3IAFA

Structure of benzaldehyde lyase a28s mutant with monomethyl benzoylphosphonate
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
554
structure length
553
Chain Sequence
AMITGGELVVRTLIKAGVEHLFGLHGHIDTIFQACLDHDVPIIDTRHEAAAGHAAEGYARAGAKLGVALVTAGGGFTNAVTPIANAWLDRTPVLFLTGSGALRDDETNTLQAGIDQVAMAAPITKWAHRVMATEHIPRLVMQAIRAALSAPRGPVLLDLPWDILMNQIDEDSVIIPDLVLSAHGARPDPADLDQALALLRKAERPVIVLGSEASRTARKTALSAFVAATGVPVFADYEGLSMLSGLPDAMRGGLVQNLYSFAKADAAPDLVLMLGARFGLNTGHGSGQLIPHSAQVIQVDPDACELGRLQGIALGIVADVGGTIEALAQATAQDAAWPDRGDWCAKVTDLAQERYASIAAKSSSEHALHPFHASQVIAKHVDAGVTVVADGALTYLWLSEVMSRVKPGGFLCHGYLGSMGVGFGTALGAQVADLEAGRRTILVTGDGSVGYSIGEFDTLVRKQLPLIVIIMNNQSWGATLHFQQLAVGPNRVTGTRLENGSYHGVAAAFGADGYHVDSVESFSAALAQALAHNRPACINVAVALDPIPPEELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Active-site engineering of benzaldehyde lyase shows that a point mutation can confer both new reactivity and susceptibility to mechanism-based inhibition.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
molecule keywords Benzaldehyde lyase
total genus 175
structure length 553
sequence length 554
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.38: Benzoin aldolase.
pdb deposition date 2009-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain
A PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
A PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iafA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iafA01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3iafA02
4J16C 4KXVA 3EXEA 4RJJA 3HWWA 2V3WA 2VJYA 4KXQA 4C7BA 5MFPA 3EXG2 3JR3A 5EJ4A 2JI9A 1ICIA 2E6KA 5ESDA 3FZNA 2BFDA 1ITZA 3PKIA 3DVAB 1E3TA 1Z8NA 4RJIA 2X7JA 1TKCA 4BVEA 1ZPDA 2BFBA 5K2OA 2G25A 3DVAA 4O8ZA 4JT8A 2Q28A 1X7ZB 5ERYA 5I4IA 4MPPA 3ZHSA 3GLUA 5EJ6A 3LQ4A 2H2FA 2JI8A 2BP7A 1WCIB 2C3OA 1M2GA 4GM0A 1M2JA 2OD2A 1YHZA 2Q5JA 5EJ9A 3LQ2A 4MPRA 1X7WB 1X7XA 2JI6A 3UPTA 4RMJA 4UUAA 2EZ4A 2EZUA 2W93A 4JU9A 2UZAA 4JUAA 3M6LA 3CLTD 2PANA 5I51A 2C3YA 1PNOA 5EJMA 5BWLA 1X80B 3FSJX 3UK1A 1OLSA 3ZHUA 4L2IA 4COKA 2H2IA 3AHDA 1JSCA 1RP7A 3D7KA 4BVHA 3AHIA 5BWNA 3PDHA 2EZTA 4UTZA 2BEUA 1M2NA 1MCZA 3DUFB 3U3DA 4C7VA 4MZXA 2HJHA 1PNQA 4J1TC 2OD9A 4BV3A 1GPUA 3FLMA 4Y6LA 2WVHA 3AHEA 3OOYA 1O96B 3DUFA 3OE1A 4FEEA 2BFCA 3RIYA 3LQ1A 2H4FA 3LPLA 2VBGA 4JU8A 4JSRA 4C7XA 5I5GA 5ERXA 3EXIA 3IAEA 1UMDB 3AI7A 2XT6A 3DV0B 2QQGA 5K6TA 4V1CA 1Q14A 3ZG6A 1V1RA 1QGDA 4K9KA 5IMSA 4HDAA 4X3PA 2H4HA 2IHUA 1V16A 3PKJA 1SZDA 3EXIB 2WVAA 3CLRD 1T9CA 1HZZC 2BEVA 4QPZA 1YTLA 2IEAA 1OLXA 4X3OA 2BFFB 2H4JA 2JIBA 4FEGA 4G1CA 2FSVC 4IG9A 4C78A 3U31A 1IK6A 3GLRA 1PI3A 1U2DC 2O1XA 3RIGA 4I5IA 4TWIA 2PGOA 4KXYA 1YNOA 5EJ8A 5HJEA 4BVBA 2AG1A 3HWX1 1V11A 5MFZA 2G28A 3EY9A 4R8MA 1Q6ZA 3AHCA 3HYLA 1X7YA 4K9PA 2JLAA 1M2HA 5MGNA 2VK8A 3EXFB 2Q5OA 2NYRA 1POWA 5FYQA 1DTWB 2Q29A 2WVGA 4D5GA 5DEIA 1XLTC 5D7NA 4ZP1A 2J9FB 1NGSA 1W85B 2OO5C 4UTXA 5AHKA 4JD5A 2PGNA 2H59A 4FVTA 1V1MA 2BFEA 2VBFA 1UM9A 4GM4A 4KGDA 4BN4A 3IAFA 4QQ8A 5MF6A 1NM5C 3JWPA 3E9YA 1L8AA 3EXHA 3AHHA 4K9MA 3MOSA 4JUDX 2C42A 1V5FA 2BFFA 1Q17A 4IF6A 2A1TR 2J9FA 1OZGA 2EZ9A 2QTAA 2H2HA 1W88B 3EXEB 1PTJC 3D4BA 2BFBB 1YD7A 4BN5A 5HHTA 2IHVA 1N0HA 1UPBA 1R9JA 4JUCA 3GLTA 4K9NA 3CLSD 1X7YB 4KXUA 1B0PA 2BEVB 4F4UA 3ZGOA 3DV0A 4V1CB 1QS0A 1OVMA 1T9DA 1U5BB 4JUBA 2YIDA 2UZ1B 1V16B 1YBHA 1EFPA 2H2DA 2O1SA 3K35A 2VBIA 1X7WA 1UMCA 4GPEA 1OLUB 4UUBA 5EJAA 4Y6QA 1PO7A 5I5EA 1W85A 2OORC 4BVFA 3EXHC 1Q1AA 1TKBA 1V1MB 2BFEB 1X80A 2IHTA 3AHJA 1UPAA 2YICA 1S7GA 2G67A 2BFCB 3M49A 1TRKA 1MA3A 4KXWA 1V5EA 3F6EX 3ZHTA 5K3SA 2BRUC 1V5GA 1T9BA 4FZ3A 2QQFA 3ZGVA 2BP7B 1QPBA 4MPJA 3EXFA 5DGDA 2JGDA 1UPCA 4KXXA 1U28C 4RMHA 4UU8A 2R8OA 1D4OA 1V11B 4RMGA 2FWNA 5EXDA 4GM1A 1DTWA 5EXEA 4BVGA 1QS0B 4QELA 1YC5A 1BFDA 1OLXB 3KOMA 2R8PA 2EZ8A 2C31A 2FN3A 3ZHRA 2XTAA 3F6BX 4KPUA 2XT9A 2H2GA 1OLUA 1EFVA 5HYVA 1NI4A 3CLUD 2NXWA 1PVDA 5C4IA 4K9LA 4D5EA 2JI7A 2QTCA 1Y9DA 2BFDB 4MQ5A 1UMDA 1T9AA 4XEUA 4UU7A 5HGXA 3AHGA 1PT9A 3ZHVA 1J8FA 4BUZA 2OD7A 1X7XB 4K9OA 2C3UA 2BEWA 2OZLA 2R5NA 4ZZIA 4GG1A 1POXA 4JT9A 1UMBB 2C3PA 2JGDB 4K9QA 5K6RA 1YHYA 3AHFA 1UM9B 5EJ7A 2VK1A 3L84A 2C3MA 2OZLB 4L3OA 4GP9A 2Y0PA 2FR8C 2DJIA 3CF4G 2UZ1A 3ZHQA 4F56A 1M2KA 5FEMA 1V1RB 1X7ZA 2B4YA 4WBXC 4TWJA 2A1UA 2JLCA 1YI1A 1YC2A 1OZHA 4V1CI 1TKAA 1UMCB 3EA4A 4BV2A 1PYDA 2Q27A 5EJ5A 2FRDC 4UTNA 3RIMA 1DJLA 2Q5QA 1O97D 4UTVA 2BEUB 4UTRA 3M34A 1KEKA 1OLSB 5DGTA 3GLSA 3EYAA 1U5BA 3D81A 1OZFA 1S5PA 2VK4A 4RJKA 1UMBA 4RMIA 3EXHB 4IAOA 1U2GC 2BEWB 4JUFA 1SZCA 1AY0A 1U31A 1WCIA 2AG0A 5BWOA 2PDAA 4Y6OA 3EXG1 4Q9DA 1NI4B 3M7IA 1W88A 2Q5LA 4HD8A 1YI0A
chains in the Genus database with same CATH superfamily
