3IAFA

Structure of benzaldehyde lyase a28s mutant with monomethyl benzoylphosphonate
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
554
structure length
553
Chain Sequence
AMITGGELVVRTLIKAGVEHLFGLHGHIDTIFQACLDHDVPIIDTRHEAAAGHAAEGYARAGAKLGVALVTAGGGFTNAVTPIANAWLDRTPVLFLTGSGALRDDETNTLQAGIDQVAMAAPITKWAHRVMATEHIPRLVMQAIRAALSAPRGPVLLDLPWDILMNQIDEDSVIIPDLVLSAHGARPDPADLDQALALLRKAERPVIVLGSEASRTARKTALSAFVAATGVPVFADYEGLSMLSGLPDAMRGGLVQNLYSFAKADAAPDLVLMLGARFGLNTGHGSGQLIPHSAQVIQVDPDACELGRLQGIALGIVADVGGTIEALAQATAQDAAWPDRGDWCAKVTDLAQERYASIAAKSSSEHALHPFHASQVIAKHVDAGVTVVADGALTYLWLSEVMSRVKPGGFLCHGYLGSMGVGFGTALGAQVADLEAGRRTILVTGDGSVGYSIGEFDTLVRKQLPLIVIIMNNQSWGATLHFQQLAVGPNRVTGTRLENGSYHGVAAAFGADGYHVDSVESFSAALAQALAHNRPACINVAVALDPIPPEELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Active-site engineering of benzaldehyde lyase shows that a point mutation can confer both new reactivity and susceptibility to mechanism-based inhibition.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
molecule keywords Benzaldehyde lyase
total genus 175
structure length 553
sequence length 554
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.38: Benzoin aldolase.
pdb deposition date 2009-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain
A PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
A PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iafA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iafA01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3iafA02
2Y0PA 2EZ9A 3D81A 4K9PA 4BVGA 1UPAA 3ZHTA 2BEUB 2UZ1A 2HJHA 1M2KA 3EYAA 3MOSA 3CLUD 1TRKA 2A1TR 3EY9A 1X7YA 2C3OA 1U2DC 4V1CB 1UMCA 3GLSA 1X80A 2G67A 3CF4G 5DGTA 2JI8A 1PT9A 4UUBA 1UM9B 2BFCA 5HHTA 3EXG2 2EZTA 1OLXA 2H4JA 1SZCA 5ESDA 1UPBA 2C3YA 1ITZA 2BFEA 4R8MA 3HWX1 1Q14A 3DVAB 2BFFA 1O97D 2XTAA 5I51A 2PANA 3EXHC 5EXEA 1QS0B 5EJ5A 1TKCA 1NI4A 5C4IA 1X80B 1U28C 4Y6QA 2C3UA 4G1CA 3CLRD 1OVMA 5EJ6A 3AHEA 5IMSA 4J16C 3L84A 1OLXB 4V1CI 3DUFB 1D4OA 3ZHVA 4KXQA 4BN4A 2OO5C 4FEGA 1PYDA 2H59A 2PGOA 4K9KA 4UTRA 1T9CA 2JIBA 3LPLA 3CLTD 2H2IA 3FZNA 3RIGA 4RMJA 4K9LA 1W88B 3ZHRA 1EFVA 4IF6A 2BFCB 2NYRA 4UTZA 4J1TC 4RMGA 2J9FA 2QQGA 2BEVB 5MFZA 1UMDA 2VK8A 3ZHSA 3M7IA 1POWA 4BUZA 1V5FA 1OLSB 4KXVA 2YIDA 3ZGOA 5MFPA 1DTWB 1YTLA 3EXIB 4D5EA 5K2OA 1X7XB 2JGDB 4BN5A 2VK4A 4JUFA 1PNQA 3DV0A 3ZHUA 1ZPDA 3AHJA 2H2FA 2BEWA 2Q5OA 2VBGA 4GP9A 4JUAA 2BFFB 1YI1A 5FYQA 1BFDA 4JUCA 4C7VA 1XLTC 2Q5JA 5DGDA 4L3OA 3RIYA 4K9QA 1TKAA 1L8AA 5I4IA 1U31A 1MCZA 4COKA 1ICIA 2EZ8A 2G28A 2A1UA 3D7KA 3GLRA 2Q28A 1NM5C 1WCIB 1Q6ZA 2W93A 1JSCA 4FEEA 4KXYA 2H4HA 1X7WB 4C78A 1B0PA 1IK6A 2EZUA 4QELA 2JI9A 4O8ZA 1SZDA 4GM1A 2C31A 3UK1A 4RMIA 1UMBA 3AHFA 4MZXA 3EA4A 1X7ZA 2WVAA 4JT8A 1V5EA 1YHZA 3AHHA 2R8PA 5EXDA 1T9AA 4X3OA 2DJIA 2Q29A 4C7BA 3E9YA 4BV2A 3LQ4A 2Q5QA 3AHCA 1OLUB 1QPBA 2JI7A 4MPRA 4MPJA 1X7ZB 1YC5A 4JUBA 5BWLA 3ZG6A 2H2DA 2NXWA 2BFBB 1M2HA 2FRDC 2PGNA 4D5GA 4RMHA 4FZ3A 2E6KA 2FWNA 1PVDA 4UTNA 1Y9DA 4RJIA 4RJKA 3PKIA 1S7GA 4UTVA 2IHUA 4GM0A 1NI4B 3UPTA 3EXFB 1YC2A 2OD9A 2VJYA 4JSRA 5ERXA 4TWIA 2QQFA 1POXA 4JU9A 3RIMA 3M6LA 4UTXA 3AHGA 3LQ2A 2FR8C 5DEIA 1AY0A 1OZFA 5EJ8A 1V11B 2OD2A 1RP7A 3EXFA 1MA3A 4Q9DA 1V16A 3OOYA 2H2HA 1S5PA 1M2JA 1V1MA 2OORC 2H2GA 5ERYA 3ZGVA 2UZ1B 1T9BA 3DV0B 2WVGA 5HJEA 5K6TA 1UPCA 2OD7A 4BVBA 2BEWB 2PDAA 2X7JA 5EJAA 5EJ7A 1M2NA 5AHKA 1PNOA 4F56A 3DVAA 1Q17A 4ZP1A 1X7WA 3PDHA 4FVTA 2IHVA 5EJ9A 4JT9A 3EXEB 5HGXA 2BEUA 4BVHA 1OZHA 4JU8A 3PKJA 1Q1AA 2YICA 4Y6OA 1X7YB 1YI0A 3JR3A 2BRUC 1PI3A 5MGNA 2QTCA 2IEAA 1YNOA 4KPUA 2BFDB 2BP7A 2QTAA 2BFBA 3JWPA 1PTJC 2Q5LA 4JUDX 2IHTA 1DTWA 1YD7A 3D4BA 1YBHA 3HYLA 5EJMA 1V1RB 4X3PA 1Z8NA 2VBIA 3F6BX 1W85A 2O1SA 2FSVC 2OZLA 3AI7A 4TWJA 3AHDA 4IG9A 3EXHB 2JLCA 3HWWA 1T9DA 2JI6A 1DJLA 3GLTA 3DUFA 5HYVA 2UZAA 5I5GA 3EXG1 5K3SA 1V16B 1TKBA 1KEKA 3OE1A 4I5IA 3U3DA 4V1CA 2BFDA 2J9FB 1YHYA 4UU8A 4C7XA 1EFPA 2WVHA 4HDAA 2FN3A 5MF6A 1W88A 3EXEA 1NGSA 3IAFA 2B4YA 1OLSA 4Y6LA 1V1MB 4KXUA 1N0HA 2XT9A 1QGDA 1U5BB 4L2IA 1UMDB 3FLMA 2V3WA 2BEVA 3ZHQA 4RJJA 4F4UA 1V1RA 1J8FA 4QPZA 4MQ5A 4BVFA 1W85B 1OLUA 2AG1A 5BWNA 2BFEB 5BWOA 3M49A 3EXIA 2R8OA 4K9NA 4ZZIA 4QQ8A 1M2GA 1PO7A 4XEUA 4GG1A 1GPUA 5FEMA 1QS0A 2Q27A 2XT6A 4KGDA 1O96B 1OZGA 1UMCB 4UU7A 5K6RA 2C42A 1V11A 3U31A 1R9JA 4K9MA 2C3MA 2O1XA 4MPPA 4BVEA 3CLSD 2JLAA 5EJ4A 4HD8A 4K9OA 2VK1A 3LQ1A 2C3PA 2BP7B 3K35A 1X7XA 2JGDA 3AHIA 1HZZC 3GLUA 4KXWA 1V5GA 2VBFA 2AG0A 4BV3A 3M34A 2H4FA 1E3TA 4GM4A 3EXHA 1UM9A 3IAEA 2G25A 4WBXC 1UMBB 4KXXA 1WCIA 5I5EA 2OZLB 5D7NA 2R5NA 4IAOA 4GPEA 4UUAA 3F6EX 1U5BA 2EZ4A 3FSJX 1U2GC 3KOMA 4JD5A
chains in the Genus database with same CATH superfamily
