3IAM6

Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, reduced, 2 mol/asu, with bound nadh
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
161
structure length
144
Chain Sequence
EREGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDAQADVMIVAGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFNNYAIVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVRGQAYNERGERLPPVAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-quinone oxidoreductase subunit 1
publication title Structural basis for the mechanism of respiratory complex I
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 35
structure length 144
sequence length 161
chains with identical sequence F
ec nomenclature ec 1.6.99.5: Transferred entry: 1.6.5.11.
pdb deposition date 2009-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
6 PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12280 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iam600
4HEA6 2FUG6 3IAS6 5LNK6 3IAM6 3I9V6
chains in the Genus database with same CATH superfamily
1GZHB 4B7ZA 3GNQA 1RP7A 2XNKA 5LJIA 1UUFA 2COUA 1R4AA 2GLUA 1IWBB 3W3AH 4GRDA 1KHTA 2FHPA 3I39X 1OLSA 3V4OA 2GPYA 1MB4A 4CL8A 4DCTA 4M89A 3RRFA 2AOXA 3P52A 3DOEA 3SXUB 4G4GA 2X58A 3F47A 2VF7A 1VSTA 4QUDA 4A8PA 4IHAA 2H31A 3UATA 4YMIA 1GDDA 1NV8A 1Q21A 4C7MA 1N0IA 5IKEA 1XQ9A 2I54A 3GRZA 1NLFA 4M1SA 2UYHA 1BFDA 1IM2A 5I9SA 3E9MA 2XUIA 3EMVA 1U2EA 3F5FA 3OF2A 1TJ5A 3K9LA 4ND2A 3HXMA 4RK0A 4O2RA 5TC4A 2F9FA 1QLWA 3VYWA 3RADC 3QVSA 1UBCA 3F3SA 5HJ7A 3FTPA 1RHRA 2VK2A 2VK1A 2XXJA 4K9LA 2O7RA 3NRJA 3WLSA 2J3LA 5JD5A 3IAS6 5ALOA 1RRGA 3LQFA 1KE2A 1O94C 2G36A 2EEPA 2FPXA 5DSZA 3SOPA 5CLGA 3UWDA 3WSTA 4O2BB 1MT3A 1A69A 4KE6A 1MV8A 