2JGFA 4J16C 4MRAA 1QH8A 1E9RA 3L40A 3IE2A 3HKDA 1OFUX 3LUDA 3WAGA 1DIGA 2PX6A 3KBBA 3J80A 4P08A 1YGYA 2P11A 3LTNC 4TMTA 4G85A 4TGLA 1P0QA 4I2NA 4YWHA 4CM7A 1EXDA 1PR6A 5C3UA 2N1MA 1KJQA 4GSKA 1XP5A 4MWDA 5A3VA 4DMCA 3WWEA 1C0PA 1GPMA 2E18A 3E22A 5ELMA 1PQYA 1W0JA 5A7FA 2P6PA 4QPNA 5P8WA 1DBSA 1E94E 1GN8A 3JR3A 3PSAA 4Z53A 5FWXA 1AGRA 2C00A 2OBLA 1ENZA 3I8OA 2BD0A 4H7HA 2UYYA 2PVPA 2OY0A 4JI8B 2H5LA 4DHWA 4V2UA 4BGEA 1Q11A 3CJRA 2WUWE 1BCRB 4LZPA 5BWMA 5HGJA 1ZSVA 1PYGA 4AUEA 2AJ8A 4RZQA 2REXB 4I8IA 3WOHA 4GE0A 1U6KA 4CCYA 4HDMA 2PBRA 4NAUA 1A4UA 3ST7A 1ITZA 4HYYA 4N18A 3D7RA 4YIKA 1LD3A 1Z7YA 4NFLA 2YS7A 10MHA 2ID8A 1FSZA 2VUSA 4A2CA 4DLRA 1NVBA 2H3HA 3OIFA 4JP2A 2R1VB 3E53A 4RHXA 4F45A 1H2FA 3RROA 1SKAA 4DNXA 1GU0A 1K7XB 5DI3A 4D4IA 3ZDDA 5K2OA 4B79A 3BPSA 4PHCA 1D1PA 1ECJA 4KFCA 4BWGA 4KQHA 2EIHA 4FZ5A 4II7A 1NBEA 4XAQA 1YKSA 1KYYA 1JRLA 4TQGA 5C1OA 4JT8A 1I6KA 2PYZA 3IXLA 2B8EA 1G8SA 2HF7A 4GLFA 5IAGA 2R8BA 1GZVA 5A2QA 2JFOA 3V9PA 4HDRB 1PWHA 4RIGA 3HCBA 4U7WA 1WCIB 2Q4TA 1GYQA 2BGTA 2X1MA 4UHHA 2PSJA 1QP8A 1N5JA 4ZTBA 1G8HA 1ODFA 5CA0F 3VC2A 1P3Y1 2FZKA 1W4LA 4KH0A 5BN4B 5KSYA 4EG6A 2ORED 3W2HA 1J0CA 1VL0A 2PV7A 3JR7A 4LNUB 3L06A 3I72A 4IKEA 4RMJA 2J33A 4YJ2A 2ZZKA 1M74A 2X76A 3A9UA 3KJHA 1E9AA 3FNEA 4KR0A 3B1XA 3GCXA 3PDCA 4LJYA 3Q6NA 3L8EA 1FW6A 2VZ0A 4DMLA 3ESCA 4JUAA 2XADA 5JRJA 3LGAA 2YZGA 1WXDA 1V4VA 4I8XA 4TRRA 3VVLA 1PG5A 1U7PA 3WGMA 4KACA 3BWEA 4R8LA 2R66A 3WTCA 3B2EA 4GOXA 1AG9A 3OD1A 3PD0A 3SDBA 1KZGB 4GT1A 3RVRA 1BDHA 2HJRA 2OK8A 3NG1A 1L9KA 2A0YA 1FS4A 2BMJA 3GPBA 3OD5A 3TXYA 2ADMA 3LBNA 1IXSB 4R8RA 5DBOA 4CT0A 1RP7A 3PEUA 1JR3D 2NZXA 3C45A 2WFLA 1NIJA 2YIJA 1LBEA 2R6CA 4U3JA 1YB4A 2CLKB 2LD4A 3H04A 1HNXB 1O89A 2XV1A 3IUJA 2I33A 4WKOA 1AA9A 1K7EB 1FVOA 5D3ZA 5JYCA 4X8HA 1OYVA 1E2IA 1YA6A 3LRXA 5EFZA 4B7ZA 3RC1A 2GZAA 4NVRA 5C8YB 2IF2A 1FTWA 1P1KA 3IYLW 2OR3A 4A0RA 2XBLA 4CDNA 2IDMA 2PT5A 1CEEA 1YNSA 3E81A 1KKUA 2C4VA 1ZAKA 3KKLA 4UD6A 3GCGA 3FG9A 3G6WA 3UAZA 1JP7A 1DBIA 2QK4A 4TRJA 1XDSA 4E5KA 5BSHA 2WP8J 5DT2A 3W8RA 4EH1A 2J5XA 3E35A 3CB4A 1HDOA 4ZI7B 1OI2A 2AOXA 3D6VA 3NONA 1O08A 1RT9A 1D4AA 5DX1A 3C4QA 3DEJA 3AFNA 3N2GB 1JLKA 3BX1A 3LIPA 3PR1A 4D56A 2QOEA 3VKFA 3A4IA 1RRCA 2ZR7A 4JU8A 5K0EA 4H4DA 4RFVA 3LRPA 3VDRA 4CEJB 1L1RA 5TVGA 2W37A 1V39A 5TQ2B 1I4TD 5JPCA 1GV0A 1KOJA 3A7DA 3V46A 3V8RA 3L4BC 2ANCA 2B1IA 5CFMA 1PQ4A 1R1DA 3EDOA 3PDIB 3LA6A 3ZWOA 1U1DA 2B0CA 2P0EA 3R7SA 1BX0A 4L0MA 3C43A 3QX3A 3RPEA 2H92A 4L50A 4PXAA 2BIFA 4HDAA 4ZVLA 3R6DA 4I3HA 1M66A 4ZCRA 3MOGA 3PEEA 1REQB 3FTDA 1U0JA 1M67A 2WJAA 4BFZA 3I1IA 4IOJA 2ZRQA 3EXIB 2E4XA 2WVAA 3E5RA 3AINA 3W3AD 4M1MA 2IYXA 2HZBA 2FYTA 4FP9A 4B3GA 1KEVA 3PT9A 4ARUA 1EJBA 1YTLA 1G21E 3BWBA 1RXSA 4Q1BA 1RR6A 5H4HA 2HJSA 1TU0A 4ZT3A 4DLAA 3OX2A 3M5CA 3Q5DA 1V0JA 5TT1A 5KOHB 4ZYTA 1K08A 3B52X 1EBBA 2QW1A 3CTPA 3TLGB 5KTTA 1IG3A 3KQNA 1DFGA 3STUA 2FJUA 4KQCA 4X1YB 5AVYA 4J03A 2QEQA 1PW5A 5FUQA 1QYXA 4I1RA 4MWCA 1OWLA 4O1MA 1E3MA 3F73A 1R4NA 2Y68A 5IXJA 1PI3A 3S2SA 1SUBA 2O5EA 2RH9B 4LUCA 3RI3A 5A9TA 2R2AA 5HE9A 5JPIA 4AFNA 5BMVF 2VYQA 3EMDA 1RM5A 4BLSA 2BGKA 5EWMA 1DXOA 3QRWA 3KJXA 2P30A 3ZDXB 5F7OA 4AY4A 5I7FA 4W99A 3GK3A 4WVLA 4OQLA 3TMKA 1WRBA 1P9NA 3GG2A 2H7YA 3PKZA 2O0KA 2WT4A 3DS8A 2P27A 2QVZX 3IAAA 3PXEA 4KYUA 3DB2A 2JFYA 4UBIA 3VPDA 3I9OA 3P5SA 4KREA 3SQNA 2ETVA 1DKQA 1PP4A 4I6EA 1NVFA 4OHMA 3O3CA 3NUZA 4ZVMA 4O1IA 1DT3A 1Y6QA 2ZYWX 4NJEA 1EWRA 4URHA 5EXTA 1LRLA 1SC1A 4Y2PA 1S3FA 5TQ0A 4IZIA 1ZK4A 1Y4AE 3BCHA 3PDUA 1QRTA 2BBSA 3ANTA 5TT0A 4P35A 4ACBA 1CEXA 3I4CA 1WUIS 2XNJA 3PGJA 4MVYA 3T9AA 1L7QA 1L7OA 2ZWVA 3DZIA 3FTNA 4YUYA 1W5SA 5A6SA 4JIGA 1EFTA 4NG4A 1ZLYA 3LWBA 1DUSA 1KAHA 2P7HA 4I5DA 1TYEB 3LHFA 2AX3A 1KFCB 3O95A 1U94A 4IJWA 4G86A 2XRYA 2ZIFA 3GQVA 4JI1B 1N7JA 2DTEA 1DEHA 3T3OA 1L3IA 4IDGA 3T3IA 3ETGA 4B32A 1XDUA 1B8NA 1E8MA 3HVKA 1E89A 3OZVA 3RIHA 3JWPA 4CMKA 4EW6A 1QF6A 5ARDA 3H83A 2G80A 4W9NA 1I5RA 4F2PA 1YOVB 2ZBPA 2Y93A 2GRJA 5AJWA 2C42A 2EXXA 2G83A 5JXIA 3LY8A 1QDEA 5JFTA 1XAGA 3PFNA 2C4MA 1A98A 3LRTA 4MO2A 1LLDA 3I2GA 5ALYA 2HA6A 4TSRA 1O54A 4X0EA 4R3UC 4WK6A 1JWBB 3KVRA 2PKCA 4XDYA 4XDHA 1WUKS 4XYMA 2ZQYA 3NDIA 521PA 5KPDA 1SURA 1N0HA 4QDKA 4BX2A 3PRKE 3T06B 5EPUA 1EB8A 4CKZA 5EPOA 1XRQA 4Q1AA 1MU0A 2BTOA 2UVQA 3EZLA 3G1UA 3C85A 4MIOA 2AOWA 1J4AA 3AEQA 3QWBA 5H80A 4NKRA 3UB3A 4C05A 5IASA 1YFLA 3T1VA 4F4UA 1I4LD 4YAIA 1IC6A 1JU4A 1DAPA 3EZNA 1XE3A 3ET5A 3R5XA 5C8ZA 3IT0A 1TUBB 1DMSA 2VRBA 3ZGOA 2AEFA 1R0SA 1CUZA 3RANA 1RC0A 1XELA 5C1IA 4M89A 4KAJA 1TCUA 3EFOB 3IEIA 4DCNA 5CFOA 2OLJA 3PD7A 5C9ZA 5JSUA 5JZMA 2P4HX 1N7GA 5SZIA 4N8DA 2C58A 1J2JA 2GSWA 2O1SA 1XXHE 4LDZA 4L72A 3LE8A 4NESA 2HQSA 4R2XA 3PX3A 4R2JA 5AVJA 2PQ2A 3UV7A 3LUKA 5CA1A 5IT5A 4TUYF 4WCFB 3MINB 2E49A 2ZBEA 3DV9A 2G36A 3KPVA 5A4FS 1Q1AA 2HHAA 3BZUA 2IIVA 3ENWA 3R20A 3TDKA 2X4DA 2HUPA 2G9VA 2VPZA 4JHLA 4ADSG 3IVCA 3PQDA 4CF7A 3GBSA 3ITKA 4U63A 2IPAB 2J9XB 3QX9A 4DUZB 1TRKA 3DLIA 4IDOA 2ZZNA 3WYDA 4GKJB 2ONKA 4YRKA 3ZV3A 3Q40A 4MXDA 1JXQA 1H2RS 1SKUA 5BRJA 3HJUA 4AQYB 4EB6B 5FT9A 4Y1RB 4Q19A 1Z25A 1SU7A 3QE9Y 1VCNA 2BP7B 3F9RA 1QPBA 4GU5A 5BNWA 3EXFA 3GRFA 4GGMX 3MT7A 8MHTA 2VTKA 4ZCPA 2W6ZA 4G0PA 1WKCA 2Z5FA 3K20A 5JMPA 3EWAA 1YU9A 2H9AA 5KZMB 1NA5A 2DJ5A 1UBFA 1T0PA 4WZAA 4D6PA 4ER3A 5EEGA 1G9XA 3L7MA 1KGSA 4DDWA 4R6XA 3DBLA 4F6RB 5IAOA 3AUKA 1K75A 2QMEA 3ICOA 4D9IA 1YE3A 1T6YA 4JQCA 1EK2A 1C81A 2FSUA 1R4MB 3RWMB 3KOZA 1D04A 4URVR 3EUEA 3KKQA 4D0GA 3WWOA 3VDXA 1W96A 2O3SA 4HNHA 3ZE1B 3L7JA 3CX8A 5CGZA 4XOUA 2C5HA 2I29A 3IE0A 3OP1A 3EE6A 1XTRA 3ZTYA 1BXZA 4KPUA 4KK3A 3WFJA 2RC5A 4MUGA 1SRQA 2IYUA 4GC5A 4RHUA 4ZVRA 4BLRA 2PJUA 4QUJA 4Z3DA 