3IAFA

Structure of benzaldehyde lyase a28s mutant with monomethyl benzoylphosphonate
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
554
structure length
553
Chain Sequence
AMITGGELVVRTLIKAGVEHLFGLHGHIDTIFQACLDHDVPIIDTRHEAAAGHAAEGYARAGAKLGVALVTAGGGFTNAVTPIANAWLDRTPVLFLTGSGALRDDETNTLQAGIDQVAMAAPITKWAHRVMATEHIPRLVMQAIRAALSAPRGPVLLDLPWDILMNQIDEDSVIIPDLVLSAHGARPDPADLDQALALLRKAERPVIVLGSEASRTARKTALSAFVAATGVPVFADYEGLSMLSGLPDAMRGGLVQNLYSFAKADAAPDLVLMLGARFGLNTGHGSGQLIPHSAQVIQVDPDACELGRLQGIALGIVADVGGTIEALAQATAQDAAWPDRGDWCAKVTDLAQERYASIAAKSSSEHALHPFHASQVIAKHVDAGVTVVADGALTYLWLSEVMSRVKPGGFLCHGYLGSMGVGFGTALGAQVADLEAGRRTILVTGDGSVGYSIGEFDTLVRKQLPLIVIIMNNQSWGATLHFQQLAVGPNRVTGTRLENGSYHGVAAAFGADGYHVDSVESFSAALAQALAHNRPACINVAVALDPIPPEELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Active-site engineering of benzaldehyde lyase shows that a point mutation can confer both new reactivity and susceptibility to mechanism-based inhibition.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
molecule keywords Benzaldehyde lyase
total genus 175
structure length 553
sequence length 554
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.38: Benzoin aldolase.
pdb deposition date 2009-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain
A PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
A PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iafA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iafA01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3iafA02
4O8ZA 2AG1A 4R8MA 1PYDA 5IMSA 4KXQA 1TRKA 4BUZA 3ZHVA 4K9QA 5MFPA 2FSVC 1Q6ZA 5I4IA 1V5FA 4KXUA 2BEWA 3E9YA 4RJIA 1UM9B 2EZUA 1O97D 2VBGA 4C7BA 4HDAA 2YIDA 2H2FA 1HZZC 1X7XA 3AHHA 3DUFA 1PNQA 5AHKA 2V3WA 2UZAA 4UTXA 4ZZIA 3PKIA 1X7YB 2JI8A 3GLSA 4KPUA 4JT8A 4K9PA 3GLUA 2BFCA 4C78A 2BP7A 4RMGA 4RMIA 3ZHSA 4Q9DA 1PO7A 5EJ8A 3LQ4A 2XTAA 2G67A 2FN3A 1X7ZB 3EXHB 1T9DA 4KXYA 5EJAA 4QELA 1E3TA 3EXHC 2A1UA 4V1CB 4BVBA 4HD8A 3CLSD 2NXWA 5ERXA 2PGNA 4F56A 5BWLA 4GG1A 1OLUB 2BFFA 4FZ3A 1OLSA 1U2GC 1U5BA 1QGDA 3M6LA 2B4YA 1PNOA 3GLTA 2JI9A 2VK1A 1S7GA 2JGDB 3CLTD 3FSJX 4RJJA 5I5GA 4K9OA 2BEUB 3M7IA 3RIGA 2VK4A 1X80B 4XEUA 3LQ1A 2BFDA 3UK1A 1TKAA 4X3PA 2VBIA 4KGDA 2OO5C 2E6KA 3HWWA 1OZGA 4JUCA 4C7XA 5HYVA 2H2DA 5MGNA 4BVHA 4RMJA 1X80A 2C3UA 4F4UA 4JU8A 4WBXC 3AHJA 1GPUA 3EXG1 5EJ6A 2W93A 5EXDA 1NI4A 2Q5OA 1M2GA 2OZLB 1N0HA 1ZPDA 3F6BX 5EJ9A 4BVGA 2BFDB 5HHTA 1OLUA 4IG9A 4BN5A 1DJLA 4JD5A 2JI6A 1S5PA 1V1RB 3EXIB 5EJMA 1YNOA 1EFPA 3EXFB 3EY9A 4UU7A 5EJ5A 3AHCA 3CF4G 3DVAB 3ZGOA 3PKJA 3AHGA 1OLXA 4I5IA 1UMBA 3HYLA 3ZHRA 1EFVA 1M2NA 2OD2A 3RIMA 2WVGA 3OOYA 3EXEB 4UTVA 3K35A 3IAFA 1T9AA 5EXEA 4UU8A 4RMHA 2O1SA 2BFBB 5K6TA 1POXA 4D5EA 1UM9A 3D4BA 1J8FA 2Q5LA 4C7VA 2JLCA 4V1CI 4MPRA 2Q28A 4GP9A 3F6EX 1V16A 2J9FB 1M2KA 1R9JA 3AHFA 3ZHUA 5K3SA 3ZGVA 3ZHQA 2FRDC 2H4FA 3U31A 3M34A 3HWX1 2BFEA 5ESDA 3JWPA 4GPEA 4UUBA 3CLRD 1T9CA 2O1XA 3EA4A 3ZHTA 2JGDA 2BEUA 4TWJA 1M2HA 4Y6LA 2BEVA 1YHZA 2C3OA 4GM0A 2EZTA 2QQFA 1WCIB 2QTAA 3CLUD 4L3OA 1UMBB 2PDAA 4IAOA 4GM4A 4UTNA 2Q5QA 4KXWA 1OZFA 2HJHA 1U31A 3LPLA 1OLSB 1Z8NA 4MZXA 3GLRA 1UMDA 4COKA 1U5BB 2BFEB 2R8PA 5D7NA 2OORC 1X7WA 1ICIA 3IAEA 2EZ4A 2OZLA 1NI4B 4K9KA 2QTCA 4K9MA 1IK6A 1QS0B 2IHUA 4Y6OA 5EJ7A 2DJIA 4UTZA 2WVAA 3MOSA 1BFDA 1V5EA 1YHYA 2XT9A 3AHDA 4UUAA 1UMCB 1T9BA 4JUFA 1TKBA 5DGTA 4K9NA 3EXFA 4JU9A 1JSCA 4BVFA 1PTJC 4QQ8A 1M2JA 4KXVA 2H2IA 4JSRA 1SZDA 2BFFB 5I5EA 2BEVB 2VJYA 2G28A 3D81A 1V1MA 5MF6A 3EXG2 1V11B 5HJEA 1YC5A 2H4HA 2X7JA 1Q1AA 4MPJA 4TWIA 2UZ1B 2Q5JA 1PT9A 1V16B 1PVDA 2AG0A 1Q17A 2H59A 5HGXA 1YBHA 3EXIA 3JR3A 1Q14A 3PDHA 2VK8A 1V11A 1Y9DA 1OZHA 4KXXA 5DGDA 2A1TR 1POWA 1X7XB 3EXEA 1OLXB 5BWNA 2JI7A 4BV2A 1PI3A 2IHTA 2FR8C 1W88A 4X3OA 1QPBA 4D5GA 4BVEA 2FWNA 4JUBA 2H4JA 2BP7B 4BN4A 1WCIA 4FEEA 2WVHA 3LQ2A 2BFBA 5MFZA 1UMDB 3FLMA 1YI0A 3DV0B 1V1RA 4QPZA 4V1CA 2G25A 2JIBA 2OD9A 4L2IA 4JUAA 3EXHA 1ITZA 2C31A 3U3DA 1MCZA 3DVAA 5DEIA 1UPAA 2UZ1A 2H2HA 2BEWB 5ERYA 1U2DC 1L8AA 3AI7A 2JLAA 3L84A 4FVTA 3FZNA 1YD7A 4UTRA 4ZP1A 1DTWB 2C3PA 2OD7A 4J16C 2Y0PA 5FYQA 1W85B 2BFCB 3DUFB 2IEAA 1RP7A 1NGSA 2IHVA 3RIYA 1X7YA 4MQ5A 1U28C 1MA3A 1YI1A 4GM1A 2QQGA 3AHEA 4JT9A 2PANA 2Q29A 1TKCA 2R8OA 4G1CA 4MPPA 2EZ8A 1W85A 1UPBA 2J9FA 2C3MA 5FEMA 1O96B 1SZCA 1YC2A 4IF6A 1B0PA 3D7KA 2VBFA 1XLTC 1QS0A 1D4OA 3ZG6A 2PGOA 3M49A 3UPTA 4JUDX 2C3YA 4FEGA 2R5NA 2XT6A 3KOMA 1AY0A 1UMCA 2Q27A 1X7ZA 3EYAA 1KEKA 2EZ9A 1YTLA 1NM5C 2YICA 2H2GA 5C4IA 1DTWA 2NYRA 1UPCA 3OE1A 1OVMA 4RJKA 5I51A 3AHIA 1V5GA 1V1MB 1W88B 5EJ4A 5BWOA 4J1TC 1X7WB 4Y6QA 4K9LA 3DV0A 5K6RA 2C42A 2BRUC 4BV3A 5K2OA
chains in the Genus database with same CATH superfamily