2PUTA 1GRVA 3SQOA 2I22A 1H85A 2AEJA 4CFYA 4HADA 2IUSA 4JSTA 2P9QA 4B2YA 5D1HA 3NIBA 3NXSA 4D4IA 4P86A 4D0RA 1ENZA 1MORA 3GDOA 4YUZA 3FCAA 1BHQ1 3KXPA 5EVCA 4RYLA 5A5DA 4G85A 2FPRA 5ENZA 5DIFA 4XYBA 4DCSA 2A1TR 1M1ZA 2QW1A 2O6HA 2VPPA 5U4XA 4V0MA 4OUDA 2V9PA 3BRWD 4TTVA 1NVUQ 1UXKA 3EZGA 2F1OA 4L9WA 3KYCA 1P4AA 1GY8A 3SX4A 3AJRA 4D81A 4U6SA 4EFDA 3LO8A 1TZMA 2YN0A 1L8OA 5BVHB 2HRDA 1YB1A 3K30A 4B3FX 4LOLA 4H7DA 1W73A 3I5XA 1XU4A 5B1HA 3WV4A 4FGKA 4B6EA 2DLCX 3T7TA 4E4RA 3V6LA 1C4XA 5CUQA 4O4LF 3QKIA 3FMPB 2PT5A 1KQPA 2LDBA 2ZT6A 1Z4JA 4Y9RA 1ABFA 1RXUA 2OGUA 3EOBI 5I51A 3JQ9C 5FR2A 2REOA 4WJZA 3A9CA 5B3AA 4JZKA 1QS0B 3LXMA 4F11A 2P90A 4KIGA 3ENZA 3BXFA 5KNBA 1H2WA 3WKDA 1X80B 1NZJA 2CF5A 1M2EA 2QTVA 4GIBA 2MSDB 3ITDA 2CVHA 4ZRDA 3QEBZ 3IURA 4HGPA 1VMKA 4F0JA 4YR9A 2PA0A 4G01B 4J1SA 1PFVA 1XPUA 2QNRA 3K9QO 4CEJB 4MQEA 3QTTA 4NJEA 4PYKA 2ISCA 1RQPA 4Q9IA 3ZWBA 3DUFB 4MGKR 4EGJA 4Q39A 4E12A 2JLXA 2I62A 1BGWA 3PNQA 4P5EA 4NMLA 1ZNYA 1KI4A 1P9RA 1LPMA 1UR5A 1U3WA 2F1IA 2KWIA 1BW9B 3CNLA 1FJ2A 4MR9B 2Q5EA 3ICEA 2WM8A 4BV9A 1QKIA 5IJ0B 4P58A 3SZGA 2FPPB 3VR5H 2C9MA 3ELDA 1XAIA 3GBVA 3MMSA 3ZKAA 2WJ3A 2X8JB 1N32B 2BTQA 2VJPA 1ZHFA 4CL2A 4CKCB 5AK5A 2O2EA 1VPWA 1GCOA 4RVSA 1LLUA 4Z9AA 1L4HA 1ZEMA 9MHTA 2HHCA 1USIA 3LZDA 4EJ6A 4ZYXA 2XCRB 4J1TC 4PZ0A 3THYA 1V8PA 5EPEA 3Q7EA 1H9BA 1MN6A 2JJ8A 3KVVA 4CKWB 1YS9A 2J3QA 4UPEA 1FLVA 4L9AA 4TYPA 3L4EA 4LZWA 1HV8A 1YDHA 4I0WB 4UAGA 5F12A 2DVMA 3T7IA 1MV8A 1MB9A 5B6JA 3FUXA 4X8HA 3RYIA 4LECA 4GH5A 3WLSA 4J75A 3UG6A 4D96A 3I0ZA 1LF5A 4KRYA 3AV0B 4RDXA 1JIQA 5JXJA 3N2IA 4QARA 3T0FA 1UBNA 2CDAA 2YHAA 3I9JA 1AS0A 3WLEA 2YYZA 3KT8A 4HH3C 4JEMA 4NDAA 1TMGE 2JAOA 4JUFA 5JDIC 2IS6A 3PUZA 2EEZA 1B41A 1V4NA 1NJ8A 3I3SR 1WPRA 3P71T 3QV2A 5TQ2B 3LHFA 5A71A 3SDSA 2O8FB 1JDNA 2VBGA 4RF5A 4OI0A 3OTOB 3SHOA 3RJ5A 1GQ2A 3TFWA 2GBLA 4PZEA 1Q5PA 3O1IC 4US0R 3V8MA 4BQRA 4UASA 4QE3A 2Q07A 5LD2C 3LU1A 1DP4A 1T2FA 4ER3A 1ECFA 2ABWA 1QNLA 2NO1A 2AFHB 5BP7A 4HV4A 2BKVA 4L3OA 1YV9A 4RENA 4RY8A 5FI0B 2PSEA 1JQDA 3NO4A 3TR0A 4UOZA 1KU6A 3LQFA 4NMXB 1ZN7A 3DR5A 2XNJA 7MHTA 2OM6A 2WJAA 4FCTA 4RDCA 5BN5B 1FJXA 3FYUA 4PCVA 3FDFA 4TXJA 4COKA 4QEZA 5FTWA 4NHOA 3FROA 1J2UA 1XTZA 4H1TA 4XD7A 4ABYA 3R77A 3CKLA 4BNYA 5A3JA 1Z5NA 2I4IA 3B2QA 5AT1A 4QFMA 1QHGA 1WCIB 1FUYB 3HJAA 3K16A 1XMQB 4F96A 3GPCA 4Q9HA 2A14A 1IXYA 1TM5E 1I9GA 2A59A 4ZAZA 3GNSA 3CW2A 3RK1A 3LECA 1MXHA 1UBKS 1M8GA 2DAPA 1PR5A 3UV3A 4ZGWA 4FYYA 3Q5EA 1F5SA 4C1NA 2PKYX 2FN9A 2QGZA 4NU6A 1YIDA 2ZRQA 1PR4A 3ZUPA 4C3UA 4CKBA 4DVGA 1N25A 4E1AA 2QV7A 2H1CA 1Z2AA 2X4GA 2BISA 2QZSA 2JFHA 2ZWMA 1TDJA 3EVFA 3KB6A 4O29A 4U7WA 3R5SA 5THQA 2F1JA 1GSHA 4N3NA 4LE0A 3TX6A 2HY7A 2VATA 3RFUA 4C7OA 1CIPA 2QV0A 1SMKA 5BOSA 3DAFA 2G07A 4M7RA 4HHEA 4YUYA 1GUYA 4G1UC 1Z6PA 3CLTC 1W5FA 2YXEA 2A33A 2ZI5A 3BL5A 3MIZA 5BR7A 4LJAA 3JWHA 1IY0A 3QYJA 4FUTA 3OEWA 3DA8A 3NQ41 5EKDA 3TGWA 1RYDA 3VOSA 1T35A 4B4DA 4YMGA 1GAQA 3TJZA 4P7GA 3R4CA 5FUYA 3MUFA 2VC2B 3JQ7B 1GZDA 4KITB 1INLA 4ARVA 1VPVA 3G2OA 1LK0A 2JCVA 4D4JA 1JHMA 4DLNA 4BS9A 5FWXB 5EHZA 3NV7A 4KDEA 2B78A 3LXRA 2BBSA 4JR0A 3F4BA 3WFJA 3IAM6 4PINA 1EYZA 1L4KA 3CZCA 2HMSA 2VQ6A 1BWQA 1Y4UA 2BEKA 3DTVB 1Q83A 5IJXA 3QBTA 2QMHA 2P3QA 4ZC8A 3USES 2BHRA 5J3JA 1L6RA 4F2WA 1QZ3A 3OURA 1RPAA 4JQZA 4MA5A 4EEZA 1DIRA 2EKQA 3G2NA 3ZZTA 5BW8A 1KR2A 1R0YA 3MT9A 5I7AA 3MSCA 3AFHA 3C3WA 4JGGA 4KK3A 3KYJB 2FQQA 2Q5HA 1VJ0A 4LE2A 4AZ3B 3QNUA 4GC5A 3HRKA 4RTJA 1OHHA 4LC1A 2DWOA 3LQ2A 1VYVA 1FP2A 3CWZA 1E6WA 5EJ8A 2WNHA 3TW4A 1G19A 2AOTA 1S2LA 1NPYA 1SZPA 5HF5A 2HKIA 3DGFC 1G9TA 4LZAA 1P6XA 4RZHA 2OD2A 4V0OA 1WNTA 1RS0A 3OZ7A 5JSKA 5KCMA 2QUBA 1R4MB 5EJ2A 2PT9A 3NAZA 4GOMD 3OPYA 3GT3A 4YJGB 5BNTA 4PR0A 1UZNA 1OD6A 5TR9A 1SUPA 2V1UA 3V4ZA 1DEAA 3ORYA 3OIGA 2VWHA 3A28A 1M2JA 1BE8A 2VZ8A 1VFNA 4IJWA 4R9UC 4D4MA 4IINA 3RC2A 3W5IA 1GFZA 1RBZA 3CUYA 3H4TA 4ZEMA 4HQNA 1T9BA 3GJ8A 4I55F 3TLBA 1A4RA 4NICA 1OH7A 3DLAA 3OJCA 4C0BA 2W4QA 4RVHA 3F9RA 1W2HA 5SY9A 3DVSX 2IHYA 4NATA 4FUQA 1G8GA 4D3YA 4MR9A 4B9AA 4HJXA 3RS8A 3DTYA 3HL0A 4IQGA 4B35A 2BFMA 2D4HA 4CQNA 3I1IA 4J0IA 5L4LA 5ALGA 5FTJA 3RAJA 3WNZA 5KQMA 1ST3A 2YFHA 4BY9E 1F8GA 2XGOA 3HZRA 1SCKA 3ONNA 3Q8KA 2WM9B 1AQYA 2PUBA 1ZD1A 1MO4A 3H97A 4C0SA 1P2SA 1UANA 4KXMA 1TJ4A 2XQFA 3ETCA 4F4DA 1XCGB 1NP3A 2O05A 1DX4A 1OZHA 4RZUA 3DZFA 3ZTWA 3PUWA 4BVAA 3DP7A 2Q3LA 3GLHE 3L6BA 3S5UA 3RSFA 5HNKA 4C4TA 3PKJA 4OB8A 4CKZA 4EEXA 2FDRA 4HYYA 2ZUSA 4QD3A 4TKUA 2VWPA 2AMVA 1QVVA 4UVEA 4MKGA 4L07A 3U6BA 1JIIA 1PI3A 2QVCA 4MGHA 4OXIA 4ZKEA 1AO3A 5KQRA 3SKYA 4PRLA 1TUBB 1ESZA 2Z6AA 3AL2A 2GKGA 3ZIDA 2XDQB 4KLRA 1GTRA 3PVZA 4V3BA 1YRBA 1H5NA 4F84A 2VHXA 2FFQA 3FXAA 2HXSA 2MWMA 2RHMA 2BBOA 4ONEA 4MJLA 3BWDD 2HZ7A 4FFLA 3B3AA 1WZUA 3DS8A 1E77A 5BXYA 4TKVB 2EW2A 2OHIA 3COPA 3NHSA 3G13A 3M0EA 1XWWA 3M6IA 3GLKA 2P91A 3NTRA 5CLFA 3O31A 4EVSA 5FLXA 4X3PA 3VKWA 2GR9A 2JLRA 5D3MB 2VS1A 2ZWPA 3DBIA 4GLOA 4EVRA 4M1TA 1SG9A 4CV0A 4ENVA 1B14A 2QOEA 4KVAA 3ZCUA 5C8YF 3A0RB 2C8JA 3GXOA 3ZBTA 4P2GA 3TIXB 2C0QA 1WAMA 3FUWA 3B51X 3W8EA 5FOQA 4I4LA 3RBVA 3BSWA 1G42A 2WW8A 4NLLA 1BD4A 3EEYA 4J0CA 2JLCA 3KTAB 4HNSA 1HORA 4KO8A 3CJTA 2UZAA 5E8JA 1W93A 2WWVD 2J3JA 3D5TA 2CD9A 1WUJS 2GASA 2LW7A 3C5CA 3ELYA 3PTZA 5JZBA 3FETA 3DZGA 1DJOA 3CX6A 3ICPA 3L7OA 5IAAA 1IY1A 2NSYA 3OP4A 4JQOA 4YR7A 3SHTA 1TAGA 3FCEA 2WMOB 1WA5A 4RVDA 5CD1A 3DOOA 4LVCA 2WKRA 4GZ6A 2VRCD 3O38A 2XWBF 4QT0A 5IM5A 4PPGA 3W8RA 1VBFA 2I33A 2J9FB 4QODA 3QQPA 3MWYW 4ZCIA 1H0SA 1KJQA 1VLHA 1WXWA 3T3HA 7MDHA 2OP1A 5A4DA 5G40A 3K6RA 3C48A 2V7WA 4NP6A 5I9BA 2PUHA 5LQJA 2AJLI 4LJ7A 1E2DA 2JAXA 3UJ3X 1BU8A 2EFDB 1VPLA 2PQMA 2XE8A 5FX2A 4BMPB 4QSHA 2O5RA 3E81A 