3RS2A 4PX2A 3W1EA 3EGEA 1DIAA 1JZTA 2NXWA 5LOVA 1FFBA 1B6RA 1K06A 1C8KA 2ZU6A 1PFVA 3FNIA 4RVUA 1TYCA 1FTGA 1GCAA 4PV7A 1Y5NA 2ATIA 2C4KA 5DASA 2ZIAA 1XLWA 1XTIA 2CSUA 4FKZA 4LRUA 5EHXA 2IX3A 2BCGY 3LVQE 4B44A 4MQ5A 3RHFA 5NULA 3COPA 1ZUHA 3QMMA 5JASA 1DX9A 4HSGA 1S3SA 2B4RO 4KGVA 5KJEA 1A8PA 1D7AA 2ATEA 5JDIC 3ZDZB 1A5ZA 1O95C 3OBBA 4NK4A 1WV0A 5DCWA 4KFSA 3KZNA 1VXOA 3B1YA 3W5DA 3WRXA 1GKYA 4YRLA 3ONVA 4N0PA 3R3SA 3C14C 3GGOA 2YL2A 4KWHA 3ZW8A 3I52A 3THYB 2ODPA 3D6MA 2NNWB 2OCBA 1M7GA 2RK3A 3O4FA 1EYZA 4HKTA 2OZLA 4L08A 3WHKA 5ARBA 3BICA 4PVDA 1POXA 3ZWVA 4CTNA 1WXQA 3FWKA 1VL8A 4J91A 5E7IA 4TVBA 2V1XA 4O4LA 1FFEA 4RQTA 3CC8A 4U7HA 3KZCA 4C89A 1GR0A 3UC9A 4FN5A 3VJMA 3K9FC 3ZE6A 3S8YA 3AHFA 1A5SB 1VLZA 1Z5ZA 2ID7A 2JL1A 1KE2A 4CGZA 1BE6A 1UM9B 3ETJA 3T0GA 1JIKA 2X5NA 2D2VA 1ULAA 4OFZA 3R0VA 4URFA 4B3BA 3GEGA 4E11A 1G6OA 4RL6A 4UAUA 4EFLA 1NTRA 4MWZA 3TLJA 4NBSA 4G9GA 1YOVA 2FSPA 4AURA 5IJAA 2YHBA 1YZNA 3B36A 1K86A 3HN2A 4UAGA 4BLQA 3GVIA 3HH8A 3EGDB 3DPUA 4CRWB 1DOHA 2IGBA 3S27A 1NV9A 1L7VC 2IIPA 3WLAA 5CFPA 4GRDA 3FF1A 2JLCA 3S68A 1YI1A 4QO7A 3L6OO 2QTTA 1G8JA 4ZT7A 4L78A 1BTOA 4H7FA 1L8OA 3KCQA 1NOKA 3IB3A 3ZH9B 3ZK9A 2PYDA 4INOA 3ZCRA 3TR5A 3D3QA 1T15A 4I50F 5FBKA 4KWEA 4NENA 5E7QA 4EJMA 1OH8A 3ZLJA 2CVPA 5B1DA 4Q9LA 1Y3HA 3LDGA 4JFRA 1P44A 4B4WA 1IFXA 1AQNA 2IYOA 2JGMA 1XZLA 2QNBA 1UBKS 1P4JA 5TS2A 4JBLA 2O19A 3T61A 1AKEA 5BVHA 1BMTA 4B3XA 1YUMA 3KHKA 4KMRA 4QTUB 4ALJA 4OK6A 3C97A 3IXMA 1OYYA 4X71A 3HL4A 3B7PA 13PKA 4GOLD 4J0FA 2JDIA 1JHQA 5AW3A 2GYWA 2HXSA 1AN9A 1TQ6A 4WHMA 5EMHA 1U80A 1Z2AA 1UK7A 2UYGA 4UVHA 1A5BB 2NZJA 2X3UA 2D06A 1ZK3A 4XTRA 2PSHA 4JUFA 5TGTA 5EYPA 5L3VA 4Z4QA 2O8EA 2CNNA 2RHHA 1NN1A 4O08A 4Q6WA 4F5WA 1ZY2A 4GBED 1DJQA 3CZ4A 3FNFA 3THSA 1E1YA 1UWLA 3CN7A 3ZY3A 4CM9A 4EB0A 1JX6A 4IRUB 2WYOA 1QQ7A 4CG0A 2Q5LA 5C7OO 1VLMA 5JS6A 3I0ZA 4BU1A 4XPIA 2DR2A 4NU0A 3R8CA 1OPRA 1VE6A 1IN1A 1OW3B 1J2RA 2OL4A 2R4QA 3GCWA 2ZAYA 4HWPA 1HFEL 3ASZA 4PLCA 3GBPA 3TZQA 4BJHB 3MWFA 1DIHA 4X5OA 3JYPA 3BWDD 3ECAA 2W6ID 4UCXA 1CY4A 2PUAA 1V96A 1UDXA 3G6KA 1YDGA 4FJ2A 2Q1XA 5H59A 1V5WA 2J3QA 5IJ0A 1DHRA 1E3SA 3EEOA 4MQMA 3TRHA 1QHEA 5LUAA 3VAAA 2WB2A 3ZEAA 3DZJA 4MW9A 2P6UA 4XUEA 4ZCMA 1DG3A 1QVAA 3MT9A 4UZSA 1B15A 1HLDA 1TT7A 2C8LA 4GMGA 4R2KA 4KSYA 2X0EA 3C3XA 2Z5VA 5AI9A 4KWTA 3MHTA 1Y8AA 1ZSNA 1YXMA 2FWBA 4O02B 5LXTB 2RCYA 4YVFA 3RLFA 3JW8A 4BATA 4ESEA 4EJ2A 3A9WA 3DKPA 3L9XA 2I91A 4HXGA 4Z6KA 2HJ9A 4R5MA 1GKKA 5THXA 3LF2A 4UUOA 2LZ0A 3FUTA 5CT4A 2BFBA 3IRVA 5DSXA 1N78A 3VXKA 1QDLB 2QQ5A 3GAAA 4HVTA 1ZUNA 3BGSA 1YDHA 1GZHB 2WKRA 3GARA 4FFOA 2FZ5A 1B43A 3OVMA 3WQQA 3TQHA 2FMHA 1NIPA 1U0FA 2W6IA 4JY7A 1X7ZB 4AP6A 5I4IA 3GLUA 4QRDA 3LO5A 2OP0A 4CM8A 3IUNA 4DWVA 1PBTA 4IIXA 5TV2A 3BD8A 3ORFA 4GBJA 1GT6A 2GN6A 3CSUA 4WN9B 2ZJ6A 1SOUA 1RWWA 2C3OA 3ELBA 1Z74A 3HY3A 4ENRA 3A4YA 4UAVA 3H9CA 4HXFB 2BSXA 4WXHA 2Q4RA 1RYMA 1G20B 1RM4A 3AH8A 2CXUA 1QZ3A 2XNCA 4CN9A 1X7XA 2B2XA 3ODGA 5DE3A 5FB3A 1UBCA 3UNXA 3BB1A 2YZMA 3JATA 1FFHA 1ZICA 1FVHA 4KODA 3GW8A 4OI0A 2DFVA 3EN0A 1W25A 3AR8A 3IAUA 1Q2UA 1KFEB 2O2JA 1A9TA 3M4NA 4FMCB 1NHGA 5CX1A 3A0RB 5F5NA 4YDQA 1AB6A 1UODA 1XDGA 4MYSA 1NLZA 4LV8B 3GFFA 2O54A 1H05A 5KC9A 2ZAOA 5BSWA 3TIXB 4L3VA 3HK2A 1T0JB 4B3FX 3WMGA 2AOUB 2FEPA 5EKXA 1YCHA 4RVCA 5IF3A 3EF1A 1NMEA 5B12A 2PX8A 3GA0A 2C2MA 3KQLA 3HY6A 4X24A 2W2XA 3A1FA 1RCTE 1FXUA 4NBKA 4RPGA 4ZT6A 5I9BA 4C7MA 3R9WA 2J30A 4R68A 3ND7A 2WUEA 4BOYA 3IDFA 4MOWA 2J0EA 4FHFA 4QE3A 3HEMA 2W8BA 4TKUA 1JSCA 2F4NA 2NSJA 1YB5A 4KPGA 4YJ2B 5IZ4A 1H8EA 1KOLA 3FYCA 2FPLA 4HX2A 1T36A 3NHBA 4D9MA 2PGAA 2BCJQ 1R74A 2OAP1 2PH3A 3JU3A 4MGZR 5JSZB 4HWRA 2H54A 2L42A 2NN3C 2JNWA 3OY2A 4GI1A 2QZJA 2IH4A 3LY7A 1JIVA 2XCUA 1IDN1 1RBMA 1XTQA 5BSTA 2AZXA 4U3JB 1K8ZB 4JP1A 4FQ8A 4BO5A 2QIPA 3TPFA 1M2NA 1UBTS 4LZZA 3G5AA 3OE7D 2W2MA 1Y1QA 4A0FA 2Z1MA 1R5BA 4L9SA 4XR9A 4UBNA 5DHSA 4J1TC 5LN1A 2G72A 2PG3A 2FVXA 3G7SA 5ALWA 3TZKA 1F4VA 5CB4F 4V24A 3C41J 3WGHA 1ZKDA 3QWAA 1NBMA 4MIKA 5CJ2A 2GXSA 1E18A 5A06A 3RUHA 2IE8A 1QFSA 3KXDA 1Z63A 5FOWA 1HL3A 5JSFA 2JCYA 4B82A 3OJOA 1UZUA 3U4QA 1EK0A 1Y3DE 2CXXA 1E1RA 2L19A 3CJQA 3CCCA 3HEBA 3O21A 3F47A 3Q9NA 3PD1A 5DBHX 2QF7A 3O90A 4IRXA 3U7JA 4LNUA 2CBGA 4N39A 2ZWMA 3AXSA 4IJVA 1F2TB 3WL6A 5HKBA 4YRQA 5K8JB 1L7XA 2QRNA 4WZAB 3DLPX 3RT1A 3DVSX 3FGPA 2LW7A 3H19A 2JEOA 3AY0A 2VAVA 3D0OA 4R71A 1RRKA 2GARA 4C07A 4U02A 2JCSA 5AK3A 1EE1A 2QG4A 2P9BA 1G41A 3DCYA 1KMHB 3HB4X 4L0QA 4M1EA 2HMVA 4LF9B 1FU4A 1W49A 1UBNA 3C70A 1E6LA 1SOVA 1P29A 3N5KA 3BE8A 3S7ZA 4M7WA 4R7TA 4BEJA 3OAAD 4Q5IA 5T7BA 3VVMA 1RZRA 1T0BA 2JC3A 3B6IA 4MUYA 5K8VA 1MXFA 2GOYA 3PEFA 1JEQB 2D2FA 3PNQA 3RK0A 3KSRA 3OPYB 4XVUA 5C80A 3EAFA 3L07A 3LL7A 5CVCA 2GBIA 2G9QA 4IG9A 3VMFA 1LFDB 3FVRA 1QM5A 2ZKLA 2O7VA 3KLOA 1OV6A 1IM2A 1SUSA 2B34A 4BDTA 1M7HA 1SQSA 4PM4A 3C15C 2E37A 1ABFA 1CERA 1TJ3A 1Q7EA 1Z29A 3STWA 2EWVA 1PL6A 4LGYA 4D8UA 4DJJA 2CFIA 5C31A 3ETCA 3O0TA 4D26A 3TTYA 3IKJA 4XWKA 2NX2A 1UF9A 1LVUA 3KHUA 2AG1A 2QTNA 1ZOOA 1N9GB 1ZVJA 3HXKA 3DBLB 3HWX1 3OCYA 3OSUA 4H3HB 4NBUA 1HM5A 1TIPA 1G8AA 1U1CA 4LJAA 4P2BA 4D2IA 3EY9A 1G59A 3GGGA 1AMUA 2AZ4A 2B5VA 5LSAA 2A58A 1K2VN 4R3WA 2FPIA 4EB6A 