPA 4ORUA 1VWKB 1GT5A 3BS2A 2A2GA 2MHDA 4Z6JA 2RA6A 1LIDA 1FELA 1I04A 3CKGA 5H9AA 2JU8A 3HTYA 1LIBA 1SWEA 4KIIA 5AJCA 2X8TA 3S26A 1WBIA 2AMMX 2GTLO 2RTFB 4GUZA 4JO6A 1AQBA 1OEEA 4GNYA 3ZZVA 5B29A 2IZDB 4IB9A 1SWTA 5C0NA 3WYPA 2RTIB 2K23A 1QY0A 4GDZA 2HKDA 1KXOA 3HWDA 2IZCB 4YDAA 3T2XA 4YFRA 3BY0A 2YMSA 1CRBA 1EUOA 2RTJA 2MO5A 3F8AA 4U9CA 1VWHB 3STKA 1B0OA 4AW8A 3FIQA 5H9NA 3P6FA 1B8EA 4OKAA 1EPBA 2ASNX 3IA8A 1KT7A 2AF5A 1G85A 2ANSA 3NQ3A 1CBRA 4MEEA 5BVQA 3SZIA 2RTDB 1FE3A 4CDFA 1DV9A 4ZHFA 3PP6A 2A3FX 3B2JA 2X34A 1RXKA 1GKAB 1W4TA 2G8CO 2Z4HA 1LF7A 4ALBA 3I0AA 2M4LA 4O4UA 3ZI8A 1A2DA 4CPFA 3RDUA 1HMSA 4Z2VA 4TLJA 2XSTA 4DCBA 2IZEB 2KTSA 4YH0A 4A8ZA 2WUTA 4IAXA 2A5CA 1TW4A 2RN4A 2L67A 4HWMA 5EEEA 4AZOA 4IMOA 3PH5A 4GGRA 1SRFA 4KC7A 3BSZE 4HPDA 5CYBA 3FEPA 3WYQA 1CBIA 1EXSA 1STSB 5DPQA 5HBSA 4BX7B 2AT5X 1JJJA 1X71A 2X8FA 2WWPA 2LBVA 1DF3A 3STMX 5HCDC 1SRJA 1FENA 2ALLX 2P8GA 1EIOA 3OE3A 1G5WA 2X45A 3TGBA 3NR3A 3PH6A 2Q4NA 2JW1A 3O19A 1SXXA 1VWMB 1IJ8A 1LIEA 2WQ9A 3C77X 4L3RA 4ZCBA 3HOEA 4JNJA 1VWPB 4DNEA 2G5LA 1DZMA 2RTHB 1JMXA 1NP1A 2POAA 5IO5A 1VWJB 3RDQA 3BU1A 4D6BA 2NP1A 2OF8A 3EMMA 1NQNA 2CZTA 2X56A 4A1HA 4I3CA 4BOEA 1ERXA 4YGZA 2AT0X 1ZNLA 4YCHA 3U9PC 2BT9A 3B2IA 3KFHA 3RWXA 1X8NA 3NQKA 3NPOA 3NADA 3CQNA 1RXHA 2PI3O 1RLBE 1YWBA 4XMFA 1PTSA 2RTGB 1Y53X 3CBCA 3F6ZB 1TOWA 2GTFX 5B2AO 2UZ2A 2JGSA 1ZNDA 4MVEA 3WZPA 4DQ3A 4HPCA 3CKFA 1QY2A 3FW5A 4O3ZA 3O2YA 2OVEA 3NP1A 5CSEA 1Y52X 4ZR2A 5BVTA 3WXQA 3HWFA 4U8UO 4IRWA 2W2FA 1OPAA 1NBXA 1XCAA 2AH7X 1OEJA 5CHKA 4WFUA 4Y0QA 5K68A 3HWEA 1DZKA 3N91A 5HZ8A 1BJ7A 3RY2A 5LJHA 1GT1A 4MIRA 1IKEA 3SOTA 5HZ6A 3AKNA 4YGGA 5FQ8E 5L3YA 4UU3A 3QKGA 3BU9A 2BC3A 2MWHA 1LPJA 1SWPA 4ORRA 3VG2A 3FDCA 5FQ6E 5B11O 3RE5A 4NNTA 4ES7A 1LDOA 1VWQB 1VWCB 1QY1A 1B56A 4QZUA 4ZHDA 4LZVA 5JD2A 2IZHB 1O1UA 3P6HA 1ZNEA 1XKIA 2L9CA 5L8NA 5HWZA 3MG5A 2IZFB 3WZQA 4OEMA 2FWVA 3BRNA 3CR6A 4ORSA 5KHPA 1GX3A 1HXLA 1X89A 3HPEA 3FLLA 3D9WA 1N9YA 2A2UA 3FA6A 2OFRX 5F6ZA 1VWLB 3FR4A 3FENA 3P6DA 1MX8A 2IZAA 4O3WA 5K06A 1BRQA 3ELZA 3P6GA 4UU2A 4EQAC 1STRB 1T0VA 2R73A 4NYRA 1JIWI 2A0AA 3VE2A 1YWCA 1VWNB 1PBOA 1FJ1E 1U0XA 4BQUA 1KL3A 4C5PA 3LV4A 4FBOA 3MVFA 4YGHA 4BX6B 3RBYA 4ZHGA 1KQXA 1IFBA 2HZRA 1O1VA 1LCWA 3OBLA 1HQQA 2K62A 3SAOA 3VGWA 3WJDA 4BX5A 1ZNGA 1Y55X 2WQAE 2FHNX 3T6LA 2HLVA 2KD2A 1ICMA 1W5RA 1DZPA 1QFVA 1T68X 3APXA 4YDBA 4NLJA 4O9SA 1EW3A 1MEPA 1TVQA 4ODDA 5HZ9A 3VG7A 1FTPA 2CAMA 1JZUA 2IZJA 4ON1A 3DTQA 2O62A 3T2WA 2VFCA 2RTNB 4KC8A 1KGLA 4FBRA 2W2AA 1O8VA 2AVIA 4CPHB 1SWGA 2QM9A 3FEKA 5HCCC 1PMPA 3ZW2A 3FA8A 3TZSA 3RDOA 4HPBA 1ICNA 2OY1O 2KW1A 1AVEA 3RE6A 2BHVA 3SZJA 2A13A 3PEDA 3VG4A 1WUBA 4BCSA 3OJYC 1SWBA 4ZH6A 3V8UA 1SWUA 2AT3X 1E00A 3BDRA 1E02A 2FRSA 4EFGA 4Y0SA 4AZQA 3GE2A 3PK2A 1NDJA 1AVDA 2Q2MA 2R56A 4YFPA 1SRHA 5AEOA 4QZTA 2C1QA 3CMPA 1SLGB 4NYQA 4GJVA 1YWAA 5LKEA 2CBSA 4JHQA 4ALOA 1RBPA 2RTQB 2L5PA 3EYCA 4GGZA 4EEJA 2W2BA 2FKGA 3K3LA 3SLJA 3WJEA 1OBPA 1D3SA 4FBVA 3T1DA 4I60A 3SZHA 3C78X 3IFBA 3PQUA 2HMBA 4I9RA 1BM5A 1SY3A 2RTAA 5AJBA 2ZAGA 3VG5A 2JU7A 5HZ5A 4L1NA 1HN2A 3JSQA 2FS6A 1I9HA 1NQMA 1VYGA 3BX8A 4WHIA 4YCEA 3RDXA 3I17A 4XMEA 4GD9A 1OSPO 2DM5A 2AT8X 3ZQ3A 3RDMA 3F9DA 3ZW0A 1X8OA 2RTEB 4XMDA 2ZSCA 4N7CA 2OZQA 4ZH9A 5LJDA 2X32A 4TKBA 3BX7A 5IRUA 1SA8A 1NC9A 1Z24A 3QQ2A 5D8JA 1IKJA 3ZW1B 1ZNHA 3DSZA 1YP7A 1SY0A 1BEBA 4INNA 5LKFA 1LELA 3GAQA 1E06A 3FW4A 1MVGA 1LNMA 4LKPA 1ML7A 1SXUA 4Z2OA 2CM4A 5IXGA 1A18A 2OYBO 5K67A 2RTBB 2OL6O 3MBTA 4IB8A 1VWAB 1RSTB 2Y3FA 2OL8O 3APUA 3CQRA 1EALA 1SWHA 3WBGA 1ACDA 1SMPI 4MVLA 1AVGI 1SWKA 2FGSA 3FA7A 1QG5A 1STPA 4BJ8A 2CM9A 3UEWA 1VWIB 3VPJE 3WZNA 5D47A 1N9MA 5HA0A 2DJFA 5B10O 4XMHA 4I3BA 5B3MO 2JOZA 3P24A 3B2HA 1EQDA 1KFFA 1LDQA 2WR6A 3D95A 4QNIA 2QO4A 5IRWA 1KL5A 1H91A 3OD9A 1BRPA 4ORWA 1SLEB 4GETA 2Z4IA 5BYPA 1I05A 1SREA 2G78A 2E4JA 2IFBA 2WEXA 3EBWA 4TJZA 1SWCA 3RKGA 2OVDA 2X4MA 2RCQA 3FYFA 5EPQA 5FAZA 4COTA 5LJBA 2RTPB 1KT5A 1UREA 1VWOB 2CBRA 4LQZA 3EW1A 2IZKA 1A3YA 4HFOA 1UYNX 1QWDA 4I3DA 3AEHA 5LJEA 1G7NA 4AYHA 3WJBA 1S2PA 2LA7A 5L8OA 2G79A 1OEKA 4NW4A 1MDCA 4LKTA 4BGFA 5CE4A 2PY1A 2RTLA 4YKMA 3WJCA 1KZWA 3FIDA 2A5BA 4IB6A 4XMGA 1ZRYA 2Q2PA 1G74A 1BBPA 4O4SA 3VU1A 4B55A 1AB0A 1GT3A 2QCBA 3STNA 3U03A 2OY5O 1UYOX 4TKJA 2F73A 4I95A 2R74A 2WSJA 4CSBA 1SWNA 2F01A 2WPUA 4KCAA 2X8SA 2A8GA 1PBYA 3MM0A 2OVAA 1SWAA 4JGLA 1E2TA 1VPRA 2DJGA 3PECA 4IABA 4O4XA 4EDEA 1JV4A 2LBAA 5KICA 4YFQA 2OF9A 2C1SA 3VG3A 3Q6LA 3C76X 3CBSA 4O3XB 1SWRA 1I78A 2OFBA 5L8IA 5B5GA 2Q39A 1RAVA 3RDSA 1KT4A 1DZJA 1YWDA 1FEMA 1SY1A 4AZPA 1GXAA 3WJGA 2EU7X 3UAQA 3X00A 1S7DA 1R0UA 4QYPA 1Y9LA 3B2KA 4O3YA 3FELA 3D97A 4CDDA 1KT6A 2ACOA 4XMCA 2JU3A 2QOMA 3HWGA 5H9LA 3SLOA 4K19A 1BSYA 2LB6A 4BVMA 2GTLM 1GX8A 3TGCA 