2HXYA 5KWVA 4JT4A 2FFBA 1YULA 2XTNA 4MMYB 4ZT3A 1KQFA 2ZTVA 2FSVC 1XELA 4KV7A 2X0NA 3OF2A 4LQCA 1SPXA 3TZQA 3D8TA 2MSLA 1YKFA 2CJPA 2QLTA 3GMSA 2XE7A 5CMLA 5F76A 2W6ZA 4BNTA 1JMKC 4Z5XA 5BV2P 3I09A 1Z74A 2XUIA 2RHDA 3F6PA 5KVQA 2VT2A 2YJ4A 4JQZA 4MI1A 1I7DA 4MGEA 2PU7A 1SB8A 3QU4A 5F5NA 2VSXA 3ANXA 3N8KA 4BBPA 1AXGA 4UUNA 3BN3A 4RU1A 3U7JA 4P81A 4WD3A 2GZ1A 3UJ6A 1GSHA 4A03A 5T57A 2YXPX 2X41A 2HC9A 2NPIA 4IJKA 1IC6A 4Q1EA 1MVNA 5EQFA 4WXYB 3IP9A 4K9PA 4JLOA 2C96A 3GGGA 4BTLA 1KEUA 3ADOA 4U7HA 5J1TB 3ESAA 3OC0A 5LIRA 1W0CA 4OK3A 3GDFA 1GEEA 1V6CA 3BIWA 3IR6A 2ARKA 2AA3A 1TKRA 5IJXA 5EJ8A 1Z8DA 5JCPA 5BNIA 2WIBA 4N03A 2REBA 3GO4A 1IWBB 1CERA 1ORIA 4BLWA 2FLWA 3DTVB 1HDZA 3DDUA 2RARA 5AHXA 3KFXA 5EJAA 4X92A 3RU9A 3VO9A 2FZLA 1MX1A 4DPMA 2BR3A 5FEUA 2XNJA 4B9EA 2O4UX 3AI2A 4CEHB 3U16A 1FS4A 1U2RA 2A0FA 4NECA 4AVYA 4CIDA 2F1KA 3NH6A 2VYND 5K01A 4IDFA 1V5WA 5TF0A 2FFAA 1XAGA 5I9TA 3I4FA 2PRYA 3KQYA 4MDYA 5BW6B 2JAUA 2P9YA 3OKAA 3UB2A 1SURA 1XNRB 2F67A 1NU6A 2OYRA 5KYGA 4FONA 4R5HA 3ZTYA 1H9AA 4M36A 2WDPA 5F1OA 1UDBA 3RE1A 2I1QA 2OCGA 4PS1A 1XRPA 4JR1A 1FUUA 4LRSB 1HFWA 2YCBA 5H3LA 3TBFA 3WLAA 5HRUA 3TNJA 3DXFA 1C30A 3A1DA 3IUNA 4JROA 2FR0A 4YFYA 3CF6R 4G67A 3HABA 4DY4A 5LMCA 1J2UA 4BCBA 4BLOA 1E9CA 2VCHA 3I9KA 2FR1A 1NXWA 3LOQA 4FDAA 4NPAA 1QAOA 4UVHA 5B37A 3W5IA 2AZMA 3RANA 3QF7A 1U0RA 3TIVA 4A36A 5EIFA 5A9SA 3PYLA 2G7MC 1C8BA 1O0SA 3QW2A 2YHIB 5ALOA 4EJ6A 1WV0A 4UUMA 1T5IA 5JNTA 3EG9B 3KKLA 5ALMA 2JLSA 1OGIA 3KCNA 4CU5A 3G8CA 3LPCA 4WRRA 2QTLA 4HMPA 3A32A 1ZA2A 1G4AE 3U09A 4DR6B 4V39A 1JBKA 1H4SA 5JAZA 5EVJA 1SBCA 5IT0A 2QBYA 4Q0MA 5CNJA 3ZI4A 3DL2A 4IFBA 5ADVA 1A76A 1DQPA 2FWJA 3V8PA 3QU7A 4INJA 2ZUVA 1Y7PA 2DFDA 2QTMA 1B8PA 2VHVA 2ZAGA 4M87A 1GA1A 4E03A 1W19A 1RBMA 2O1EA 2R1TB 4XPIB 4C0WA 3HDYA 4WIAA 1XTIA 3HXLA 2CCJA 1S2IA 1MH1A 3KTDA 1IG0A 3WNCA 3QOFA 4WN9A 3R1IA 7YASA 4IOMA 1X6VA 3V00A 2HHLA 4A23A 3EXG1 3I2IA 4BNHA 4LCBA 4KWCA 1HT1E 4C4AA 1WEKA 3JS5A 4GOND 4EEZA 1BH6A 2O6HA 4KH1A 3FMGA 5EYPB 2P30A 4EKYA 1MQ8B 4BQFA 5TGDA 1A04A 5IUJC 3P32A 3FUUA 3V4PB 3MVEA 2ONZA 4AJPA 4NAHA 4BN5A 1KYWA 2KLBA 4MWCA 1GKUB 2JIOA 3THYA 2PNJA 3WO1A 3F3SA 3CXUA 2Q0QA 4EPTA 1KJWA 2BR4A 1Z12A 5K8JB 1IEXA 1DIOB 2QX8A 4GD3Q 2NT4A 2PX4A 4ZPXA 3P2MA 3RSHA 3WOVA 3LIIA 1LBQA 2ZTUA 4JL5A 4ASUA 1RHJA 2PL3A 3GLGB 4G25A 2B1RA 1J9ZA 1E58A 3GJRA 2YV3A 4PZDA 5DM0A 3W3AH 3LUDA 1NFFA 3HPQA 1Z6QA 1IZZA 1WKBA 3RS8A 4YYZA 1G9TA 2WUEA 2GNPA 4B32A 4M0CA 1N8NA 4FX2A 4LDZA 4ABTA 1PJRA 1QMPA 3NIGB 2RDMA 2ZJOA 2QJRA 4B2IA 2H1FA 2CVZA 2R6AA 3RVBA 3LD9A 2J32A 4MI9A 1F8YA 1JL3A 2H7CA 4YV7A 2WTXA 4PIMA 5DXJA 1DCKA 1PU2A 3I83A 4AULA 1TEXA 2JGMA 4QJ5A 2QN7A 1PJQA 2PMCA 3PPXA 2CBGA 1KZ4A 2FX5A 2QT9A 5ALLA 2REOA 4DA7A 5GP1A 4CQLB 2V7EA 3GJYA 3UXYA 3IBFA 4Q01A 3IPAA 2NU9A 5I7EA 3LZCA 3UGJA 3O4HA 4BJ1A 3AVYA 4X6XA 3WLTA 4LOAA 1ABEA 1W4CA 2D5CA 2JFPA 3CW9A 4FFPA 3RSCA 2KLHA 2LVBA 3JRWA 1UM9A 1CW2B 1RW4A 3HE3A 3MJEA 5FXMA 2IWHA 5DIFA 1ESNA 4C7VA 4JLBA 1K88A 4DLPA 2X0JA 1E9FA 2I2FA 2ZSBA 4GP9A 3T5BA 4ZGGA 2O8VA 1G8HA 4O08A 5EKDA 4CM9D 6PFKA 3FRHA 3K71B 1A9TA 1YT5A 2NTYC 2ZQZA 4KH0A 2VT7A 4ARZA 5C32A 2X86A 3Q8WA 1LJUA 3FR7A 1LGYA 3PE4A 1P0QA 2L19A 1YQEA 2DHEA 4LVOA 3C7KA 1QPGA 1R5BA 1Z34A 2RCYA 2ZSUA 4BFTA 4I4IA 2O54A 4O4HA 3QOYA 5LLSA 1PJBA 1TJNA 1J97A 4A0QA 4BWFB 2VP9A 3HM9A 2LWIA 2XVMA 2N46A 2RGWA 2QRLA 4YMIA 5I8ZA 1XUOA 4UUBA 3RW9A 3TG2A 3CX3A 4U3JA 1T9CA 4D0RA 4LY0A 4KR3A 2AOUA 3UV3A 4XIYA 1NC1A 2RKOA 4FHCA 1PF7E 1EWRA 2GUGA 1CJKC 2WJAA 1DBIA 3QKRB 4YP5A 4H59A 4F6LA 2UXDB 2FOXA 5IULC 1Y3BE 2C94A 1PJ4A 4MVWA 1B6GA 1MABB 4K6FA 5JLAA 2QQFA 4B44A 1NBWB 1GAQA 2R9VA 3FTDA 4IUYA 1Y34E 3RRZA 4Q7EA 4DLLA 5KOHA 2NYUA 4PYKA 3ZDCA 3TGWA 4ZQEA 4MWZA 3SZRA 3C1AA 5AUNB 2B5WA 1YS7A 3ILVA 2FV8A 4X3CA 4GWLA 1NW6A 4EHBA 4Q39A 1U31A 5JROA 3LPLA 4GZLA 2J3MA 3K5HA 2D06A 1ODKA 1D2HA 1HQKA 1PEAA 1UK7A 2BZ1A 2VQ3A 3F5SA 3T9BA 2QU7A 4DG9A 3ESZA 4BKMA 4B46A 4XWOA 2XWQA 1X94A 4INPA 3JD4A 5DPMA 1UXJA 4ETWA 1GRQA 5AUPB 5TQ0A 2R85A 3ICQB 4CCAA 3NT5A 1CUWA 1I80A 4IIJF 4WT7A 3WLSA 1USGA 4NJEB 3T3EA 4YX9A 3F7MA 1O95C 1IK6A 2XKJE 3WAKA 1PFYA 1EGMB 4NBWA 4EYQA 1SWWA 1QONA 2YHIA 5GZ1A 4PGHA 1KMIY 4MVJI 2BOVA 3C8UA 5EUCA 2XADA 5C8DA 5K3FB 3GHYA 4KE6A 1NX9A 1SK9A 1E3QA 1YVEI 4LDRA 3I01M 4YJHA 3SR3A 1KF0A 4F2PA 2UXCB 4D8WA 4E2XA 2IHKA 3N6XA 1PUIA 4KOAA 3SE0A 4QVIA 4OKIA 3UXHA 4RKQA 2J30A 2I7CA 4HAIA 4IO0A 3D7SA 4M53A 5ALWA 3LKVA 3OF5A 1H4VB 5DBFA 3DKRA 4DLYA 2D1RA 3K9QO 3D64A 2Q8PA 5AOVA 3F1KA 4HGZA 2OVBA 3H83A 3H9GA 2XVYA 4LEIA 3OWOA 1ZVVA 2B2CA 1ZH6A 4OLBA 3V48A 3ZWAA 5JUWA 2YZ2A 3ZWOA 1V1MA 1WDMA 4HEJA 5MF6A 1C3OA 2VHZA 4INOA 5BRAA 4HN4B 1PUJA 1W2WB 2O19A 2I7VA 1DGQA 2ZBEA 4CTNA 2X7JA 3U7RA 3VZSA 1Q1AA 1LH0A 2QDKA 2PKWA 2ZATA 1L4EA 4GW3A 2SNIE 3RYFB 3KXLA 3KZ1E 4HVAA 4TWAA 5JC8A 3DP7A 4GO1A 2A9VA 5FBHA 3WHKA 4TWIA 5HPYB 3PDJA 5GIPE 1KORA 3WGNA 3JPWA 3Q15C 4CMHA 3FSEA 3V8EA 3MEQA 4I50F 2WTMA 1JQAA 3ELDA 5A5EA 4GLOA 5BR7A 1DOZA 2IP2A 4AP6A 5P8WA 1FRNA 4KR9A 3D3EA 4Z3KA 5KNDD 2G0NA 3RT9A 4PVCA 3FOBA 1C3VA 3JR3A 2V6MA 3EBLA 4IIDA 2XZLA 4WEQA 3FPEA 4TXLA 3AP3A 2WPNA 3EQZA 3KP1A 1Y9DA 3NEAA 4TTJA 1L8QA 1VM6A 1QVWA 5HBRA 4EB6B 3ML1A 3RD5A 3VVBA 2J87A 4YGYA 3PWZA 1VSUA 5DMXA 3FNGA 3ZWKA 1THMA 2WJWA 2QAIA 2GHIA 4W7HA 4ZQGA 2ECQA 3U7IA 1PT6A 1XL0A 1CZLA 1U0EA 4OQMA 4NXMB 1DI0A 1V1JA 2FR8C 5BQOA 1W5FA 4FC7A 4G5YA 2CVHA 1A5AB 2YXLA 1UC9A 1F0NA 4FP9A 1A88A 3FD8A 3QWFA 5DNAA 4AY4A 3SDBA 1JQ3A 3WLJA 3UATA 4YRSA 3QKSA 3A05A 2IZOA 2Y9PB 4N6NA 5A62A 1OI4A 3B3FA 3LUHA 4EZBA 1GQQA 2EJVA 5TNXA 1H69A 2ZJZA 3L6EA 3IOCA 2VUSA 3P45A 4FLMA 3V4LA 2Q49A 3ZY5A 4L5IA 2PTGA 2WVHA 3F78A 4Y3UA 5HOEA 4OBBA 3BAFA 