5JD4A 3W9BA 1U5CA 2CHGA 2PS3A 3B6EA 4PFSA 4QOHA 1MQSA 4QNMA 2PEYA 2P69A 4GVXA 4HQNA 3EXFB 5CX4A 4ALNA 1W36B 2DUMA 3O4VA 4A8PA 4C7OB 3A8TA 3FYHA 4QWWA 1SCBA 5FA6A 2VIIA 4WLEA 3V8EA 1R5JA 2MR6A 1RD4A 2QT9A 2XUOA 3P2JA 1E2MA 3RE1A 3HP1A 2TMGA 3QPCA 4BEBA 5J4VA 1KTIA 4C0SA 2P1DA 3OT1B 1KIFA 2G3YA 3FOBA 3M0EA 4ZMSA 2YXDA 2J31A 2YXLA 2Z83A 3D6AA 3I05A 3CEHA 3FYUA 3ACDA 1MEEA 1OVGA 1P4HA 3LFHA 3PFBA 2P77A 1GG5A 4G4SO 4MUJA 2QROA 4GKBA 4N7MA 4YFVA 3ED1A 4ZZ3A 3PYMA 4D3FA 1F8XA 4BFLA 1NBAA 5DYYA 5AVVA 3ZJUA 1CULC 3HCPA 3ZWWA 2H1LA 1P5JA 1Z4MA 2O20A 1WXFA 4FSXA 3SC2A 3U7GA 4HRVA 3COWA 4BCBA 3NNDA 2OVBA 3FKSA 5HRUA 3WI7A 2PRZA 4MV7A 1K7SN 1ZMXA 4KO3S 2BWJA 1NMZA 5ESWA 1JTFA 1ESMA 1EZZA 3LX4A 3N53A 3QVVA 5KNDH 1L4FA 3TSCA 2QW0X 3TL2A 1DJOA 1CJKC 2FPPA 4KDFA 2H3EA 1A77A 4U9HS 1JQJC 5EMMA 4BXOB 1OTHA 4W63A 3G5UA 1ZJZA 6PFKA 3F90A 2XCQA 1SN7A 2Q5FA 3DWGA 2BMAA 1OPXA 4QJBA 2R62A 2VT2A 3MMNA 2E1RA 3F3SA 2BHNA 3V7WA 1JZQA 3KR0A 4U0KA 5H7XA 4DDVA 2ZRKA 3GAFA 7ABPA 3GPIA 4HV4A 2QMUA 2GCOA 1FSPA 1OVMA 2JJ2A 5C35A 3X1JA 1T9DA 1X74A 1H85A 3FUUA 3LCCA 4R1TA 2QT0A 2IXAA 3MB5A 1J2EA 4L8VA 3BIWA 4NOJA 2LKCA 4R2WA 1AURA 4I5GA 3HMQA 3U7EB 1IBLB 3EVEA 3ELWA 4OU4A 5J5AA 3A9TA 1FP4B 5AXBA 3UK7A 3R7BA 2HH9A 2NO1A 1QHFA 1RVV1 2ZBFA 3BKXA 1KAGA 3GGSA 3HZZA 2ST1A 3OHMA 1MQAA 1Z22A 3A1NA 2ZUUA 3GEDA 5FV7A 2ZPUA 3IIIA 2ZT6A 1EVIA 5LL6P 4NH4A 3OZBA 1GP2A 1D6NA 1S7GA 2C8KA 2V7QD 3JV7A 4H1VA 4TUYA 3V1NA 1A2QA 3IBCA 4FHDA 3KYCA 5A6SB 1TMKA 3LPMA 1JEJA 2JHCA 5FQNA 1HDIA 1V48A 1V5EA 1UXGA 2DT8A 4FHZA 3FCCA 1W9MA 4YROA 2XKAA 3UYKA 4GGPA 1H6BA 3EA0A 3IQIX 1R64A 1YR1A 3O6VA 1N36B 4QWMA 5FBLB 4F1KA 3R7WB 4LSGA 5L3SB 2J4FA 2XTZA 1DEKA 1AXRA 1CUSA 1W73A 3CO0S 4AJ1A 2J3HA 1SKBA 2QV7A 3QHAA 1PL7A 3GR6A 4ZFNA 3X1WA 2X40A 4G4JA 4OO3A 4JIMA 4EX6A 2PQ6A 3JQBA 2W90A 1ZH8A 2I2CA 5EE1A 2HA2A 3JQAD 4YH1A 2ZSIA 3KQOA 5LQSA 3QVSA 4CQLB 3U16A 1B0AA 2PBLA 2ZUBA 4TXMA 4HN4B 5G4LA 1K5GA 2E48A 5CTJA 3UXHA 2FWNA 5KYUB 2V0NA 1U0HC 3IURA 1KA9H 1SUWA 3CR3C 2H1SA 3O82A 3VJRA 4RU1A 1TZJA 2EV9A 2HU2A 4A6XA 2PCLA 3OLCX 4L0DA 1ACMA 1M34E 3QTTA 4DE5A 4WK4B 3B1FA 4WZBE 2JBAB 2M9MA 1DBQA 4LKOA 4EJSA 3GEBA 1BRTA 1O8BA 4Y9UA 4G0UA 2EEPA 4FYMA 2JARA 4FJ0A 1IM5A 3GF4A 4UVIA 5SY9A 1KSHA 1HOXA 9MHTA 4YQFA 5BQFA 1FFYA 1FBTA 3N28A 1TA9A 2OQRA 1OGYA 1YDEA 3CYFA 1BE0A 1WZNA 3FH0A 1EP3B 1YHNA 3VRHA 4TL8A 3F67A 1TMYA 5SYMA 5JNLA 3L0SA 4JYBA 1M0EA 3DYVA 5BNIA 1SXJB 2QTCA 2PRJA 4R2LA 3WLKX 5I45A 4LZNA 1DKRA 1L5LA 4Y2JA 3CLUC 4XIGS 1KZ4A 1Q15A 2D7CA 1I9GA 3CG4A 1SY7A 2ZIXA 3BB4A 3DEKA 4G65A 5T3UA 1RYHA 4OJQA 1SA0A 4X6UA 4RS4A 4B2PA 2F17A 1BKYA 4PG8A 4EIWA 1PZXA 2HRRA 1GLVA 1J0XO 3DXYA 3NEPX 4OF4A 4ENTA 2X42A 2J6BA 1YUBA 2QMZA 2ZB8A 4IS2A 3NWEA 2VYVD 3M1IA 1JFVA 2MWMA 3K1YA 1KY5A 5FTJA 4BUZA 1S2NA 1WABA 4P3KA 1VE3A 2I8LA 3PK0A 3CPJB 1RKQA 1YJ8A 2ZRFA 3KC2A 3QNUA 2NVOA 4JT9A 5C81A 2PAFA 1F8YA 3LX5A 4HZUA 1NNLA 4YQEA 3HXOA 1J49A 1JXAA 5IXYA 1R3UA 3IILA 2FZWA 4RPLA 3NAZA 5EFOA 2XT0A 2C8VA 3BIFA 1DMRA 4CL0A 1N25A 2ACWA 1CQJA 1CUUA 1MMFB 4KSCA 5ECGC 2GN8A 4GP9A 3HG7A 3RYFA 1W36D 5BR8B 5E9AA 4Y6SA 1GXSA 4DMUB 2A1IA 1I6LA 1MO2A 1UKVY 4RKEA 1J8DA 1B8VA 2NTEA 1RACA 2XB9A 3MF4A 3N0VA 3LLMA 4IF4A 2MMGA 1W5AA 1QC5B 2PLRA 1H0RA 4HATA 2B1JA 4BX3A 1JB1A 2J87A 4WJZA 3QY9A 5B4UA 4ZAYA 2FE1A 3DYBA 1FMTA 3HCWA 4TWJA 4C0KA 1BDBA 5I9MA 5ECYA 2PKRA 2Z04A 3MBIA 4ZAGA 1C4KA 3QPBA 5C8YA 1VJCA 1TKAA 5F76A 3VI3B 4XQEA 4OHZA 2ZWPA 3QFRA 5HWSA 1BGVA 3SE7A 3PEWA 2FW6A 2WJPA 3JVUA 4K1XA 4ZV4A 1Z2NX 1PJZA 4DSUA 3AUTA 3OZFA 3KJGA 3QIVA 2NACA 3I6IA 4L16A 2OG2A 2O2CA 5ANRB 3UW1A 3OZAA 4BPRA 2RK4A 1W0JD 2WA1A 3NHAA 4FGLA 2VNHA 4OY3A 2IYAA 4TTSA 4YDHB 3SBOA 4BZPA 1VJDA 1ZM4A 4OA8A 5BV2P 3KVNA 3FKQA 4CIXA 5SZJA 1IHXA 3DBOB 2WKPA 4OJTA 1VE7A 3MCTA 1K6XA 2GA8A 1U5BA 1WM1A 3JQAA 4IWYA 4NTZA 4F3NA 5IT0A 2HMWA 4BNJA 2PWBA 1YVPA 5AOBA 3AFIA 3FVVA 3GJRA 4UVGA 1TUBA 4ENPA 4AAYA 2YJ3A 1IY0A 3A1DA 3G89A 1WXGA 3SWWA 2I3ZA 1P2TA 3F0TA 1PEKE 2CXOA 2EWWA 2DHRA 4B35A 3OIVA 2WSMA 3H5WA 1G291 2BZGA 4MR8A 5DWQA 3SAJA 5JSZA 1J06A 4ZVOA 5EE5B 3JQGA 3ZQKA 1VFPA 2XKBA 1Z82A 1E7SA 1BHQ1 3IPCA 4LYGA 2VWHA 3GLFE 1C5KA 4ZDWA 1N5RA 1RMYA 5FA5A 3N7AA 4GVLA 2DH5A 4PAMA 3ZY4A 3MUOA 2B8NA 1QNFA 1OXMA 3PT5A 2DB3A 4OH1A 2GCEA 1STOA 1ND6A 4O4IB 5DM2A 3K92A 2Y1EA 1GUFA 5EP2A 4MW4A 4M8SA 1NUTA 1DKPA 1CB7A 4ZARA 1FK8A 4G1MB 3F5QA 3GG9A 3FPGA 4GHWA 1IN4A 4R2IA 1FVFA 1V2HE 2QX8A 5DLYA 4ECEA 5CFZA 3ZU3A 2IDJA 2YXPX 4PRYA 1A96A 4C7BA 1L9XA 4PSUA 4B87A 3HS3A 4IIGA 3WLMA 3IUEA 3AKYA 1E4OA 4XQ0A 3LHIA 4YAEA 2ZJ5A 2BM0A 2C92A 3Q7RA 4JLDA 3OEED 4M37A 3VUFA 1NQVA 5DGCA 6ADHA 2AFVA 2TMKA 3R4CA 3UAXA 1O6GA 4UQLA 1KO7A 3KWFA 3UKDA 3LMKA 4ID9A 1SA0B 5IC4A 4BUJA 1Z6XA 1JXOA 4FYYA 3AUJB 3E23A 1SCUA 3FZNA 5CDUA 1SFRA 5EQJB 2XVXA 1KFJB 3SIPA 4XFKA 2W2LD 4KE8A 4YONB 2W2PA 3HLKA 4J0EA 4RACA 1Y7LA 4UTOA 1RJ9A 4BB6A 1Y3BE 1E79A 4BMSA 2FDXA 2P9EA 4MV6A 3O4IA 5FNVF 5T4EA 4YP9A 1JXMA 1MOQA 2Q2NA 2VDRB 1G3QA 2FPGB 3CFYA 2O48X 3FDFA 4GWGA 1KJIA 5JAQA 4YUZA 4UNNA 1E1LA 5A3JA 3TFOA 1WQ4A 2VHXA 4LTNA 4JA2A 3E2IA 4L6AA 1UBLS 1TF2A 1M2FA 2FJPA 3GJ5A 3G2HA 5DNEA 4FNGA 1GEEA 2BF7A 1NONA 1JLLB 1ZMTA 3MQ4A 2D5BA 3PLNA 3BH0A 1A4RA 2AKAB 1OU4A 