3EIXA 4IV8A 3T5DA 2NSDA 4A0FA 4B6OA 5FIUA 1LK7A 2JFPA 1MG0A 1S9DA 3C85A 1OC4A 3JYPA 4R2IA 2X9GA 4M0PA 3KK0A 3RC9A 1Y1LA 4EYSA 3QF4B 4H2DA 2A8YA 2X41A 4LBWA 4FLEA 5CVJA 1SD2A 4YCMA 1ONNA 1RU3A 4GX2A 1PZFA 1Y5IA 4P0TA 3IP7A 3U80A 2OFFA 3EMBA 2CWWA 5IT5A 4MWBA 3GT7A 2XUKA 2GETA 5G53C 2QAGA 2FSUA 1A9RA 1J8QA 1LF0A 1GQSA 2JIQA 4IUDS 3AUXA 2OCIA 3PL1A 3WAKA 2IU3A 3CRVA 3TEMA 2AJCA 1G64A 1JF8A 4DRXA 3ILXA 1L3IA 3CZPA 4OGLA 2AFRA 2J3KA 2Q2VA 3OZRA 3QU4A 5TB5A 1MENA 2OHFA 2VXBA 3HYNA 2GN1A 3GGJA 4TKMA 5A06A 1SVKA 1C3JA 2EKLA 3A6DA 3KWMA 3M4JA 2H5EA 5KNCH 3EEOA 5ALLA 4GMKA 5DMXA 3JYNA 1LRJA 2H16A 1XK7A 1R0CA 4QTTB 4MO2A 2VHZA 3C7DB 5CXSA 4K9OA 5BSKA 4DR4B 1AN9A 4TVKA 2QYTA 3M3PA 2JCGA 3FVVA 4K6KA 4UREA 1S3GA 4K6HA 3WLAA 3CJQA 5TT0A 3LX5A 1XDUA 4QNMA 4KCGA 5BOVA 3WOVA 4QYIA 3UHAA 4P7KA 5LVAA 4L73A 3VNVA 1I2BA 1D0SA 4M6WA 4BX8A 3QFSA 4I7EA 1ZX1A 4XIFA 3N7UA 4D79A 4E1VA 1VBMA 4UVGA 3ZCPA 4BV3A 5DHPA 5LP6B 5LPNA 3A27A 2R6CA 4N7BA 1BN6A 4DFDA 1OPRA 3OZSA 1ZAYA 2C5FA 1WQ3A 4GX0A 4N9WA 5AP9A 1LPPA 3V7YA 2Q8PA 3G2MA 1II9A 2XE6A 4L3WA 3TLXA 3AF4A 4L95C 3BMNA 3JWJA 4X92A 2F00A 4PYRA 1VP3A 3DFMA 3F78A 4CMHA 3R7BA 2ZBDA 3TOVA 2WB2A 2DGDA 1GOTA 3GIWA 2AYXA 2QG9A 4V02A 1UKBA 3G17A 5TPWA 1MA0A 3O3OB 2G5GX 1CS4C 4FHFA 3ROTA 4MCAA 3ZGNA 1N6HA 3PDIB 1MX9A 2CLKB 3KKKA 3OQIA 3CVYA 1FMTA 4OQ4A 3AG5A 1XTQA 4K81B 1U0SY 1NXSA 3KLNA 1W8IA 2O2JA 2V6MA 2BFPA 4TLLB 4TYYA 4AJEA 3SJCA 3E61A 4G1EB 2JLBA 2IU0A 5EGSA 2CXUA 2HF9A 3RUCA 1HLFA 1JKJB 1NU6A 1P2FA 1N4DA 1S3SA 3EYAA 4FOSA 3UICA 5CA1A 1L3CA 4KO4S 4MLPA 3QVKA 2ZSHA 2FMTA 3PC8A 4LUCA 1XD8A 4HT3B 2G4LA 5IC5A 2YJZA 1E2GA 3X1DA 3EVDA 4C4PA 3GN1A 1TTQB 4MV4A 1SOWA 4NU0A 3FMFA 4ZCSA 3U9TA 1BTOA 2I8AA 3X2SA 3FF4A 4YO8A 3U6KA 3CKYA 3U7IA 1XTKA 1KYQA 1JNYA 5DNCA 1ZQ9A 4U2FA 1HNWB 3WADA 1YR9A 4QUEA 5FULA 1KWKA 3DVLA 3I2JA 1KI8A 1FRFS 3FWPA 1DPFA 1DUIA 1R9NA 4AO7A 3ENQA 3V42A 2XYPA 4RKRA 3TXYA 5MFZA 2VAVA 1Z5UA 2JVJA 1P4HA 4KZPA 1QIMA 3QX9A 2BL4A 3CT6A 4LDQA 5AJTA 1NJ6A 3WLLA 1NFQA 1XF9A 4JJEA 4B2PA 2J7KA 4U6NA 2O3QA 5ENDA 3NATA 1Z29A 2QZ9A 2Z2YA 5B1SA 1SQGA 4OYRA 4A8JA 5KYNA 1LLCA 1R12A 4DR1B 3PQ2A 3R5HA 4ZVRA 2PUEA 4FJ1A 4HDOB 3FPFA 2PANA 5EYPA 3CTMA 3KJIA 3ZWDA 2XKKA 2GCEA 2FN8A 3QW2A 2QR3A 2F90A 2ZBQA 3RBXA 1GGMA 2XE7A 1NTRA 3KAKA 3KVRA 2AZTA 5IFLA 1KEPA 3BREA 4CIWA 2W22A 4NV3A 2PV0A 4URUR 1P8AA 4R0VA 1W5TA 1OF1A 4NZNA 2ZUWA 4ZTBA 2ZFUA 1WX1A 2G77B 2W6JA 3DZBA 3H1EA 4CMCA 4O8CA 3L1HA 1CFZA 4DADA 2WIJA 5LNK1 4PZYA 5F73A 2VPZA 5KPJA 1T9ZA 1YDEA 2P67A 2IYYA 3QFFA 1T2NA 2JIPA 4R1QA 3K8YA 5TV2A 5C5DA 4PC7A 1WETA 4FIDA 5EIBC 3NALA 5K3AA 2XJ4A 4AYXA 5AOAA 3IV6A 2F8LA 1K5HA 4DCJA 1KKUA 2PJZA 5F7ZA 3ICVA 3FJYA 2R87A 1GUZA 1FU8A 1TTHA 5DNAA 2XZLA 4DLKA 4JELA 1RAEA 3N6XA 4RXTA 1SGWA 1R3UA 1ABEA 1M83A 5COQA 4ZQEA 1K9VF 4ZT6A 4A1OA 3JYOA 1EI9A 2VYVD 1T2VA 4XJXA 2WD7B 2ZRMA 3MFQA 1GV0A 2PH3A 3C97A 4K03A 5AJVB 1SD5A 3AIIA 2UVPA 1YF3A 4EX7A 1KEEA 5H81A 1GPDG 1YS7A 2A30A 5DRTA 5BT9A 3RM3A 5JSZA 1UWVA 1UOOA 1NVFA 2IZ0A 3O03A 1A50B 1UMDA 5F78A 3RRJA 3S29A 4GPTA 4PY2A 3UJ6A 2ZWOA 3OJ0A 2J4FA 4IHJB 5JLJA 1TUGA 3CN9A 2CV2A 3E5HA 3G0HA 5EWJA 1XPRA 3ELWA 1EFLA 1XN4A 4MRVA 1UWLA 1V3UA 3F6SA 1ZGAA 3E70C 1V1JA 4NE9A 3T4UA 2WAAA 3I4FA 5IC4A 3MN1A 1ECJA 2OHXA 2R47A 4IEEA 1GVNB 1VMAA 1YJXA 4CMIB 5IKEA 2XW6A 1JLSA 3WSVA 3J81k 3SZMA 4R5HA 4YLGA 3KZNA 5ITVA 1CB0A 1EKXA 3B78A 4H7EA 4PBSA 5E1DA 4CQLA 1FNBA 5K0JA 2P9BA 5KSWB 1SURA 3DPIA 3KQQA 1U3DA 5EUMA 1P73A 3AWDA 4FBGA 5REQB 5ICGA 3Q11A 4JP1A 2L18A 4V0LA 1MO3A 1B0ZA 3QVTA 3H8JA 3X1WA 1G20B 1F38A 1GAEO 3KPWA 5EQFA 4JYAB 3LPNA 3N9IA 3F97A 3CIOA 3SLKA 4E15A 1FDOA 4DLWA 4I5EA 2XYVA 1E3JA 4DJDC 4MITA 2VTKA 4JC8A 5A05A 1J2EA 3H2JA 4N5MA 5TRTA 4B7AA 4CEHB 2E21A 4M1EA 3FTQA 3OFKA 1JA1A 1LGYA 1ML3A 4FT4A 3SR4A 4GBED 1Y81A 2PSFA 4XYLA 1LW7A 3NHWA 3MS2A 1MCZA 1FTNA 4JH0A 5DBHX 3WSTA 1XZJA 4EATA 1R37A 2YWXA 4ZOQI 4ZU6X 3REQB 4CHGA 4UBIA 3WP0A 4BP8A 2PNFA 1UDBA 1RI3A 2XUPA 2YASA 4MUKA 3MCUA 4OQQA 3VU9A 3FHOA 5LYJB 3EC2A 1EJ6A 1JIUA 2W93A 3OZDA 2CVFA 4P9NA 3EIOA 2CDCA 1FP6A 1P60A 1VZ2A 4GFDA 4LJ9A 3U4AA 4MTLA 1M2FA 1X7WB 2AN9A 1OB2A 2DECA 1EGVB 2ZSFA 3JD1A 1DKQA 2GZAA 1G60A 5JEEA 4MI1A 1HNXB 3ANSA 5LFAA 1VE3A 4A2WA 1XJCA 1YZVA 4AZTA 2QVBA 4X41A 3ZJYA 2D4AA 4UCFA 1RYNA 1I13A 1R0LA 4KEAA 2I6GA 3T9DA 3ESYA 2Q2QA 5IUKC 5HA5A 2IS4A 4WE3A 4YMVA 5JTUA 3UJNA 5JSYA 5KWVA 1T9AA 2V0CA 4OB6A 4QG7A 3Q3GE 2YWRA 4LVUA 2XYRA 3OHMA 2PR2A 5CW1A 4IUCS 4AIIA 4UM9D 3AL3A 4WZAB 3VHLB 4BV2A 3A31A 5I47A 1SKBA 4TVBA 1HQYE 1OX4A 3WBBA 1EP2B 3FVTA 2A67A 2DERA 1VGVA 4HZGA 5L3RA 3OI7A 1X7ZB 1D9XA 4G0ZA 3B8HA 1TT5B 2XMBA 1NE7A 1J1ZA 2J6IA 2G9RA 3F8SA 2WPNA 1O89A 3JQGA 2CMHA 2XY4A 4X20A 1L5KA 3B7PA 1QLHA 3JU3A 3P4UA 3PSAA 2XVXA 5IEBA 2ZBFA 5BORA 2B7LA 2FCAA 2X1VA 3MCZA 1AIPA 4LJKA 5FQOA 2QAGB 2ZJ7A 1BMQA 1XWFA 3WLHA 3H2ZA 2WRZA 4GF5A 5IG2A 4NXNB 1T6NA 4UTVA 4I8XA 4ZI5A 1MFZA 2HIAA 1VG0B 5JAQA 2VNIA 3ZU3A 4FB4A 1XJWA 3S8YA 2PMKA 4HMQA 2OORA 2ZTSA 4Y1GA 4C29A 2YVKA 4BO8A 1XVTA 3WVNA 3HP4A 2PGJA 4DMLA 5CFLA 1QE0A 4H1UA 1H8ED 4NCHA 3OIDA 3SFTA 4GEKA 3K2IA 4BBJA 5HRUA 3K9FC 4BQSA 4NAUA 3DEJA 1UK6A 2BKXA 5JH7B 5JDCA 1S96A 1V5IA 5D84A 2P40A 4MYSA 3CRZA 1PUXA 2BOVA 