2CLMB 2WHQA 2ZRNA 4JT8A 2FN8A 4JJKA 3RTDA 2PRJA 3QVTA 4G0OA 3J81k 5SZIA 4KCGA 1XMQB 3O4IA 1T0HB 2FE4A 3M83A 1MJFA 1C4OA 2ZI9A 1SXJA 1V0JA 1XCMA 4NNPA 5CAEB 4MUKA 4J4BA 3U4HA 3CGWA 3E8XA 4WNCA 5AOVA 1JDTA 1RC0A 2RHGB 4ZWNA 1NJGA 3CSDA 4CV1A 5MGBA 4MNTA 3THWB 3BTVA 4BTLA 3T5TA 4RS4A 1QQTA 4PF1A 5CVCA 4ARIA 3OMWA 6REQB 1XRPA 4NZYA 1YQXA 4OM7A 2XWPA 4BC1A 4BMNA 1J2JA 4K2HA 3C4VA 1NF3A 4CZ2A 3G2OA 3ZVLA 2W22A 3B6ZA 1B8VA 3OX3A 3AK4A 4HRYA 1KFJB 5AI8A 3E1GA 4QPNA 5G0SA 4GX5A 3BERA 4QARA 1H9BA 3U4QB 4KKXB 1ZL0A 4TV8B 3CKYA 3UUEA 2FSIA 2UZ3A 3T7SA 2W42A 1NXOA 1SCIA 1UZLA 3QX7A 1GNLA 1JNYA 2V54A 1QZ3A 4M2LA 4C04A 1O8BA 4V38A 1QFSA 1W4CA 4MLDA 4BLQA 1U8XX 3GUZA 3X2FA 2OHOA 2G40A 3IQHX 2IA5A 3M3DA 1YR3A 1CU1A 1E2PA 2AEFA 3E2PA 3EGXB 3H86A 3QWHA 2D1QA 1XHFA 1E9EA 2GZHA 2JVKA 2XNDD 3DBLB 1CQIB 1ELOA 1NHGA 3DR5A 1JJAA 2OD9A 2YNMA 3DE4X 3IMKA 2FUG1 2IK8A 2BGJA 5AH0A 4CKCA 4CCSA 2P4EA 3W90A 2EFGA 1K8ZB 2H1VA 4UTOA 1RIFA 1EUDB 3LHFA 1WUTA 3WKBA 3BXFA 4DILA 4E30A 1D2GA 2VYNA 3MZ0A 4X91A 5LLTA 3ZGYA 5CA1B 3DCJA 1ZD2P 2AFIE 3H7AA 1C9NA 1RE0A 3K9QO 5IAJA 1NQAO 2OCIA 3ZCUA 2CFRA 1PR6A 1W0KA 1Z47A 4WKBA 3CWQA 3DPSA 4QHTA 4HN9A 1Y9DA 1HL3A 3NVMB 5IK2A 4HVCA 1KJQA 2AOUB 2J3JA 3AVWA 2XUGA 4J8PA 3VH4A 5ARBA 4N7RA 2W6MA 2I6FA 4Y2GA 4HLQB 4HGZA 3BREA 2PL9A 3OFND 1VL8A 2FN3A 3DP9A 6YASA 4D57A 3L1KA 3KUDA 3PICA 2IW3A 4ILEA 5HKLA 4PO3X 3L9XA 4HWTA 3UK6A 1LX6A 5DYGA 5KJFA 2MR6A 3ZGVA 1CF4A 1MDFA 2VJMB 3HM2A 1C0IA 2XE4A 3LCJA 4EHJA 3PNQA 2RGNA 3U0VA 1NXTA 3EZ2A 3F2IA 2I3BA 5AFSA 5AUNB 1ZMOA 2BGMA 3A0RB 3M0EA 2R6R1 3ETLA 3M49A 2WM8A 4TLBA 5SYAA 3ZLBA 2NXWA 4I0WB 3BWXA 5K3AA 5CFMA 4BV2A 4EKGA 1ZG3A 3UJ8A 5KJEA 1X0VA 1RBZA 3HH8A 2WM3A 3ID6C 1ZGGA 4K6MA 1QH8B 3TLMA 5C1OA 4Z3OA 2OD7A 