4PFQA 1U9ZA 4QYXA 2W6CX 5CX1B 1W19A 4QARA 5JDCA 3CMCO 3TBHA 5IDYA 1XL1A 5LU9A 3EODA 4S3MA 2DFTA 2G7ZA 1GPLA 2Q8QA 4WT7A 3F2VA 4J1NA 1CJTC 1TEVA 4R9NA 4E5UA 5EJ5A 1FLDA 2PFKA 3KJQA 3ZHYA 3I42A 1M54A 4AO7A 2AVDA 5DSZA 4ZMBA 2Q9CA 1H0SA 1AHHA 2V96A 4XOIA 4KIUA 3ZNPA 4M7RA 2MOKA 4RVGA 4AN4A 4W5OA 3CZQA 1J8YF 4GMHA 4KTVE 1GQFA 3OPXA 5E6SB 2VHJA 4LFCB 2UZAA 1MV5A 1P7CA 2OV1A 3D2BA 3M70A 3H75A 5DP2A 4XPZA 3VO2A 1IY8A 3HA2A 5FYDA 4BE7B 2NAFA 2J5RA 4MCIA 3DNPA 1O87A 2PUWA 8ATCA 3C98A 2C3YA 2XCIA 2ZJBA 1TADA 3IQDB 4R8KA 3IGFA 1L4NA 3TBFA 3C3KA 3HU2A 4GQIA 4CG3A 1ZQ9A 1MO6A 1Y89A 3OOWA 1HETA 4B3DA 1X80B 5A5EA 3TO5A 5KOYA 1FRNA 1WZEA 3C4VA 1SEPA 1Q74A 1M7BA 1NKTA 3NVKI 1Z5VA 5AUOB 3C5VA 2PUCA 1NVVQ 2VOEA 2QX7A 1Q0TA 2VLIA 4YQYA 2C2YA 2CEKA 2RGXA 4HDCA 3ZQ6A 3D1JA 1Y9ZA 3TGWA 3HJTA 2VDPB 4WPGA 3DM9B 1SCQA 1ZIDA 2LKDA 2ZULA 3D7MA 3DKKA 4BECA 1IZ8A 2BUCA 4FI3F 1PLKA 4X63A 4KSBA 5F9MA 1P9RA 4ND7A 1C9KA 1OWMA 4N8EA 4RZUA 2HWYA 2Q99A 5BOSB 3HR7A 2AE2A 2IHYA 4DPMA 4PY2A 1NF8A 3SC3A 3T7IA 4YPOA 2CVQA 3EHEA 3I73A 1QLHA 1A2OA 3W6NA 3KT3A 2FRDA 1AKVA 4AMBA 5IPFA 1GGEA 2M32A 5JNUA 2LP4Y 4DMGA 1LPOA 1YZTA 5JSYA 2H0QA 4C43A 2Z2ZA 2R84A 2F4VB 2HNKA 4DWOA 3QVXA 2QMYA 5CLHA 4RWEA 2QUZA 3EK2A 4ITVA 3S8MA 1MEJA 2FPPB 5ITVA 2HB6A 4EWLA 1FYXA 1NSYA 5EJEA 3T3DA 2PEZA 1F6BA 1ECCA 2MDTA 1LI7A 1SKYE 3A6GA 3IB6A 4U2EA 4HS9A 5TNXA 3TLMA 1HT1E 2FOIA 4NEQA 4JSRA 4JYCA 4EB3A 1XKTA 5LVAA 4NL4H 4QUHA 3G9QA 2HJGA 4B47A 3K53A 4IMJB 2A5GA 1QU3A 4V2IA 3RUFA 4PPGA 1TM4E 2EW2A 3IV9A 2XT6A 5EUMA 4F93B 1ES9A 4OL0A 4P2GA 3DTYA 2NO9A 2WD7B 3TQSA 4DARA 2VXBA 3MQFA 5CG1A 2B8TA 5A04A 1JHYA 3VTAA 4YMLA 3CWZA 1KRXA 4URXR 3NW9A 4W9RA 5KYXB 3QU4A 2YOFA 1DAMA 2H4HA 4YRJA 1IZ0A 3JQ8A 1CUGA 5CA0B 1OT3A 4CLDA 3JWIA 1GARA 3TIFA 4QLBA 2WLSA 4IJMA 1RWVA 4L07A 3PXAA 4LZOA 1YE5A 4JJFA 1GPNA 2QL7A 3PV0A 4QXRA 5CLIA 1QIGA 3H2BA 3MSXA 2QSYA 4NCHA 1SM4A 2IA5A 2ATVA 2JD2A 2IEAA 3BE5A 1UT5A 3EG9A 4AF7A 5J2UF 4JT4A 4KXMA 4HWSA 1OLXA 4X3OA 3ANNA 1THGA 4R41A 3CUWA 4OQMA 5HQTA 1UKZA 4CV3A 1AS0A 3EDQA 2CYAA 3HI4A 5K3DA 4UTPA 1X15A 4M2LA 4P32A 2QLNA 5E8JA 1WMDA 1G0NA 1TZKA 2IYEA 2IXBA 3MJTA 1R0RE 2EG5A 2X0IA 3GA5A 4JLWA 4QHSA 4UPDA 2AN9A 3HXPA 3TTSA 1P4RA 4HJXA 1U2DC 2EF1A 2RB5A 2ZB4A 3NANA 2NSDA 4MYTA 3ZCVA 2BDTA 3EJ6A 4X84A 3UJPA 1TXGA 1VI5A 1HZZA 1N2JA 1PJLA 1ZI9A 3DTVA 5EJ8A 4S04A 2HADA 3OM0A 1HLPA 2AQ8A 2E7ZA 3NTQA 2GJAA 5E6SA 3U48A 3NKLA 2PKQO 4PWYA 5HR5A 3PPIA 2CHFA 3FZQA 3GHHA 4KW7A 4QOSA 4X3CA 1UAGA 3AKZA 2MYUA 2NZ2A 4KN9S 3G2LA 4Q16A 1GNPA 4V0NA 4JYZA 5DU2A 3OM8A 1XFDA 4ZRNA 2K7FA 2WZBA 4LC0A 2C9CA 4FB5A 1QIMA 3EDRA 1YBFA 3L0OA 4M8KA 1P2DA 3SEAA 3B89A 4EBBA 1A8HA 4DR3B 2QSUA 1K6IA 4G0QA 4EHIA 5F3DA 1Q0PA 3LKDA 1A9YA 4Q9KA 1T13A 1T2DA 2DUNA 2FQXA 3KLPX 4H0NA 2FP3A 3MGAA 1ZD1A 5AKYA 3V80A 3K31A 2ENUA 4PPNA 1UKCA 2RGNC 1SVUA 4MPDA 4G0VA 2VPWA 4ND1A 2R65A 5JW6A 3CVVA 1XKQA 2ODAA 1VG8A 3CRRA 3EVFA 1J0AA 1KYZA 1KMHA 1ZM3A 4LDPA 3SJAA 2DFKB 3VSBA 5JROA 4AULA 1XRPA 3NJRA 4KAAA 1JPNA 2H59A 5FR2A 4IFEA 2O06A 3O2QB 1A5TA 2NNLD 2O14A 1PZHA 1SVWA 2ZVQX 1JQEA 3PQEA 3QLUC 4KMMA 5J3JA 4Y1RA 3HYTA 5DMHA 1VCMA 2HXGA 1IIBA 2XY4A 3UGQA 2A30A 2GZMA 3K2IA 1IVYA 5FO0A 2II6A 3IALA 4FONA 2ODNA 3C6YA 4F86A 1WOYA 1M5UA 4A8HA 1UKYA 2V6IA 4INPA 3TBKA 4AYTA 4JV5B 3QOFA 1V5FA 5IANA 4I81A 1T5IA 4LPSA 1KZ1A 3VNUA 2YJNA 2HN9A 3LY5A 2Q4EA 2PXXA 3I6MA 1NL3A 4FBGA 5D6OA 1EUDA 3DQZA 4JEUA 5D85A 1O0SA 3TI7A 1W88B 1MHTA 2WNSA 4H35A 1E9SA 3OPYI 4BB0A 3U5ZB 5B3JA 5L95A 1QZXA 4WXMA 3CWQA 3QW2A 1M83A 3K6SA 2ZIXB 3ADOA 3OJEA 1Q3TA 1OFHA 5KREA 2P68A 1Y4SA 3NC4A 1L7MA 2NT4A 3DL7A 1FNNA 1A04A 1ZCBA 2IEIA 1MO5A 1P2BA 1RRMA 5EMJA 3P0IA 4YT2A 3M6IA 3ZNOA 3L2OB 2H4ZA 4FYJA 2ANBA 4FNOA 5DGHA 4E15A 1X7YB 1ONSA 1PLJA 4QEZA 5F7ZA 2HBRA 4WCVA 4HQOA 5LQMA 4B6SA 4QEDA 3DZDA 3N0WA 2F8LA 1WB6A 4H59A 1RJDA 4RXMA 3QKRA 4BZZA 2VUHB 3SHFA 3CONA 2YIDA 4BS9A 2BTQB 1CB0A 3I92A 1DOZA 3LA8A 3CH4B 4AO6A 5C0OE 5CUQA 4ZRDA 2R25B 3B12A 1UFRA 2BF4A 1PJ2A 2C5BA 4UOEA 4ZOLA 5A02A 2OZVA 3FZGA 2HJWA 1QQBA 4L27A 3IMKA 3SIWA 4P34A 2NU8B 2W4MA 2IS1A 3F6PA 3AHJA 1ZZGA 2VF5X 5IKPA 5JBQA 2NP7A 2A9JA 2G5CA 2HO4A 3OZEA 2PH1A 3GHYA 3HU1A 1FUEA 3NGLA 3QLUA 1Q92A 3BRQA 3FPHA 2GBCA 4BQSA 4TMVA 1MN6A 2O7RA 3HU5A 1L5YA 1HYBA 3NDPA 3SP1A 3U4DA 4HMOA 3MWLA 4H1TA 3ZIUA 1T9BA 1AH2A 3H11B 5JRZA 3ZKWB 3H5AA 4R1PA 4MVJA 2CV1A 4YJ3B 1EBFA 2IS4A 3I76A 3H9JA 5KSZA 4U7PB 2I67A 1SHTX 1M0WA 1YF3A 1N5KA 2PK3A 1YB7A 1R6AA 1T36B 2R8OA 1IPHA 2JBHA 5SZHB 4CKWA 4DJTA 4TMKA 4HOYA 1XUOA 2ZS7A 4UHJA 2RE8A 1BX3A 1E3QA 3E7WA 4GRIA 4OLHA 1EG2A 4GPBA 3BSFA 3TNFA 1Q91A 2Q2QA 3AF2A 4P3XA 1CPYA 1MJGA 3QYFA 1GGVA 1M76A 4M1SA 3KQKA 1K8YB 1JTVA 1BN6A 2ORVA 2ZVDA 5FDFA 1JJFA 1K27A 1NULA 2XIJA 3WGYA 2GNPA 4IGIA 2IU4A 3H3XA 2I7CA 4X62B 1PTKA 1SOWA 1W6UA 2H8KA 2IEBA 2AWNA 4XI9A 2V98A 3G5MA 4GI2A 1U2DA 1U81A 3U9SA 4DMFA 3DDUA 1RQ7A 2PIAA 4II2A 1TM2A 1Z38A 4RK7A 4CQMD 5FPQA 5EWMB 2B7BA 2HFKA 4TRMA 4ZO9A 3JRWA 3PGXA 4CE6A 2XF8A 3ENVA 2HF8A 4RETA 1X6VA 3VX3A 1N2HA 2DUWA 4K05A 1M6WA 2YRFA 3WLJA 3HKDB 4C6TB 5TMBA 3FNBA 4AXBA 1G20A 3MSCA 4D98A 5KAMA 4H18A 1P1HA 1ILWA 1P7VA 4AS1A 2RI6A 4ENUA 5GIPE 1VKZA 4J4HA 4WASA 4CKEB 4PFKA 2P9YA 3CGGA 2CSXA 