1SWFA 3NQ9A 1HXZA 3H3IA 5EEDA 3VHHA 4D6AA 3P6CA 5F6BA 4Z27A 1SY2A 1SXWA 1T8VA 4OMXA 2IZLB 4WBKA 2Q9SA 1BSQA 4O49A 4GNWA 1GKAA 1MM9A 4TKHA 2GJ5A 1VWGB 1TXLA 4WFVA 4Y0RA 5B5FA 2HZQA 4ORYA 1A57A 2AKQA 4OMWA 3WVMA 1N4JA 3BLGA 2N93A 1TOUA 1ZNKA 3ELXA 4IB7A 3S5XA 3KFGA 3E3CA 4RUNA 4AZRA 2C4IA 4OELA 2MF6A 2FT9A 1KL4A 2FLJA 5HZQA 1ALBA 1HMRA 3FA9A 1GGLA 1SWOA 4BX7A 2RTCB 1HBQA 5HTDA 2CZUA 3NX1A 1SRIA 1CBSA 3P02A 4Y0PA 1L6MA 4EXZA 1JYJA 4I6SA 4OS8A 5DG4A 2OFAA 1P6PA 1K24A 4MISA 3RZYA 2LFOA 4Y59A 3WJFA 1BWYA 1SWJA 1DFVA 4TNNA 5JR8A 1KZXA 4GK9A 4ORXA 3FR2A 1PM1X 2X55A 5LJGA 2GTLN 4ARHA 4Z28A 4GDAA 2NNEA 4YKOA 3UEXA 1OBUA 1X8UA 4FGIB 1HY2A 2L68A 4IBAA 5IRAA 3APWA 2VDFA 5EDCA 1EPAA 2NNDA 4CV7A 1IW2A 1LKEA 3S5VA 1VWDB 2OY8A 1YIVA 3VG6A 4BX5B 3KFFA 3RY1A 3HK1A 1LIFA 4ML7B 4YBUA 1VWEB 1B4MA 4ZGUA 3KZAA 1SLDB 1PEEA 2I5ZO 2FHLA 4CDCA 4NP1A 4GGTA 4GKCA 3VHMA 2QOSC 1VYFA 4GH7A 4O4OA 4RUUA 1JQPA 1QQSA 4HPAA 3NBXX 1K3BA 1MX7A 4GRJA 4EKVA 3AKMA 3KVNA 3UEUA 3EC5A 2FKJA 3MX7A 3EW2A 4OS0A 1SXYA 1VWRB 4CK4A 4CPIA 5B27A 2HNXA 1SWQA 1LCZA 2RQ0A 1AELA 1CBQA 2IZIA 1OBQA 2OY7A 3ZW1A 2MM3A 3FMZA 4M6SA 1GX9A 1HMTA 1ERBA 1N0SA 1N43A 4R0BA 2IZGB 2F09A 2JMBA 1FDQA 3RSWA 1KT3A 5LJCA 1VYOA 4A1YA 3T6FA 2JN3A 1BSOA 3APVA 1NGLA 2Y3EA 5EZ2A 5F1EA 1ADLA 4KT5A 3S60A 1JBHA 4U8UM 2UYWA 4ZGFA 1SWSA 1EIIA 3NX2A 4FQBB 2FR3A 3WOVA 2MJIA 1KQWA 3PDFA 1SWDA 1JJXA 3FR5A 2GC9A 3LTWA 4U46A 5FFHA 5IO7A 4PSQA 1OPBA 4Y5DA 4CPEA 2OVSA 2OFMX 5LJKA 4QYNA 1BLRA 1YUPA 2FTBA 4I9SA 3UEVA 4QGVA 3L4RA 3U0DA 1W6FA 2GH7A 4MVIA 4CDEA 4OS3A 5HAEA 1MK5A 4ZJ0A 2G7BA 2RD7C 4YBPA 4BBOA 4MVKA 3G7XA 1QFTA 3D4RA 1GM6A 2AL0X 2BSZA 1RXJA 2RTRB 3CWKA 4QRLA 1IIUA 3ZW0B 4LZUA 1CJ5A 1HQPA 4PJ2A 1SWLA 4BX6A 4ZHHA 2LKKA 2OL7A 5F2BA 2X46A 4GU8A 1Y0GA 5F7GA 4GE1A 4NNSA 1VWBB 2FR2A 1DC9A 2RTKA 5F58A 5D45A 5HA1A 1LICA 1QABE 3P6EA 4U8UN 1JJUA 1U18A
chains in the Genus database with same CATH topology
3VE1A 3JQOA 2KT4B 4N7DA 4AZMA 2RCTA 4QQ1A 3ZUOA 1X8QA 4ZHCA 1EI5A 5EDBA 3D96A 3ZUIA 1Y9TA 3O22A 5HTEA 1GT4A 3ZWEA 3PQSA 5IO6A 4IMNA 3KFIA 2BLGA 3HOLA 4QGWA 2FS7A 2QO6A 4A60A 3PPTA 5H8TA 4ZFXA 1D2UA 2XKLA 5D4AA 1NP4A 4ID2A 2ZAIA 5FENA 4DQ4A 2AT6X 3B2LA 3JS1A 4IAWA 5FQ7E 1HBPA 5D48A 1I4UA 1JYDA 4QAEA 4KH8A 5HCEC 3LHNA 1X8PA 5KIDA 2ACPX 4M7MA 2NNQA 2HYSA 3TGAA 3KQ0A 2KTDA 1UZ2X 2QMIA 4QGXA 4AZNA 2QO5A 5BVSA 4TQ2A 2BS5A 1E5PA 4NLIA 4YMYA 1YP6A 1I06A 2BS6A 4U3QA 1KOIA 1LFOA 1U17A 2YG2A 3EM0A 3TF6A 5HZ8A 5AQ6A 1IFCA 1S44A 3EBKA 4GZVA 5H9KA 2WEWA 1MUPA 4ORUA 1GT5A 3BS2A 2A2GA 2MHDA 2RA6A 1LIDA 1FELA 1I04A 5H9AA 2JU8A 3HTYA 1LIBA 4KIIA 5AJCA 2X8TA 3S26A 2AMMX 2GTLO 1AQBA 1OEEA 4GNYA 3ZZVA 5B29A 4IB9A 5C0NA 2K23A 1QY0A 4GDZA 3HWDA 1KXOA 4YDAA 4YFRA 3BY0A 2YMSA 1CRBA 1EUOA 2MO5A 3F8AA 4U9CA 3STKA 4AW8A 1B0OA 3FIQA 5H9NA 3P6FA 1B8EA 1EPBA 2ASNX 3IA8A 1KT7A 1G85A 2ANSA 3NQ3A 1CBRA 5BVQA 1DV9A 1FE3A 4ZHFA 3PP6A 2A3FX 3B2JA 1GKAB 2Z4HA 1LF7A 4ALBA 3I0AA 2M4LA 4O4UA 3ZI8A 1A2DA 1HMSA 4TLJA 2XSTA 2KTSA 4YH0A 4A8ZA 2WUTA 4IAXA 1TW4A 2RN4A 2L67A 4HWMA 5EEEA 4AZOA 4IMOA 3PH5A 4KC7A 3BSZE 4HPDA 5CYBA 3FEPA 1CBIA 1EXSA 5DPQA 5HBSA 2AT5X 1JJJA 1X71A 2X8FA 2WWPA 2LBVA 3STMX 5HCDC 1FENA 2ALLX 2P8GA 1EIOA 3OE3A 1G5WA 2X45A 3TGBA 3NR3A 3PH6A 2Q4NA 2JW1A 3O19A 1SXXA 4L3RA 1LIEA 2WQ9A 3C77X 4ZCBA 3HOEA 1DZMA 5IO5A 1NP1A 2POAA 3BU1A 4D6BA 2NP1A 3EMMA 2CZTA 4A1HA 4I3CA 4BOEA 1ERXA 4YGZA 2AT0X 1ZNLA 4YCHA 3U9PC 2BT9A 3B2IA 3KFHA 3RWXA 1X8NA 3NQKA 3NPOA 3NADA 3CQNA 1RLBE 1YWBA 4XMFA 3CBCA 3F6ZB 1TOWA 2GTFX 4DQ3A 1ZNDA 4MVEA 4HPCA 3FW5A 1QY2A 4O3ZA 3O2YA 2OVEA 3NP1A 4ZR2A 5BVTA 3WXQA 3HWFA 4U8UO 2W2FA 1OPAA 1XCAA 2AH7X 1OEJA 4WFUA 4Y0QA 3HWEA 1DZKA 3N91A 1BJ7A 5LJHA 1GT1A 4MIRA 1IKEA 3SOTA 5HZ6A 3AKNA 4YGGA 5FQ8E 4UU3A 3QKGA 3BU9A 4ORRA 2MWHA 1LPJA 3VG2A 5FQ6E 4NNTA 4ES7A 1QY1A 1B56A 4QZUA 4ZHDA 4LZVA 1O1UA 3P6HA 1ZNEA 1XKIA 2L9CA 5L8NA 5HWZA 2FWVA 3BRNA 3CR6A 4ORSA 5KHPA 1X89A 3FLLA 2A2UA 3FA6A 2OFRX 5F6ZA 3FR4A 3FENA 3P6DA 1MX8A 4O3WA 5K06A 1BRQA 3ELZA 3P6GA 4UU2A 4EQAC 1T0VA 2R73A 4NYRA 1JIWI 2A0AA 3VE2A 1YWCA 1PBOA 1U0XA 4BQUA 3LV4A 4FBOA 3MVFA 4YGHA 3RBYA 4ZHGA 1KQXA 1IFBA 2HZRA 1O1VA 3OBLA 3SAOA 2K62A 3WJDA 1ZNGA 2WQAE 2HLVA 2KD2A 1ICMA 1DZPA 1QFVA 1T68X 3APXA 4YDBA 4NLJA 4O9SA 1EW3A 1TVQA 4ODDA 5HZ9A 3VG7A 1FTPA 1JZUA 4ON1A 3DTQA 2O62A 4KC8A 1KGLA 4FBRA 2W2AA 1O8VA 2QM9A 3FEKA 5HCCC 1PMPA 3ZW2A 3FA8A 3TZSA 4HPBA 1ICNA 2KW1A 2BHVA 2A13A 3PEDA 3VG4A 3OJYC 4ZH6A 3V8UA 2AT3X 1E00A 3BDRA 1E02A 2FRSA 4EFGA 4Y0SA 4AZQA 3GE2A 2Q2MA 2R56A 4YFPA 5AEOA 4QZTA 3CMPA 4NYQA 5LKEA 1YWAA 2CBSA 4ALOA 1RBPA 2L5PA 3EYCA 4EEJA 2W2BA 3K3LA 3WJEA 1OBPA 1D3SA 4FBVA 3T1DA 3C78X 3IFBA 3PQUA 2HMBA 4I9RA 1BM5A 1SY3A 3VG5A 5AJBA 2ZAGA 5HZ5A 2JU7A 4L1NA 1HN2A 3JSQA 2FS6A 1VYGA 3BX8A 