3ZU3A 4J1QA 1V47A 2IYFA 2M6RA 4RK6A 3K9NA 5JEDA 1YK0A 5JZVA 1H4SA 721PA 3YASA 3LQRA 2W6QA 4HF7A 5D6OA 1WJGA 3HLTA 3RIYA 4KQMA 2CSXA 1A8HA 3FWNA 3L82B 5HZMA 1BS9A 2OXRA 3VR6H 3U5TA 3RSOA 1F1JA 3CVXA 1J2UA 2OV4A 3OOSA 5JCJA 3SBOA 2DCUA 5JWRA 2QT0A 5DLQC 2O8BA 4EMSA 3NETA 5EKUA 3QLTA 1SVOA 4XB6B 2XMBA 3U1BA 1LPSA 3PF9A 3H1TA 4KSYA 4MYUA 4BRUA 1ZGJA 2W6OA 4XIGS 3IEMA 1XLTA 4F4JA 3MLEA 1WQ1R 4QX6A 4DAEA 4PZAA 2X13A 4W5JA 1FJ2A 1SKYE 4Z7OB 3VSEA 2H5EA 3L1JA 2GAFA 4R01A 2REXB 4B8ZA 1K88A 3QX8A 4PZYA 3VZDA 4BMZA 3K1JA 1CB7A 1R6UA 4R51A 4X71A 4KMRA 3P9PA 5HSGA 3BJEA 3DCIA 1ACLA 4XGQA 1D9XA 4H1VA 5G0UA 5BN1A 5IDYA 4QEKA 5LZ4A 3G2JA 4R40A 5IW8A 3H87A 4MGZR 1CJBA 3OZFA 1X9GA 2EFJA 3PNVA 1P72A 3GLGE 5EUQB 3A4LA 3C2QA 3TRFA 4BFWA 4RHFA 4ZAVA 1FLAA 1R64A 4IH1A 5FPHA 1E3DA 3EBPA 4TXNA 5B2EA 2IUEA 3ZU6A 3DWGA 3VC3A 2VUIB 1C30B 3DZHA 2HO5A 3H8SA 2Z2IA 1UBOS 1ZGHA 4NNJA 1P1JA 5E1MA 5EZ5A 3RFUA 4ABYA 1R88A 1YUMA 1F8UA 1L5OA 4A2QA 4F3NA 2YHSA 4XXHA 4F8EA 1JEOA 4D79A 3K2IA 1RC8A 1V6CA 1RWVA 5HBRA 1XO1A 1YRHA 4Z6KA 2I6TA 1CSEE 2O8FB 1Q2XA 2FUNB 1DQSA 2DQKA 4HGNA 1RMYA 3H1AA 5BRNA 4DANA 1UZAA 4NCNA 3VYUB 2YMQA 4OQYA 3GPCA 4US1R 4KHZA 4Y0AA 5AW3A 1W44A 1HDYA 1PTJA 2WJWA 3GRCA 3FCAA 5EJMA 4HB3A 5CNKA 1IMJA 5ALRA 1KJIA 4L8GA 2RG1A 5ALVA 3BX1A 1I24A 1YA6A 4XWYA 4OJNA 2JFQA 3ZIUA 4R2IA 3AVXA 3FUWA 1CZNA 4CL0A 5JPCA 4EYGA 1WXHA 3KAPA 4AG3A 4R84A 1XMPA 1HDXA 1SBHA 1X7HA 2A2ZA 3INRA 3V2IA 4ZYTA 3N6RA 1YDEA 1Z8FA 1RQRA 2A5FA 3OZXA 4DG8A 3QJ5A 1NHWA 4JC8A 4ILKA 3RW9A 3WQBA 2W37A 3L1VA 2WBLC 3ZCVA 4YAWA 1T1EA 1RQ2A 1UK8A 3BH7A 2PRKA 3C6XA 3RIMA 3ZHOA 4ZEMA 3HPQA 4WNAB 5IN4A 5KB3A 3UBTA 4FM9A 2H1RA 2I2BA 4OPMA 4Y30A 4GYYA 1RZUA 1QGDA 4RM3A 3FTNA 4TL8A 5LBTA 1DQRA 5TS3A 2OBXA 