2DBVO 3IKMB 2HXGA 4FZJA 2QUKA 3LYHA 4R9UC 1IQUA 1UF9A 4D3FA 3MRVA 4Z9FA 4F92B 1DXOA 1XN4A 4WJKB 5L51A 2QRHA 4MVJG 4EG3A 3DAFA 1L7BA 4RQUA 2B8NA 3OTIA 2DT5A 1T9ZA 2OD9A 3Q7IA 3RVJA 1T2DA 2IELA 1F9EA 3DO6A 5I7SA 4V0SA 5B5SA 2OVFA 4HFNA 1M0EA 4G0WA 5KB3A 2J48A 4MR9A 3OCWA 3Q3EA 1QAQA 4LSWA 1XRSB 2PRSA 4Q9HA 3VNQA 4BUCA 1Q3TA 1YS6A 3DXYA 3KQWA 4EUNA 1JWBB 1BXGA 1SG6A 3E0XA 1KFKB 1VA5A 2HJ9A 4GBJA 4FVTA 1M0SA 2DY1A 4OJNA 4F8YA 5I45A 2FETA 4U8GA 1TD1A 2F4NA 3EEOA 3DT6A 5KYYB 4B4UA 1ZHHA 1EWTA 1ZXBA 3PFHA 4XVQA 3CN7A 4PC7A 3SEZA 3X1WA 2C9ZA 3DDHA 5CW1A 4EPVA 5FYQA 1V8ZA 4C4TA 1T1IA 1W85B 4PYRA 5KSYA 1XEFA 1AMNA 4ZJYA 4UNPA 1TGVA 3GWZA 3AW8A 1CUIA 4NI5A 3HCBA 3OPQA 1NGSA 1DQZA 1L5YA 1X7YA 4MGYR 4W9MC 2FPGA 1U8YA 2Q4TA 2I1VB 3H8JA 4QL3A 1NNI1 2PVPA 4LYJA 2POQX 2RFLA 1Z08A 5KTMA 5JJLA 1OTHA 5CDGA 3KDPA 1DC6A 5CB8A 1D2MA 1PFQA 4EHDA 4G1VA 3T1NA 4LBWA 1TADA 2D7JA 3FI0A 2OBLA 4UM5A 4LRTB 5LZ9A 3D5QA 3HBAA 1QSGA 3MUNA 4AC9A 4EKEA 2BHNA 3AUYA 1Y7IA 2C7BA 3D0OA 4ARCA 3U5TA 2QW0X 3R5XA 4OI0A 1UBTS 3AEKA 2IL1A 5JCJA 5C53B 3EPPA 5LQJA 1JLMA 1U1DA 1RMQA 2VATA 2WLSA 5FOVA 3NP7A 2GX6A 1ABFA 1SVMA 1ND6A 2HMUA 3TE7A 4BKUA 4C3UA 2CY0A 3LDHA 3PFKA 1OFUA 2YN0A 4R1UA 2FEKA 4GMKA 1VLMA 4QICA 3JWHA 3AGQA 3NZEA 3ODPA 5JWRA 4Y2VA 3BWEA 2R97A 4YCJA 3T34A 3AL3A 1V3VA 2YX1A 3I76A 4OH7A 1TNDA 1TO6A 2G5CA 2PFGA 2ZB2A 3GAZA 4PRZA 4RY2A 5GZ6A 3EX7C 4OHXA 1EDDA 1W44A 4EY6A 1AY0A 4IWXA 3OCZA 3KDSE 4IGFA 1JDZA 1RJDA 3DBHB 1S8FA 3KOOA 4F5YA 3FWZA 1XDSA 2H2GA 2G1JA 3B5IA 3CINA 2DHRA 3NT4A 4IYRA 4LSZA 4ND5A 2FCRA 5U4XA 2NYRA 5BQ3A 2DEUA 5DZSA 1MGOA 5TB5A 1JDVA 1N4DA 4NK5A 1RYFA 3OAAA 4DBLC 4QG3A 4JEUA 1U11A 4WY8A 1PLJA 4KXFB 5HRCA 2XF2A 3TAUA 1E2JA 3K6KA 1VHWA 1XDZA 4B4WA 4FCCA 1QVZA 4G36A 4EGFA 2X3UA 3FWYA 4S0XA 1EUQA 2GEJA 3Q6IA 4JBXA 2A94A 4YEDA 3THXA 2ZIXB 3DFMA 1SC3A 4DLUA 4J1TC 4IDAA 1GEGA 4OQEA 4RUKA 3LUKA 1M34B 4EF6A 1OHHA 1WUHS 2DTDA 3BWCA 5BN3A 2W48A 3OI7A 2Y77A 1K5DA 4L27A 3OM1A 4OG2A 4AROA 4CUKA 4EJSA 5BWBA 3NCTA 1CEYA 3HJBA 3K1ZA 3RAGA 4R8MA 4GSYA 3F8SA 1FJXA 5BN4B 5E4FA 3ICVA 1XWWA 4ND8B 4JOSA 3P2JA 3SSAA 1G5RA 1PJ3A 1UFRA 3WKEA 5THXA 2XITA 3QTBA 4HKTA 2JI4A 2ZSKA 2DWCA 4WV3A 4XM0A 1ZZGA 4Z2YA 3CB4A 2Z56A 2TMKA 2Y6VA 2UVDA 1J1IA 1DEOA 1HM5A 4EW3A 1QIJA 3EVBA 1XZJA 4JLVA 1JA1A 1PGPA 2FQ1A 2GAOA 2Z83A 1QQTA 4I4TB 2VBGA 4NK4A 4Z9YA 4F84A 4HXEB 3VX4A 2FP4A 4HS4A 1LBHA 1RPJA 2YIDA 3GG9A 3U56A 2Z1NA 1I5EA 2D5IA 5TMBA 4FI3C 1FDWA 3LUBA 5J5AA 2V4MA 5I7FA 1RKVA 3E9NA 2OXIA 3RJMA 3TRJA 4ZZIA 3PT9A 4GYJA 3F74A 3PXBA 3QFTA 4WFJA 3A70A 1U2DA 3V7UA 1MXHA 1H1LA 2BFPA 3E7PA 1QC5A 5G0VA 5TARA 1DIHA 2I4TA 5K99A 4DT1A 3BOSA 4Q9DA 3UT0A 4LDJA 4KE9A 4MINA 2P41A 2WNHA 4YAGA 1X1EA 1IUNA 1QH9A 2P91A 3LQ4A 3QKWA 4Z3OA 4HLDA 5JSQA 1GAEO 2O2HA 3OO1A 4DR3B 3H5LA 3R5JA 1D9ZA 3GFGA 4LYEA 2KJQA 4QODA 3SVZA 5JYEA 5JAUA 3U4MA 3T1TA 1JHAA 3DO5A 3O8QA 1EUCB 2X1MA 3YASA 5AW4A 2F4VB 3V6MA 2BCJQ 4UU0A 1D2CA 1K8RA 4DRYA 3CS3A 1KYIA 2HDWA 2C4HA 3N0VA 5CVCA 3HYSA 4LXUA 1ARZA 3LDFA 3WSVA 5BW4A 3QA3E 1X74A 2ZDHA 1Y8AA 4RK0A 1XTKA 3QTTA 4HJRA 4M1WA 4D0LB 3ZWQA 3B3GA 4CLEA 2B1QA 1J49A 5IC6A 4GG1A 5BWLA 4B82A 3DKPA 1T3LA 1YWGO 4Z4FA 1J0XO 4QM7A 1JZQA 1XMJA 5GJVC 3R8FA 3C7TA 3QXXA 4I5GA 2FW9A 1X77A 3BBPA 3MB5A 4TQ9A 2JGNA 4B73A 3ZEIA 1C3JA 3JQBA 5C5DA 3GRFA 4LTDA 4WX2B 3MELA 2I9KA 1TF7A 3CH7A 1Q0UA 1MZVA 1K8QA 4R6WA 1USVA 4QBIA 4ND4A 2MINA 1NJFA 4IDQA 3R5HA 1UFQA 4MYSA 5I9NA 4LF7B 3EF3A 4IHJB 4E1BA 3TLKA 2PXXA 1K06A 4MJXA 4EAQA 4IG4A 3WK4A 1RKBA 3AOEC 3EGCA 3QEOA 2BDEA 3W9YA 2BHTA 3M1LA 4BNIA 1V9CA 1BYIA 2C2ZA 4HNSA 1X80B 5G0UA 4M86A 3GFTA 2J0VA 3U62A 2V96A 1QLHA 3BK7A 4CL2A 1EYZA 1FMCA 1RYMA 3UK1A 1R18A 4JJAA 4LQLA 4UM9B 1Y4DE 2JLXA 3CZMA 4WZAE 5HCIA 5EL0A 3TFQA 3B70A 4DAEA 4ZVPA 2P9QA 3A6HA 4X3PA 3E9DA 3F3YA 5U1PA 3IAHA 1VJ0A 4JYAB 5EIAA 1SWVA 3U7QA 3FCOA 4XH9B 1K89A 3IDZA 5G4KB 2VPIA 5FKJA 3U4QA 2IA5A 2PBRA 4QBKA 1WF6A 4JUCA 2HA3A 2RKWA 2ZE6A 4A5SA 4TWBA 3I72A 3EGXB 4BV8A 3UJNA 2OORA 3UT5A 3FCCA 1Z33A 3O8QB 4HH0A 1LWOA 4HPXB 1X8XA 4LV8B 4IVPA 5CA0B 1HDOA 5FTMA 1TQ2A 1I2CA 1SBYA 1KAOA 2WU8A 3GGDA 3IJRA 4FR5A 3EFBA 3PUHA 3FGOA 1A5ZA 2Q41A 2IY8A 1SCIA 3BSSA 1EM6A 4M7OA 1VLVA 4CF7A 1EQAA 1F0YA 3T5AA 4YDSA 2F2TA 2IPNA 5LOVF 1FYWA 3GARA 2P2NA 1KNQA 2YWJA 2ZBQA 3H16A 4CKBA 4JP2A 3ZQ6A 5AVUA 5H59A 4KX5A 3Q9SA 2QGNA 5SV2A 2PKCA 4CDMA 1D1TA 1FU7A 4PE5B 4F97A 3EQ8A 2B4KA 4F11A 3IX7A 4KWTA 2AOVA 3ZDDA 3CZ5A 3CC8A 2O0JA 3BSYA 4UD6A 5G4LA 3WFIA 3ZE0B 1XNJA 3EQ6A 3HI6A 4HH4A 3GLQA 3JQ9A 4TKLA 3RS7A 4N49A 2EDCA 1W2GA 3JWJA 1O6CA 4A0GA 1YIAA 4HNVA 4BXOA 1SVUA 2H1LA 2QL7A 3OHMA 2GYYA 3LX8A 1N6NA 1OCEA 4HGPA 3R8XA 3O8NA 3I5MA 4IV0A 4WECA 4D3XA 2FDCA 4A8JC 4ZJUA 1HQCA 2WD7A 2OQIA 3RS3A 1II8B 5EE1A 1BEUB 3AY6A 2IXFA 4IGEA 3LRXA 3BMOB 3X1JA 1U7XA 1Q16A 2LUOA 4BIMA 1JILA 1Z2NX 4BS9A 3BD9A 4D74A 1I2BA 4M54A 4GGMX 3SF8B 3HJFA 1RWMA 2O8BA 2X5KO 3FE2A 3WWEA 4E2ZA 1SQ6A 4V3BA 3E7FA 2GLXA 4LYAA 1RZ3A 2XKAA 3PQ2A 1GFZA 2ZRLA 2PS9A 3B1FA 2UYYA 3H86A 3K8ZA 3I0ZA 2UAGA 5FI0B 5BN4A 4L3WA 1YBFA 4XE5A 2PMWB 5D5PA 3FFXA 1XK7A 3RS2A 5FOXA 1A7KA 1RS0A 4IYJA 3T0IA 1T9AA 1ZD1A 2IW1A 2X9GA 3HCAA 2WM9B 2V98A 3A6JA 4RMHA 2UUCB 4MDHA 2FB9A 4A16A 3WLOA 2QRMA 