4WHIA 4YCEA 3I17A 4XMEA 2DM5A 2AT8X 3ZQ3A 3F9DA 3ZW0A 1X8OA 4XMDA 4N7CA 2OZQA 4ZH9A 5LJDA 4TKBA 3BX7A 1SA8A 1Z24A 5D8JA 1IKJA 3ZW1B 1ZNHA 3DSZA 1YP7A 1SY0A 1BEBA 4INNA 5LKFA 3GAQA 1E06A 3FW4A 1MVGA 1LNMA 4LKPA 1ML7A 1SXUA 2CM4A 1A18A 3MBTA 4IB8A 3CQRA 3APUA 1EALA 3WBGA 1ACDA 1SMPI 4MVLA 1AVGI 3FA7A 1QG5A 2CM9A 3VPJE 5D47A 5HA0A 4XMHA 4I3BA 2JOZA 3P24A 3B2HA 1EQDA 4QNIA 2WR6A 3D95A 2QO4A 4ORWA 1H91A 3OD9A 1BRPA 5BYPA 4GETA 2Z4IA 1I05A 2G78A 2E4JA 2IFBA 2WEXA 3EBWA 4TJZA 3RKGA 3UEWA 2OVDA 5EPQA 2RCQA 3FYFA 5FAZA 4COTA 5LJBA 1KT5A 1UREA 2CBRA 4LQZA 1A3YA 4HFOA 1QWDA 4I3DA 5LJEA 1G7NA 4AYHA 3WJBA 1S2PA 2LA7A 5L8OA 2G79A 1OEKA 4NW4A 1MDCA 4LKTA 5CE4A 2PY1A 4YKMA 3WJCA 1KZWA 4IB6A 4XMGA 1ZRYA 2Q2PA 1G74A 1BBPA 4O4SA 3VU1A 1AB0A 1GT3A 3STNA 3U03A 4TKJA 2F73A 4I95A 2R74A 2WSJA 4CSBA 4KCAA 2X8SA 2OVAA 4JGLA 1VPRA 4O4XA 3PECA 4IABA 4EDEA 1JV4A 2LBAA 5KICA 4YFQA 3VG3A 3Q6LA 3C76X 3CBSA 4O3XB 5L8IA 2Q39A 1KT4A 1DZJA 1YWDA 1FEMA 1SY1A 4AZPA 1GXAA 3WJGA 2EU7X 3UAQA 1S7DA 1R0UA 4QYPA 1Y9LA 3B2KA 4O3YA 3FELA 3D97A 1KT6A 2ACOA 4XMCA 2JU3A 3HWGA 5H9LA 4K19A 1BSYA 2LB6A 4BVMA 2GTLM 1GX8A 3TGCA 3NQ9A 3H3IA 5EEDA 4D6AA 3P6CA 5F6BA 1SY2A 1SXWA 1T8VA 4OMXA 4WBKA 2Q9SA 1BSQA 4O49A 4GNWA 1GKAA 4TKHA 2GJ5A 1TXLA 4WFVA 4Y0RA 2HZQA 4ORYA 1A57A 2AKQA 4OMWA 3WVMA 3BLGA 2N93A 1TOUA 1ZNKA 3ELXA 4IB7A 3S5XA 3KFGA 3E3CA 4RUNA 4AZRA 2FT9A 2FLJA 5HZQA 1ALBA 1HMRA 3FA9A 1GGLA 1HBQA 5HTDA 2CZUA 3NX1A 3P02A 1CBSA 4Y0PA 4EXZA 1L6MA 1JYJA 4I6SA 4OS8A 5DG4A 4MISA 1P6PA 3RZYA 2LFOA 3WJFA 1BWYA 1DFVA 4TNNA 5JR8A 1KZXA 4GK9A 4ORXA 3FR2A 1PM1X 5LJGA 2GTLN 4ARHA 2NNEA 4YKOA 3UEXA 1OBUA 1X8UA 4FGIB 2L68A 4IBAA 3APWA 5EDCA 1EPAA 2NNDA 4CV7A 1IW2A 1LKEA 3S5VA 3VG6A 1YIVA 3KFFA 3HK1A 1LIFA 4ML7B 4YBUA 1B4MA 4ZGUA 3KZAA 1PEEA 4NP1A 4GKCA 2QOSC 1VYFA 4GH7A 4O4OA 4RUUA 4HPAA 1QQSA 3NBXX 1MX7A 4GRJA 3AKMA 3UEUA 3MX7A 4OS0A 1SXYA 4CK4A 5B27A 2HNXA 2RQ0A 1AELA 1CBQA 3ZW1A 1OBQA 2MM3A 3FMZA 4M6SA 1GX9A 1HMTA 1ERBA 1N0SA 4R0BA 2F09A 2JMBA 1FDQA 3RSWA 1KT3A 5LJCA 4A1YA 2JN3A 1BSOA 3APVA 1NGLA 5EZ2A 5F1EA 1ADLA 4KT5A 3S60A 1JBHA 4U8UM 4ZGFA 1EIIA 3NX2A 4FQBB 2FR3A 3WOVA 2MJIA 1KQWA 1JJXA 3FR5A 2GC9A 5FFHA 5IO7A 4PSQA 1OPBA 5LJKA 1BLRA 2OVSA 2OFMX 4QYNA 1YUPA 2FTBA 4I9SA 3UEVA 4QGVA 3L4RA 3U0DA 1DF3A 4MVIA 4OS3A 5HAEA 4ZJ0A 2G7BA 2RD7C 4YBPA 4MVKA 3G7XA 1QFTA 3D4RA 1GM6A 2AL0X 3CWKA 4QRLA 1IIUA 3ZW0B 4LZUA 1CJ5A 1HQPA 4PJ2A 4ZHHA 2LKKA 2X46A 4GU8A 5F7GA 4GE1A 4NNSA 5F58A 2FR2A 1DC9A 5HA1A 5D45A 1LICA 1QABE 3P6EA 4U8UN 1U18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KT4 B;  4N7D A;  4AZM A;  2RCT A;  3ZUO A;  1X8Q A;  4ZHC A;  5EDB A;  3D96 A;  3ZUI A;  3O22 A;  5HTE A;  1GT4 A;  5IO6 A;  4IMN A;  3KFI A;  2BLG A;  4QGW A;  2FS7 A;  2QO6 A;  4A60 A;  3PPT A;  5H8T A;  4ZFX A;  1D2U A;  2XKL A;  5D4A A;  1NP4 A;  5FEN A;  4DQ4 A;  2AT6 X;  3B2L A;  3JS1 A;  4IAW A;  1HBP A;  5D48 A;  1I4U A;  1JYD A;  4QAE A;  5HCE C;  5KID A;  1X8P A;  2ACP X;  4M7M A;  2NNQ A;  2HYS A;  3TGA A;  3KQ0 A;  2KTD A;  1UZ2 X;  4QGX A;  4AZN A;  2QO5 A;  5BVS A;  4TQ2 A;  1E5P A;  4NLI A;  4YMY A;  1YP6 A;  1I06 A;  1KOI A;  1LFO A;  1U17 A;  2YG2 A;  3EM0 A;  3TF6 A;  5HZ8 A;  5AQ6 A;  1IFC A;  1S44 A;  3EBK A;  5H9K A;  2WEW A;  1MUP A;  4ORU A;  1GT5 A;  3BS2 A;  2A2G A;  2RA6 A;  1LID A;  1FEL A;  1I04 A;  5H9A A;  2JU8 A;  1LIB A;  4KII A;  3S26 A;  2AMM X;  1AQB A;  1OEE A;  4GNY A;  5B29 A;  4IB9 A;  5C0N A;  2K23 A;  1QY0 A;  3HWD A;  1KXO A;  4YDA A;  4YFR A;  3BY0 A;  1CRB A;  1EUO A;  2MO5 A;  3F8A A;  3STK A;  4AW8 A;  1B0O A;  3FIQ A;  5H9N A;  3P6F A;  1B8E A;  1EPB A;  2ASN X;  3IA8 A;  1KT7 A;  1G85 A;  2ANS A;  3NQ3 A;  1CBR A;  5BVQ A;  1DV9 A;  1FE3 A;  4ZHF A;  3PP6 A;  2A3F X;  3B2J A;  1GKA B;  1LF7 A;  4ALB A;  3I0A A;  1A2D A;  1HMS A;  4TLJ A;  2XST A;  4YH0 A;  4A8Z A;  2WUT A;  4IAX A;  1TW4 A;  5EEE A;  2L67 A;  4AZO A;  4IMO A;  3PH5 A;  3BSZ E;  4HPD A;  3FEP A;  1CBI A;  1EXS A;  5DPQ A;  5HBS A;  2AT5 X;  1JJJ A;  1X71 A;  2LBV A;  2WWP A;  3STM X;  5HCD C;  1FEN A;  2ALL X;  2P8G A;  1EIO A;  1G5W A;  2X45 A;  3TGB A;  3NR3 A;  3PH6 A;  2Q4N A;  3O19 A;  1SXX A;  4ZCB A;  1LIE A;  2WQ9 A;  3C77 X;  1DZM A;  5IO5 A;  1NP1 A;  2POA A;  3BU1 A;  4D6B A;  2NP1 A;  3EMM A;  2CZT A;  4A1H A;  4I3C A;  4BOE A;  1ERX A;  4YGZ A;  2AT0 X;  1ZNL A;  4YCH A;  3U9P C;  3B2I A;  3KFH A;  1X8N A;  3NPO A;  3NAD A;  3CQN A;  1RLB E;  1YWB A;  4XMF A;  3CBC A;  1TOW A;  2GTF X;  4DQ3 A;  1ZND A;  4HPC A;  3FW5 A;  1QY2 A;  3O2Y A;  2OVE A;  3NP1 A;  4ZR2 A;  5BVT A;  3WXQ A;  3HWF A;  2W2F A;  1OPA A;  1XCA A;  2AH7 X;  1OEJ A;  4WFU A;  4Y0Q A;  3HWE A;  1DZK A;  1BJ7 A;  5LJH A;  1GT1 A;  1IKE