2XOEA 3M6FA 2ATCA 2L17A 3DB1A 1THGA 3H13A 4R0VA 1P19A 2J5KA 3D7LA 3W06A 1B41A 3GWGA 1ITZA 2Q3MA 2JL1A 2I6UA 1AKUA 3P27A 4JA0A 1Y6RA 4L4SA 3RVPA 4QFCA 1R3DA 2NZUG 1O94A 1LKZA 2FLWA 1KVQA 3HJGA 2GM5A 2X1HA 1B42A 2QTAA 4ZO8A 3AVTA 1TA0A 2E3JA 4D6XA 1T1GA 1O6GA 1DIOB 1HSOA 1TMGE 3M5PA 1YHZA 1YT5A 5EXSA 2J45A 1JYEA 2XRMA 3F2VA 3PE3A 2PKXA 2PVCA 4XX0A 3PXDA 3AH8A 3L40A 4OGKA 3AP1A 1VMIA 4TQAA 4RZQA 1J90A 2WVAA 3VZPA 1KR5A 2UYYA 2PGOA 2H11A 3B1ZA 4M9UA 4TLDA 4RSMA 5JNVA 3NHLA 2QLMA 4L2IB 4Q03A 3D0KA 2JKYA 1DHRA 1AKVA 2GTPA 4G6ZA 4I46A 4OF4A 3THYA 3PZBA 1DAOA 2JIPA 1U0BB 3JQAB 1ONBA 3FGOA 3QNWA 2QT9A 4NVRA 1PQYA 1TMKA 4D96A 1XJ5A 2RARA 3OHSX 3A06A 3SDSA 1ST3A 3AVOA 4NFSA 4W1SA 2ANCA 2PCLA 2D0IA 4O4JB 3LA6A 4BRZA 2BFCB 2JGLA 2XWBF 1ZXLA 2CFSA 1DXQA 3V4ZA 2X77A 2ATXA 2O2ZA 4GX0A 2ZAYA 3T3DA 3UFXB 4BNIA 3K71B 1E1QD 1C4XA 4N5LA 3UJ9A 1XDSA 3BEDA 1C4WA 5I45A 5KYNA 4B3MB 1Y4UA 3C7AA 5E3IA 3ZDCA 2YC2C 3FYUB 1U0JA 1GV1A 1WWKA 3A14A 2REQA 3DV9A 4KXLA 5D87A 4ND7A 5DM70 5AVUA 1VGQA 3CUUA 1T9ZA 2JAQA 3FHLA 4IKOA 2HZBA 4IIVA 4U1RA 5GM1A 4Z49A 2PD4A 2LUOA 3IMCA 3QXXA 2H1IA 3ZH2A 4BMYA 4BU0A 3L2OB 3ROMA 4ZJYA 3UVEA 2AOVA 5TQ2B 1H22A 4HH0A 2C8LA 3DFUA 1NWCA 4ZEOA 4FBLA 2WZQA 3VNVA 4P7JA 3Q7PA 1EDDA 2HAEA 2VP4A 4H17A 5KI6A 1II9A 4H1WA 4IDHA 2UYCA 1CHDA 1DRWA 1NKVA 2FR1A 3K9BA 1ATZA 3MAJA 2XTZA 4IL5A 3U7QA 3PTAA 1M2GA 1P5RA 3AIKA 4BQOA 2WIBA 2ZJ4A 2H2FA 3FH0A 1RHKA 7REQA 3S81A 1KC3A 4EG7A 4MXDA 1I4OA 1IBLB 4EFLA 3EWIA 3QF4B 3PUIA 4EW6A 2PBFA 4NEHB 1KYWA 1W29A 4HNVA 4EATA 5B1DA 1A9RA 2LV8A 1YL7A 3QSYA 3G82C 3QVMA 5A4JA 4KQFA 3HWRA 2CLKB 2GI4A 3FSEA 2XSZD 3GZJA 2FK8A 1OWLA 4QULA 1B0ZA 9LDBA 3U4GA 3JQ9C 3NWPA 5IWCA 1T13A 1YBMA 3HBJA 1Y7TA 5KVQA 2B6NA 4RKQA 5EESA 2W7TA 