4QOGA 1SCKA 1Z6PA 4IF4A 3C6QA 1KEEB 1E63A 5E9AA 2R8EA 2A1TS 3D4BA 3E9RA 1JG1A 2IIPA 4DADA 2J9RA 1GR1A 4L5AA 2ZIUB 3KETA 2JLCA 1LK7A 4MGKR 2HO4A 2W4MA 2Q7OE 3AERB 2C0PA 4IFIA 4XTCS 4TWZA 3CX6A 2G9UA 2PZKA 5JARA 2AWNA 3UMYA 1UKYA 3AETA 2HXSA 4FGJA 1FX0B 1IULA 1YFKA 4M0EA 5REQB 3RHZA 5C8XA 5F1YA 4LYGA 5KCZA 4IH4A 3O26A 1X86B 1BWQA 2G63A 3V4ZA 1BEEA 1X2BA 3ND7A 4HT3B 5K0SA 1WNFA 2PIDA 2X5OA 3Q41A 4J9VA 5AW9A 4OB6A 3BHNA 2BISA 1CUXA 4KQMA 5EMMA 2IX3A 5JAPA 1ZR4A 3I4CA 3JQCA 2BGIA 3MUEA 1XN1A 5KJ1A 2GXUA 4AMZA 5G3ZA 3HNRA 1KYZA 2ZE5A 4ID9A 4RFSA 2QGZA 3UJAA 3H4IA 2A86A 2RHJA 4RPIA 5EXXA 4B8ZA 1ZGJA 3O92A 4IX1A 2GYUA 4OGWA 5KMGB 3VI3B 1LB1B 2DPGA 3M5WA 4G07A 1IY8A 2QVXX 4OLJA 2DH6A 1RLIA 1VLHA 3NKVA 5KX5B 3F2VA 3UAXA 4XCXA 2P3OA 4QSMA 1X1BA 4GMXA 3VPBA 1CUJA 2QI9F 1JHYA 3M0EA 4F1KA 4K46A 5BT8A 2FPLA 3OX1A 1EG2A 1W7AA 3NATA 1X9IA 5F1PA 4PFJA 2ZUCA 3UTDA 1G4UR 1XQ6A 4N0PA 5TS2A 4PW0A 4KREA 2VJKA 1TYCA 4YI5A 3CVWA 2A4KA 2HJHA 1ZJ5A 3T6KA 3U37A 3MJFA 1NXPA 4R1PA 3BH7A 5PGMA 3T7RA 3U9TA 1OJLA 1TQ4A 3I73A 3Q87B 2PBZA 4I1RA 4AP5A 2OHGA 3JZFA 4U02A 4YH1A 3GLRA 3MILA 4FYIA 5FAXA 3THRA 1U3TA 1FFDA 5AFSA 3O2JA 2CVQA 2R7NA 3NBXX 4QA9A 4JQYA 2NO0A 2FSPA 4JSTA 2Y3IA 1C7ZA 4NMHA 1K6JA 1AHIA 4ISCA 4DREA 5A2QA 3CHYA 5LA6B 1WZUA 2BJVA 4KPGA 3B6JA 1KI1A 3DBIA 1U8FO 1XZNA 4Y6OA 3IP8A 4RVCA 1KJZA 5K3DA 5KTRA 2OEPA 1DOHA 1VPEA 1XTQA 1Y6JA 3HSYA 1QDUA 4GRIA 5JWOA 1LX6A 2GM5A 1UMKA 1N3LA 3IXLA 4FNGA 3T4PA 3AV0B 1UMCB 2ZAOA 3VR4D 2A5JA 2N1BA 3RHTA 1LKZA 4UQLA 4MIOA 3U3ZA 1FX1A 5LD2B 1KY5A 1V3TA 4J1QA 2ZVQX 8ABPA 4IFTA 4C7OB 4CMCA 4PSAA 1TZCA 4XWAA 1E59A 3IUEA 3RIHA 1PTJC 3U4HA 3HLYA 4Z9BA 3L8HA 4Y6RA 2H2IA 4N5DA 3COWA 1HURA 1QFSA 2NVUB 5DI3B 4YRJA 3OLYA 3BE6A 2DFKB 1V7ZA 2Q3BA 4BKRA 2JEZA 1C50A 1M66A 1ZNWA 1R8QA 1E1MA 2R5FA 3AOEA 4QGAA 5I4CA 2YN2A 3U3RA 1YZYA 5KVSA 1CFZA 3IUSA 3O93A 1UC4B 5EESA 4FOSA 3OU7A 2D59A 4HTFA 2JFVA 4J3JA 2QENA 4XJVA 5ECYA 4Z4CA 4E33A 2DGDA 1ZSVA 4H0CA 5B3JC 2C0QA 3L7DA 5HXAA 1BHO1 1X1QA 3K6SB 5J2UA 1PEKE 2PVSA 2PH7A 4M55A 4CL0A 1JQDA 2G06A 4K2AA 4Y8VA 3VH3A 4CMJA 1MN6A 4EFKA 2GRJA 3AU8A 3FWKA 3AYXB 4C6SA 4CDGA 2R62A 3EXIA 2RGBA 1Q14A 4LDNA 5CEJA 3D02A 2J5BA 2JDID 4EOGA 2O1WA 1JI0A 2J9YB 2FF5A 2QBYB 5HMLA 3DV9A 3LC1O 3B2QA 4JLNA 5AKXA 1M0WA 2I7DA 4L7QA 2AJBA 3TDKA 4D8UA 4TV8A 3OCJA 3KVVA 4UMEA 1B00A 2J4FA 4URFA 1BX3A 5DGDA 2GO7A 4ZYVA 5KQRA 1MX9A 1Y1LA 4MPTA 4M88A 2WY2D 2VHWA 4QBFA 1PI3A 2WD8A 3BMXA 4FFLA 5F7XA 5D3MB 4KWIA 1O96A 1NUSA 3HYRA 5JYCA 4U00A 1WSDA 2H1WA 2EGHA 3WK9A 1ADYA 3KT3A 4P33A 1TB4A 1PG2A 4HI0E 4B6SA 1W36C 2Y1KA 4TMWA 4CR6A 4H7EA 4I8IA 5BSMA 2XIQA 4RWZA 4BN4A 4OGLA 2B8TA 3UH1A 4DLBA 2DQZA 4MVCA 4E70A 2PKXA 3WIVA 1IB0A 2E18A 2FYTA 5IXYA 1E9DA 1I0LA 2CXQA 3MT0A 4FEEA 1JB1A 1EFCA 3A4VA 3IALA 1C4OA 4ALLA 3UC5A 4EL5A 3DDSA 4LNUB 2ZR0A 3DPSA 4D57A 3L7NA 1I8TA 1H8ED 2CNNA 3FX2A 3ZH9B 1XPUA 2DJ5A 3LH5A 2WZCA 4LCJA 2AGVA 4LYDA 4OO3A 3UMVA 1NUPA 4H3SA 4JELA 3RS0A 3BGVA 1M34E 4G4GA 3H1PA 1ZM3A 3I1JA 3BKXA 1P18A 4JXKA 5IKEA 3M6FA 4UBKA 2Z2JA 1GG2A 5IH7A 4ROTA 5AKIA 5LYJF 1DRKA 1CQJB 1L8AA 2X8JA 3KT8A 4KIUA 2HV8A 1DAOA 3VR5H 2OM6A 5IU6A 1VRWA 2FR8A 3ANMA 5J23A 3R76A 4HQRA 2LCQA 2RHLA 3K0FA 3SSMA 4Y18A 2H3HA 1AGXA 1N6PA 1FVOA 5KNBD 3HCOA 3IE1A 1AUVA 3EIFA 5E3IA 5J63A 3E4DA 5EI5A 3ROMA 4BJHB 3GNTA 1HRDA 2O3SA 4JB2A 3KJXA 4PZAA 2E0IA 3EIXA 5CNKA 5JS7A 1P4RA 3RADC 3GV0A 4Z6KA 3EG9A 3PF8A 1SG0A 1LPSA 1G7SA 3AR5A 5KKAA 5K4HA 3D4OA 1I7NA 4UTPA 1CIPA 1XFAA 4NBTA 1I7SB 1UM8A 1O6FA 2R44A 1M76A 4XA8A 2W8BB 2H08A 3AI1A 4JC8A 3PV0A 3PEYA 1RPAA 1DXQA 2OBNA 3QKSB 3TRFA 3DZJA 3OIDA 4JLKA 1SC6A 4HMQA 5AM2A 4M83A 3AM4A 4B17A 1VSTA 3COJA 4B1FA 2AC7A 1E2IA 1E5LA 2I4NA 5F98A 2V74B 1UJMA 2X4IA 3L9XA 1SOAA 2X19A 1HI9A 2XE6A 3EA5A 1ZHFA 4Q1AA 2QI9C 3OE7A 4R3NA 5A3JA 5AICA 1X2EA 2ZRDA 3OBBA 3TW8B 3D7KA 3K9FC 4PZYA 2IY7A 3EMVA 1QXSA 3SD7A 1CS0A 4P83A 4CL3A 4FOLA 3HBMA 4GRDA 4EFDA 2JAQA 3ZG6A 3KVYA 1F1JA 1LZKA 1KEVA 4S2EA 3ZS9A 2B2XA 4JJ7A 4R7GA 1AKUA 2XE8A 3C97A 5FQOA 5LBUA 2HF7A 3L04A 4B35A 4EHIA 4NU6A 4ZMBA 4QYMA 3S1AB 1XMVA 3DULA 3H04A 4C2UA 1P45A 2E49A 2WABA 3BX1A 2G0AA 2ZJ0A 1DU4A 1T4CA 4NZMA 4UPVA 5E6RA 2E55A 521PA 4BVFA 3KWFA 4B7AA 1T0HB 2VP2A 4O4LA 1XRNA 3HI4A 2YV2A 3CLHA 4X8LA 1H2AS 2K6GA 3SHOA 1OXUA 4M1TA 5JRJA 3VDNB 3EUAA 3FCXA 4ZAGA 4RJKA 4PLCA 5I51A 3N74A 3ZDEA 2ZS7A 4EHNA 1NYTA 2BM9A 3VR2A 4DJJA 3AUTA 2WA2A 1Q92A 1IEQA 5CDHA 1OR8A 1WAMA 3V8QA 4DQ0A 2FH5B 1CE8A 1GNRA 2Q62A 5H9VA 5KTNA 5KX5F 4ICIA 2FPKA 3TLYA 5BOVA 3O82A 1NYRA 3OZDA 1MX3A 3GCZA 4NZ9A 3GC6A 2I8CA 4K9LA 1XD9A 2C42A 4NAVA 3UJ8A 2Y1GA 3GUHA 3BRWA 3NBKA 3SP1A 4BPRA 4FJ0A 3OM9A 1R64A 5AUQA 1JV2B 1GCGA 2PZGA 2V7VA 4YT2A 1CB0A 2ODTX 3N2NA 4ALMA 3T5DA 5IXJA 1Z0AA 2WWRA 1ZK4A 3O1IC 1EEXB 3VRHA 4E22A 3ZDYB 3WOHA 5GJCA 1NKTA 5EZ6B 2ZRNA 4PQEA 5K3FA 1Q84A 2OQRA 4E4TA 4UNNA 4KXUA 3AEKB 1BA3A 1LNQA 4E88A 3PB3A 3TKAA 1L5NA 2BFAA 3R44A 4FT4A 4PYMA 3G0BA 5C8YA 2OB2A 4NXNB 1GFSA 3WWPA 2ADMA 1ZINA 3BFKA 3NGLA 3C14C 4B7CA 5T7BA 4BVJA 3CISA 1GV1A 2Y1FA 1PV4A 1N2BA 1N6LA 2PWBA 3TEFA 3WIEA 3L8EA 5IJAA 3UB3A 1IN4A 1KP9A 1VFNA 4GE3A 4PLWA 2WIFA 2X15A 5K20A 1MC4A 1QYXA 3EWNA 1TCAA 2WG0A 3VDMA 4EHAA 1UBUS 2JI8A 3CW8X 