A;  5HZ6 A;  3AKN A;  4YGG A;  4UU3 A;  3QKG A;  3BU9 A;  4ORR A;  1LPJ A;  3VG2 A;  4NNT A;  4ES7 A;  1QY1 A;  1B56 A;  4QZU A;  4ZHD A;  4LZV A;  1O1U A;  3P6H A;  1ZNE A;  1XKI A;  2L9C A;  5L8N A;  5HWZ A;  2FWV A;  3BRN A;  3CR6 A;  4ORS A;  5KHP A;  1X89 A;  3FLL A;  2A2U A;  3FA6 A;  2OFR X;  5F6Z A;  3FR4 A;  3FEN A;  3P6D A;  1MX8 A;  5K06 A;  1BRQ A;  3ELZ A;  3P6G A;  4UU2 A;  1T0V A;  2R73 A;  4NYR A;  2A0A A;  1YWC A;  1PBO A;  1U0X A;  4BQU A;  3MVF A;  4YGH A;  4ZHG A;  1KQX A;  1IFB A;  2HZR A;  1O1V A;  3SAO A;  2K62 A;  3WJD A;  1ZNG A;  2WQA E;  2HLV A;  1ICM A;  1DZP A;  1QFV A;  1T68 X;  3APX A;  4YDB A;  4NLJ A;  4O9S A;  1EW3 A;  1TVQ A;  4ODD A;  5HZ9 A;  3VG7 A;  1FTP A;  1JZU A;  3DTQ A;  2O62 A;  1KGL A;  2W2A A;  1O8V A;  2QM9 A;  3FEK A;  5HCC C;  1PMP A;  3FA8 A;  3TZS A;  4HPB A;  1ICN A;  2A13 A;  3PED A;  3VG4 A;  3OJY C;  4ZH6 A;  2AT3 X;  1E00 A;  3BDR A;  1E02 A;  2FRS A;  4EFG A;  4Y0S A;  4AZQ A;  2Q2M A;  2R56 A;  4YFP A;  4QZT A;  3CMP A;  4NYQ A;  5LKE A;  1YWA A;  2CBS A;  4ALO A;  1RBP A;  2L5P A;  3EYC A;  4EEJ A;  2W2B A;  3K3L A;  3WJE A;  1OBP A;  1D3S A;  3T1D A;  3C78 X;  3IFB A;  4I9R A;  2HMB A;  1BM5 A;  1SY3 A;  3VG5 A;  5HZ5 A;  2JU7 A;  1HN2 A;  3JSQ A;  2FS6 A;  1VYG A;  3BX8 A;  4YCE A;  3I17 A;  4XME A;  2DM5 A;  2AT8 X;  3ZQ3 A;  3F9D A;  1X8O A;  4XMD A;  4N7C A;  2OZQ A;  4ZH9 A;  5LJD A;  4TKB A;  3BX7 A;  1SA8 A;  1Z24 A;  5D8J A;  1IKJ A;  1ZNH A;  3DSZ A;  1YP7 A;  1SY0 A;  1BEB A;  5LKF A;  3GAQ A;  1E06 A;  3FW4 A;  1MVG A;  1LNM A;  4LKP A;  1ML7 A;  1SXU A;  2CM4 A;  1A18 A;  3MBT A;  4IB8 A;  3CQR A;  3APU A;  1EAL A;  3WBG A;  1ACD A;  4MVL A;  1AVG I;  3FA7 A;  1QG5 A;  2CM9 A;  5D47 A;  5HA0 A;  4XMH A;  4I3B A;  2JOZ A;  3B2H A;  1EQD A;  2WR6 A;  3D95 A;  2QO4 A;  4ORW A;  1H91 A;  1BRP A;  4GET A;  1I05 A;  2G78 A;  2E4J A;  2IFB A;  2WEX A;  3EBW A;  4TJZ A;  3UEW A;  2OVD A;  5EPQ A;  2RCQ A;  5FAZ A;  5LJB A;  1KT5 A;  1URE A;  2CBR A;  1A3Y A;  4HFO A;  1QWD A;  4I3D A;  5LJE A;  1G7N A;  4AYH A;  3WJB A;  1S2P A;  5L8O A;  2G79 A;  1OEK A;  1MDC A;  4LKT A;  5CE4 A;  2PY1 A;  4YKM A;  3WJC A;  1KZW A;  4IB6 A;  4XMG A;  1ZRY A;  2Q2P A;  1G74 A;  1BBP A;  1AB0 A;  1GT3 A;  3STN A;  3U03 A;  4TKJ A;  2F73 A;  2R74 A;  2WSJ A;  2OVA A;  1VPR A;  3PEC A;  4EDE A;  1JV4 A;  2LBA A;  5KIC A;  4YFQ A;  3VG3 A;  3Q6L A;  3C76 X;  3CBS A;  5L8I A;  2Q39 A;  1KT4 A;  1DZJ A;  1YWD A;  1FEM A;  1SY1 A;  4AZP A;  1GXA A;  3WJG A;  2EU7 X;  1S7D A;  1R0U A;  4QYP A;  3B2K A;  3FEL A;  3D97 A;  1KT6 A;  2ACO A;  4XMC A;  2JU3 A;  3HWG A;  5H9L A;  4K19 A;  1BSY A;  2LB6 A;  4BVM A;  1GX8 A;  3TGC A;  3NQ9 A;  5EED A;  4D6A A;  3P6C A;  5F6B A;  1SY2 A;  1SXW A;  1T8V A;  4OMX A;  4WBK A;  2Q9S A;  1BSQ A;  4GNW A;  1GKA A;  4TKH A;  2GJ5 A;  1TXL A;  4WFV A;  4Y0R A;  2HZQ A;  4ORY A;  1A57 A;  2AKQ A;  4OMW A;  3WVM A;  3BLG A;  2N93 A;  1TOU A;  1ZNK A;  3ELX A;  4IB7 A;  3KFG A;  4RUN A;  4AZR A;  2FT9 A;  2FLJ A;  5HZQ A;  1ALB A;  1HMR A;  3FA9 A;  1GGL A;  1HBQ A;  5HTD A;  2CZU A;  3NX1 A;  4Y0P A;  1CBS A;  4EXZ A;  1L6M A;  1JYJ A;  4OS8 A;  5DG4 A;  1P6P A;  3RZY A;  2LFO A;  3WJF A;  1BWY A;  1DFV A;  4TNN A;  5JR8 A;  1KZX A;  4ORX A;  3FR2 A;  1PM1 X;  5LJG A;  4ARH A;  2NNE A;  4YKO A;  3UEX A;  1OBU A;  1X8U A;  2L68 A;  4IBA A;  3APW A;  5EDC A;  1EPA A;  2NND A;  1IW2 A;  1LKE A;  3VG6 A;  1YIV A;  3KFF A;  3HK1 A;  1LIF A;  4YBU A;  1B4M A;  4ZGU A;  3KZA A;  1PEE A;  4NP1 A;  4GKC A;  2QOS C;  1VYF A;  4GH7 A;  4RUU A;  4HPA A;  1QQS A;  1MX7 A;  4GRJ A;  3AKM A;  3UEU A;  4OS0 A;  1SXY A;  4CK4 A;  5B27 A;  2HNX A;  2RQ0 A;  1AEL A;  1CBQ A;  1OBQ A;  2MM3 A;  3FMZ A;  4M6S A;  1GX9 A;  1HMT A;  1ERB A;  1N0S A;  4R0B A;  1FDQ A;  3RSW A;  1KT3 A;  5LJC A;  4A1Y A;  2JN3 A;  1BSO A;  3APV A;  1NGL A;  5EZ2 A;  5F1E A;  1ADL A;  1JBH A;  1EII A;  3NX2 A;  2FR3 A;  2MJI A;  1KQW A;  1JJX A;  3FR5 A;  2GC9 A;  5FFH A;  5IO7 A;  4PSQ A;  1OPB A;  5LJK A;  1BLR A;  2OFM X;  4QYN A;  1YUP A;  2FTB A;  4I9S A;  3UEV A;  4QGV A;  3L4R A;  3U0D A;  1DF3 A;  4MVI A;  4OS3 A;  5HAE A;  4ZJ0 A;  2G7B A;  2RD7 C;  4YBP A;  4MVK A;  3G7X A;  1QFT A;  1GM6 A;  2AL0 X;  3CWK A;  1IIU A;  4LZU A;  1CJ5 A;  1HQP A;  4ZHH A;  2LKK A;  2X46 A;  5F7G A;  4GE1 A;  4NNS A;  5F58 A;  2FR2 A;  1DC9 A;  5HA1 A;  5D45 A;  1LIC A;  1QAB E;  3P6E A;  1U18 A; 
#chains in the Genus database with same CATH topology