1ZN8A 3FCOA 4DR1B 2Y1KA 4LGCA 2R6JA 2WWYA 1NMYA 2PX3A 3PFCA 4RVFA 1T4CB 5ER9A 5F21A 4J76A 4ZZIA 1C7RA 1TPYA 5ALLA 3G9TA 2ACVA 3DZBA 4Y2TA 3NDBB 4X64B 1ECGA 2M2IA 2VKTA 2AMLA 4CT5A 4DCJA 3ZIAA 3RVSA 2TRSB 4MHSA 4OG2A 3DF7A 1DQSA 2NU6A 3T12A 3O8QA 3ITNA 3VYTB 3JQBC 4B46A 3LNTA 4Z0TA 2QLTA 4WW0A 1EGAA 4EYGA 2IP1A 3P2MA 2FKAA 3DW1X 3GRPA 5KQRA 3S28A 2VYND 1VI6A 1I0LA 4Q82A 4DQLA 5J4LA 1UK8A 1P1IA 2C4UA 1Z0UA 4RJTA 2UZ1A 4KBGA 3ZV6A 4ZK2A 2OAQ1 4EL0A 2HLDA 1M2KA 2XJ4A 3COVA 2DLCX 2B1QA 1GTG1 4MI9A 4NIMA 5KYUA 1ZHOA 2I2DA 1XZAA 3NYWA 3D7LA 4E3WA 4AIRA 4K88A 3BJZA 1H3FA 4IHJA 2QJRA 3QU2A 4B0OA 4JLOA 1K7FB 1XRJA 3RAEC 2WY2D 1XYVA 2AJBA 2EL9A 1TVEA 2YWGA 1F3OA 1FX0B 4LWPA 5EG5A 2Q27A 1EZ4A 1QYDA 2BBWA 2PZAA 4I36A 5AYVA 2OXEA 3UH0A 2R7NA 5D5QA 2PCJA 4BRUA 3L82B 1T2CA 2Y4NA 4OLFA 5GJVC 4TMWA 1PZNA 1ZITA 2WUDA 2WQZA 4BO1A 2BMFA 1PW7A 2YYSA 3EZYA 1N6OA 2BEUB 4K6OA 2HWXA 3V7FA 3RV3A 3MYYA 4YCJA 3T5BA 3VPFA 4N49A 1TL7C 3U19A 4JWTA 2AI2A 2EX0A 2JGRA 2CDNA 4I9GA 1LBQA 4QQFA 4B84A 5JV5A 4I4CA 4H3SA 4MUHA 4CKEA 2CYBA 2YS6A 1RHMA 3AVQA 3LUBA 3G2JA 3EC2A 3HJRA 3K9GA 4L51A 4OOFA 1XZNA 1UQTA 2JGNA 1DRJA 1RRFA 4RVDA 2QN9A 6CHYA 4IAOA 1UBOS 4ESOA 1IL0A 3ZQ4A 3IQWA 2B4AA 4X7BA 2VJQA 2C94A 3AK4A 3QXCA 4UXIA 1SXPA 4M9QA 1Z2EA 4JQOA 4UARA 1G2PA 2JFPA 5CYGA 4GQAA 2HI0A 5GJCA 3U3OA 5BW5A 2DH6A 4EQZA 4YFYA 5CDTA 3CO5A 1O6BA 1OY1A 2VDUE 2XYHA 3DOHA 3OLVA 4P7FA 5CMLA 1W52X 2ICAA 3C2QA 4WX2B 3PHIA 4QBFA 1FIUA 3TQRA 5DNUA 1Y34E 3IUMA 4RCZA 4FOTA 3EXEA 721PA 5FUMA 3U3MA 2EP8A 2GCIA 4ABTA 2CLOB 1E6UA 2HRBA 4ZC1A 1DZ3A 3QVTA 4Q15A 5JJLA 2ESRA 3AFGA 2TSYB 3PC8A 4LCEA 1J8VA 2Y9MB 3GLFA 3MS7A 4NQRA 1G21A 3VVCA 3MAGA 3GLIE 3T9BA 1GN9A 2BGRA 1U8TA 3QU9A 2MYTA 4EVQA 5JO0A 1EEXB 2YYAA 4I9HA 4C30A 5TB5A 1MZVA 2WUVA 5ADUS 4GDFA 1P17A 5BOVA 3FFTA 1U04A 1ZUWA 2MSNA 1L5KA 1P72A 2HD4A 4DZTA 4PW0A 3GC6A 3JASB 4E33A 1VBNA 3WKCA 3KVVA 1LBTA 4XWTA 4N12A 4EF6A 3CRZA 4G1FA 4KE6A 2FDRA 3LXUX 1SWWA 1UXHA 3E70C 4CR8A 2OG1A 4AJHA 3ZXYA 4YCSA 4MUIA 4ALKA 2H65A 3CZ9A 4FNMA 5ER6A 4B8YA 1E3TA 2O8DB 1GAXA 2IQIA 4Q1EA 1KSJA 1CDOA 1YRYE 5CCXA 2H7XA 3F98A 4YAGA 3HFRA 3MILA 4V39A 1ZEJA 2H6EA 2QUIA 3DBRB 2Q1YA 1WB9A 2EKQA 3ZWMA 4NATA 4S1VA 3GMTA 5JFGA 4EPVA 3PHLA 4YAJA 2HUNA 4DQKA 5HKOA 4DRXA 2FPOA 1JQBA 1ZOPA 1Q3HA 5JH7A 3HA3A 4OK5A 3LXMA 3I6ZA 1S8NA 2R1VA 4P81A 4EO4A 4ZANA 1AOXA 1RTKA 1H8HA 1HY3A 5B7QA 4WNIA 2XUIA 2ZT8A 3DB1A 3IAM1 1RADA 3FFBA 4MYHA 3ZS9A 3KQSA 1QP7A 1RWNA 3TL3A 1HNWB 4ZYXA 1OWNA 4IIYA 3KSBC 2QRZA 5DXJA 5LMZA 3EYWA 1XN1A 4J0DA 3PWZA 3A6LA 2XXBA 2YJZA 1JBKA 3QU7A 4PN3A 2A9KA 2OLKA 2LDBA 4YT8A 2CWWA 2BFPA 3TIVA 4UE2A 2WKQA 2WM8A 4JLMA 2BUBA 2C9OA 2IVZA 4P86A 4FW8A 2VP2A 1JIJA 1G19A 3K0AB 1QNLA 2QAGC 4JBHA 4M0KA 1WEHA 3QYJA 3W5AA 4DEXA 4P7GA 1FYWA 4NR0A 1TVCA 1TAQA 4QRHA 3ON5A 4RORA 3C0KA 3M6LA 4BNYA 4EY3A 2AFHA 1WXHA 1N5MA 3CLTD 3PFGA 1IPFA 3NHZA 2JFNA 4U5QA 3ANSA 3LYLA 1AU9A 1Z7GA 4L8GA 5BN5A 4MI1A 5JXGA 1BG6A 1ZJYA 3PLRA 3IPXA 3MS2A 4WUVA 5ED0A 4DB2A 2WQ6A 2ES4A 1K6EA 3ZY6A 3UMCA 2GUWA 4FE4A 5E3HA 4B3JA 1QIFA 5FRDA 1JIIA 3AM1A 2DSNA 2EBUA 2NVBA 2R6HA 2ZRPA 4AI6A 2C07A 4LWOA 4M76B 5SICE 1O03A 5LWQA 3DE4X 2V9CA 1KWKA 1K1EA 1BEUB 2QUHA 1B2LA 1GG8A 3IBFA 2FMTA 1RMTA 4UOZA 1V7PC 1O6ZA 3O73A 1ESDA 2SKCA 4BLUA 4MV5A 5JE8A 1QSGA 3AGQA 2DX7A 3V34A 1E62A 1V6AA 2AT1A 1QX4A 3NO4A 1ZMRA 3MWEA 1WY7A 1KSGA 1EJ0A 3RS7A 1JIXA 4N0EA 4Q4JB 2V7VA 4REQB 4MROA 3ISVA 5IBQA 1V9CA 1Y37A 1KDYA 1IQ0A 3BIXA 3I2JA 1FTSA 5AUNB 2RK6A 3DUFB 3MXOA 4JYMA 4A8TA 3ZCPA 2X14A 3IODA 1OQAA 2HA0A 3C7TA 2L0XA 4YGXB 4RLQA 4IW3B 1U9JA 3Q7SA 4IFBA 3VSEA 3UGJA 1LPMA 3K71B 1Y6GA 3B8HA 2X58A 4V0OA 1RC8A 3B5JA 2NT3A 2WVHA 1Q95A 2E4YA 2HNAA 3R5SA 4J2TA 3ZIDA 3I04M 1GRQA 1LV7A 1CQPA 1ZXLA 3VYRB 1QH1A 3K5PA 4DLVA 1FMCA 1ODLA 1U4SA 2V0CA 3K9WA 4XDGA 1M6VA 4OB8A 3FMGA 2DETA 2ZUSA 4TZKA 2I4LA 2XXJA 2SECE 3Q2KA 5HVNA 2A3NA 5IC5A 1Z08A 1KK2A 2HIHA 1T0UA 3IFSA 4MVXA 4B3SB 3JWEA 3U9LA 5DM4A 4NPCA 3HKCB 5MHTA 1C4WA 3L6DA 3OE4A 3WYCA 4EY4A 2R6ZA 1PVOA 5LA6A 3GCZA 2WQ7A 1Y6FA 3M81A 1WTAA 4P0PB 2FN8A 1JMYA 1ADYA 3C3DA 4QDZA 1N2CB 1RLMA 1Z13A 5FFFA 5EWJB 4EA6A 3W5CA 2ZI5A 4YRCA 2BEKA 1XDWA 2KE5A 3ZR4B 2IP2A 4DCTA 1E92A 1CZRA 1DLIA 1YZFA 2IHUA 1DRWA 4R98A 3X2SA 3OKPA 4WFIA 1HDYA 2H5EA 2QV0A 3PKJA 4TPKA 1BIFA 1XNQB 1OXKB 3BL8A 1ZD5A 1RABA 2DWOA 2CB9A 2Q21A 2QXUA 4Q05A 5E4FA 2BSQA 2V7PA 1SXIA 2R44A 4O2AB 5ULLA 2BJWA 4XJVA 4PGAA 2JIBA 3BDAA 5K3FB 2VDVE 3ET4A 3IP7A 1TYZA 5EJFA 1USIA 3TG2A 1FX1A 4GGOA 1RJFA 1IOZA 3OX4A 3EG9B 3EMKA 4Q1VA 3RAPR 5JNWA 1O94A 4BY9E 2X8AA 2CBZA 3I5XA 5B58C 3QBJA 1MJ5A 4EJFA 1N5LA 1C3OA 3Q7QA 4K40A 4EJSC 5L6LB 3L1HA 2QNIA 2JRCA 2IKQA 4MUXA 2RIRA 1LDMA 2XMDA 3N2KA 4XZ3A 5IM5A 1QFMA 3LECA 4TWZA 2B4QA 2BY4A 3FSGD 3MMXA 3RVBA 1OFIA 4OXIA 4QPJC 1WVIA 3ILYA 4O33A 1ZNWA 1F0KA 2SHKA 3A37A 5BQ3A 3GY0A 5F2KA 2R11A 1OE0A 4A9AA 3TSWA 4JJZA 3ADCA 1FLVA 1QFYA 2ZCJA 5E7MA 3TQOA 5I48A 1WQ1R 4RWZA 4HAVA 1KMNA 5CNKA 4Z0PA 3RIEA 4U6QA 3Q98A 4I1OA 4NECA 1AB5A 3R76A 3U5TA 4MWEA 2FCRA 4UUPA 4QULA 4AUNA 3TTWA 1ZN9A 2PJDA 7ADHA 2CL0X 4Z8YA 1CNFA 2OHOA 2YV3A 3G82C 4IEEA 5CCEA 2D1SA 4BQIA 5MN6A 2P8SA 3EZ2A 5D86A 1IQPA 3WLLA 2J4CA 4HPXB 2LTAA 2RH5A 3BCUA 4NJEB 2IHZA 