4MRRA 4FHDA 1U04A 1ADFA 3RC8A 4O4HB 4KYTA 1JNYA 5LBIA 1RTTA 3OQIA 1SUEA 2BP7A 3GVIA 3D8BA 1P60A 3PQ8A 3ZHSA 3PC2A 4B6GA 4FX5A 5HCNA 3KSRA 4R3WA 1KI4A 1XXHA 5JEDA 2QZ4A 4G26A 5I7WA 3D4NA 3LY7A 3LFHA 3N8HA 1BE1A 3C3PA 3LPNA 2BGTA 2ZRBA 3E27A 5TXGA 1SVNA 1RXUA 4X1IB 5FWDA 4DV4B 1GPJA 5H83A 5F73A 3HCDA 2XYPA 4EPRA 4BVAA 1YO6A 4FGKA 1JR6A 3Q10A 4PSVA 3NHKA 3BREA 2WWGA 3ZNNA 1SXJA 1XEXB 2PGNA 4WASA 2V6IA 3KU4A 1Q20A 1C29B 2QT1A 3I45A 3MWLA 4FBGA 2ZXEA 4IIFA 1QIEA 3FLBA 3J81k 3RS9A 1YQGA 3AGPA 3D9QX 4MYRA 4UXJA 1OLSA 3TWOA 1F8XA 1WTAA 2XMGA 4C03A 4US0R 1W48A 4DXDA 4OFBA 5EMLA 2NZ2A 3OY2A 3IVGA 3F5DA 4HATA 3KZVA 2CFSA 4I5DA 1N2ZA 3KE8A 2A1UB 5CYOA 2DG2A 2OESA 3C3YA 2J6BA 2XGOA 1PYOA 4IKOA 5DH9A 3WLEA 3Q3JB 3IAS6 1UJBA 2IE0A 4J43A 3RS5A 3RO7A 3VO1A 2GSDA 4EAAA 3GVPA 2JZNA 5JZSA 1O08A 3EZ6A 1QFYA 2ANBA 3C4JA 1OWOA 2Z5FA 3Q5DA 1DADA 1I4OA 2AD5A 4M38A 4FE4A 1H6BA 3PP8A 4PC1A 4CWAA 2X3FA 1QIKA 1F9AA 3EIHA 4C1BA 2W8BA 3O3MB 3STTA 2PT6A 2JIRA 2AFVA 3B1YA 5GPBA 4YDQA 4IJQA 1L3BA 5LYYA 5T8KA 1YZNA 2RK6A 3HADA 5HF6A 1YDWA 5BV1A 1MJGM 1EVEA 3QHAA 4RS4A 4UDNA 4C76A 1L8XA 2V4UA 2BV3A 1TZJA 3HDJA 4GR4A 2QSZA 4BFSA 2ZBRA 1YQQA 2NAPA 1OA1A 4BB6A 1XCBA 2C3UA 2REXB 1DRWA 3HXKA 3WDLA 2Q2NA 4B3SB 1L5LA 5DM2A 3BJEA 1GPUA 1QHNA 1YBMA 4TSRA 4Q9IA 1W75A 3TQFA 4YQFA 2GYWA 1EB9A 2O3JA 3EBPA 2OCIA 3M5PA 4XPZA 3E58A 1JFSA 2Q5OA 4MV1A 3NGXA 3A37A 5DI3A 4N1AA 5LJIA 1ZC4A 2GWHA 2O2IA 4PM4A 4ACBA 4MZDA 4AXBA 2GZHA 2RH9B 1W1WA 4P7JA 2HQBA 4K2HA 5E7IA 5IASA 1TFRA 5AM4A 1KC1A 2ADOA 1HTWA 4CKEB 1DJLA 3SLKA 1Q7RA 2WWVD 3F97A 5HIMA 1KU6A 1SZPA 3BIXA 2ZUWA 1ST2A 3OQHA 3L4EA 1CKEA 5FTKA 3UXEA 4CMKA 4CLRA 3PNKA 2B7LA 5L9AA 1OH6A 3C1OA 2FG6C 4AUKA 4CCYA 4TTTS 5K0NA 1CU1A 2BL4A 1U1CA 2HRBA 5BR1A 2O2EA 5LMZA 1HE8B 1XCOA 3R0JA 3WRXC 1A8UA 1L0BA 1SG9A 3O8OB 4DR1B 3JZAA 2DFTA 3NIFB 2E48A 4KXMA 5DSZA 3THWA 1BMQA 4DDTA 5LP6B 4PFQA 4RK1A 4EJSC 4XASA 2X40A 3MUFA 3LBAA 1Q0HA 1XCLA 5KHOC 5K0BA 3KLBA 2BE7A 2Z04A 3NEJA 1ZP6A 2IK8A 3ZEAA 1PV2A 4RF2A 4V0OA 4EB8A 2GAJA 5JY6A 2V6JA 2W42A 1DIAA 1VE3A 2V7UA 1UBSB 1GU7A 4IJ6A 2ZUBA 1KVRA 1GRNA 2B0JA 2PRIA 3VJLA 1WS6A 2HU2A 1XWIA 1N0UA 2ECKA 1PG5A 3L5OA 4M1OA 4Q3AA 2CFTA 3IOYA 4YYEA 1HFEL 4WOJA 4EABA 4DYDA 1SU6A 1T13A 5B53A 3JASA 1Q74A 4J1SA 2M6LA 5AESA 2J07A 4ZVMA 4MUNA 2XGMA 4PSCA 4RVUA 1XLVA 3RFXA 1DB3A 4D5EA 2AEFA 5JNVA 3U61B 1EXDA 4LZAA 2NSJA 2W6MA 2YMPA 3B9PA 3IVMA 5AOCA 1HTTA 3P94A 4N4AA 5IVDA 3WB1A 1F38A 4DPKA 1YQ9A 4ASUD 5CDSA 1AJEA 5LU8A 3MS2A 1XRMA 4JHXA 3VKUA 1DFGA 3A1EA 1ZUNB 4MQBA 3E9CA 1E20A 1L3IA 1GPKA 3PFWO 4XD7D 5J4YA 5TLSA 5TT0A 3R9KA 1M2KA 1WQ4A 1J21A 1E3JA 2B83A 4I1YA 2C20A 3Q6MA 4EJMA 3Q3CA 3DLIA 4LJ4A 3RWMB 1HLGA 1R0YA 4IIEA 4P92A 3F4BA 3PEWA 5EP3A 2JATA 4CNBA 3EGIA 2FRDC 1WUKS 1Y1KE 2JDIA 1CG6A 2FZWA 2KQUA 2O0HA 2IOFK 3IAM6 5E3JA 1X9HA 4IEIA 4M7RA 5HMMA 1HE4A 1FNDA 3HWX1 4GI2A 3BCRA 4O2LA 2BFEA 5C31A 5F5XA 2QE7D 3B60A 4P2GA 3GFFA 3WGTA 1E9BA 2P9CA 4HDRB 1IBRA 1YUBA 4DCVA 3C8ZA 3TVYA 2PUBA 4YO7A 2BEVA 3I12A 1ZK0A 3TOSA 1CHNA 1Q2XA 1WXXA 4TT3A 1SHUX 3L41A 1SU4A 3K2QA 1JMVA 3TNDA 3TQOA 2K5UA 2QRQA 1IN6A 3EWIA 4GZ6A 2VHUA 4XXHA 3TW0A 3ZLBA 5ESRA 3WLQA 4F85A 1TU4A 1LS6A 2AN9A 3GLGA 1BDHA 4B7XA 2Q5QA 1DE0A 4URYR 4AMUA 1JIVA 3NTQA 3RU7A 4I99A 5L6MB 3WV4A 1OLSB 1IFXA 3OMWA 5ITWA 1Z8NA 4HAOA 3KB8A 4ZQHA 4ZO4A 4FPXA 4C6HA 2W90A 3ZK9A 1W34A 2WJ3A 3WYGA 4PQRA 4ND3A 1Z5PA 2WUFA 4HWKA 2OSBA 1V7PC 1FSPA 3WRYC 1MT0A 5LWQA 3KD2A 4NR0A 5IC5A 4ISBA 4CQLA 1KJ8A 1ZRSA 3X1YA 3F71A 4DV5B 3WNQA 1FYDA 1JG2A 1X38A 2AR0A 1K8YB 5KYTA 4RPHA 4P54A 1IM2A 4YFVA 3LX6A 3JYLA 4BB9A 2ODPA 1E1LA 1R5OA 1E94E 3M6WA 2ZG6A 4DCJA 3KWLA 4HTFB 2FPOA 4MTLA 2XT9A 4BTEA 3KOZA 2Z9CA 1RZRD 2CD9A 3DTVD 4I0WB 2ORVA 3ETNA 2GPWA 1E6MA 2I03A 1YB4A 3EMDA 3RYCA 5K8UA 1G19A 2JG3A 4YCSA 1T2NA 5I4BA 4X93A 1UINA 1GZVA 4N18A 1S4QA 4NCKA 3UGTA 4CU2A 1Q19A 3WRYA 4AKEA 2XRFA 2BN4A 2NSLA 1YFZA 2C5SA 1ODJA 5KYXB 1QBKC 4OXKA 1BVHA 5IKXA 4HGNA 5BSVA 4IRXA 1OWNA 4NBKA 4Z86A 2C2MA 5E1DA 4QQRA 1DC7A 1SIOA 4YRKA 2VHEA 3KELA 4QYTA 4ZOBA 3EXG2 4YV1A 4R54A 2X1HA 3KJNA 2G9NA 3ZNPA 5D2CA 2CXNA 2PX6A 3CX4A 1O95D 3B12A 4V0LA 1LPNA 5IMBA 3RREA 4UFNA 3A27A 3K72B 3OZSA 3ZTWA 4G5OA 3NBMA 1AUOA 4G4JA 2KYRA 5HM6A 2A84A 1I1HA 1QIFA 3GHHA 4R8KA 1GL6A 1N4AA 5HGXA 4CTMA 3P4YA 3EFOB 5A05A 5ER6A 5LWHA 4JLMA 4RL6A 5IDXA 1V3QE 3CWCA 5EZSA 3GLFB 1TUEA 2C4NA 5CB4B 2EKPA 3TLGB 3ELYA 3JALB 3PIDA 4MWOA 2GJSA 4XX1A 5FFNA 2BSXA 4XWKA 4GPBA 3ZY3A 4DCNA 3GEGA 3NHFA 4UHDA 1XL1A 4KGVA 3UAWA 4FMCB 4M6WB 5F7OA 2GBIA 1PJTA 2IEZA 1R6AA 3MCZA 2HLHA 1X7XB 3PGMA 5AKLA 3ZHYA 3I61A 3GEDA 1MP0A 4MUXA 3GBSA 5G3YA 4PCUA 1U99A 3NDRA 4JEMA 4BV2A 2M2IA 3T7IA 1U0JA 3AI3A 1E79A 3GDHA 3LKBA 1YZLA 3L40A 2HCTA 2WQZA 1GGJA 1RADA 2RHWA 5C7YA 1ILEA 2JJQA 2WKRA 1GUAA 4BVEA 4JODA 1JQKA 3B38A 1DAMA 1BJRE 3B8HA 5TVKA 4BL5A 4DN6A 1IMJA 1QGZA 2QW8A 2ZJ7A 3ESYA 3NU1A 4RPCA 1F6WA 4EG4A 4FW8A 2ZBDA 5SYAA 1Q2UA 3KPWA 5IZ4A 1MQAA 1VI2A 4Q4JA 1RFGE 4RK7A 2PLAA 4KV9A 4RENA 5KKNB 1JAZA 4QDZA 3K1TA 5D85A 2CN1A 3VC7A 4N7BA 1UMDB 3OQIB 4EHHA 2D1QA 1CRQA 3ZU2A 5TVGA 3EXAA 2B9EA 2FSHA 1VPWA 2PSHA 1ZOOA 1SVOA 2QN3A 4WZBB 1KQPA 2VRCD 3JYQA 3EEFA 3WNBA 4M46A 4M8KA 3KU1A 4L02A 4FGZA 