 2VFB A;  3VE1 A;  3JQO A;  2KT4 B;  4N7D A;  2I5V O;  3Q34 A;  1MOY A;  2RCT A;  2RTO B;  4QQ1 A;  3SLT A;  4AZM A;  3ZUO A;  1X8Q A;  4ZHC A;  1EI5 A;  1LUQ A;  5EDB A;  3D96 A;  3ZUI A;  1Y9T A;  3O22 A;  2IZB A;  1GT4 A;  5HTE A;  3PQS A;  3ZWE A;  4IMN A;  4CPH A;  5IO6 A;  3KFI A;  2BLG A;  3HOL A;  4QGW A;  2FS7 A;  2QO6 A;  1RSU B;  3PPT A;  5H8T A;  4A60 A;  4ZFX A;  1D2U A;  2XKL A;  5D4A A;  1NP4 A;  4GJS A;  4ID2 A;  4NV8 A;  2RTM A;  2ZAI A;  5FEN A;  4DQ4 A;  2AT6 X;  3B2L A;  3JS1 A;  4IAW A;  5FQ7 E;  1HBP A;  5D48 A;  1I4U A;  1JYD A;  4QAE A;  1LCV A;  4KH8 A;  1DF8 A;  3LHN A;  1X8P A;  5HCE C;  3VHI A;  4YVB A;  5KID A;  1JMZ A;  2ACP X;  4M7M A;  2NNQ A;  2HYS A;  3TGA A;  4Z2P A;  3KQ0 A;  2KTD A;  1UZ2 X;  2QMI A;  4QGX A;  4AZN A;  2QO5 A;  5BVS A;  4TQ2 A;  3WZO A;  1N7Y A;  2BS5 A;  1E5P A;  3AUM O;  4NLI A;  4YMY A;  1SLF B;  1I06 A;  1YP6 A;  2BS6 A;  1KOI A;  1LFO A;  1U17 A;  2Y32 A;  2YG2 A;  3EM0 A;  4U3Q A;  3TF6 A;  5AQ6 A;  1IFC A;  1S44 A;  3EBK A;  4GZV A;  5H9K A;  4NV7 A;  1VWF B;  1SRG A;  2WEW A;  1MUP A;  4ORU A;  1VWK B;  1GT5 A;  3BS2 A;  2A2G A;  2MHD A;  4Z6J A;  2RA6 A;  1LID A;  1FEL A;  1I04 A;  3CKG A;  5H9A A;  2JU8 A;  3HTY A;  1LIB A;  1SWE A;  4KII A;  5AJC A;  2X8T A;  3S26 A;  1WBI A;  2AMM X;  2GTL O;  2RTF B;  4GUZ A;  4JO6 A;  1AQB A;  1OEE A;  4GNY A;  3ZZV A;  5B29 A;  2IZD B;  4IB9 A;  1SWT A;  5C0N A;  3WYP A;  2RTI B;  2K23 A;  1QY0 A;  4GDZ A;  2HKD A;  1KXO A;  3HWD A;  2IZC B;  4YDA A;  3T2X A;  4YFR A;  3BY0 A;  2YMS A;  1CRB A;  1EUO A;  2RTJ A;  2MO5 A;  3F8A A;  4U9C A;  1VWH B;  3STK A;  1B0O A;  4AW8 A;  3FIQ A;  5H9N A;  3P6F A;  1B8E A;  4OKA A;  1EPB A;  2ASN X;  3IA8 A;  1KT7 A;  2AF5 A;  1G85 A;  2ANS A;  3NQ3 A;  1CBR A;  4MEE A;  5BVQ A;  3SZI A;  2RTD B;  1FE3 A;  4CDF A;  1DV9 A;  4ZHF A;  3PP6 A;  2A3F X;  3B2J A;  2X34 A;  1RXK A;  1GKA B;  1W4T A;  2G8C O;  2Z4H A;  1LF7 A;  4ALB A;  3I0A A;  2M4L A;  4O4U A;  3ZI8 A;  1A2D A;  4CPF A;  3RDU A;  1HMS A;  4Z2V A;  4TLJ A;  2XST A;  4DCB A;  2IZE B;  2KTS A;  4YH0 A;  4A8Z A;  2WUT A;  4IAX A;  2A5C A;  1TW4 A;  2RN4 A;  2L67 A;  4HWM A;  5EEE A;  4AZO A;  4IMO A;  3PH5 A;  4GGR A;  1SRF A;  4KC7 A;  3BSZ E;  4HPD A;  5CYB A;  3FEP A;  3WYQ A;  1CBI A;  1EXS A;  1STS B;  5DPQ A;  5HBS A;  4BX7 B;  2AT5 X;  1JJJ A;  1X71 A;  2X8F A;  2WWP A;  2LBV A;  1DF3 A;  3STM X;  5HCD C;  1SRJ A;  1FEN A;  2ALL X;  2P8G A;  1EIO A;  3OE3 A;  1G5W A;  2X45 A;  3TGB A;  3NR3 A;  3PH6 A;  2Q4N A;  2JW1 A;  3O19 A;  1SXX A;  1VWM B;  1IJ8 A;  1LIE A;  2WQ9 A;  3C77 X;  4L3R A;  4ZCB A;  3HOE A;  4JNJ A;  1VWP B;  4DNE A;  2G5L A;  1DZM A;  2RTH B;  1JMX A;  1NP1 A;  2POA A;  5IO5 A;  1VWJ B;  3RDQ A;  3BU1 A;  4D6B A;  2NP1 A;  2OF8 A;  3EMM A;  1NQN A;  2CZT A;  2X56 A;  4A1H A;  4I3C A;  4BOE A;  1ERX A;  4YGZ A;  2AT0 X;  1ZNL A;  4YCH A;  3U9P C;  2BT9 A;  3B2I A;  3KFH A;  3RWX A;  1X8N A;  3NQK A;  3NPO A;  3NAD A;  3CQN A;  1RXH A;  2PI3 O;  1RLB E;  1YWB A;  4XMF A;  1PTS A;  2RTG B;  1Y53 X;  3CBC A;  3F6Z B;  1TOW A;  2GTF X;  5B2A O;  2UZ2 A;  2JGS A;  1ZND A;  4MVE A;  3WZP A;  4DQ3 A;  4HPC A;  3CKF A;  1QY2 A;  3FW5 A;  4O3Z A;  3O2Y A;  2OVE A;  3NP1 A;  5CSE A;  1Y52 X;  4ZR2 A;  5BVT A;  3WXQ A;  3HWF A;  4U8U O;  4IRW A;  2W2F A;  1OPA A;  1NBX A;  1XCA A;  2AH7 X;  1OEJ A;  5CHK A;  4WFU A;  4Y0Q A;  5K68 A;  3HWE A;  1DZK A;  3N91 A;  5HZ8 A;  1BJ7 A;  3RY2 A;  5LJH A;  1GT1 A;  4MIR A;  1IKE A;  3SOT A;  5HZ6 A;  3AKN A;  4YGG A;  5FQ8 E;  5L3Y A;  4UU3 A;  3QKG A;  3BU9 A;  2BC3 A;  2MWH A;  1LPJ A;  1SWP A;  4ORR A;  3VG2 A;  3FDC A;  5FQ6 E;  5B11 O;  3RE5 A;  4NNT A;  4ES7 A;  1LDO A;  1VWQ B;  1VWC B;  1QY1 A;  1B56 A;  4QZU A;  4ZHD A;  4LZV A;  5JD2 A;  2IZH B;  1O1U A;  3P6H A;  1ZNE A;  1XKI A;  2L9C A;  5L8N A;  5HWZ A;  3MG5 A;  2IZF B;  3WZQ A;  4OEM A;  2FWV A;  3BRN A;  3CR6 A;  4ORS A;  5KHP A;  1GX3 A;  1HXL A;  1X89 A;  3HPE A;  3FLL A;  3D9W A;  1N9Y A;  2A2U A;  3FA6 A;  2OFR X;  5F6Z A;  1VWL B;  3FR4 A;  3FEN A;  3P6D A;  1MX8 A;  2IZA A;  4O3W A;  5K06 A;  1BRQ A;  3ELZ A;  3P6G A;  4UU2 A;  4EQA C;  1STR B;  1T0V A;  2R73 A;  4NYR A;  1JIW I;  2A0A A;  3VE2 A;  1YWC A;  1VWN B;  1PBO A;  1FJ1 E;  1U0X A;  4BQU A;  1KL3 A;  4C5P A;  3LV4 A;  4FBO A;  3MVF A;  4YGH A;  4BX6 B;  3RBY A;  4ZHG A;  1KQX A;  1IFB A;  2HZR A;  1O1V A;  1LCW A;  3OBL A;  1HQQ A;  2K62 A;  3SAO A;  3VGW A;  3WJD A;  4BX5 A;  1ZNG A;  1Y55 X;  2WQA E;  2FHN X;  3T6L A;  2HLV A;  2KD2 A;  1ICM A;  1W5R A;  1DZP A;  1QFV A;  1T68 X;  3APX A;  4YDB A;  4NLJ A;  4O9S A;  1EW3 A;  1MEP A;  1TVQ A;  4ODD A;  5HZ9 A;  3VG7 A;  1FTP A;  2CAM A;  1JZU A;  2IZJ A;  4ON1 A;  3DTQ A;  2O62 A;  3T2W A;  2VFC A;  2RTN B;  4KC8 A;  1KGL A;  4FBR A;  2W2A A;  1O8V A;  2AVI A;  4CPH B;  