1ZD9A 2OKCA 1YZFA 1OZFA 3BGOS 3DZHA 3ZY4A 1ID8A 2X8AA 1TYDE 1S2IA 5BVHA 1EUDB 4L02A 3PENA 4IIYA 3V80A 3IPXA 2LV8A 1PF7E 3C43A 3R6TA 4HTAA 4KBFA 2CSXA 4GI2A 2J9ZB 1XLTA 3LYUA 4V39A 5F4ZA 1J23A 2QTFA 2QMUA 2BLNA 4MA4A 3TYXA 1L4FA 2FSPA 4MB2A 1Q1BA 3GG2A 4ZVKA 5C7IO 1MQAA 3GEEA 3UJPA 2Q6OA 3VPXA 5KYYB 5KWEA 3U7JA 1L4BA 2A9QA 1F2UA 4M1SA 5JCPA 5JR3A 3JY6A 4OU5A 2WWTA 4FYPA 2H2GA 3LFTA 1VMEA 2ST1A 4WOKA 4OL9A 5L3ZA 4YRIA 4M1OA 4OQEA 2QB5A 2G9NA 1M1NA 3E4DA 3I9MA 2GZHA 4RZIA 2W0SA 3NBYC 3EPLA 2ZIZA 1QLJA 1NRJB 4TVSA 4HZIA 1E3IA 3JRNA 2A78A 3DBRB 1JJ7A 2WTEA 4Y1RA 1P33A 1JAYA 4L28A 3IQHX 4INJA 1RSZA 4S1NA 5FRDA 3HFSA 1C8VB 2WPDD 3BD9A 4PZPA 2BBTA 4WKGA 4YRRA 3IODA 1QZXA 1UDWA 2A4MA 3O1JC 4KNWA 3FF1A 5FOUA 3SBOA 4RS3A 1ZOIA 2Y77A 4WXRA 3V6MA 5EJ9A 2CJWA 2Z8ZA 1SB8A 1U90A 3BH0A 3EXEB 4N8EA 4Y1RB 4RF2A 1RQXA 2QEQA 1FP1D 3BGDA 4TL8A 3K0KA 2ZDQA 2RCYA 4RTRA 2OE2A 3FWHA 3R3JA 4KQ6A 3VTFA 4JU8A 1KBOA 2ECFA 3GCZA 3WIDA 2P6MA 2RHRA 1ZUD1 2IC5A 4K1XA 2VZLA 2FYTA 1GTVA 3AYXB 3L49A 1C29B 4HO1X 4MQ4A 1GGHA 4UW9A 1GAXA 5DV9A 4KQXA 4QHSA 3RAGA 2FP4B 4HDRB 4BCDA 5DNYB 3PNKA 4HQLA 4L5YA 1ADYA 3Q7SA 4XB2A 1Z6AA 3MCTA 3CUSA 3V8BA 2ZUTA 2UXCB 3R8CA 3I9V6 1ZK4A 5K4HA 5ARDA 1GXSA 1YNOA 3GYGA 3G5LA 3MINB 2G80A 3HUEA 1F9EA 1L5YA 2XOEA 3HY4A 3ORQA 4GZMA 2JH9A 4BLSA 4PIPA 1XNGA 3B2NA 5DWVA 2W7TA 5KOYA 1L0BA 1X1CA 3NAGA 4OP1A 4E31A 1HKUA 2BM9A 3H4IA 3H2KA 3ZE8A 5LDHA 3DAYA 3VTKA 2HHAA 2LRHA 5CLQA 2GAFA 2ILTA 3EJ6A 2I1WA 1TM7E 2II6A 1G21A 2QM8A 4K8OA 2SKDA 4RA9A 1S9HA 3WY9A 1H4QA 1OILA 1NYRA 2AXEA 4H16A 1M6VB 4O2LA 3A2LA 1E9AA 3P9PA 4L85A 4Y2GA 3R76A 4FOLA 1LNQA 2DR0A 4LGCA 5HS6A 5FV7A 4EX6A 4QQNA 1RWNA 3FDXA 4O4HB 2A0FA 2J9XB 4JENA 4YJFB 5D1NA 4FCVA 2AQIA 3ZLTA 5K3FB 4JC0A 4JL8A 4F5EA 5AIBA 3WAGA 1P5HA 4FC6A 1L5LA 2UV8A 1ZR4A 1BDHA 3AB8A 4M8IA 3UJCA 3BGWA 1YFLA 3V34A 1NUTA 3GLTA 4KRFA 3TRHA 821PA 5LZ5A 5I9TA 3NPAA 5T8KA 5DLPA 5K4AA 4GBJA 2WR8A 2FJ0A 3DQPA 2O8DB 1WF3A 3N2LA 4CMAA 1RC8A 2PRKA 2ZRLA 4HX2A 5JV5A 1PJ4A 3M6XA 4EZIA 3KQWA 2CCJA 3NWEA 1EX7A 1XC7A 1NDHA 4NWIA 1OA1A 2BKAA 3NFRA 3IP3A 3OD5A 3PDUA 5JT1A 2H31A 4G63A 2BGWA 1LWNA 4KACA 2BLLA 2LPMA 1H3NA 3AUJB 3LBHA 1AGRA 3WWCA 4CIDA 3OZVA 5G0UA 4D25A 1Z0ZA 2OCBA 4IKPA 5KCZA 2WAXA 3L6UA 3NWBA 4DARA 3HN6A 1DV2A 1FVXA 1GUFA 2XRYA 1R64A 4MRPA 5ALWA 4EYGA 5KTPA 2YDXA 2ZAYA 3IQFA 1IZ8A 4H31A 3GC6A 4FKBA 1N0HA 4ZOAA 3NTUA 5B7NA 5K3DA 1JHOA 1E99A 3PJFA 4J91A 3RG2A 3BJEA 3W6PA 2EDCA 4R8VA 5BNIA 2H51A 2YJ5A 1JXAA 3L4BA 4IZOA 1E6EA 1ECPA 1RRPA 1UBHS 4GL4A 4WZAE 1C30A 2FFJA 2Y0EA 2ZQ5A 3HL4A 2HGZA 4O2AF 3W4JA 3ZCRA 2O23A 1DAMA 3OLWA 1DT3A 4HAIA 4L8VA 4PGGA 3EC7A 5REQA 1NI5A 1RZRA 2C4WA 4L1KA 1E7RA 2DRIA 4Q3CA 4MR7A 1ZH2A 4CI0B 4CMIA 4F92B 1MU0A 2AG1A 3IO5A 1O6FA 1Z74A 3NORA 4KN9S 5BWOA 3FPKA 2FMHA 4BNLA 4LDJA 1AQJA 2YHIA 3PXCX 4G84A 1NC3A 4MROA 1BCRA 2W2LD 1PO7A 3FB4A 2GEFA 3E3LA 3EVTA 4E6EA 3F73A 3NDBB 1XK6A 1VC2A 2GTIA 3AJAA 4B4VA 5ELMA 3BMOB 1LCIA 2PWYA 4A23A 1O96B 2M6KA 3TNLA 4E6PA 5IN4A 4J7AA 2WV9A 3ZU4A 2R2GA 4DMCA 2EJCA 2CV0A 1UBJS 2YJ6A 1W76A 1E0KA 2O0LA 3SXUA 2X5KO 4BNGA 3LK6A 4CE6A 4DQLA 3ZWKA 1DEOA 5JAMA 1GU0A 3WOHA 4Z8XA 3ZC3A 2ZDHA 1KDRA 2RHOA 4G2TA 4QU0A 3D6TB 2WU1A 3R0IA 1G0NA 3HN7A 4XWYA 4XVHA 1TPYA 4HKTA 1Q91A 4GRAA 4B9EA 2JGMA 2PUCA 3KKMA 1L5VA 3V2UA 3ZOKA 4D43A 4LCEA 2DBZA 4YRAA 4JBGA 4JKIA 3U7QA 4RJLA 3K5HA 4XM0A 3FOEC 3DDHA 4LX8A 1MKYA 4RO0A 1ONOA 1R0KA 2FHSA 3F98A 5IT9A 4NJOA 4C30A 1RI4A 4DV6B 4UEOA 1MAAA 3ZW9A 9ABPA 1FX1A 5IXJA 3FW1A 1E6UA 3WGYA 2ETVA 1M2WA 3P0EA 1BE6A 2HXYA 1UMBB 2CKMA 2WOOA 2Y2VA 3DQZA 1I3KA 1RWQA 3VDMA 2XCQA 1BQ3A 1VI6A 2HA0A 4CKWA 1EA5A 2J59A 4K6CA 3HR8A 3THRA 2GS9A 1AA6A 1MEEA 2BGTA 5D7NA 3ONDA 1H2RS 1K6MA 3KALA 4PYNA 3URKA 3WMWA 1SA0A 4WKNA 2FMUA 4CMJA 3SF8A 2PT6A 3MGCA 3IEKA 4ZCTA 4NENB 3QIVA 1GCAA 4OTZA 1JKFA 3ZJ5A 4B7XA 1DL5A 2W8BA 3OTIA 5CJ2A 5A5VA 2EZ4A 1P4RA 4JJ6A 3U4HA 5D00A 3FSJX 1QXSA 1U2GC 2YV3A 3HCNA 4UUMA 4CTOA 2NZUG 5AW6A 2AJBA 2AJTA 1WEHA 3JAKB 4BVGA 1Q1GA 5B12A 4R2XA 1YU6A 2QJFA 1DAOA 1DUSA 3GCXA 2HJHA 2VAPA 1ZW1A 2K4MA 2IZ5A 2W2QA 4D9IA 2IHNA 5C1DA 2XTZA 1T4MA 1I8TA 2LCIA 5AHWA 3DEHA 1MOPA 4KR2A 3Q0EA 3AGQA 3FYDA 3K9NA 3VZDA 1PQYA 5HR5A 2ZI6A 4PNZA 2EQBA 2VUHB 5ARBA 2NUAA 4V1CB 2F3UA 2YRWA 1JNXX 1G1AA 2Z2KA 2YFYA 5KVQA 4V2IA 4ALIA 3JQCA 1Q16A 1BKDR 4MV5A 4CLEA 3MJFA 2JI8A 3IOEA 4ZZ1A 2UXDB 2G3YA 4N76A 5FA6A 1KQOA 2M1ZA 2AI2A 1EBBA 2ZRCA 2VH2A 4OGGA 4PPNA 2KB0A 4FSDA 4QBKA 4EPWA 4ZYVA 3OD1A 3GWGA 3V1YA 5J58A 1NZFA 3O90A 3OJOA 1FU4A 3HS3A 5ESDA 1YQXA 2VHJA 1JALA 2COKA 2VEDA 1B8NA 2GUWA 3BL6A 3E0QA 1T26A 3G2IA 4XR9A 4B31A 3DJYA 5C8VA 3RO7A 1Q14A 2OYCA 4MDEA 1NR7A 1NHWA 1I2AA 1W581 1U4OA 1VRCA 3MA0A 1XG5A 1A4XA 3WTBA 5J2TB 3FBWA 1PZMA 3DH0A 5EXEA 5HXAA 1H6DA 1R8JA 1EX9A 1U0RA 2JVIA 3BS4A 3EUFA 4Y1EA 3AL0C 1Z5PA 1Z38A 3ZWVA 4I9FA 1P18A 5CFPA 5IUJC 4V03A 1U9CA 3CG0A 3IDZA 1T9HA 4YBRA 5JSHA 3I2KA 3NBAA 4FIZA 3CNOA 3D6FA 3I5MA 2IW3A 3F5DA 3ZKWA 2X9VA 1CZRA 3NEPX 5ADWA 2ODAA 4Z4FA 3W2GA 1RBQA 5KX5A 3D6UA 3VYWA 4KXQA 3S2ZA 1C1HA 3WLIA 4B6RA 1C0IA 3W9BA 2QT9A 2GFQA 4JBYA 3ZY3A 2I34A 2N1MA 3P9QA 2YMPA 2PGOA 4KFRA 4MDHA 1N2XA 2YYYA 2R7AA 5FA5A 1S1MA 1QCYA 3HP7A 1N4AA 3QA3E 4LFBB 3AUYA 