4Q3OA 3PXEA 1JVNA 3QPCA 3GROA 1HLFA 3PXCX 1WKVA 2WHPB 2Y4OA 5T4EA 3V42A 4UXIA 3K9NA 4UD2A 1C80A 4EG7A 2ZUFA 1SC4A 2FFQA 2I55A 4IM7A 4B31A 4DVJA 1H42A 4JC4A 4NL4H 2OCLA 3SKVA 3T12A 1OIXA 4D9KA 5EG5A 3OCCA 4BNUA 3RV3A 2XOKD 3CTPA 3IKJA 1ZO8A 2YMQA 2C3PA 1E4YA 1SUIA 4P4SA 2GN9A 4R16A 1AT1A 3M2PA 3OZIA 1HNWB 4L2IB 2BFCB 4JASB 2RGNC 3TOCA 5GVSA 1REQB 4U2FA 1Y4SA 3DUFB 2HU8A 2IEAA 4TUYA 1I10A 2PQ6A 2EW1A 1GYRA 1PWYE 2JHFA 2YWXA 3A1TA 1V48A 3DLTA 3EEIA 3HMKA 3I3SR 4P1ZA 1UT5A 3JQDA 5E4JA 2Q2VA 1B0UA 2GLTA 1D1SA 3DD5A 3OVMA 2YCLA 1WOMA 1UL1X 2XCOA 1PHRA 2WU4A 1SGWA 4D6PA 3ORRA 1HT2E 1CP2A 5IK2D 1KRWA 4PXYA 1WW2A 5F64A 1WLYA 2CJWB 3QLJA 4JX8A 3ZBPA 3P1JA 1GQ2A 3G0CA 3O83A 3NPAA 3K1AA 4UDYX 4ARUA 1TCVA 4DHEA 4TS9A 3JQBC 2HA4A 4C0HA 2OKCA 4OP1A 3I64A 2UXBB 1FB5A 1FX0A 4BMZA 4MKZA 4HFJA 4RW0A 2QL6A 3R3YA 2OC4A 3H0CA 2XXAB 5CA1B 5AJXA 2IV2X 1DMSA 1CIJA 5TEWA 1DC5A 4YMVA 3AEYA 1ZUIA 2YZNA 1OZ0A 3OUUA 4EI9A 4Q3LA 2Q2OA 2IV3A 3TLBA 2YHAA 3KHKA 4I9HA 5HZMA 1TJPB 4A26A 3TNLA 2H8GA 3QY9A 1PSDA 3RVKA 2P6PA 4DBVO 3RJ5A 3PLAE 1CUSA 1NVDA 3FM9A 3IPXA 1C0EA 1RRFA 2GD2A 2IYOA 2WHXA 4GEKA 2Q50A 4LVCA 5DGIA 5BSRA 4CKBB 4XM2A 3ZK7A 4XGIA 5JDIA 4FGUA 2Z5LA 4WL0A 5JV5A 1BHQ1 2P9HA 3COSA 3EDYA 4LHYA 4Q4CA 2J59A 1GN9A 1AQIA 5D1NA 4HP8A 1X7ZA 1JEJA 4TMXA 3S3TA 4X1KA 1F6BA 1HH4A 3V80A 5CCBA 4PXSA 3HZHA 2C04A 3IQXA 5HM8A 5TS3A 3JQ7B 5MDHA 2O5VA 3A36A 1L1EA 2YXBA 1CJUC 1E2DA 2PAFA 3FKSD 2IVZA 3I32A 4M7WA 5AQEA 2VL7A 3ENKA 3OE1A 1N2CA 4R2KA 4UHFA 3G1WA 5DIZA 4YR9A 5JAOA 2CV0A 2NOAA 3VQTA 3ZD7A 4HNUA 1ODFA 1YJCA 2Q6LA 3AF1A 3AZQA 4U6NA 4FYYA 1AXRA 3TLEA 3MBOA 3VBCA 2YNMC 3ASYA 3WAJA 4YJGB 4H6VA 1US8B 3C3CA 2GPBA 3ZWMA 3GH3A 2EF1A 1Q0LA 2W6PA 1VXOA 3B2EA 3M81A 4IIXA 4KSBA 4W6ZA 2GJ8A 3DOJA 3JD2A 2GZAA 3JQAB 3FOCA 2XD4A 1O3YA 3CKKA 4X8HA 2IITA 4INAA 2ZB4A 4GBED 3V55A 2GPJA 3WMWA 2DCMA 3GYBA 3R3VA 3RHFA 2AG1A 5DEOA 1Z7BA 3SIPA 3U4GA 1Y63A 1B43A 3H2IA 3WLRA 4AMYA 2ZYUX 3QTLA 4JLDA 3MOIA 2IQIA 2YY6A 3UKJA 3ZBQA 3U60B 3CNLA 5GAJA 1KWKA 3PZBA 3V7NA 3ESQA 2GHRA 4L4YA 4TYPA 4FD3A 2P67A 2BD0A 1ZA1A 2C0CA 3F6CA 3JQ9C 3NORA 3HH8A 5DLYA 1U28A 4CFYA 4D8VA 2NU7A 3K4PA 2I3AA 3R3XA 4LZPA 1JQBA 3IIJA 3JQFA 4OBWA 3H0EA 4D8XA 3EZ7A 1SVLA 1VE9A 1FXSA 1KH2A 3WL5A 2QAGA 3MJTA 2A57A 2XQKA 3PA8A 1JLLA 1JAIA 1FVHA 4WXEA 1DAFA 4BNMA 5FOUA 3ON5A 3BD8A 1U3UA 4WFQA 1P6QA 1FF9A 1XEXA 2OGZA 2V3WA 4DMCA 1GNVA 3PJRA 3F7NA 2XUJA 3NNSA 2JFWA 1CVIA 1FDUA 3OZCA 4E2FA 4EK9A 4P3XA 1WZCA 1UKEA 1UK8A 3UK2A 3N0WA 2Q0XA 3NP9A 1AMOA 4GR9A 4LNAA 4CIVA 1KJQA 4J0IA 4B7ZA 5BV8A 3PL1A 3IEXA 1NFQA 1TT5B 4IVRA 1T43A 3LCUA 2JLBA 1NX6A 3I6ZA 3MLBA 4KO8A 4D2IA 1W5TA 1JZTA 3W2GA 2BIFA 3DBHA 4KXYA 5EIWA 5F9MA 1BKYA 4MWDA 3OZBA 3CVUA 1W47A 2VJMA 3WWCA 1B0AA 4LXTA 4BNYA 2BKLA 4V1CB 3B82A 1NULA 4LJ6A 2B2NA 3BCHA 3JD1A 2WE8A 4REQA 4BFLA 4OMCA 2CXSA 4ZO7A 1XHFA 3I2YX 4HG2A 3R7LA 3TNFA 1KDTA 3V3TA 4LY3A 5BW8A 1Z07A 2C2OA 3EWAA 4U1RA 4G1UC 3EZ9A 2FJ0A 1ACLA 4QWWA 1QVRA 2ZW9A 3U0BA 1HEUA 4QLAA 1GL7A 3FVTA 1N7IA 5E8RA 1Y3CE 3W8FA 4CTKA 4Z49A 8MHTA 4IDGA 5LYJB 4ARAA 3AY3A 4U7PB 1CZOA 1YJ8A 1D7AA 2Y67A 2QVLA 3GLTA 1UOOA 1SEVA 2X3YA 4GLLA 3HY3A 1ZGCA 3DVQX 1QHIA 3K0CC 3HJAA 1Z73A 4DMKA 5TPWB 1BE6A 4QHYA 4TYNA 3OICA 1XK6A 1R88A 2GKSA 2ZTMA 3WGZA 5KNLA 3LBYA 3A7DA 2G88A 1JLKA 4A8TA 1GAWA 1LVGA 5CK5A 4MW0A 1EU1A 1BVYF 4K9OA 2LNDA 3SLGA 4DIDA 4OHMA 3EVGA 5DYTA 3RFCA 2R68A 4GE0A 3LRPA 4KTVE 4DARA 2XLBA 1Z62A 1VPTA 2GVDC 2Q1XA 4URZR 4RETA 2PKYX 2WG2A 5COQA 3U4AA 4KQ6A 3VBEA 3VZCA 4DGQA 5HJ7A 4HN9A 1ZUHA 5C1DA 1EVLA 2OV1A 1Y9AA 2Z8ZA 2K7ZA 5EWLA 1TF2A 3BEDA 4QXOA 4WZAA 4QECA 3FBTA 3TLMA 2GM9A 2RHHA 1E7RA 2Y27A 4NYJR 4PN3A 3G0IA 3L8CA 2DKOA 5DWVA 3BXFA 1YMVA 1Z39A 1H8HA 1T9HA 1BCRA 2GQ0A 4F4FA 1NW9B 2JLVA 4K9SA 4D97A 4GI5A 1PAUA 9GPBA 1CQJA 2B3TA 2NU6B 3PQFA 3ICCA 5FHQA 2HLDA 2GEDA 1SUWA 4PSUA 3I58A 5GONA 1OSNA 3AKCA 1QV7A 4DRXB 3FDJA 3SAJA 5HQ3B 1TU3A 3K0FB 2EJCA 4J1TA 2PKEA 5EJ6A 2AMYA 1F8GA 3I2GA 4LUCA 4NU8X 1NBMA 1XZQA 1M8GA 3DMHA 5FOTA 3DE5X 1WVIA 1DIRA 3RNLA 3MGCA 1NJ6A 4NJEA 4BNJA 3OM8A 1DIBA 2ZFUA 3K9CA 5B55A 2VAXA 1ZL2A 4D6YA 2YRXA 3A3KA 1M6WA 2VNJA 4DQKA 2BONA 3RC3A 2WIGA 1K66A 1EVYA 4I7EA 2B1GA 3DBLA 1U6KA 3LT4A 4MKFA 3MIZA 1ORVA 3DLPX 3UMCA 3ZJ4A 4RTPA 3GAFA 3HZOA 4JT2A 2XDQB 3F47A 3DTYA 3FSGA 3RWBA 1A5BB 1S2GA 3ND6A 4M2LA 3GJ0A 4BO2A 4EQ6A 4HGYA 1Z4KA 2CXTA 2WAXA 1CJSA 4KACA 5IJWA 1JSLA 4ZI7F 1Z2DA 3DLHA 1E3IA 1AKVA 3WNZA 3ETCA 4K6GA 1BW9B 4G01B 2JAXA 4A91A 5LPNA 3PKJA 1ADGA 2WSSD 1K4KA 3OKPA 2RAUA 4UBJA 5CLQA 3K5PA 3PFGA 3LRTA 5LR6A 2ET6A 1Y3HA 4BQQA 1B76A 3GOHA 3TFOA 1KE2A 4XRRA 4KE8A 1N5JA 2GERA 4NRDA 1EFPB 4V2UA 4ZVQA 2RGRA 1DBQA 3BA6A 3I1FA 2A92A 5FR1A 3EXEB 1QORA 3OLQA 3TSOA 2L82A 1Z26A 2R751 3AKDA 3BE5A 2Q1UA 1KPGA 3Q9UA 4RCYA 3GRPA 2VSFA 1GA4A 4PTZA 5DYNA 2IBSA 4OHYA 1UIMA 2JKVA 1KYQA 4AW9A 4H17A 1KDYA 3UAGA 3LTEA 2PX8A 4M76B 4ODIA 4AX4A 1HC7A 2X14A 3C8MA 3G88A 2CNWA 4MKHA 4IUBS 1JJFA 1ZD3A 4YJFB 3QITA 1W0JA 3SBEA 5FUWA 5CFLA 3GFSA 4QTTB 2OBFA 3HU2A 4X6YA 2JZCA 5ALUA 2WOOA 1QK3A 3PEEA 4BO8A 3GG2A 4LXHA 3UUEA 3UQZA 3ZGVA 2X8JB 4BEVA 1RLMA 4L6IA 5FDFA 3M34A 5F9HA 1SRQA 3VO2A 1ZX1A 1YZKA 3QLUC 4LCEA 4TTQA 2VWPA 3CCCA 3NBAA 1SELA 2QLJA 3Q8LA 