2QUKA 1REQA 3P19A 1P7PA 1WUTA 4JDUA 3VZPA 3RKSA 3VJKA 3B85A 2AG5A 5C37A 5CBPB 5LYJB 4FVTA 2OILA 1V1MA 1EE9A 1P2FA 1GITA 1FP2A 4LHXA 5GM1A 3IAFA 5DMXA 1VYUA 3BD6A 4YUVA 3VYVA 4XB6B 4ND6A 4A82A 2WYIA 2RKWA 2FK7A 4Z86A 1SZPA 1ORVA 1Z4LA 2BPOA 3I37X 1NW6A 3LP5A 4S1PA 1MQ8B 3LT0A 3SX4A 3VSAA 3P2KA 1ZS9A 3RVQA 2X5JO 2Z1DA 1RWPA 4G9EA 4QGHA 1CFZA 3WLPA 2HIMA 1M73E 4H15A 3INYA 4EUKA 1Q17A 1YR7A 2QW8A 4HUQA 3SHWA 3GOQA 3ORQA 3IMCA 2HK8A 2J9FA 1CUCA 4JEMA 5JR3A 1LGYA 3EEQA 4GPD1 4ZWNA 3VR1A 1F51E 3MCVA 4IVQA 1X1CA 4IWNA 4YQZA 3VHXA 1CXZA 3IMGA 2VP4A 4KPYA 3SJ7A 3GLHE 1GEGA 1XZ8A 4C4XA 1EX9A 4PZYA 3W5VA 1U3UA 3F46A 2FF7A 4FD2A 3V4PB 2XCSB 1EA5A 2VF8A 5D84A 3WDSA 3CZAA 5HK9A 5KTOA 1Z4PX 1LNQA 3HHPA 4TMXA 3OQBA 2GXQA 2AGVA 2AZTA 1GZUA 3LJKA 4HCJA 3Q8MA 4KXUA 3KTDA 2WMNB 1MD9A 5HBRA 1JH9A 3NIDB 1NXXA 2Y92A 2YOGA 7MHTA 4YECA 3CKLA 5B1SA 1UK9A 1CR4A 3QEAZ 4B8ZA 2WAAA 2Z9DA 4QU5A 2GEJA 1C30B 5DPMA 1A0OA 1SB8A 2X6RA 4RK5A 4O1HA 5BN4A 4C14A 2CKDA 3WL4A 2D2IA 5C5EA 5LMCA 4HWGA 2CHUA 2D2EA 2RGCA 5DBIA 1A9OA 1Y3IA 2UVDA 1IBRA 3L43A 5EHZA 2E21A 4LI3X 4UHDA 2G1UA 3I1YA 3TXAA 3OQVA 3ZDBA 1KQOA 3WYAA 4HLNA 2HRCA 2YICA 1G6KA 3DMPA 4HT3B 1T6BY 4QOEA 2G06A 3RC8A 2XQVA 4HP8A 5FTKA 4OMCA 4Q7KA 1QMPA 2A0KA 1RBQA 2W6JA 1PZFA 1QVWA 1XDZA 2XECA 4HNQA 4MICA 3VZRA 4BO4A 1MB2A 4FI3C 3ZHTA 4G67A 5I7VA 4F97A 3J81A 1W87A 1JA9A 1TUIA 2HDNB 3GP5A 4FW9A 4CKBB 2HSGA 2IZ0A 4RXTA 5HKAA 2C5LA 1IJEA 2B82A 2JIMA 1F4PA 2CNBA 1I4WA 4NENB 1R4ZA 4ON9A 3QBTA 2PLWA 3V6MA 2D4HA 4JJ7A 3DGFC 3MT0A 1OTYA 2AUTA 4KHPB 3PXBA 2NUTB 3P2EA 2JHPA 2HR1A 1H42A 1UBSB 2EHDA 2XPCA 4A16A 4DSNA 3CLTC 1E2PA 1YQQA 2VDWB 3OJ0A 1NNEA 2IBSA 5BYAA 2FG7C 3Q2IA 3A28A 2FSHA 1BYUA 1M0SA 1Z3IX 3LC2O 4P6VF 4OQPA 5JPDA 2GJ4A 4TS4A 1HDXA 2RHLA 4B4KA 4IIHA 5MF6A 2X6TA 2YHIA 3IAHA 4CQNA 4A92A 3FBTA 5EHNA 1WMBA 4OQDA 5G53C 2C31A 1X0XA 2FN3A 4N82A 2ODQA 2WU3A 3F6BX 2ZS8A 1TYBE 4MR9B 1E9FA 2YY5A 4MO9A 3WIBA 3EGWA 1EFPB 3TKLA 1XD2A 3B7GA 1E6EA 4H7IA 3QPWA 5T57A 1D4FA 2Q3JA 4I4LA 1U6IA 2AA3A 4MJ3A 1SHLA 3FPJA 3MJEA 3VHLB 2J45A 1YVUA 3THYA 1YA4A 5KYWB 1TTPB 2F7SA 4D02A 3WRVA 5AM4A 1HQCA 3LX8A 2AR7A 3O3NB 2B7CA 4TYMA 4LA4A 4KITB 5TJHA 4LNHA 1V9SA 4WBNB 2IP4A 4AKTA 5BV8A 2AFRA 1XMSA 1YACA 2AJLI 3OQHA 5EC8A 4I3GA 1UP7A 2ZU0C 2P2CA 2CXTA 1HMYA 3TOXA 4CL2A 1EFUA 3TQFA 2KBFA 5DGXA 4YLYA 4WVFA 5E6RB 2BH9A 4IQ8A 5EN4A 2IZ6A 2IEDA 1YZQA 1LLUA 2P2GA 3MNFA 1VPWA 4XEHA 1SUDA 4JVOA 4CHGA 3TX6A 5LQRA 5FL7D 5DI3B 2QDKA 5K6RA 2I4MA 3GDWA 3ND6A 2OXFA 2DG2A 3FPCA 1S2IA 3AILA 3UB4A 1HG0A 1V6SA 3BWXA 4GZ3A 7REQB 3PGVA 3TECE 1H2BA 2PXHA 3H65A 4IDQA 5E95A 2PBZA 2IT1A 3VMMA 3R75A 2GPYA 1HDEA 3QQPA 3PC6A 4NLLA 1GSHA 1S96A 3I9MA 3K8ZA 3VNRA 1B14A 5CT6A 3SICE 4GOJA 3NBAA 4J0QA 2CK3D 1X9IA 5FHRA 1ULTA 5HIJA 2Q2VA 3AETB 4IUBS 2XWQA 5HIMA 2HTFA 2P3LA 3ENZA 2QN7A 3DE6X 3FXAA 3ZOKA 3TQCA 2A1UA 2O05A 4R0MA 1Z36A 4NMHA 1BCRA 3FCSB 2PBFA 3JZIA 4M7OA 3SCZA 2Z95A 1LBSA 3EW7A 4OGKA 5GGYA 2CXRA 2NU9A 5C7YA 2X0JA 5FBRB 4KQGA 1N2IA 3NOVA 4UTNA 4FWTA 4BX8A 2O0LA 2CVZA 1AS3A 1YGPA 1ZJ5A 3LOUA 4UTVA 3B9QA 3USCS 3N0XA 2VH5R 3QFHA 1X3SA 1L5VA 2EP7A 2IUEA 5E7JA 1OLSB 4EAQA 1P4SA 2M6RA 3GLSA 3OUZA 2A14A 1DXHA 2Y6UA 5ALSA 4ENSA 4QT4A 4RPKA 2R5FA 3NCHA 3CE6A 3EF3A 2IUSA 3HGQA 3E61A 3JYQA 3W6UA 4JSTA 1GG9A 3EFHA 1S5PA 4L02A 5TJ9A 3A6HA 1YSCA 5L4SA 2VPXA 1CJBA 2KB0A 1RXCA 2REQB 1PEAA 1XTTA 3DXXA 2E5LB 1QIIA 2BEWB 1TQ4A 1TU4A 2GDZA 4QXOA 2WWIA 4M99A 4DV6B 3MTEA 2R8EA 3UWSA 2I65A 2ZJYA 3ANXA 3D54D 3TQTA 1PJCA 2XCRB 4ZDKA 3FZYA 2QXTA 2L69A 4RV4A 3WWCA 3RTCA 1IATA 2ZJAA 4QQNA 3HJAA 3HXTA 3P9CA 4BO8A 5KNBH 3F71A 3KSMA 1HT0A 3MZ0A 1I1OA 1SK8A 4ZEWA 1S7CA 4PE5B 2FMKA 2IW1A 1L5SA 1PDOA 2H1VA 2XYRA 4PZDA 3V8BA 4FYXA 1E99A 5E9WA 3RVOA 3EVTA 3IPYA 1XMOB 4OIFA 5B2EA 5IK2D 1ZCAA 4EYOA 5LLSA 2BHTA 3CX4A 4XGRA 5I3ZA 3KSDO 2ZRHA 3RBVA 1NVXQ 2VJCA 4XRRA 3GFVA 2KHZA 2MHCA 3GV0A 1N6KA 3O91A 1W44A 2W2TA 3DXFA 4WNCA 4JBXA 3WNCA 4R2MA 1A9ZA 5DJ5A 2VRNA 3S3TA 2BJVA 1XP8A 2D5AA 4WH0A 3UWDA 5F3RA 3ZXIA 3FOWA 3ZE0B 1D2HA 1M1XB 2ADFA 3TG8A 2IHBA 3I30X 4IZOA 4O2LA 4NI5A 1B76A 3GJ4A 2RHDA 3K4QA 5AI4A 2VA8A 4FDAA 1M9NA 4G6ZA 3NAGA 4MWBA 2WYUA 4LK3A 3RREA 1T9KA 2VYCA 3FMFA 3E5HA 4YLEA 3HA5A 2C54A 1YV9A 4YN3A 4TQAA 2FPMA 4PLYA 1JHXA 1GHTA 2YJ4A 2CZQA 2WD7A 4PR0A 3V8MA 4M83A 1Y80A 3T34A 1UDAA 2A9PA 2WIAA 3HJNA 3W3AA 4BXOA 4FKBA 3EEFA 4R2HA 3OIGA 3ZZMA 3JYHA 2VG8A 4OP3A 3TLXA 1SPXA 3HCAA 5M29A 4DKJA 2G25A 3U4QB 5H5JA 2B9EA 1F9EA 3CRVA 4FQ5A 4W1SA 5GOTA 4BASA 3K0KA 4PZUA 4DLKA 1SG6A 4Q7MB 4HNAA 3ABQB 2VXOA 2I6SA 1XQ1A 2IEZA 4WKNA 1ESNA 4E03A 2DCUA 2BMVA 3AUFA 5A3RA 1GGKA 1Y7TA 16PKA 1VMKA 3D31A 4S0ZA 5L7YA 4ZD6A 4CTJA 2K2WA 3FTFA 4RF4A 1ZX1A 5FNVB 1NATA 1L3BA 3AJEA 2F1OA 1V3VA 2NYAA 3BULA 4LQCA 1Z4KA 4IIJA 1XF1A 1JU3A 1M2JA 3I5AA 5GVRA 5JI2E 1LPAB 3RHZA 3ORYA 4E94A 5JRDS 2CD9A 3V1KA 3VC3A 2IXGA 3UHJA 2DECA 3BZWA 3B5IA 3OLYA 5DNAA 4FC6A 2LWIA 1YRQA 2O3UA 1OFUA 2W70A 2Y0BA 1OSNA 3G8BA 1HDCA 2Q62A 3BCRA 3O9MA 3BREA 3S2ZA 2D8MA 4IGFA 4LK2A 5LYJA 3OOHA 3HUFA 5TARA 1Z0KA 5TGZA 3W8EA 2V0GA 3A27A 1ZK0A 3HV0A 4QBIA 3S2IA 3WMFA 4CLOB 2Q4DA 1ZW1A 4M49A 3I5MA 2ZEJA 3JD2A 4EL5A 2J8ZA 1OXUA 5CBKA 1MAVA 2CNKA 1BXGB 1KPHA 2KX7A 4DTCA 