2LUOA 2VRNA 4RMJA 2I3DA 4U7HA 1CF2O 1YZGA 1QGOA 2ZKLA 1IHPA 5JCXA 4N01A 2I71A 2XWQA 3N75A 1L5OA 1LSSA 1Z6YA 5G3ZA 5C5EA 1P4SA 1NQWA 3QPBA 4QGBA 4TMXA 4K1LA 3K0BA 1YI8A 1FQOA 3QK7A 1L4EA 4JA2A 4N12A 5F33A 1CVRA 1T5HX 3A6KA 2PX5A 4R2WA 1P1KA 1QNFA 1X2EA 2QQGA 5FLKA 3PGMA 5F4BA 3ADCA 1AJEA 5A9TA 1GL3A 5CAEB 5HTKA 4CFSA 4PC3A 5IVKA 1CR1A 3F8TA 2H52A 3U3ZA 4UEJA 4IWYA 1O8CA 1VMDA 1M34B 4I1IA 4CKYA 1OLSB 2GPJA 4PLYA 1P0IA 4XDHA 2QW0X 2YBEA 2DTXA 2EL9A 2RI1A 2VXYA 2XQKA 4Y67A 4IV5A 1QYXA 1Y80A 1VIMA 4NSNA 2XTMA 4CKCA 5AVVA 3L8FA 3SC6A 3IR6A 3QF4A 5DGCA 2IL1A 4K0KB 2SKEA 3Q7RA 3DJFA 5HF9A 2RBGA 1SXJD 1KAQA 2VYVA 4IOKA 1QFYA 4GOND 3W6NA 4HAYA 1GVHA 5B5SA 5AM1A 4QTZA 2VHWA 1RJEA 5BYAA 1KNXA 2H7YA 4Q3BA 3WDLA 3MWEB 1H3FA 2QMZA 4OHXA 5F76A 2X4IA 3WMEA 2P4SA 4KLZA 3E7PA 3UMGA 1TA9A 2H0AA 3WKEA 1WMFA 3I1JA 3H6KA 3LM8A 3KFXA 1YVDA 3JQPA 3QE4A 3RSZA 3T5MA 4Q3NA 4JLVA 4TMWA 3UK2A 1P91A 1NJGA 3C3BA 4G37A 4E0BA 1L5MA 3JQAD 3HM2A 4G36A 1XALA 4UU0A 2YXBA 3GGCA 1OE0A 3NBKA 3GFSA 4WAUA 3LDGA 4PG4A 4RA6B 2ZUVA 1HDIA 3CYFA 1KH2A 2WLSA 4QJ3A 2E6UX 2HUNA 2N0SA 1V7PC 3V8QA 5BYJA 3C3PA 1FSPA 1QRDA 3FKSD 1H1LB 2IXGA 1FFXA 1SAYA 3CWQA 4HQRA 3W8FA 3NBZC 4OHFA 5B3LA 3C74A 4WI1A 1SUEA 1AZWA 2M6RA 2OV2A 4QELA 2JI9A 2PBRA 2QG4A 3SOZA 2IELA 1PV4A 2P62A 3LJKA 4NKRA 1YQDA 2J8ZA 5C18A 5I4BA 2GWHA 2PUDA 3KYDB 3N05A 3GNTA 3PGXA 3KNZA 5AW4A 1M33A 4PGMA 4IMJB 1OZ0A 2TECE 2XUAA 3GPBA 5BSVA 4WOPA 2HADA 3D8NA 4LF7B 2I3BA 4RZ2A 2P8SA 4L16A 1Y1KE 1HT1E 1ZXBA 1HYHA 4NULA 2BGIA 3CV3A 3RS0A 1XCBA 2VNKA 3QI2A 4WA8A 4IMIB 2GTPA 1SM4A 1OLUB 4CGZA 1UJ2A 2JI7A 3CS3A 1STOA 3H2SA 4U6QA 3S44A 1TTTA 4MPRA 4QOFA 4C3VA 2ACWA 1IH8A 4RK4A 4EY6A 2QP4A 2BCEA 2CJFA 3PQ5A 4AP5A 5KQSA 5KOHA 4CTKA 1N5DA 3O4RA 1U0BB 4RY2A 1CB7A 2UUOA 3GDHA 4IF4A 1TAQA 3FYTA 1IEXA 1T29A 5F3WB 3BERA 1KPHA 1SUSA 3M82A 3V8RA 1IRIA 1WXQA 5KB3A 1NN1A 1N0IA 3GEMA 1T4BA 3KZKA 5BR1A 1S02A 1EVJA 2ZYTX 3O9ZA 1S7GA 4YTEA 1QQBA 3FFXA 4DCCA 1OBVA 2JEZA 3CVJA 4JK3A 2NVUB 3W5HA 1A9SA 2QL7A 4ZC1A 1HE1C 2GPSA 3EXFB 3U4QB 4AKHA 5ERXA 1T3ZA 1KGDA 2AYYA 4B3GA 4HS9A 4L76A 4LXHA 4ODIA 3PRHA 1F2TA 1IAVA 4YJ2B 4BTEA 1H65A 2CCGA 3HADA 4DC1A 2NVUA 5FNVA 3QHPA 4H7KA 4R81A 2WWGA 3LY8A 1LV7A 1DX9A 1E79A 1XSEA 2MYUA 2PLAA 1CPYA 3DOHA 1HPLA 2P5UA 1KYYA 2C2KA 2VCEA 2IBMA 3BPSA 2FR8C 2V4MA 3JZAA 3NXKA 5T6MA 1DIAA 2B30A 2NX2A 1P80A 2PWPA 1IE3A 4MUXA 2XVYA 3CUTA 4BDSA 4G0VA 1NSTA 2OBFA 4KQ2A 4KR7A 3TWOA 1NQVA 2Q1TA 4PC1A 4DV4B 1XYYA 1XE3A 3TMKA 3VU9B 1XQ6A 2KYRA 1RP7A 1KIAA 4XYGA 1W2WB 3ILSA 4Q1EA 2OC9A 2WV7A 4H0FA 3QMVA 5TPZD 3INTA 5B37A 4D4KA 3LHKA 2WJHA 1N7GA 2LKDA 3G9UA 4IX9A 1K89A 3EFOA 2E49A 4JYPA 4M9SA 4BNFA 1ZR2A 3C6QA 1V4BA 2B1IA 2CLEB 2CGEA 3BIFA 3H8VA 4MUFA 5AXDA 1NVGA 4M4SA 3UM9A 5A9SA 2HJVA 5C7LO 4FXOA 2IOHA 1P9OA 4KWHA 1VBNA 4QNRA 4JIGA 2H5JA 1KTVA 2P9JA 3FMVA 3KYBA 4L7QA 4P4LA 3ZIUA 1ZCZA 4RNDB 2OD7A 3MWLA 2RH4A 4OUKX 4TSRA 4DLRA 1NBME 3IHKA 3IIIA 2J7PA 3RT1A 4C2UA 1GFSA 1NONA 1ZL0A 2WFLB 4NJMB 4UNNA 4TRNA 1R16A 2TMKA 3L7MA 1NMQA 1QZUA 3C3YA 3I64A 3TLCA 3STXA 3WIVA 4FYXA 1H42A 1DFHA 4DYDA 2EFYA 2FPGB 5CA1F 4N7MA 1VJRA 2YHIB 3H8SA 4Z9FA 3UXEA 9ATCA 3VKGA 4IS2A 4WEOA 4MW1A 4FVTA 2NO4A 3DO5A 5GV8A 1U0GA 4J2OA 4LHEA 4TWRA 4JT9A 3R8XA 2HSEA 3MJ4A 4Q4LA 1PGOA 2P5SA 3ASUA 2F9FA 5M2QA 3A2NA 2PAAA 2BEUA 3KRTA 4G4SO 3DDSA 2EARA 1GZ5A 1A71A 3RTDA 3SHQA 5EMLA 1G7CA 2XAUA 5CG2A 2YCLA 4QUDA 4G26A 5H3LA 5JCZA 2YICA 3EUEA 4M38A 4RFSA 3GW8A 3RRYA 3D4OA 1R74A 3UC9A 1NG1A 2WJIA 3LP5A 1T2EA 5JE8A 1R9MA 2BPOA 3H7AA 4MI3A 1IM5A 2WDPA 1IJBA 5F2OA 2XF8A 2QX8A 1Z07A 2A5GA 3SX0A 2PS9A 1DCFA 2WT9A 2Q5FA 3LXXA 1FNDA 3Q98A 2Y6VA 1EJBA 3V7NA 3IT1A 3WL8A 2OTCA 1RRGA 2WFAA 2PX6A 2QLLA 1CTQA 1DQRA 4LQ4A 6ABPA 3PX2A 3IXLA 4E14A 1U2GA 3MT7A 3GBPA 3N74A 3TZKA 3L8ZA 3G8YA 1UBUS 5F1KA 4EJMA 2OSBA 3G6KA 1EJ0A 4WFJA 3ZI7A 4B3HA 3FWZA 1CZNA 3Q7PA 2HXGA 1GQFA 4QWWA 1WKBA 5B4UA 1ODJA 3QVJA 3GZJA 5D85A 1YBMA 4E21A 3IELA 4DZRA 1ZITA 5I9MA 5FF9A 2VEOA 3TSOA 2V6FA 3AEQA 3MWGA 3FUVA 1R5NA 4LSMA 4A8JC 1J9GA 1CE8A 2GA9A 5CURA 4B8WA 4IO0A 3T9FA 2ECQA 5EXPA 5CFOA 1QYVA 3AQ4A 4E2WA 2CNWD 3DLIA 1M3SA 1KETA 2WHYA 2CWDA 2ZUUA 4FMCF 4KTTE 4RV4A 1UZAA 3DBLA 2Q62A 4RX1A 1RACA 4MW5A 2W2OA 1W94A 3I92A 4BQEA 1S2NA 2BJVA 5L3SB 1LC0A 1LZKA 3DVRX 1JH8A 4KIJA 2G1UA 3DUFA 4AJLA 3L8YA 2V5VA 1WDKA 1OASA 2R751 3KXDA 4I3GA 3P9NA 2E4AA 5P8WA 3IUYA 5GGYA 4M1MA 1KJJA 2PGXA 3WV5A 2ZVDA 1E1RA 3DBHB 4BJ3A 5K6AC 4MKHA 4P2BA 5DGXA 2DX7A 2GEUA 3JZMA 4REQA 4UD6A 2X23A 4YGXB 3RU3A 4B3SB 1W25A 5CCEA 2ZUFA 4QDOA 4X7RA 5TSDA 3KVNA 4XGKA 2ZULA 5J5VA 2F6RA 2IYXA 3MTEA 3RFTA 3WJ1A 1AQ6A 1LBEA 1XVLA 1I2MA 3PIIA 2I7DA 1NUQA 4MV8A 4S1PA 1IWBB 2Y92A 3JQEA 1P8JA 4KXUA 4D4LA 1ZD2P 4EGCB 1OI7A 1F0PA 1DV1A 1R50A 2BEVA 3V4OA 3TNDA 2MMGA 1FL9A 2WB4A 1FB5A 5ICMA 1N2BA 2BHNA 3DKIA 3M81A 4EKYA 2X14A 1YMQA 3B6KA 5JNSA 4FINA 3BKXA 3TJRA 4ATNA 5AESA 1L4GA 3ZLVA 4YDQA 4RUKA 3V7UA 4Q1VA 5C80A 3WX0A 2OPBA 3EGIA 1FRZA 2ZE8A 2ZW9A 3HPRA 4PFSA 3TRFA 2OV1A 1NXQA 2AUTA 4IMPA 1YTUA 4L5JA 2VUSA 1ZLXA 1UFVA 1T5LA 4H60A 4A91A 3EOZA 2B7CA 4JUIA 4U9UA 2NZ2A 1OMOA 4XEUA 4P4NA 4XSVA 4UZEA 1NBIA 1MAWA 5TPWB 1T0UA 1NYLA 4Y2TA 4GWKA 1PE0A 2HMTA 3H42B 2Q27A 3IGFA 3MTGA 