2FSVA 2G9ZA 1ZISA 4H3HB 4DDHA 3ONFA 2Y1DA 1RWWA 2WC1A 4FYVA 2H65A 4GHWA 4IGAA 2D8AA 1V45E 4Q4HA 3HBNA 4FI3F 2QSJA 2VJMB 5CVJA 5BRJA 1Z0UA 2E1PA 1AKYA 1N2SA 2WPDA 4HX5A 4LXGA 2BPOA 1U9CA 4TZ6A 2GN1A 3TTWA 3HJHA 4OF4A 8LDHA 3KYJB 2G1PA 1Z4OA 3MWJA 3A9UA 2LIPA 3T0FA 3LC7O 2G09A 1LY1A 5IANA 4ROSA 2BBSA 1II8A 1P72A 3OEHA 4BQRA 3KQUA 3HQ4O 3VR5D 2UZ3A 1XE3A 3AV3A 2V7QD 3OKFA 1CF9A 1Q77A 2FDXA 4K9RA 2P11A 4LZLA 4ZOLA 4O4JF 3TBKA 5JVDF 1J1UA 4LHZA 1SXGA 4ZICA 2A9PA 2ZPTX 4D6XA 5ADWA 1N1MA 1P8AA 3DW3X 4TTRA 3ZDRA 4GDFA 1Y8QA 3ZD9A 2EQAA 4JK3A 2AUNA 1AKMA 2VXBA 4MRMB 1IATA 1RQ7A 1YJAA 1T8YA 1QH1B 1M8FA 2DC1A 1EUCA 1M1YA 1YZFA 3C7AA 1NI4B 1U3VA 2X5XA 3DFIA 3K0EA 4K9KA 5H16A 2EBHX 3F9RA 4K9MA 1U7UA 1NUHA 4PZPA 3LSYA 5C0OE 3NDIA 3TTUA 1TMKA 4IIJA 1CNEA 3R09A 2YVKA 4MH0R 4WA7A 5T3UA 2JFZA 4Y9TA 2HPHA 3BBLA 3ZJ5A 1BFDA 5JSFA 3IIEA 2EW2A 1ZGZA 2QD2A 1E7SA 1ECBA 1WV1A 2AE2A 3H2BA 5AVOA 2H8KA 5CEFA 1QRUA 2XEXA 3ZCPA 4PF1A 3K0KA 1HE5A 1JU3A 1PS0A 3IERA 4RHUA 1Z6YA 4LRQA 3VNVA 3FXAA 3PUYA 2I76A 4B9AA 3VR3A 2DYKA 4JITA 1GWNA 4II2A 2RMKA 1AXEA 2J5QA 1P7CA 2C2WA 1BCRB 1ISJA 1FFGA 3AFHA 3EHEA 1V25A 4J7UA 5JZ9A 5CLIA 3WMRA 3ZW7A 3GGJA 2W71A 1FP4B 1CJVC 1EUZA 2CBZA 1WXQA 2QIOA 3HMQA 3LMKA 2X6QA 1FFHA 1Q0ZA 1J9GA 4GYKA 4OHUA 3ROQA 4K03A 2SCUA 4YRMA 2D5LA 3AVTA 4G81A 1V11B 4XIGS 1F4PA 5BYAA 2J85A 3BVPA 4JMLA 4TXMA 2YQZA 5PNTA 2O8CA 2YZGA 2Z4SA 1ZHOA 5JDIC 2IU3A 5JNWA 1IEVA 1SCDA 2QXUA 3TJRA 3VR3D 4YLYA 2VCYA 3E61A 2UZ1B 4YP0A 1I1NA 2R6FA 3ZLVA 5IDQA 1PT9A 2Y1WA 1HYQA 4KQ1A 3G68A 4X61A 4Y2SA 5ALHA 2Q4EA 1NOJA 2HDNB 3GUYA 3KQQA 2OCBA 4Q02A 4QLOA 5TSDA 4QOFA 1XJ0A 4P35A 1Q57A 4LZZA 3LUJA 2CMDA 2VAWA 3VNAA 3BHMA 1I2DA 4KVAA 2J3HA 3KHUA 3PHCA 1FFXA 3OIVA 4TV9F 4QJBA 3W90A 1TF5A 2VDNB 5ES4B 4Z4QA 4H7JA 1A9QA 3HDTA 3N86A 2IODA 3PX7A 4FS8A 2JVIA 3LDUA 4NE7A 1QIGA 1XMIA 4UOEA 1DJQA 4TMKA 2EDAA 1T9GS 3KPVA 5CA0F 2FA9A 3UCEA 1U63A 2H5IA 3EZLA 1I51A 2VO1A 4ANFA 1I7LA 3HKDB 3MWGA 2AZXA 2PJZA 5DJ5A 4GEGA 1O6ZA 4S04A 3V7WA 1RWQA 1A4UA 2VTVA 5HG0A 4DUPA 1HETA 1IY2A 1GL9B 3HS3A 1XALA 4YMGA 2CJFA 4EJ0A 1Y6FA 1EM8B 4D02A 4X90A 5JCJD 4WLFA 3WL3A 1YF3A 3RUAA 1W6UA 4C89A 1WZ2A 1PZXA 4ONEA 3H8SA 5A9RA 2HFJA 3PCXA 4LZOA 2EWWA 5ANRB 4CM3A 2QN2A 2WIJA 3LQ2A 3U1VA 2HF8A 2FXIA 3P9IA 1HQDA 4MUYA 5DCWA 3THYB 1NM5A 4RA6B 1YI0A 4BZPA 2ENUA 3DV0B 4NOMA 2V3CC 4MPDA 3RRFA 3VU1A 1KMMA 2ZQ5A 3QLVC 4FT2A 1HL3A 2HQRA 3W5CA 1RNLA 5AW6A 4LBZA 1UKAA 3HNOA 2C61A 3BXGA 4YI3A 2C31A 3G9XA 3U3DA 1BDMA 3DOUA 3ETHA 3KQMA 3MT8A 1QO0A 3NS7A 3PHGA 3ZE9A 1A0OA 1J7JA 4EENA 3S2IA 1RWBA 4YMUA 4JR0A 3W04A 3CCFA 3UICA 3R3ZA 1M2EA 3EG5A 1C1DB 1DEKA 3HDQA 4HADA 3OJCA 3UHOA 1XZMA 1ZCAA 2FKAA 3G7UA 5HZKA 4K88A 5AVKA 4JR2A 2WF8A 1L8LA 1SVWA 4J16C 4BYMA 4I9GA 4UVGA 4L95C 3AZOA 3QRWA 4WHMA 1ODIA 2ZGVA 1PQ4A 2H00A 5B2EA 5K2MA 2MU1A 2R1UA 3CLTC 4K81B 4NJOA 4X62B 4Q7MB 3DEKA 3DOCA 6NULA 4CM8B 2FZCA 1H3FA 2ZYTX 1XTPA 3NUQA 4FEYA 3DZCA 1DC4A 2G5TA 1TTTA 3FOZA 1DLIA 2JFBA 2OV4A 4M0LA 2QK4A 2QX7A 1JRLA 2VZ8A 5REQA 2PANA 4MUAA 4DQLA 3L3BA 1P1KA 1TEVA 1VKJA 4NYIQ 4CLOB 4OQPA 3AL0C 4A73A 4DV2B 4ZKEA 3AUAA 3R6GA 2AFIA 2AVDA 3WXBA 3DS8A 4D25A 4BQSA 1UT6A 4QUEA 1E4OA 1R6UA 1LSSA 4P3PA 3CKMA 3LQRA 1U7DA 4P86A 3SJZA 2PUGA 1JXQA 5FEMA 2P6UA 2B0CA 3TO5A 4MW6A 2P9GA 1MJFA 3T1HB 3HN6A 1VSQA 1QHYA 3UO8B 4XM1A 4HDNB 3IKLA 3IQDB 4PWYA 4UFOA 5DN6D 2NZUG 3BM5A 3NDPA 5F7JA 5CCXA 1DBWA 4UKDA 5IAKA 1XLTC 1Q0SA 1WDKA 4V0RA 1Z4QA 1EHYA 2WJ6A 2JFXA 4RORA 3TL2A 5E3HA 5JPCA 3TDMA 1QHEA 1NQOA 1QHXA 1VL0A 4M9UA 1JDPA 1JG7A 4UATA 1O89A 2OV8A 4KMMA 4RWEA 1YR8A 4WKOA 5CVVA 1VBNA 5HIIA 4AT1A 5JQGA 2XB6A 4JNCA 1ZZEA 2ZREA 2GBCA 3R6WA 1IOLA 1E2UA 2J3EA 2VJLA 1UBCA 3M1YA 3CO5A 5KOJB 1E1QA 3BUSA 2ODWA 1Z7GA 3C98A 3G2IA 3L7YA 1L5QA 1FPMA 3PC3A 4Q16A 5DGCA 3CZ9A 1HFKA 1WHTB 1A2OA 5GOTA 2B34A 2HSJA 3K73O 3TPFA 5EHZA 4JGBA 1XZBA 2UVQA 1MO6A 2VF7A 2ZYDA 1LDMA 2RC5A 4Q7LA 4G65A 1TAGA 3I0NA 3I30X 4QO7A 2QWXA 4L22A 4RPKA 3ZWPA 4AB1A 3C5EA 4AZVA 4UCXA 2CZCA 3NYRA 5DHTA 4AZ3B 3A8TA 3OEEA 5P21A 4PHCA 4V0QA 4H7FA 2QVZX 3EGXA 3L01A 5HEKA 5AKHA 2IYVA 3ZJUA 3QMWA 1WXGA 3AM5A 4UNSA 4W5RA 1QG2A 4FHZA 4EZEA 3SYNA 3LT2A 5EHXA 2O20A 5KJ6A 4BBAA 3IAUA 4FOTA 5AJUA 5K2OA 2C5FA 1ZLXA 2PM8A 2IKQA 1PL6A 2Y0CA 1NVBA 2C57A 4QEZA 2NU8B 2ZANA 5M29A 2I80A 2YWDA 4JWTA 3N3BC 3VSDA 3IV9A 3MGAA 1T35A 1W6RA 2BEWA 3OU2A 3E9YA 3OF3A 4ARSA 3OQPA 1E1CB 1KH1A 3VJMA 1E1NA 2XEDA 1R4MB 1L9KA 1ZEJA 4PN7A 3CRZA 1O97D 3EVAA 3Q2IA 4QREA 3AEQB 4W9NA 4XI9A 5E8JA 4RAQA 3ZGZA 1FBTA 2P79A 3CJQA 4OQNA 3ZPXA 1RZUA 2X9NA 3LL4A 4DNFA 4B40A 2RH4A 1UODA 2ID4A 2QTTA 4W5OA 1OXTA 4MR9B 4DLZA 4UEJA 1P5JA 5BWMA 4TMZA 5L45A 4LVUA 4R9VA 3FRIA 5FFFA 4ILKA 4XTRA 3S5JA 4BGUA 1GCUA 4I5FA 2I66A 4MR7B 4LFBB 4YAEA 3AFIA 4NV1A 3ITNA 3O4FA 4G5XA 3P9YA 3BMQB 1KK2A 1OFIA 1HZZA 1N8KA 3SG0A 4G1FA 4Z7OB 2EAUA 3CUKA 5G2OA 2H1HA 3SEAA 3KZOA 3T1YB 1FLAA 2FEWB 1BQEA 2A4MA 5SY9A 1VJ5A 5COAA 3BDVA 1ETHA 2C29D 3DVRX 5D51S 5JBIA 3PX3A 4HS9A 1T3HA 3FFTA 1OFGA 3RS4A 2D1FA 2JBHA 3CVOA 2JZOA 5FA8A 3OJOA 1E3TA 2PEYA 1U3WA 2A1UA 4BVBA 1MUUA 3WA6A 4HB2A 4F4HA 4OUDB 1TQHA 5L3VA 1I4TD 4G5QA 4AIRA 1KEEA 1XF1A 5CXQA 2AKEA 1SRRA 2ZT5A 4HLNA 1OV6A 3UAOA 3KYBA 3CLKA 4LC1A 