4FILA 3DMNA 5AW1A 1VPWA 2O54A 5EJAA 4QOHA 3TQCA 5IZ4A 2ZUVA 3F7OA 3JVEA 5F3WB 4PBSA 4NU6A 4Z8YA 3JARB 2O48X 2HRQA 1ZKDA 4KSBA 2X2FA 1MR3F 4D81A 2Q8NA 2VPPA 1O89A 1BWRA 2VC2B 2JKVA 5FH9A 4V0SA 1L7VC 1RXSA 5CB4B 1J7KA 2ONZA 1TTQB 4Z2YA 3DVAB 3R1IA 1KO5A 4Y98A 4ZT7A 2PGDA 1C8BA 3ELUA 4Q7KA 3AM3A 3IP9A 2C2GA 1JDPA 4IDPA 4NYIR 4BP9A 4U3JA 5BOSB 1BKSB 1BDMA 4HK4A 2UZ4A 2X4DA 3R40A 3WIBA 2AE2A 3KXPA 1GPMA 3MOIA 5LIRA 5G53C 1JQLB 2XDQB 1N5IA 2IY8A 2JBAB 4F93B 3LSYA 1PQUA 4LJKA 3LP5A 4CU5A 2KQUA 4BV3A 2WTAA 3AJDA 5EYPA 3IPCA 1CJSA 4B45A 1DIAA 5JZSA 1GTSA 3SFZA 1GUZA 4U6NA 3NI2A 1EJ6A 2Y68A 4OLBA 5JI2E 1WV0A 2FTKE 4AI6A 3DOUA 3VSCA 3G5MA 3G13A 1JG6A 2A8YA 2MSWA 3K0AB 4FGZA 1OGJA 4CT0A 2YWFA 3IRVA 2R8ZA 2H7YA 1N32B 5F73A 1Z3CA 2OZVA 2QGFA 3AFOA 3BQNB 4WLEA 3S1AB 1NPYA 4L5AA 4M6WB 2R47A 2ZSAA 1A2KC 3BCSA 2VDNB 3ETDA 2HSDA 5JQGB 4CV3A 2EWWA 3B78A 3LJKA 2RGRA 1E59A 4BBAA 2HSEA 4BNXA 1TJ3A 3EY4A 1UH5A 4RGVA 3RFXA 2G9UA 1N1DA 2WUDA 4G9EA 1DOAA 4W7SA 3GK3A 4I9UA 1CVIA 3A6DA 3LTEA 5FQNA 3V1LA 4XRRA 2PH3A 1H85A 1CEQA 1OWMA 2C9YA 3CX7A 2JLRA 4EP1A 3HU1A 1IJKA 3EZ9A 5HZHA 4L0QA 3V5NA 2ZDQA 1AQLA 4Y2HA 4Q34A 1GAWA 1L5HB 1YDGA 4RD3A 2C7GA 3NONA 3HKDB 3KYCA 3EOBI 2GN6A 4F2GA 2ZS9A 1JE0A 4J76A 1C9MA 2PQ0A 1Z4PX 3GZTB 5LQCA 2CSUA 3OBIA 1QTIA 1NBOA 1W6RA 1I7QB 3LDAA 2FUCA 3W9YA 5CPBA 5BSHA 1U2RA 2X0NA 3FKJA 1GCOA 2E87A 2I4MA 4MWOA 4AMUA 5C4MA 4AY6A 4KPYA 1M34B 3AERA 3IBGA 2P9BA 2QT1A 2XDAA 4FKBA 1HKHA 4URYR 3G5AA 3NNDA 4FOOA 2KLBA 1Y1LA 5DT2A 5LQRA 2AW5A 2EBWA 1Y8QA 4M8LA 3PEFA 1ZAYA 4WOJA 5EINA 2QP9X 4LYFA 2BEKA 3PQ2A 1JJFA 2VRNA 3ZWXA 1I3MA 2IDMA 1MAWA 3S29A 4DXHA 1MB9A 5JXWA 1GZ4A 1GDTA 4RM2A 5E4FA 1UOEA 2AD5A 2AMFA 3JQDA 3UWOA 3UMJA 3L4JA 1SXPA 4PZPA 2XCQA 4UOZA 1PK8A 