4OXQA 4QHYA 3JRXA 3UQYS 2MSCB 3KPUA 4IX1A 4TV9B 3W4IA 3Q4GA 2H7VA 2HCBA 4QYXA 1JHRA 3PDCA 4WADA 3G9QA 4PR3A 3MMPA 4Q0MA 2RG7A 1XAGA 3HMQA 3WNVA 4TZKA 3BX1A 1H2AS 2PKEA 1QQTA 1TVMA 3EH1A 3PRJA 4MS3A 4BCBA 5I9NA 2QBYB 2GBLC 3CE9A 4F12A 3X2FA 2Q7XA 3KZOA 4G0PA 4JXZA 1RWKA 4BFWA 1NVMB 1F3LA 1TECE 1W2GA 2CYCA 2G09A 2MJLA 1GU1A 4M7OA 4ZPJA 3VHXA 2OCAA 4BZZA 2Y2UA 3BXHA 4MRSA 3RJTA 4ZDJA 1JYFA 3SQMA 2J08A 2VF5X 5JHHB 3E35A 1E32A 2AFHA 4FLFA 1JHXA 2R7MA 1QIDA 3HDTA 4LHZA 4KAXA 3DAOA 3HVUA 3QA9A 3PT9A 1Z2PX 1WU7A 2WSSD 1UJMA 3M34A 4JBIA 4OU4A 4FFPA 1EWYA 3KXLA 1ADGA 2CY0A 3WGKA 1S2MA 2ZIAA 5JY1A 2ZBUA 3H0EA 1DTSA 2PQ6A 3KL4A 4NH0A 1XPJA 3R44A 1JAZA 1P1CA 3MTAA 4L6CA 4TTQA 5EUBA 1PEKE 5LR6A 2Y1WA 1QOPB 2I6QA 4QXOA 3FWNA 5BV8A 2NTEA 3FLBA 3N0XA 2ROQA 3OVMA 1IU9A 2HLHA 4NOLA 3CW8X 1H8HA 2VSQA 2PX2A 1KZYC 1K8QA 3WL4A 4QNNA 2VRCA 3C3EA 3QU2A 4CHTA 3G2KA 2A9VA 3JWEA 1OJLA 1CY4A 2A6PA 2VDMB 4GWGA 3SIRA 3ZXYA 1CR6A 4KMSA 5A4FS 4BNZA 3GA5A 5ERGB 3AF6A 2FW1A 1MMFB 5DASA 4AP9A 5GQSA 2C29D 3VH4A 1U2QA 2V7QA 4ZHQA 3TNFA 1UPAA 3QKSB 4U1RA 1QH8B 4LGYA 3DL4A 2CDBA 1KI1A 3NNNA 2IUUA 1ZJYA 1UKZA 1CZOA 3DULA 1EDZA 3FOBA 2RHJA 1OY1A 2DY1A 2BZ0A 1FFCA 3JQQA 4RD4A 3H05A 3EY9A 4GE3A 4Y0NA 4L9RA 4FGJA 5BMVA 2OXIA 4EVQA 1XLWA 3C6KA 1CQXA 2G6TA 4BNDB 1A8SA 4MVJD 4KR3A 4P3XA 4ZJZA 3HA7A 4CIBA 1WB6A 2G67A 2ODEA 4BTVA 3UJ7A 3CXUA 3FCCA 1G8JA 3P0JA 2H00A 3OLCX 3PL5A 5BSGA 5HKAA 1T5OA 2OK8A 4HEHA 4OHBA 3A7EA 1M73E 5DNVA 3ZU2A 2Z6VA 3H84A 1KYZA 2FX2A 4PHTA 5SYNA 2WJ6A 3W5AA 1OXKB 3LUGA 4BNDA 4D0NA 4P93A 1VLLA 2CXPA 4HDMA 5DDIP 1U8ZA 1U9JA 3S7ZA 3TX2A 1TFRA 3VZBA 4TYNA 5ALRA 3U7GA 1C1XB 1GEGA 2IU6A 1ACMA 2N9UA 3Q15C 2ZTHA 1LTHR 4EI9A 5JPCA 4Z3OA 2DPYA 3BE6A 3ND9A 3HJBA 3JXEA 2IUEA 4BNMA 1PK7A 1VECA 2GXQA 1TAUA 5EJ5A 2X1MA 4L51A 4XIGS 1KDYA 3CZRA 3KHKA 1KMNA 4FONA 4DDWA 5B7GA 1F4PA 4G1CA 1EEXB 4X1KB 4GKJB 1KKMA 1BXGB 1JVBA 1XTPA 2EIHA 3G1TA 5AKIA 5EP2A 5LBIA 4CT4B 5HGJA 1E1DA 4ZAVA 4RD0A 4TMTA 1PUIA 4BC0A 4B34A 4ASUA 2FEOA 1J7KA 3GT0A 2E5FA 4F46A 1D4OA 2QE7D 4L22A 2Z56A 4M9CA 4ARZB 2ZR8A 1BGVA 1D6NA 1HFJA 3E18A 1E9BA 3TZBA 3MWDA 3HJUA 5BSTA 5FWYB 4MWCA 2CB0A 3D8TA 4ABTA 2XZDA 4ERXA 3OQMA 3DBVO 1ZIDA 4R9SA 3LVFO 1PLJA 1MAHA 5JSFA 3NDIA 2VJOA 4AB1A 1WD5A 2I7TA 1W88B 1WHSA 1Q44A 3E1GA 1Y7TA 3HJGA 3MTQA 1D4ZA 2FRDA 1FTQA 3QP9A 3GPIA 1FLAA 4KVGA 3RAEC 3CSSA 1RXSA 1P5JA 2IYQA 1CUBA 1QFSA 4PYIA 4YP5A 1EG2A 1D4FA 2R68A 4G5SA 2J9FA 1RWMA 4H7HA 3UK7A 3ZZ0A 4B79A 1ZJWA 4Y7DA 4OLBA 1BVHA 1VSTA 1DWUA 4G0XA 1C8KA 4ASUD 3PQ6A 4G1BA 5LU9A 3K5WA 3QFCA 4PE5B 3SHVA 1G5FA 4NBUA 2Z83A 2QY9A 3IH5A 2JKVA 5TMBA 4F4HA 4DC0A 5LLTA 2YINC 1I1HA 4KSYA 5K0FA 2FPMA 5EY5B 3IDAA 1ZINA 3HDJA 5DX1A 1KVUA 3NH9A 4PQGA 2NVBA 4OM8A 4XD7D 5KTYA 5H83A 3I83A 3MUEA 3RFFA 4W5RA 2JFNA 1EDOA 2VDJA 4LRUA 1EAYA 3EUAA 4CM9A 4G5RA 2IPNA 3IP8A 3LCJA 2ZREA 2VYNA 3DEIA 4KUEA 3CHYA 3FPSA 4IIDA 1EMDA 1K7FB 1MTZA 3ED5A 1R0ZA 2CHFA 4Q24A 2J6CA 1PCXA 3N0WA 4QOJA 5LZ7A 3UWOA 3USZA 4BMSA 1RLJA 1QFJA 4J1NA 4WH0A 4D6YA 4Z7NB 2GK7A 1YI1A 4M9RA 3AEUB 1ONSA 4IXNA 1XLTC 4C0AC 1F60A 1Y63A 2Q5JA 4C7VA 5IM4A 1P29A 5FI3A 1P7WA 1V39A 3BK1A 3I42A 3BRSA 1F8YA 1QP0A 5DWDA 4Q93A 3A6EA 4P4TA 4Q21A 1ADCA 2JJ2D 3AM5A 5TGZA 1XQ9A 3RV3A 4C6RA 1L8AA 3QVGB 2HSDA 1YO6A 3UA4A 3BRQA 4EELA 1PS9A 1SFRA 1ULBA 1WW2A 3JQDA 4C14A 1DAPA 4I1PA 1PJLA 1QB7A 3C8ZA 3G7UA 5F2NA 2YXPX 3FLEA 3ESCA 1XEXA 3K1YA 2IZZA 3PPVA 1HTBA 1KZHA 2C2MA 1KGSA 2AF3C 2C9CA 1R3DA 3B7WA 3OPVA 1BEZA 3PUIA 1DAEA 2QIOA 4QVGA 5K4GA 1L1FA 1FS6A 1GTMA 5DFAA 5B36A 2EJBA 5JAOA 4BLOA 4BWGA 1T4CA 2W37A 2NGRA 5D3KA 4GM1A 3R5JA 1UFQA 2XBLA 4RMIA 1ST2A 4EHNA 2CVOA 3CC8A 1RT9A 4XJTA 4MZXA 4A27A 1PL6A 4P5DA 5DPMA 1F1JA 4JBWA 2HEIA 1HYEA 2H1SA 1M1NB 3LYAA 4Z1MA 4B6FA 4BNHA 4G8JA 3EFBA 4TT8A 4IXMA 3JW8A 3OQHA 1GUBA 1W96A 4FE3A 3QUSA 3QZUA 1AURA 1FU7A 4XX1A 2HU7A 2P68A 4HAUA 1G16A 2C2GA 1KDPA 4UUQA 4YVFA 4LIPD 5GGXA 3URMA 3ZG6A 4Q4CA 4I1RA 4L5AA 4FK8A 3VU1A 4JZYA 4IVPA 2A0KA 2J5RA 2RGAA 1E1KA 1JAIA 3QXCA 3PITA 4X6XA 1DHRA 5JZOA 2QENA 5CLJA 1KKLA 1Y9EA 1IJKA 3P9SA 3WMGA 1YZHA 5C8YB 3TQFA 2IE0A 6Q21A 3FCUB 2RGRA 1E4EB 3SJZA 4MVCA 4FYWA 4OVKA 4KJXA 4AMGA 2B83A 3FIJA 2I7CA 4M53A 3RYIB 2GHQA 3NHBA 4PXAA 4GM0A 3FFBA 2ZAOA 1B3BA 1XP5A 3DFIA 4MH0R 2FZ5A 4US1R 5J40A 4X66B 2CVPA 3VU3A 4ZZ0A 2O5CA 2FEWB 3PFNA 1IQPA 4E7PA 2CK3D 3O1LA 3Q1LA 1POXA 1A95A 1A8UA 1QM5A 2FPSA 2B0CA 2V7GA 3CM0A 3GFFA 4HLQB 2HDHA 1QMGA 1O94D 2AN1A 3GMIA 2C03A 4UHFA 3DF7A 4I8DA 4UAVA 4F5DA 3G68A 5ECWA 4C5BA 1T0BA 3RIMA 5GVRA 2PU7A 1RQGA 1Y3FE 2NUAB 5G4KB 2GF2A 2ANCA 2VQ3A 4NBSA 2Q1XA 3IP9A 4DIUA 5ICEA 2P7IA 2G0NA 2NUPA 5JAHA 4PXYA 2RHGB 2H9YA 1C7RA 3EH2A 4AXBA 3EISA 4EHIA 1NDUA 2V7TA 1UJ5A 2RAPA 5C5IA 4N6GA 1BEUB 1P1IA 2ADMA 4UATA 3GARA 4HXYA 4NZYA 3RTCA 4EY7A 5K3BA 1I5OA 1J00A 2ODQA 4B6QA 2PNJA 4Q9DA 3OOYA 1I0ZA 3AVYA 3O5AA 4KRXA 4P08A 1KNQA 1DC7A 4A3SA 2JCBA 1KY3A 2GCPA 4ZN6A 1TLLA 1KO1A 1DKNA 3JQ6A 2VP6A 4BFSA 2ZSAA 3L5KA 2J0EA 3EQ9A 4L5IA 3OUTA 4JI6B 3SC4A 4GKKB 4FFNA 1CK4A 3DV0B 3RHFA 2FE1A 3U56A 3TKLA 1UKCA 3DG9A 3H5WA 1E2FA 4A0SA 5CB4B 5P21A 3R7NA 3WRXC 2BEWB 3ZNPA 3EIQA 4ESEA 1C30B 5ALXA 4AJ4A 2X8BA 4C07A 4A5OA 1GPYA 4U3JA 1QF6A 2A1IA 3HDQA 4TL9A 2VKTA 