1YMQA 2PIAA 1YXMA 4AY3A 2DLDA 3S7ZA 2VRNA 4LFAB 3DDNA 1PBNA 3TECE 4BP8A 2V0CA 1T2UA 4NYJQ 5LLDA 2O5EA 3GXBA 3S2SA 2J4CA 2XHEA 4UZFA 4XGNA 3VR6A 3DYBA 4J8PA 4RGYA 3E53A 4NU0A 3FAKA 3M6LA 3QBJA 5JDCC 3UG6A 2ZDGA 4E3ZA 3E1SA 3FGNA 3JAWA 2PH5A 1JE1A 4IR7A 4XD2A 5AI8A 5AVWA 2QXTA 1Z29A 1KZHA 5FJJA 5LFAA 1PBTA 2XA2A 2ZKLA 1E0KA 3BJMA 1LF0A 1TD9A 3WMGA 4DYVA 3ZVLA 1Z4MA 2DWQA 1JEDA 1ODCA 3JVIA 3LBIA 2BGUA 2OHFA 3P9NA 2D74A 3N8IA 1M1UA 5D86A 3H9BA 3CLTD 2Q8QA 4J9UE 2ES4A 3FH0A 2GPAA 1CLEA 2MTBA 4LJ5A 2AMFA 5IN4A 4IDNA 2F1HA 4C7MA 1XKXA 1V8PA 1MX5A 2F3PA 4R2MA 4X97A 3TOXA 4XEUA 2QRVA 3FR8A 2MOKA 1EZ1A 4DFDA 2WDZA 1XZDA 2A3RA 1KDZA 1MAWA 1L5SA 2QY9A 4PG6A 1OROA 1K3TA 3FYUB 1OIVA 5BOSA 3DBLB 1WR8A 4LS3A 2P3SA 5CNMA 4WXRA 4EMTA 4Z4HA 4RELA 3FFBA 3WRXA 1UOPA 1HY3A 4ZALA 1FUYB 2Z9BA 2H2DA 1OYOA 2LDXA 3KKOA 1PJ2A 4FZ5A 3N2GA 4J0CA 3QX9A 4B0OA 1XTVA 3MB8A 1IJFA 4RGQA 5J2TA 3W5HA 1YFJA 2PX5A 2OZKA 4P4GA 4LJRA 2YINC 1IM8A 2QMOA 3HWSA 4OXRA 3LYAA 2W2KA 1Y3IA 4P36A 5GTDA 1KFJB 4OK6A 5DTQA 2QTZA 1EDOA 1NSTA 3B6KA 5IP5A 3F73A 3NFYA 3KQPA 3DZFA 4TRNA 3D7RA 3JD0A 4NG5A 1NP3A 1U2PA 4P0TA 3V5NA 3PUXA 2W5UA 2GESA 1U8ZA 1W9HA 2Q4DA 3HYCA 1BEZA 4RESA 3REFA 5HHTA 3H5RA 4GYYA 5D01A 2WIKA 1D5WA 1YUMA 1ZICA 4XYMA 4GKKB 1CRLA 1KR5A 2ECOA 4GICA 4D0NA 1KZYC 1WCYA 1D9XA 3W3ZB 1CEEA 1Q21A 1D2AA 2I67A 2PV7A 4H1UA 4Y2HA 3SGLA 1KQOA 1QP8A 1YNOA 2GEFA 2PLRA 4UM8B 4AY6A 1ACJA 5LBTA 5AJTA 4BJ6A 1Q0QA 1EK6A 2G80A 1A8SA 2FSFA 3U4IA 5E6SB 2AH5A 3K4QA 3QY0A 3D6HA 3SJBA 1JEYB 3SSNA 5FBLB 4COOA 3L1KA 3PFIA 2CHFA 1QHGA 1FTWA 2XJ9A 4YJHB 4F4JA 4Q3KA 3PDUA 2H52A 2J6IA 1C1HA 3WVNA 4E2YA 1DUIA 1NF9A 1FQJA 4C3ZA 3ACBA 1I3LA 3HYLA 4HZUA 4CF3A 3G0DA 1R5NA 3MRSA 5A7GA 3U81A 3DCJA 1A71A 3R2JA 5AJZA 1U0NA 5EE0A 4YACA 3QG1A 2JCGA 1W36B 4H1WA 1ZM7A 4PC2A 1J0DA 1E5TA 2X2OA 4XUEA 3CNBA 5HTKA 2TMYA 2FPRA 4ZD6A 4JOCA 5FWYA 4IO1A 3VU8A 5K6TA 1RXCA 2GA8A 1MVLA 2MJLA 3FWHA 4PTYA 1UPXA 1KE1A 4Z4IA 3T5PA 3WYAA 3C7CB 1K3UB 2FMXA 5HZHA 2FOIA 2R6R1 3C43A 3ZTTA 3O21A 2JLUA 5BVHA 4IXMA 1E60A 3CQ9A 5EGNA 3VSAA 4PLFA 1J56A 1AQJA 1A5TA 3NEYA 1JJBA 1TVMA 3TCXB 4DZTA 2GO1A 1I4EB 4RV4A 2OXCA 1Q0TA 1JLRA 1U3GA 3TUIC 3X2SA 4ER6A 2XQGA 3OLVA 5FULA 3TRHA 1GAXA 4EJSB 1YL5A 4FB5A 2PYIA 3W1EA 3HA3A 4CF6A 5I3ZA 2XVXA 1CP3A 4O4IB 3LC2O 1USWA 2XGGA 3R0XA 4L76A 3V4VB 4JA2A 1CDZA 3IE0A 4MQLA 5FV7A 1G6OA 3E2IA 1ISRA 2FMFA 1REQA 3KXIA 3JQPA 3TI9A 1YHZA 3I52A 2Z8YA 4US2R 1K97A 1U3DA 1UZLA 3UMBA 4PQFA 2DE0X 2DCUA 5CT6A 4W1SA 1OFTA 2IYLD 3WMEA 2Q8NA 3CZCA 4NENA 1PR4A 2FMUA 2QTAA 1OA0A 2XMBA 1GL3A 3HYTA 3OECA 4KIFA 5BQXA 1G18A 2LZ0A 1N9GB 1HT0A 2D62A 2QTFA 5I7VA 1DAHA 1TCBA 1EWKA 1WXEA 3I5UA 4M0FA 3EA0A 1BS9A 4DEXA 5FPKA 2EBFX 1RI1A 3GH1A 1DBRA 4HNRA 5LXTF 2OAEA 1SBZA 4U2EA 3RVOA 4E3WA 4EW6A 4EUFA 4KK4A 3TXYA 4GL2A 2JJMA 3MZ0A 3BL8A 4QUBA 5AI5A 4E0BA 1MXFA 2R8PA 3E2PA 1A96A 1MFPA 2FUG6 5K0ZA 2IY9A 2P3QA 2ZT7A 2ZYIA 3QWIA 2A0UA 3EPRA 3ABZA 4R68A 3ST7A 1U8AA 1R6BX 2C5HA 4BNKA 3IQWA 3S70A 4EKDA 2QTCA 3KKQA 5JZOA 4LV5B 3NWBA 3O0TA 4BNXA 3N8GA 4XAQA 5SZIA 3ZGLA 3NTUA 4HR7A 3NONA 3SBXA 4B81A 3EZNA 4UM7A 3KIPA 4WWHA 1JX6A 2VPTA 3TB4A 1XXLA 5K6AC 2O5CA 4H4CA 2B8WA 2ZJYA 4R71A 1B74A 3KJEA 1EGHA 2IFTA 4JDPA 4YRZA 4HVCA 1RQ2A 4LXXA 3R7FA 2M6RA 1E3WA 1VOTA 3HB1A 4JJ6A 2PMEA 2Z5GA 2FG7C 4E5YA 4YMTA 4BGDA 5B1DA 2AYYA 4IH1A 1Y89A 2B3DA 2H57A 1O9HA 4O59O 5EZ5A 4ERNA 3QVTA 4FU0A 4N7JA 1KYXA 2M98A 3HXPA 1FFXB 1WDTA 2OFPA 1TECE 3ICPA 1P19A 2FPGB 4AECA 5LL6P 3R0ZA 2VXOA 3T9FA 2J3LA 5KAMA 1JDNA 4YP6A 5H4GA 5I5EA 1H2EA 3H7AA 5DO9A 2IOYA 3RQSA 1GKYA 5TQVA 3WJ2A 4ZV7A 2AJCA 1D09A 1YC5A 2H4HA 1LLDA 2ZRIA 1OQAA 3IILA 4UDXX 3IP6A 3AMVA 3K20A 4G0QA 4J0KA 1DKLA 2QD5A 4RHFA 3ROFA 3WKDA 3O84A 1J0BA 1Z0IA 1NR1A 4J4BA 4QPNA 4ZCMA 1U2ZA 3TD6A 3ONVA 5LC1A 3RSLA 4QDJA 2VP6A 2FSUA 1LLUA 3G5UA 5BV0A 1DFIA 3WB2A 2PCJA 1SQ0A 2OV3A 2R1VB 2CNKA 5DT2A 4BC0A 3QX3A 2YJ5A 2AQIA 3MRTA 1Y7LA 3ZH2A 2C98A 2ZJ8A 5LN1A 4DLWA 2AUTA 2TS1A 4N8DA 4Y2UA 4B3BA 1J0EA 3MBKA 5FTLA 5EUMA 6ABPA 4WLEA 2B7CA 2Z30A 3D4LA 3Q5GA 3BH0A 3GEHA 3DCYA 4MWSA 4PLTA 3A9TA 3FZGA 4H08A 4TT8A 3GPLA 2A0WA 4QM6A 1TAHA 3CBQA 4KXXA 4GXQA 1DZ3A 5DCUA 4JI8B 2A58A 1V39A 1FSGA 1E1YA 1P2GA 5ALSA 3KD3A 1P62B 5FHRA 4MDEA 1PRYA 2VTEA 2IHTA 5B1HA 4C4SA 4FFBB 1B6TA 2XJ4A 3ESRA 3K16A 2P4HX 3F8TA 3H4VA 3E5HA 3ZDXB 1W5BA 4QAJA 5KOHB 1MRNA 1WMSA 2D0OB 3ASUA 2F8MA 4I08A 4WW0A 3IBSA 5F4BA 4D4LA 1GNQA 1N8TA 1MG5A 1NLZA 3JQRA 5J58A 1VBFA 3W2HA 1B3BA 1Q15A 3C85A 5E2AA 5K8LA 1FDRA 2R47A 5CT5A 4ZPJA 2ZBPA 4IDCA 1BS2A 1SKQA 5FADA 1IXYA 3H1FA 3ZCQA 2PZBA 1E61A 2HRRA 3BYZA 1DOAA 2YW9A 3C6BA 3DQPA 4Y1FA 5FO1A 2XBMA 5MFZA 4BFZA 3WJAA 1C8LA 1LDNA 2KBFA 1HDXA 3AONB 4U2KA 3OQMA 3U44B 2AN1A 1V1RA 5HE9A 3ZC3A 2PUHA 1J5XA 1ZI6A 2WKPA 2ZBVA 3OIUA 5FLKA 3WR5A 2B61A 4YRNA 1ESZA 4PAOA 1AF4A 2P78A 1X1AA 3JQAD 3ZKWB 1V4VA 1I01A 3AF5A 5K8VA 4DE5A 4TKVA 1UPAA 3IHLA 2C58A 2X5NA 3HGQA 2F59A 3FPLA 3KHSA 1I6KA 2R7AA 4GT1A 4M89A 2J4DA 4YNBA 2QPAA 5ETJA 4AMGA 4EL0A 4QRHA 2ZXFA 5KWJA 2Q9AA 3FYCA 1N75A 4IUCS 4BMVA 4HAVA 4LBVA 2UVPB 3QV2A 4O4HF 2Q5IA 4WN9B 2YC4C 4TZ0A 2GK6A 2IS4A 1QYCA 3OC6A 5KOIA 3C1UA 5LMNB 1CNMA 4UUOA 4LRUA 5KEIA 3OEWA 4AQ7A 2Q3EA 4NS1A 2IRWA 2HCBA