3I3SR 5I51A 1PNOA 5DLQC 3S1LA 2CMFA 2HM7A 2BGGA 1TI7A 4LDAA 4X92A 3Q87B 3TJMA 2QRHA 3FPSA 3HVIA 4JI6B 1PFUA 3SE0A 3OWXA 4EUNA 3D8HA 2OT3B 4CMEA 5I4BA 3I9LA 2JFVA 4XGKA 1EXMA 1R0XA 1RAIA 5I7SA 5K5EA 1MC5A 5IAJA 4E6EA 4YV2A 1NQAO 2FA9A 1CY1A 1EXNA 1DCKA 3W5JA 3IIKA 2PU7A 4GUDA 4KB5A 1XCMA 1KI1A 3AHIA 3FUXA 2OTCA 4M7PA 4NHEA 1FFXA 2WWFA 3PG5A 5BWNA 4OH7A 3JYNA 2GK4A 2XTNA 3PFKA 2ZRLA 3PDHA 4UBKA 3T0FA 4I4TF 3VR6A 3TM5A 2QG9A 3OT1A 4EPTA 1UH5A 4R1LA 5DN6D 5EINA 3JARB 1A9XA 2VSFA 1ZYUA 1P81A 3LPNA 4OHYA 1Q0SA 4ZJYA 2BR3A 2ZUFA 4C4ZA 1N5IA 2R1TA 4ACAA 3JQCA 2OUIA 3JZFA 1OH6A 1G8KA 4UHFA 3SKYA 4KC0A 3DUFA 2GEBA 3BXGA 5F35A 3HFJA 1HZJA 5LJLA 3G0GA 3PTLA 1F1BA 2EP5A 4RTOA 4MMYB 1Q1NA 4DUGD 4DLTA 5G3YA 3KVYA 2PL1A 5J1TB 3UEOA 3WYFA 1GCGA 5ERXA 1EVLA 1K9VF 4MV0A 2O7QA 1CJSA 1FPQA 1L5FA 4XCVA 3TPCA 1PWYE 4G97A 4AF6A 3ESQA 3KD2A 1XVIA 4Y30A 3RFXA 2C7PA 4EHAA 1FW8A 4HQLA 1SQ6A 1YR2A 3VH4A 4LDJA 3B38A 3EEYA 1ODIA 5FKJA 2I7DA 3IAS1 4R7GA 2W58A 4MWTA 1Q7RA 3UTDA 4U7TB 2EBWA 3GP8A 1R66A 4JB3A 5BSMA 4GL4A 1LZLA 3N8HA 1PKXA 4MJ7A 5JHGB 4FFNA 3PL5A 4ZREA 3DSRA 4JB0A 2A35A 4J7XA 1TO1E 4MRPA 1NC3A 3C24A 4GLOA 4Q9HA 4YNBA 1G5RA 2PUTA 3K16A 2OMKA 5KX5A 3ADDA 4EO7A 4WCFA 3SEFA 3UBMA 1OXSC 5AVSA 3NC0C 5K01A 1DX4A 2PGJA 1VLLA 4TWAA 1AMNA 4WJKB 3FWPA 1VMDA 4B6EA 4H27A 4FEGA 2I2WA 1G7TA 1CYDA 5JQGF 3AVUA 1OC2A 4NCXA 1MLDA 1JDZA 1VSTA 2EWMA 2OWDA 1JLLA 1M1YE 5G0TA 2ZTHA 2QPAA 2OQIA 2XD9A 3PC3A 4QGGA 5E3IA 1W9HA 3BEOA 1PX0A 4NZNA 2ZW9A 1K97A 1UFQA 3K0AA 4WLFA 5FUWA 5G1OA 4LF5B 3AO0B 2MINA 4Y0NA 3JQ6A 2YHUA 3MJFA 2I6GA 2CCJA 4HGNA 4IFTA 4YCCA 3IS3A 1KQGA 1R3DA 3FW1A 4GLJA 1IQUA 1X38A 1N2SA 4EHJA 1W1UA 1B0UA 4OL9A 1NURA 5I9SA 4ARZA 1OROA 2X4GA 1E9VA 3VH1A 1UPFA 3WWYA 3THWB 5CT9A 5C2JB 1PS0A 3K4HA 3LT4A 4J9VA 2VHYA 4Z4HA 3PNBA 1XLUA 3T5CA 5ICGA 3ZWAA 3FAKA 1LNSA 3VR4A 1WX1A 5IT4A 3BHJA 2PPVA 4A6PA 2AYXA 1ENPA 3K0CC 1I1QB 4DCVA 2Y2VA 5JSKA 1POWA 3IQGX 5DB4A 2VHQA 3L4BA 2BLNA 2X3YA 4P4UA 5EZ5A 3ORRA 5HZKA 3ZE8A 1DX6A 5DEIA 1LK5A 2ZRNA 1Q1GA 1B16A 4B6QA 2VEOA 2NIPA 3GAZA 4AECA 3B9PA 5K3EA 1XQ6A 3I09A 4UZEA 1TEHA 3QBVA 4DXHA 4N3CA 4A1OA 4DSTA 2P5SA 1KVUA 1PT7A 3H2YA 5AHKA 4YUXA 1EM8A 4F1WA 2IVFA 4KMOA 3ZV4A 4EHLA 2COUA 2PGNA 3VR3A 4KPEC 2XGOA 2I3BA 3E03A 4JCCA 4GXQA 1U4OA 4KWCA 4AN1A 2F43B 4JP5A 2BVNA 1WLYA 4TTJA 1UZMA 3I58A 1QLWA 4NBWA 5D3QA 2WHPA 5COAA 4ZAWA 4L5YA 3DDZX 5TF0A 4DEVA 1NMXA 1OA0A 2J7PA 2RBGA 3C3BA 4QXMA 1HTTA 1N3IA 1NJ2A 4KFRA 1WPGA 2MSDB 4G5GA 4MA0A 3FOZA 2PS0A 2HSJA 2XUHA 1OBVA 3PIIA 4J0GA 1UBMS 3DNFA 2IUFA 1Y1KE 3O75A 3U80A 5C8DA 1QE0A 3L7YA 3MMPA 3T5GA 5I4KA 3ZS8A 1HK7A 1KJ8A 3BWVA 1OBHA 3HACA 3N07A 5G3ZA 2NP6A 2ZQ5A 1UANA 1E61A 1CCWA 5CFLA 3HJFA 1TTHA 3GLHB 3W4JA 2TMYA 2XXAA 4MLDA 4RK6A 5F78A 2VH1A 1NJ6A 3F1KA 3TOCA 3BVPA 2CJFA 3KB2A 4NXMB 1EAYA 3VV2A 3DKVA 1G8PA 2BFBB 1JG4A 5LYYA 3DDOA 2YV1A 4JLBA 2DXIA 2B94A 5GINE 1XRNA 1SIOA 1FFGA 4IMIB 3STXA 1M34A 2R85A 3ZKAA 4JDPA 4R31A 2IYWA 3FPEA 1M5TA 3JTMA 2HJVA 5CVJA 2OESA 3BM5A 1HYGA 1IMJA 3DBHA 1BX1A 4LYHA 5EMLA 4CL8A 2VUUA 4BNWA 3N2NA 1SUEA 2YWRA 3F5DA 4KO2S 1M1YA 4R8VA 4RTLA 4ETIA 3E58A 3QVWA 2MIIA 1KEUA 4OB6A 1ZIXA 3UQYS 1W0KA 4P3NA 2WFAA 5AW2A 2YKGA 1YONA 1S3IA 2Y1CA 5DN6A 3UFXB 1IWPB 1S3GA 1FUYB 4DR2B 2CCGA 1F8UA 1E2JA 1HT2E 2FSFA 1CDDA 3SLGA 4X91A 4F5YA 3EQZA 1OLUB 1XNRB 1FMJA 3TLCA 1WD7A 3NIFB 3T9DA 3N87A 1JHUA 1A9SA 4M9XA 1SXJA 4QGFA 3E1KA 5DHQA 4BTLA 4US2R 3EXHC 4NRDA 1IHDA 4YRBA 3B3AA 1XAIA 4RTNA 2GN0A 5IKMA 1NG9A 3A6FA 5AKLA 1QRDA 3QLVA 1E6KA 4L8WB 2PGIA 4PNZA 4TT8A 1I10A 4WEOA 3T4PA 4ATNA 3QSYA 3IVRA 2IYQA 3GLGB 2OVFA 4Q39A 5F64A 5C32A 2P1RA 3NFYA 4DG5A 1AKMA 1VHWA 2CLEB 1FNCA 2XZOA 3EHDA 4AJJA 4BMYA 5GONF 1ZCJA 2X8LA 3M82A 3PDIA 5AP9A 4CLEA 2VDJA 3WIDA 1FJ2A 4F8EA 4MPJA 4D8WA 4DCCA 1KY3A 4QTXA 3QEBZ 5JS1A 5DTRA 2YN0A 3PP8A 1U0GA 3WNDA 3T1YB 1ORTA 3Q5EA 2JRLA 4M0EA 3TFQA 2FZEA 1J22A 3OTQA 1JILA 1MIHA 3FIUA 3HM2A 4XH9B 3U1BA 4V3CA 3K0CA 2ZR0A 1U3VA 5KKCA 4HGOA 2J6IA 1IQRA 1DELA 5CFRA 3NHMA 1XXHB 4YMGA 1GQQA 2JAWA 2ZJFA 1XOIA 1V8BA 3MMZA 1U5AA 1KBQA 3ES9A 3QKIA 5EP4A 5CDYA 1PHPA 4MMXB 5H83A 3C7AA 2H1RA 2W22A 2F9MA 2JVIA 1J90A 1YC5A 3IIEA 3T9CA 4Z51A 1Z8FA 2YH2A 3B2NA 3CS3A 3RTEA 1PD0A 1X14A 1QGYA 3DZFA 5I9IA 3T35A 4JK3A 1LLFA 4CMCA 4N48A 1JEDA 1HOTA 1FQJA 1IEWA 2I62A 3MERA 4WZBB 5JUWA 1GGJA 4LZAA 5LA6F 3F6RA 4C6HA 4L4YA 4E4TA 1QJCA 3QUSA 4MRMA 5H0IA 1D0VA 1W7AA 4YT5A 1SRRA 2FMIA 1XRSB 3PUIA 2FQYA 3IEXA 4EI8A 4TKVA 2H1FA 2Y05A 4EI2A 4DHEA 4RE6A 2CXSA 2IY9A 2MR5A 3LZDA 3EIFA 1CIJA 1HMPA 1P8JA 4WXEA 4V0ME 4DBVO 3FPFA 2ZRBA 3M5DA 2RMKA 4XB2A 5CDGA 4JQYA 1D07A 5HGXA 3ER8A 1XRMA 3CM0A 1N3BA 1Z6TA 2KLBA 2Q1UA 1C2YA 3A6ZA 1VBKA 1ZL2A 3M6XA 1H9BA 4RKQA 3LUFA 3AY6A 4MWSA 2PQ0A 3GZTB 4P4SA 5CVTA 1N33B 5LBUA 2R5NA 4PANA 4ARCA 3SDZA 2YUTA 3HLTA 3FPAA 3GVCA 3KAQA 1Y63A 4PBTA 3ZHOA 4AJIA 3OECA 5D87A 1OLOA 2OKCA 3T3GA 3WKDA 3ULKA 4F3KA 1FP1D 1JKIA 2BI7A 2J3EA 3L6EA 1YHYA 2G76A 1A9QA 1A4XA 2ZG6A 5ESRA 3EIHA 4BNIA 3KV3O 4KK4A 1MTZA 5ES3A 4EG8A 1J25A 3KYDB 3LVRE 4L3OA 2IHKA 5JWOA 4C4AA 2CFOA 4RD1A 3EBLA 4RQAA 4QJ3A 3WLFA 5TIIA 1P77A 2C2HA 3HB1A 3RFCA 2C9ZA 4JITA 1X19A 4F0JA 4LRXA 4TUYB 5LCXA 2IEGA 5C7LO 1X7GA 3CH6A 3KVOA