1SWG A;  2QM9 A;  3FEK A;  5HCC C;  1PMP A;  3ZW2 A;  3FA8 A;  3TZS A;  3RDO A;  4HPB A;  1ICN A;  2OY1 O;  2KW1 A;  1AVE A;  3RE6 A;  2BHV A;  3SZJ A;  2A13 A;  3PED A;  3VG4 A;  1WUB A;  4BCS A;  3OJY C;  1SWB A;  4ZH6 A;  3V8U A;  1SWU A;  2AT3 X;  1E00 A;  3BDR A;  1E02 A;  2FRS A;  4EFG A;  4Y0S A;  4AZQ A;  3GE2 A;  3PK2 A;  1NDJ A;  1AVD A;  2Q2M A;  2R56 A;  4YFP A;  1SRH A;  5AEO A;  4QZT A;  2C1Q A;  3CMP A;  1SLG B;  4NYQ A;  4GJV A;  1YWA A;  5LKE A;  2CBS A;  4JHQ A;  4ALO A;  1RBP A;  2RTQ B;  2L5P A;  3EYC A;  4GGZ A;  4EEJ A;  2W2B A;  2FKG A;  3K3L A;  3SLJ A;  3WJE A;  1OBP A;  1D3S A;  4FBV A;  3T1D A;  4I60 A;  3SZH A;  3C78 X;  3IFB A;  3PQU A;  2HMB A;  4I9R A;  1BM5 A;  1SY3 A;  2RTA A;  5AJB A;  2ZAG A;  3VG5 A;  2JU7 A;  5HZ5 A;  4L1N A;  1HN2 A;  3JSQ A;  2FS6 A;  1I9H A;  1NQM A;  1VYG A;  3BX8 A;  4WHI A;  4YCE A;  3RDX A;  3I17 A;  4XME A;  4GD9 A;  1OSP O;  2DM5 A;  2AT8 X;  3ZQ3 A;  3RDM A;  3F9D A;  3ZW0 A;  1X8O A;  2RTE B;  4XMD A;  2ZSC A;  4N7C A;  2OZQ A;  4ZH9 A;  5LJD A;  2X32 A;  4TKB A;  3BX7 A;  5IRU A;  1SA8 A;  1NC9 A;  1Z24 A;  3QQ2 A;  5D8J A;  1IKJ A;  3ZW1 B;  1ZNH A;  3DSZ A;  1YP7 A;  1SY0 A;  1BEB A;  4INN A;  5LKF A;  1LEL A;  3GAQ A;  1E06 A;  3FW4 A;  1MVG A;  1LNM A;  4LKP A;  1ML7 A;  1SXU A;  4Z2O A;  2CM4 A;  5IXG A;  1A18 A;  2OYB O;  5K67 A;  2RTB B;  2OL6 O;  3MBT A;  4IB8 A;  1VWA B;  1RST B;  2Y3F A;  2OL8 O;  3APU A;  3CQR A;  1EAL A;  1SWH A;  3WBG A;  1ACD A;  1SMP I;  4MVL A;  1AVG I;  1SWK A;  2FGS A;  3FA7 A;  1QG5 A;  1STP A;  4BJ8 A;  2CM9 A;  3UEW A;  1VWI B;  3VPJ E;  3WZN A;  5D47 A;  1N9M A;  5HA0 A;  2DJF A;  5B10 O;  4XMH A;  4I3B A;  5B3M O;  2JOZ A;  3P24 A;  3B2H A;  1EQD A;  1KFF A;  1LDQ A;  2WR6 A;  3D95 A;  4QNI A;  2QO4 A;  5IRW A;  1KL5 A;  1H91 A;  3OD9 A;  1BRP A;  4ORW A;  1SLE B;  4GET A;  2Z4I A;  5BYP A;  1I05 A;  1SRE A;  2G78 A;  2E4J A;  2IFB A;  2WEX A;  3EBW A;  4TJZ A;  1SWC A;  3RKG A;  2OVD A;  2X4M A;  2RCQ A;  3FYF A;  5EPQ A;  5FAZ A;  4COT A;  5LJB A;  2RTP B;  1KT5 A;  1URE A;  1VWO B;  2CBR A;  4LQZ A;  3EW1 A;  2IZK A;  1A3Y A;  4HFO A;  1UYN X;  1QWD A;  4I3D A;  3AEH A;  5LJE A;  1G7N A;  4AYH A;  3WJB A;  1S2P A;  2LA7 A;  5L8O A;  2G79 A;  1OEK A;  4NW4 A;  1MDC A;  4LKT A;  4BGF A;  5CE4 A;  2PY1 A;  2RTL A;  4YKM A;  3WJC A;  1KZW A;  3FID A;  2A5B A;  4IB6 A;  4XMG A;  1ZRY A;  2Q2P A;  1G74 A;  1BBP A;  4O4S A;  3VU1 A;  4B55 A;  1AB0 A;  1GT3 A;  2QCB A;  3STN A;  3U03 A;  2OY5 O;  1UYO X;  4TKJ A;  2F73 A;  4I95 A;  2R74 A;  2WSJ A;  4CSB A;  1SWN A;  2F01 A;  2WPU A;  4KCA A;  2X8S A;  2A8G A;  1PBY A;  3MM0 A;  2OVA A;  1SWA A;  4JGL A;  1E2T A;  1VPR A;  2DJG A;  3PEC A;  4IAB A;  4O4X A;  4EDE A;  1JV4 A;  2LBA A;  5KIC A;  4YFQ A;  2OF9 A;  2C1S A;  3VG3 A;  3Q6L A;  3C76 X;  3CBS A;  4O3X B;  1SWR A;  1I78 A;  2OFB A;  5L8I A;  5B5G A;  2Q39 A;  1RAV A;  3RDS A;  1KT4 A;  1DZJ A;  1YWD A;  1FEM A;  1SY1 A;  4AZP A;  1GXA A;  3WJG A;  2EU7 X;  3UAQ A;  3X00 A;  1S7D A;  1R0U A;  4QYP A;  1Y9L A;  3B2K A;  4O3Y A;  3FEL A;  3D97 A;  4CDD A;  1KT6 A;  2ACO A;  4XMC A;  2JU3 A;  2QOM A;  3HWG A;  5H9L A;  3SLO A;  4K19 A;  1BSY A;  2LB6 A;  4BVM A;  2GTL M;  1GX8 A;  3TGC A;  1SWF A;  3NQ9 A;  1HXZ A;  3H3I A;  5EED A;  3VHH A;  4D6A A;  3P6C A;  5F6B A;  4Z27 A;  1SY2 A;  1SXW A;  1T8V A;  4OMX A;  2IZL B;  4WBK A;  2Q9S A;  1BSQ A;  4O49 A;  4GNW A;  1GKA A;  1MM9 A;  4TKH A;  2GJ5 A;  1VWG B;  1TXL A;  4WFV A;  4Y0R A;  5B5F A;  2HZQ A;  4ORY A;  1A57 A;  2AKQ A;  4OMW A;  3WVM A;  1N4J A;  3BLG A;  2N93 A;  1TOU A;  1ZNK A;  3ELX A;  4IB7 A;  3S5X A;  3KFG A;  3E3C A;  4RUN A;  4AZR A;  2C4I A;  4OEL A;  2MF6 A;  2FT9 A;  1KL4 A;  2FLJ A;  5HZQ A;  1ALB A;  1HMR A;  3FA9 A;  1GGL A;  1SWO A;  4BX7 A;  2RTC B;  1HBQ A;  5HTD A;  2CZU A;  3NX1 A;  1SRI A;  1CBS A;  3P02 A;  4Y0P A;  1L6M A;  4EXZ A;  1JYJ A;  4I6S A;  4OS8 A;  5DG4 A;  2OFA A;  1P6P A;  1K24 A;  4MIS A;  3RZY A;  2LFO A;  4Y59 A;  3WJF A;  1BWY A;  1SWJ A;  1DFV A;  4TNN A;  5JR8 A;  1KZX A;  4GK9 A;  4ORX A;  3FR2 A;  1PM1 X;  2X55 A;  5LJG A;  2GTL N;  4ARH A;  4Z28 A;  4GDA A;  2NNE A;  4YKO A;  3UEX A;  1OBU A;  1X8U A;  4FGI B;  1HY2 A;  2L68 A;  4IBA A;  5IRA A;  3APW A;  2VDF A;  5EDC A;  1EPA A;  2NND A;  4CV7 A;  1IW2 A;  1LKE A;  3S5V A;  1VWD B;  2OY8 A;  1YIV A;  3VG6 A;  4BX5 B;  3KFF A;  3RY1 A;  3HK1 A;  1LIF A;  4ML7 B;  4YBU A;  1VWE B;  1B4M A;  4ZGU A;  3KZA A;  1SLD B;  1PEE A;  2I5Z O;  2FHL A;  4CDC A;  4NP1 A;  4GGT A;  4GKC A;  3VHM A;  2QOS C;  1VYF A;  4GH7 A;  4O4O A;  4RUU A;  1JQP A;  1QQS A;  4HPA A;  3NBX X;  1K3B A;  