3IPYA 4R1UA 3U26A 4CL0A 5F9HA 1V7CA 2ZI7A 3R0QA 2HU5A 5BNFA 1H2BA 3PC8C 4ZP1A 2BHSA 5AKLA 4ZD6A 3ROFA 2V65A 3RVNA 3TQHA 1Z8FA 5FFNA 3BBLA 4ITUA 3SS9X 5HW0A 3A4TA 1W4CA 4DY6A 2RAUA 2HI0A 1F48A 4IGAA 4HLNA 5FPSA 5BR8B 1OB5A 1W0CA 3N7AA 4HZUA 5CBPA 3TZLA 5DULA 4ZO4A 1NVAA 3IT3A 5I9IA 3D2BA 3MD0A 2Q3MA 2QRZA 1I6LA 1I4OA 4QLAA 4ZDIA 4YAEA 3CF6R 3Q72A 2Y1KA 5E4FA 3N3BC 2NSJA 2CXXA 4MUGA 1QV9A 2O8NA 3KO8A 4LOHA 4K05A 1V8ZA 4B1FA 4QU8A 1ULZA 4F4UA 3L0CA 2DHDA 3TIFA 4KQJA 1RIFA 3MQ2A 4PHFA 3HKBA 2XGGA 4S04A 1X0XA 5G0SA 1DBRA 3IHLA 2ZT8A 4X8MA 1VQ1A 1XMSA 2G5CA 3VHQA 4BATA 2JGIA 1QU2A 1MNAA 3NX4A 5J59A 2LD4A 2AOWA 2ASVA 1R6VA 3RIXA 3WLJA 5ALPA 1WB4A 1ULTA 2QTCA 3NOQA 3O4HA 1YRAA 3GD5A 3QSGA 4HYTA 3FDZA 1DAGA 1ZESA 4GHWA 3QKWA 5DE3A 2H54A 2J3HA 1AHIA 2BFBA 1HT3A 4KG7A 3QJ5A 5AM5A 3RSHA 3WYAA 2GHTA 5E3JA 3A9RA 3KHUA 4R5MA 3BMOA 1PJAA 1KQ3A 1KJIA 3EWIA 4F9EA 1XXHB 2FW0A 3ODPA 1IM2A 1XVVA 9LDTA 1B74A 4R1LA 2WVJA 3V48A 1GP2A 1J6UA 2VBCA 3DEZA 2NO6A 2EWWA 2WFLA 1OI4A 2WUFA 3K31A 4II3A 2FOIA 3HR7A 1I2ZA 1N7IA 4X44A 1Y5NA 2VBIA 1JHVA 1QC5A 1BX3A 4I5DA 4E46A 2OO5A 4BXOA 1KJWA 5AVWA 1E79D 4KXNA 4X1OA 1AH2A 1UP6A 5FWYA 2B4TO 4J3FA 4OP3A 1U0HC 2VAMA 4DMFA 1AO0A 1R8XA 4X90A 3KU1A 2JIZD 5E1MA 5JJBA 1EE1A 4WESB 1GL6A 2OP0A 2I3ZA 1GZHB 1TEZA 3DVQX 3F5MA 4IJKA 3ZQJA 2ZVPX 1V16B 4JJ4A 4NMWA 1VCOA 3UANA 1JLMA 3A4IA 4HWRA 2ZYIA 1KEKA 1YZYA 3GJSA 2CLFB 2O1EA 4AP6A 1TA0A 1JHQA 2F1HA 2W2KA 2YWJA 1A2KC 1DAFA 2VI5A 3I45A 1E9EA 4EO7A 3CVXA 2QK4A 4JYCA 4E5NA 5JAUA 1N5MA 3IVCA 3NHMA 4RLSA 2JF0A 5DOVA 1YVEI 4E5YA 3GLFB 1RZ3A 1SIOA 3DE6X 1D1SA 3KIPA 4M36A 3IAS6 2EYUA 1ZZEA 2VF7A 3REOA 3H9EO 2F3RA 2A1TS 3KS9A 5GIPE 2NN3C 4KGZA 5DP2A 3ESZA 2HRZA 4WECA 4CM6A 3BVPA 3TQIA 4R1TA 5FPYA 4AJ1A 2ODBA 1VHJA 4I3FA 3WTCA 3PD0A 3GOQA 3R3ZA 2NU9B 4RTQA 2JLQA 3OY2A 3IPCA 4MVJH 1SG0A 1K98A 4E5UA 2VWGA 4ZPXA 3ZHQA 3S2UA 2XB9A 1ESNA 4ECEA 4EGQA 4KOAA 1P61B 2LE0A 1A1SA 3W1WA 3AOGA 4CCWA 1D2HA 1D09A 1V1RA 2QQ5A 1RI1A 1UJCA 1EFVB 4OSPA 5DOZA 3WLPA 2I8LA 4MYUA 2HRCA 3O4VA 4TWAA 1V8BA 2GN4A 4MP6A 1TLFA 1CT9A 2Q6KA 2C9OA 1PD0A 1DWQA 3EGXA 3MWEA 2FWPA 2W90A 1ZY2A 2NTJA 3NV9A 3WJ7A 3HN2A 3OCWA 4F3CA 2AI1A 3BFJA 1T36B 3HEAA 2ZSJA 3EUWA 1IY9A 2VF8A 2CNOA 3H2GA 4B3DA 2OGWA 2P4QA 1MLDA 3IMEA 1EVZA 1XJ5A 5FLEX 5G0VA 3O2QB 3HM9A 4DMUB 2ZB3A 3VVCA 1KHTA 2EERA 4ETWA 2Y1LA 4Y0VA 3WHIA 5JZSA 3GYBA 3RVBA 1LDYA 1NNEA 3U31A 5CEFA 5A5FA 5JNTA 4CEJA 1BYIA 4R2JA 1RRVA 3AR9A 3OTHA 4FMCB 1G2PA 4J43A 4F2HA 2AA3A 5BSHA 2HSJA 1KY2A 4BUJA 1IBLB 3HK2A 2C00A 1KJNA 2JLAA 5HP4A 4EUNA 2C8VA 3FUTA 3L2OB 3C3DA 4ND5A 2C2YA 3AFIA 3T3MB 2GN0A 3DEKA 1ISFA 1BH6A 3N70A 1IWPB 1T0IA 1ZHHA 5JWOA 4W8GA 4ZV7A 2FRVA 2GQ0A 2VUIB 1SC9A 3HZOA 4BNUA 4J16A 3OZCA 4NVRA 4XVQA 4Y6GB 1RXWA 4AS1A 1OKKD 1RKQA 1SC6A 2BP7B 2Z43A 3A04A 3M9XA 2R1TB 3AR7A 4ME6A 1YQEA 1JT9A 1ZJJA 4KV9A 1U9YA 5DM4A 2IYAA 1CUUA 2JI4A 3IVRA 3OJXA 3AQIA 2WJ4A 3H9BA 1UBSB 3BWVA 4LV8B 5FBHA 2EBFX 3CO5A 1Q7BA 4EW6A 2BM1A 2AOVA 3KKEA 1WHTA 1XI2A 3K2EA 4A8HA 3NUZA 5LKRA 1SCJA 3H1BA 2DOKA 1PAUA 3ROEA 2CXHA 1E96A 1KPGA 4CT0A 1BFUA 3RG8A 4UARA 2VYQA 1BDJA 1ZSNA 4ROSA 5JD6A 3VSAA 2QTBA 4BASA 1NE2A 1HE4A 1TGVA 4E07A 4IAOA 1S8FA 2PO5A 1GPJA 3K9CA 1DLJA 2XA9A 3AI2A 4G8DA 4J29A 1K4MA 1NUAA 1CHNA 1U1FA 3KJFA 4KE9A 1SHLA 3ONVA 1K75A 3LT2A 2WEKA 4L8WB 2AMYA 1EE9A 3WFIA 1JJIA 2BY4A 3AVQA 4BWVA 2WKSA 2EZ9A 4MWGA 4OH7A 2BEJA 2DSTA 5E4JA 3KUUA 1EFTA 4K9PA 1Z12A 3A3OA 3JD0A 4OJMX 4PG6A 4QDJA 4WN3A 2AXQA 2DU8A 3BHIA 4XJSA 5MN6A 3ZD7A 2GD6A 4HDCA 1PJRA 4REMA 4D26A 1K4KA 1QGUB 2XGJA 3HVRA 1MPTA 1X3SA 3D6AA 4RHXA 1ZONA 1FW8A 2Z8YA 2AH5A 2Y1DA 4K2AA 4N0MA 3UT5B 4Q7QA 2PXCA 1OJ7A 4HNHA 3WYCA 5IWCA 1FLNA 5LYJF 4Q18A 4Z2AA 4ARCA 2OZKA 2H0RA 5L7WA 3NDPA 1M7GA 2VYCA 4UTOA 1OFGA 5C8DA 2A5LA 2ZJ5A 4RYDA 5K5EA 4RZ3A 3TQQA 2IF2A 1XZAA 3CU5A 3GLSA 3WK7A 1WMDA 4GMFA 1SCUA 3DMHA 1Y5LA 2PYDA 1XZFA 5B1YA 1ZJ4A 3HXKA 4W1QA 2FG6C 4TXHA 1DPGA 2G1KA 1TK9A 1W4AA 4MRMB 4CWAA 2XH8A 2VTVA 2XSZD 4MUEA 2GSWA 4UHDA 3SFZA 4DA4A 1UWKA 4DANA 3CLVA 3C3XA 1UAYA 1RWPA 2X6TA 2EV9A 1ZD4A 3LCVB 4LPKA 4M8SA 4WKBA 1SUWA 5KTSA 4YP6A 5AW5A 3LIPA 3NRBA 4AZVA 1ZMOA 2OV8A 3LVRE 1YT5A 3Q41A 4FSXA 4BNTA 4C0WA 1SBNE 3IUQA 3MF4A 3BJZA 2QD3A 4G4SP 1F4LA 1S4QA 4X63A 4KPYA 3EPKA 2UAGA 4PHHA 1EINA 1QUEA 5LOVB 2OQ2A 5AW0A 3HCPA 3P4YA 4KPGA 2XMSA 4W8HA 3ND8A 2HBQA 3TLMA 3QJYA 1PQ4A 1U3VA 1T8SA 1JZSA 2Q2OA 3OE5A 4BNVA 5EJ6A 3A14A 2IXEA 2YWBA 5HM6A 1CUCA 4V38A 2WY2D 1OXXK 1NXTA 3K70B 3BSYA 3VBCA 2BGJA 2JGAA 2VO1A 3ZXUB 1IYZA 5BV2P 1KZ6A 1CUSA 4W8OA 3SWWA 4L27A 2PUAA 1I80A 1J42A 3FNQA 4J7UA 3OP1A 3LMKA 4DCTA 1C9NA 2IHJA 4NV0A 5JOQA 1JPVA 3Q6MA 1FUIA 4DDVA 2HJRA 2JHPA 1JL3A 4C89A 3OZAA 4DWJA 2O2HA 2FWIA 3AEZA 1HOXA 2KBFA 3DMNA 2WIDA 1Q92A 1TEHA 2H5LA 5SYMA 5IWAB 4MKXA 1GCIA 2HK7A 4JXXA 1G291 2OOKA 4IFTA 1DC3A 3ZVLA 4GOOD 3RIGA 5K20A 4NI5A 4ZVSA 4YYZA 2ILVA 2PS3A 2Z2XA 4QA9A 4C5AA 4QKQA 4HGYA 3EYWA 4AM8A 3R5XA 4YMTA 3T1NA 2QF7A 3PI7A 1CEQA 4KLCA 1UBRS 3LI2A 2PMWB 4AN0A 2P41A 2C54A 3DZCA 3O95A 5CCDA 2WP0A 4HRXA 1WXDA 2R62A 1CX9B 3DDOA 4XASA 3NTLA 4XOIA 5C34B 5JVDA 2DR2A 1IOWA 2H8KA 1NJ5A 5FNZA 4NZ9A 3VC1A 1AHPA 1POWA 4PBTA 4P3OA 3RYTC 3GRYA 1Y8QA 4G81A 1PZGA 4QBTA 