1MX7 A;  4GRJ A;  4EKV A;  3AKM A;  3KVN A;  3UEU A;  3EC5 A;  2FKJ A;  3MX7 A;  3EW2 A;  4OS0 A;  1SXY A;  1VWR B;  4CK4 A;  4CPI A;  5B27 A;  2HNX A;  1SWQ A;  1LCZ A;  2RQ0 A;  1AEL A;  1CBQ A;  2IZI A;  1OBQ A;  2OY7 A;  3ZW1 A;  2MM3 A;  3FMZ A;  4M6S A;  1GX9 A;  1HMT A;  1ERB A;  1N0S A;  1N43 A;  4R0B A;  2IZG B;  2F09 A;  2JMB A;  1FDQ A;  3RSW A;  1KT3 A;  5LJC A;  1VYO A;  4A1Y A;  3T6F A;  2JN3 A;  1BSO A;  3APV A;  1NGL A;  2Y3E A;  5EZ2 A;  5F1E A;  1ADL A;  4KT5 A;  3S60 A;  1JBH A;  4U8U M;  2UYW A;  4ZGF A;  1SWS A;  1EII A;  3NX2 A;  4FQB B;  2FR3 A;  3WOV A;  2MJI A;  1KQW A;  3PDF A;  1SWD A;  1JJX A;  3FR5 A;  2GC9 A;  3LTW A;  4U46 A;  5FFH A;  5IO7 A;  4PSQ A;  1OPB A;  4Y5D A;  4CPE A;  2OVS A;  2OFM X;  5LJK A;  4QYN A;  1BLR A;  1YUP A;  2FTB A;  4I9S A;  3UEV A;  4QGV A;  3L4R A;  3U0D A;  1W6F A;  2GH7 A;  4MVI A;  4CDE A;  4OS3 A;  5HAE A;  1MK5 A;  4ZJ0 A;  2G7B A;  2RD7 C;  4YBP A;  4BBO A;  4MVK A;  3G7X A;  1QFT A;  3D4R A;  1GM6 A;  2AL0 X;  2BSZ A;  1RXJ A;  2RTR B;  3CWK A;  4QRL A;  1IIU A;  3ZW0 B;  4LZU A;  1CJ5 A;  1HQP A;  4PJ2 A;  1SWL A;  4BX6 A;  4ZHH A;  2LKK A;  2OL7 A;  5F2B A;  2X46 A;  4GU8 A;  1Y0G A;  5F7G A;  4GE1 A;  4NNS A;  1VWB B;  2FR2 A;  1DC9 A;  2RTK A;  5F58 A;  5D45 A;  5HA1 A;  1LIC A;  1QAB E;  3P6E A;  4U8U N;  1JJU A;  1U18 A; 
#chains in the Genus database with same CATH homology
 3VE1 A;  3JQO A;  2KT4 B;  4N7D A;  4AZM A;  2RCT A;  4QQ1 A;  3ZUO A;  1X8Q A;  4ZHC A;  1EI5 A;  5EDB A;  3D96 A;  3ZUI A;  1Y9T A;  3O22 A;  5HTE A;  1GT4 A;  3ZWE A;  3PQS A;  5IO6 A;  4IMN A;  3KFI A;  2BLG A;  3HOL A;  4QGW A;  2FS7 A;  2QO6 A;  4A60 A;  3PPT A;  5H8T A;  4ZFX A;  1D2U A;  2XKL A;  5D4A A;  1NP4 A;  4ID2 A;  2ZAI A;  5FEN A;  4DQ4 A;  2AT6 X;  3B2L A;  3JS1 A;  4IAW A;  5FQ7 E;  1HBP A;  5D48 A;  1I4U A;  1JYD A;  4QAE A;  4KH8 A;  5HCE C;  3LHN A;  1X8P A;  5KID A;  2ACP X;  4M7M A;  2NNQ A;  2HYS A;  3TGA A;  3KQ0 A;  2KTD A;  1UZ2 X;  2QMI A;  4QGX A;  4AZN A;  2QO5 A;  5BVS A;  4TQ2 A;  2BS5 A;  1E5P A;  4NLI A;  4YMY A;  1YP6 A;  1I06 A;  2BS6 A;  4U3Q A;  1KOI A;  1LFO A;  1U17 A;  2YG2 A;  3EM0 A;  3TF6 A;  5HZ8 A;  5AQ6 A;  1IFC A;  1S44 A;  3EBK A;  4GZV A;  5H9K A;  2WEW A;  1MUP A;  4ORU A;  1GT5 A;  3BS2 A;  2A2G A;  2MHD A;  2RA6 A;  1LID A;  1FEL A;  1I04 A;  5H9A A;  2JU8 A;  3HTY A;  1LIB A;  4KII A;  5AJC A;  2X8T A;  3S26 A;  2AMM X;  2GTL O;  1AQB A;  1OEE A;  4GNY A;  3ZZV A;  5B29 A;  4IB9 A;  5C0N A;  2K23 A;  1QY0 A;  4GDZ A;  3HWD A;  1KXO A;  4YDA A;  4YFR A;  3BY0 A;  2YMS A;  1CRB A;  1EUO A;  2MO5 A;  3F8A A;  4U9C A;  3STK A;  4AW8 A;  1B0O A;  3FIQ A;  5H9N A;  3P6F A;  1B8E A;  1EPB A;  2ASN X;  3IA8 A;  1KT7 A;  1G85 A;  2ANS A;  3NQ3 A;  1CBR A;  5BVQ A;  1DV9 A;  1FE3 A;  4ZHF A;  3PP6 A;  2A3F X;  3B2J A;  1GKA B;  2Z4H A;  1LF7 A;  4ALB A;  3I0A A;  2M4L A;  4O4U A;  3ZI8 A;  1A2D A;  1HMS A;  4TLJ A;  2XST A;  2KTS A;  4YH0 A;  4A8Z A;  2WUT A;  4IAX A;  1TW4 A;  2RN4 A;  2L67 A;  4HWM A;  5EEE A;  4AZO A;  4IMO A;  3PH5 A;  4KC7 A;  3BSZ E;  4HPD A;  5CYB A;  3FEP A;  1CBI A;  1EXS A;  5DPQ A;  5HBS A;  2AT5 X;  1JJJ A;  1X71 A;  2X8F A;  2WWP A;  2LBV A;  3STM X;  5HCD C;  1FEN A;  2ALL X;  2P8G A;  1EIO A;  3OE3 A;  1G5W A;  2X45 A;  3TGB A;  3NR3 A;  3PH6 A;  2Q4N A;  2JW1 A;  3O19 A;  1SXX A;  4L3R A;  1LIE A;  2WQ9 A;  3C77 X;  4ZCB A;  3HOE A;  1DZM A;  5IO5 A;  1NP1 A;  2POA A;  3BU1 A;  4D6B A;  2NP1 A;  3EMM A;  2CZT A;  4A1H A;  4I3C A;  4BOE A;  1ERX A;  4YGZ A;  2AT0 X;  1ZNL A;  4YCH A;  3U9P C;  2BT9 A;  3B2I A;  3KFH A;  3RWX A;  1X8N A;  3NQK A;  3NPO A;  3NAD A;  3CQN A;  1RLB E;  1YWB A;  4XMF A;  3CBC A;  3F6Z B;  1TOW A;  2GTF X;  4DQ3 A;  1ZND A;  4MVE A;  4HPC A;  3FW5 A;  1QY2 A;  4O3Z A;  3O2Y A;  2OVE A;  3NP1 A;  4ZR2 A;  5BVT A;  3WXQ A;  3HWF A;  4U8U O;  2W2F A;  1OPA A;  1XCA A;  2AH7 X;  1OEJ A;  4WFU A;  4Y0Q A;  3HWE A;  1DZK A;  3N91 A;  1BJ7 A;  5LJH A;  1GT1 A;  4MIR A;  1IKE A;  3SOT A;  5HZ6 A;  3AKN A;  4YGG A;  5FQ8 E;  4UU3 A;  3QKG A;  3BU9 A;  4ORR A;  2MWH A;  1LPJ A;  3VG2 A;  5FQ6 E;  4NNT A;  4ES7 A;  1QY1 A;  1B56 A;  4QZU A;  4ZHD A;  4LZV A;  1O1U A;  3P6H A;  1ZNE A;  1XKI A;  2L9C A;  5L8N A;  5HWZ A;  2FWV A;  3BRN A;  3CR6 A;  4ORS A;  5KHP A;  1X89 A;  3FLL A;  2A2U A;  3FA6 A;  2OFR X;  5F6Z A;  3FR4 A;  3FEN A;  3P6D A;  1MX8 A;  4O3W A;  5K06 A;  1BRQ A;  3ELZ A;  3P6G A;  4UU2 A;  4EQA C;  1T0V A;  2R73 A;  4NYR A;  1JIW I;  2A0A A;  3VE2 A;  1YWC A;  1PBO A;  1U0X A;  4BQU A;  3LV4 A;  4FBO A;  3MVF A;  4YGH A;  3RBY A;  4ZHG A;  1KQX A;  1IFB A;  2HZR A;  1O1V A;  3OBL A;  3SAO