3DDNA 4PYJA 4MK4A 1J0AA 1X3LA 4LRYA 2POCA 4JMPA 1W4RA 4IIJB 4LS3A 3M3HA 4UBJA 1YB2A 3RREA 5JANA 5JC1A 4D5EA 9LDBA 1Q0HA 1ADJA 4QM6A 2XJ9A 3MG9A 4IXDA 2I9KA 1X9IA 2ZUBA 1QPGA 2Q41A 3B53X 3N2GA 4XOUA 5LQKA 4PICA 4EENA 1N5JA 2VOJA 1C9MA 1YVUA 2PYZA 1ESEA 1PT7A 1EVIA 2V7UA 3CY6A 5JQWA 2QWXA 4FT2A 3UTDA 2H1IA 5BN4A 4YAJA 1FTGA 1VCMA 4LOKA 4R1NA 5CDTA 3T1TA 1X1QA 4D45A 1QHHA 2DH5A 1P0MA 2O5VA 1XRQA 2W98A 2J0QA 1EAMA 4O4HF 1QIIA 3C5EA 3T3EA 3ZYCA 2BMFA 4TTIA 3EARA 2OFWA 3KOOA 4IGIA 1SKMA 1M6YA 1HLDA 4LGMA 4CLRA 4AECA 3I73A 1NJSA 3K73O 4LDPA 1M34E 1VKOA 4Q00A 4QPNA 5HE8A 5HZMA 1SCQA 2NACA 3IULA 1KVRA 1QHHB 2VLBA 4JOCA 5L45A 1VE9A 4BXOB 4FCWA 4I66A 1O8BA 1T1RA 2JASA 4AF7A 1ICIA 3LUHA 1ODLA 1WVIA 2VLIA 3ZQ4A 2O2XA 3M4YA 3OAAD 3PHHA 3PHBE 4OOEA 2W8BB 2HU8A 3UJ8A 3V5NA 5B7QA 5JHGB 1KQFA 4AF8A 4M0FA 2HA6A 4FNGA 1Y8RB 4FS8A 3WB9A 1NVTA 1A5SB 2I2CA 2PAFA 1R6TA 2WBLC 3L8MA 3QUCA 4JVSB 1D8TA 4PWZA 1M6WA 2E85A 4YV7A 4KYVA 3AJ9A 4RSMA 3ABRB 5DM70 1D3AA 2Q5IA 2JFQA 4M87A 3IP6A 3WQBA 2ZZMA 4M1YA 5JISA 1E9SA 1SB9A 2FDXA 2Q4TA 2YZNA 1JG6A 3IAM1 3KDAA 4HDNA 2XECA 1KFKB 4IDFA 5TS3A 3S55A 3T54A 3RU2A 3UMVA 4BP3A 4CU5A 1YRLA 4N40A 5H4GA 2IBTA 2PZEA 3TG8A 1EXDA 1P1FA 2FMXA 1CEEA 2XTJA 4QPDA 3CFYA 3HV2A 1PDVA 4CZ2A 1QH9A 1N5KA 1ENOA 1HZZA 2DKNA 1XX6A 5LDGA 1E2BA 4F85A 4UFPA 4PXSA 3RHSA 5I9LA 3AF1A 5AJUA 4OXYA 2AEMA 4U4AA 2Q5QA 2WF9A 4Y3UA 3WFZA 3E22B 1TQHA 3FSGD 3R6GA 1IZYA 1TMOA 5DU2A 1BDIA 1B0AA 1YC5A 13PKA 3ET5A 4PW0A 2E1RA 3W8DA 5IXSA 1LZLA 1AGPA 2AK3A 3B12A 3IAXA 5JJCA 1XKXA 4LSZA 3OU7A 1RHQA 2WHRA 3D4PA 4HNQA 1T1JA 3CXRA 4JBHA 2WSLA 2UZIR 4CEIB 4ZHQF 4OQNA 4DV5B 2B37A 2Z4RA 2ATXA 2ZS7A 2QL6A 1ISMA 4P53A 3K6SB 4NCAA 4BKRA 1NBOA 1PVDA 4U63A 4Q6WA 3IL2A 3L4JA 3W5CA 3JALA 2WKWA 5CDSA 1HQKA 2IXAA 4M0KA 1PSDA 3VNRA 1P7CA 2D3WA 4GGPA 5DK6A 5IBCA 2IV2X 1OFUX 5C1OA 5GONF 3RIHA 4LK2A 1JWAB 4KN6A 2QSZA 2IYWA 1EDEA 1UPTA 3O2NA 4HJRA 4J3NA 2BFNA 4YRPA 3Q2IA 3SEAA 4KTVE 2JJQA 2LZ0A 3UGJA 1T3LA 3L0PA 4JSRA 5SICE 3RODA 2FPPA 4EOGA 2NV2B 2QRKA 4JOBA 4M98A 3LOQA 4BWFB 2ZB8A 1F8UA 5JATA 4ROTA 2O2CA 1PDWA 5EFOA 1N57A 1PGQA 3QW4B 1U2RA 4YQEA 5TVGA 2C4HA 4C21A 5CCBA 4DV7B 1E2MA 1DOAA 5CXQA 2HDOA 2QUKA 1UFRA 3T3OA 4JX8A 3TVDA 2NP6A 1IOLA 1T3TA 3MTBA 5TJ9A 3OX2A 1ZZGA 1TU3A 4NYIQ 5HTOA 1XUOA 3R0ZA 4IIJF 4JJKA 2WPDA 3RIEA 2W83A 4C2TA 2AOUA 2OMKA 3Q7TA 3L46A 3T35A 1RYHA 2H4XA 5EKTA 3QRWA 3KC2A 3PNVA 1ZYUA 4ESVA 4ZHSA 1RXEA 4RIFA 2QDKA 1EGMB 3BA6A 4I9GA 5KWIA 2R6JA 3WL5A 4QGAA 4RY9A 2VQEB 2ZJ2A 1Z9BA 2HM7A 4MCHA 2QJOA 4EHHA 3QLVA 4IVRA 4FNOA 1TO6A 3TZCA 1SY7A 1V3TA 2X0NA 3I9NA 1QAQA 2XMGA 3OUZA 1EXVA 1O94A 2E4UA 3AZPA 3N8GA 2YFKA 4TT3D 5BWMA 3F3SA 1DC5A 4YA6A 1QSGA 2Z5GA 1G2OA 5AHXA 1QLWA 3PFFA 1EM8B 1PNOA 4K5QA 4HGQA 4YEDA 1PZHA 3DVAA 1NV8A 4RJ2A 4TRMA 3SVLA 2QRPA 3KKNA 4TPKA 3NRCA 4CIAA 3A32A 1BRMA 1KVQA 2NSHA 3BB4A 4MKRA 4Q12A 4RDIA 3PDHA 2AQHA 2RKBA 3OT1A 5FQNA 4LHWA 1TZKA 2HMWA 4M9QA 4U02A 1B8UA 2FPKA 2IXFA 1JFLA 3IQXA 3KELA 3VR6H 1YBVA 2QS9A 4DLSA 5FWNA 2AK2A 1UH5A 3OWXA 5IVPA 4U5XA 1EK5A 2D2VA 1F12A 2O3SA 3IBSA 3T1QA 1QH1B 4HN4B 4V3CA 4WERA 2PBLA 1JHAA 2WNSA 1QYIA 4KGXA 2VJCA 1JYSA 3KSDO 1W5EA 1UF9A 2DCUA 3QENA 2NTYC 4LWPA 3CH6A 2ALJA 2PX8A 3II6X 2RH9B 2FSGA 1BXZA 4C3OB 4M76B 3UJDA 1MG5A 3UPUA 3W1EA 2D6FA 1V26A 4N5LA 4M8LA 3BIXA 1SXJE 3GNQA 4GR4A 4PYQA 1I7NA 4QFCA 3LNCA 1GUDA 3AY7A 5B4TA 4DCMA 1QR2A 1GADO 3IQEA 4RTSA 2ZIEA 4FN4A 3M1YA 3V7WA 1LU9A 2ZUEA 3ESQA 1V5WA 2YIJA 2QE6A 3D6HA 4IPTA 3K71B 2JJ1A 2R3SA 3C1UA 4J9VA 4RK5A 4DNPA 1YE8A 4A4DA 4LRWA 3PA6A 1GGJA 1QE3A 1EFUA 1YD7A 2D2EA 1YBHA 1FDSA 4YFYA 5DJ5A 1L1QA 1QG2A 2IIPA 1QCDA 3AEKA 5E7IA 3RJ9A 3UZUA 1MHTA 5JH7A 5MHTA 3EW7A 4EG3A 3KYDA 2VHEA 5K8TA 2PUVA 1Z8NA 1ODFA 4WLEA 3L6OO 5GONB 1Z73A 2JG3A 2QXUA 3FIUA 3FTDA 3SM3A 1YCFA 3BE8A 4GQAA 2XMCA 4FR0A 2MMCA 2Q3CA 1ZA2A 1OAOC 1ZIXA 3KR1A 2D1FA 2PLWA 4YAGA 3AFOA 4PIMA 1W52X 1VLZA 1XCLA 4TTJA 4BNXA 1RXVA 1XZQA 1M6VA 3M9LA 3I2IA 1HUQA 3SJAA 5FPPA 2QTNA 5M29A 4L4RA 1WTAA 1XKLA 4F9GA 1CUDA 3ILHA 1OXSC 1SOMA 1YONA 1MAUA 1YJBA 3A26A 3DZIA 3HXTA 3QOXA 4GQBA 4J6EA 4M86A 2V9ZA 1LQTA 2JLYA 2JJ1D 3E0XA 3FLAA 1F2UB 4R8SA 4S1WA 4ZOBA 1IQ0A 1LFDB 2WKPA 5FL7A 2G06A 1K86A 2GKSA 4FFRA 4GT1A 5I8PA 1CEYA 1DI0A 3IHWA 4J90A 4A03A 4CM1A 4TL6A 2V0GA 1CLEA 3IVXA 4AK9A 4YMLA 4Q6BA 4HAVA 2QY6A 1TX4B 2EG5A 2XEDA 3ZH2A 4QREA 2AOXA 5FBRB 5A0VA 3MAJA 4PNHA 3TDNA 3DTVD 3K6JA 1MC8A 2QBYA 1IZZA 3LC0A 3L93A 2CE7A 3MXTA 2BBWA 4MGIR 2PLNA 4CL8A 4RKEA 1V1MB 2FX3A 2AKAB 1WMBA 2DHCA 1BVRA 1PBNA 4MWEA 1DT5A 4ZEWA 2PR7A 4X1YB 4JN6B 4NV1A 5LD2B 3A9TA 1RM3A 2HO5A 1UT5A 2CEKA 1KBQA 4GMHA 2JFBA 4MHOA 2X22A 2Y1GA 3F2VA 1KFJB 4QJBA 4BLUA 4Q7JB 1KEUA 1TYAE 1EFAA 3ZXSA 1W44A 3BMXA 3OQVA 3ML1A 2A0XA 2WU8A 3R0VA 2I2DA 1CHDA 1SCIA 3BZUA 4YRLA 3LF1A 4HNVA 1OLUA 4QGGA 1DU4A 4BBAA 4QG3A 2XUZA 1NN3A 3D7RA 1L9XA 1Y1RA 1CU1A 3N6RA 4UNSA 3FFWA 3U44A 1JJBA 1W5BA 3S3TA 2V55B 3CNQS 4ZICA 1XN1A 2OR3A 1FDWA 1N3IA 2X0JA 4MIEA 2ECOA 1NF9A 4RVOA 3SZLA 4A0QA 4C88A 1CDDA 1P2BA 3OA2A 3FPHA 4ETIA 1L8XA 3KQOA 2WHXA 1THMA 3ESXA 1UMCB 1US8B 4UU7A 2N75A 1HE5A 1V47A 1BEEA 3OOSA 4P22A 4EPRA 1D07A 2B61A 4URVR 4UU1A 3T4XA 2JDIA 1E2KA 1KXZA 1BYUA 1YJ8A 1ELOA 1P5FA