A;  2K62 A;  3WJD A;  1ZNG A;  2WQA E;  2HLV A;  2KD2 A;  1ICM A;  1DZP A;  1QFV A;  1T68 X;  3APX A;  4YDB A;  4NLJ A;  4O9S A;  1EW3 A;  1TVQ A;  4ODD A;  5HZ9 A;  3VG7 A;  1FTP A;  1JZU A;  4ON1 A;  3DTQ A;  2O62 A;  4KC8 A;  1KGL A;  4FBR A;  2W2A A;  1O8V A;  2QM9 A;  3FEK A;  5HCC C;  1PMP A;  3ZW2 A;  3FA8 A;  3TZS A;  4HPB A;  1ICN A;  2KW1 A;  2BHV A;  2A13 A;  3PED A;  3VG4 A;  3OJY C;  4ZH6 A;  3V8U A;  2AT3 X;  1E00 A;  3BDR A;  1E02 A;  2FRS A;  4EFG A;  4Y0S A;  4AZQ A;  3GE2 A;  2Q2M A;  2R56 A;  4YFP A;  5AEO A;  4QZT A;  3CMP A;  4NYQ A;  5LKE A;  1YWA A;  2CBS A;  4ALO A;  1RBP A;  2L5P A;  3EYC A;  4EEJ A;  2W2B A;  3K3L A;  3WJE A;  1OBP A;  1D3S A;  4FBV A;  3T1D A;  3C78 X;  3IFB A;  3PQU A;  2HMB A;  4I9R A;  1BM5 A;  1SY3 A;  3VG5 A;  5AJB A;  2ZAG A;  5HZ5 A;  2JU7 A;  4L1N A;  1HN2 A;  3JSQ A;  2FS6 A;  1VYG A;  3BX8 A;  4WHI A;  4YCE A;  3I17 A;  4XME A;  2DM5 A;  2AT8 X;  3ZQ3 A;  3F9D A;  3ZW0 A;  1X8O A;  4XMD A;  4N7C A;  2OZQ A;  4ZH9 A;  5LJD A;  4TKB A;  3BX7 A;  1SA8 A;  1Z24 A;  5D8J A;  1IKJ A;  3ZW1 B;  1ZNH A;  3DSZ A;  1YP7 A;  1SY0 A;  1BEB A;  4INN A;  5LKF A;  3GAQ A;  1E06 A;  3FW4 A;  1MVG A;  1LNM A;  4LKP A;  1ML7 A;  1SXU A;  2CM4 A;  1A18 A;  3MBT A;  4IB8 A;  3CQR A;  3APU A;  1EAL A;  3WBG A;  1ACD A;  1SMP I;  4MVL A;  1AVG I;  3FA7 A;  1QG5 A;  2CM9 A;  3VPJ E;  5D47 A;  5HA0 A;  4XMH A;  4I3B A;  2JOZ A;  3P24 A;  3B2H A;  1EQD A;  4QNI A;  2WR6 A;  3D95 A;  2QO4 A;  4ORW A;  1H91 A;  3OD9 A;  1BRP A;  5BYP A;  4GET A;  2Z4I A;  1I05 A;  2G78 A;  2E4J A;  2IFB A;  2WEX A;  3EBW A;  4TJZ A;  3RKG A;  3UEW A;  2OVD A;  5EPQ A;  2RCQ A;  3FYF A;  5FAZ A;  4COT A;  5LJB A;  1KT5 A;  1URE A;  2CBR A;  4LQZ A;  1A3Y A;  4HFO A;  1QWD A;  4I3D A;  5LJE A;  1G7N A;  4AYH A;  3WJB A;  1S2P A;  2LA7 A;  5L8O A;  2G79 A;  1OEK A;  4NW4 A;  1MDC A;  4LKT A;  5CE4 A;  2PY1 A;  4YKM A;  3WJC A;  1KZW A;  4IB6 A;  4XMG A;  1ZRY A;  2Q2P A;  1G74 A;  1BBP A;  4O4S A;  3VU1 A;  1AB0 A;  1GT3 A;  3STN A;  3U03 A;  4TKJ A;  2F73 A;  4I95 A;  2R74 A;  2WSJ A;  4CSB A;  4KCA A;  2X8S A;  2OVA A;  4JGL A;  1VPR A;  4O4X A;  3PEC A;  4IAB A;  4EDE A;  1JV4 A;  2LBA A;  5KIC A;  4YFQ A;  3VG3 A;  3Q6L A;  3C76 X;  3CBS A;  4O3X B;  5L8I A;  2Q39 A;  1KT4 A;  1DZJ A;  1YWD A;  1FEM A;  1SY1 A;  4AZP A;  1GXA A;  3WJG A;  2EU7 X;  3UAQ A;  1S7D A;  1R0U A;  4QYP A;  1Y9L A;  3B2K A;  4O3Y A;  3FEL A;  3D97 A;  1KT6 A;  2ACO A;  4XMC A;  2JU3 A;  3HWG A;  5H9L A;  4K19 A;  1BSY A;  2LB6 A;  4BVM A;  2GTL M;  1GX8 A;  3TGC A;  3NQ9 A;  3H3I A;  5EED A;  4D6A A;  3P6C A;  5F6B A;  1SY2 A;  1SXW A;  1T8V A;  4OMX A;  4WBK A;  2Q9S A;  1BSQ A;  4O49 A;  4GNW A;  1GKA A;  4TKH A;  2GJ5 A;  1TXL A;  4WFV A;  4Y0R A;  2HZQ A;  4ORY A;  1A57 A;  2AKQ A;  4OMW A;  3WVM A;  3BLG A;  2N93 A;  1TOU A;  1ZNK A;  3ELX A;  4IB7 A;  3S5X A;  3KFG A;  3E3C A;  4RUN A;  4AZR A;  2FT9 A;  2FLJ A;  5HZQ A;  1ALB A;  1HMR A;  3FA9 A;  1GGL A;  1HBQ A;  5HTD A;  2CZU A;  3NX1 A;  3P02 A;  1CBS A;  4Y0P A;  4EXZ A;  1L6M A;  1JYJ A;  4I6S A;  4OS8 A;  5DG4 A;  4MIS A;  1P6P A;  3RZY A;  2LFO A;  3WJF A;  1BWY A;  1DFV A;  4TNN A;  5JR8 A;  1KZX A;  4GK9 A;  4ORX A;  3FR2 A;  1PM1 X;  5LJG A;  2GTL N;  4ARH A;  2NNE A;  4YKO A;  3UEX A;  1OBU A;  1X8U A;  4FGI B;  2L68 A;  4IBA A;  3APW A;  5EDC A;  1EPA A;  2NND A;  4CV7 A;  1IW2 A;  1LKE A;  3S5V A;  3VG6 A;  1YIV A;  3KFF A;  3HK1 A;  1LIF A;  4ML7 B;  4YBU A;  1B4M A;  4ZGU A;  3KZA A;  1PEE A;  4NP1 A;  4GKC A;  2QOS C;  1VYF A;  4GH7 A;  4O4O A;  4RUU A;  4HPA A;  1QQS A;  3NBX X;  1MX7 A;  4GRJ A;  3AKM A;  3UEU A;  3MX7 A;  4OS0 A;  1SXY A;  4CK4 A;  5B27 A;  2HNX A;  2RQ0 A;  1AEL A;  1CBQ A;  3ZW1 A;  1OBQ A;  2MM3 A;  3FMZ A;  4M6S A;  1GX9 A;  1HMT A;  1ERB A;  1N0S A;  4R0B A;  2F09 A;  2JMB A;  1FDQ A;  3RSW A;  1KT3 A;  5LJC A;  4A1Y A;  2JN3 A;  1BSO A;  3APV A;  1NGL A;  5EZ2 A;  5F1E A;  1ADL A;  4KT5 A;  3S60 A;  1JBH A;  4U8U M;  4ZGF A;  1EII A;  3NX2 A;  4FQB B;  2FR3 A;  3WOV A;  2MJI A;  1KQW A;  1JJX A;  3FR5 A;  2GC9 A;  5FFH A;  5IO7 A;  4PSQ A;  1OPB A;  5LJK A;  1BLR A;  2OVS A;  2OFM X;  4QYN A;  1YUP A;  2FTB A;  4I9S A;  3UEV A;  4QGV A;  3L4R A;  3U0D A;  1DF3 A;  4MVI A;  4OS3 A;  5HAE A;  4ZJ0 A;  2G7B A;  2RD7 C;  4YBP A;  4MVK A;  3G7X A;  1QFT A;  3D4R A;  1GM6 A;  2AL0 X;  3CWK A;  4QRL A;  1IIU A;  3ZW0 B;  4LZU A;  1CJ5 A;  1HQP A;  4PJ2 A;  4ZHH A;  2LKK A;  2X46 A;  4GU8 A;  5F7G A;  4GE1 A;  4NNS A;  5F58 A;  2FR2 A;  1DC9 A;  5HA1 A;  5D45 A;  1LIC A;  1QAB E;  3P6E A;  4U8U N;  1U18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...