3FCOA 3ZDYB 4QKQA 2ZREA 3AHGA 5T4FA 3HXOA 5M04A 4F46A 2P5SA 4BLUA 4K9OA 4YJFA 2X3FA 3IESA 1YS2X 1Q0RA 4KQWA 4BZPA 4TT3A 4RU1A 4GPIB 4Q1VA 1CIPA 4PFKA 3ESYA 4RGYA 2Q3BA 1D7AA 3OQBA 2P9YA 1V71A 1QJCA 3GJ5A 1OFIA 3W5UA 2YW2A 2V59A 3NTLA 5I9MA 1G59A 1R9NA 4GC9A 3U7EB 3U7JA 3HSKA 1S9HA 3B5JA 4RDHA 2Y1XA 3UV7A 5IJ9B 2AFVA 2XMGA 2YHIB 5JDIC 2CXRA 3ZDEA 1Z38A 3GLFB 3L01A 1F2VA 4MB6A 2XXAB 4OGLA 2DFNA 2QRMA 4NH0A 2NXNA 3TTVA 5KVSA 2Q5OA 4MKHA 3ZTTA 4EUFA 1WPQA 1MQ8B 1ISGA 1PGJA 4BLSA 3VOSA 3IKTA 4BKMA 3I2FA 4F4UA 3B1WA 1G8KA 4BCBA 3PIIA 2DG2A 1N9GB 5K3EA 1D6SA 2PO5A 2DX7A 3BN3A 1MGPA 1V45E 4JB3A 1XKXA 1O5IA 1XG5A 3OEED 3SMVA 1IHDA 2ACWA 2PH5A 1QDLB 1EB8A 1EZ1A 4ND5A 3NEYA 2FWRA 2DTDA 1HQKA 4G67A 4UC0A 5BSUA 2Y1DA 2Y76A 4BCCA 5B1HA 2G4CA 4BCDA 1P6UA 4JLWA 5LQSA 3P26A 3LVRE 2FSPA 2VJDA 4JNCA 3WIVA 3ZX4A 5I9IA 3H4VA 1VSQA 3ITKA 2GH1A 4HBGA 4R7GA 3U0BA 2K2WA 2NQTA 2PDAA 4WJLA 1D6NA 4U7DA 3GIWA 1KS2A 2Z98A 3BKXA 4OHMA 4P5DA 4ZO7A 4AKSA 2VWPA 4P6VF 4Z4CA 2ZOSA 1T25A 4WKCA 1FJGB 3QZUA 4TMVA 3RUFA 2DWPA 2XODA 2FI1A 4Q7MB 3F9IA 5F5LA 2IV7A 5A7FA 2JGDB 2EG9A 1J00A 5DXJA 3KP1A 3ND6A 1ESNA 1ZINA 1M1YE 5AK6A 2O5EA 4FMCF 2BFAA 2IHZA 3Q0EA 2WUGA 3BCUA 3O0DA 3V9PA 1KSJA 5JAQA 3WMXA 2EZ8A 3P5BA 3X1ZA 3ZI7A 2YMLA 1ZMBA 3EAQA 4QDJA 3SQDA 3VZBA 4G41A 2P7IA 4AUNA 2BGTA 3DT9A 4GQAA 3ZDXB 2ZRLA 1JEQA 2OXCA 3COSA 1ULSA 2H1HA 4IMIB 4R16A 1UJ4A 2AZMA 4WHMA 1ABEA 2GF2A 3D64A 4BKOA 1Q12A 3JWGA 4KQ1A 1L9KA 1S2GA 2ZUWA 3N86A 4YMGA 2D06A 1X9IA 1Y1QA 2AX3A 1P1CA 1EIWA 4C88A 3CJRA 3H5LA 4RXMA 1IRIA 3D4BA 4HNQA 1KP3A 1CTQA 2C5AA 2KPOA 4KXMA 4JJ4A 1E1QA 2NWQA 1QH0A 4B6PA 2NT4A 2C7VA 4F12A 1V1MA 1ZYUA 2DKFA 2JDID 4MDHA 1ILWA 3VNAA 1CR0A 1TT5B 2RI0A 1E64A 3MCTA 3JQ7B 4UEQA 3RAPR 1L1EA 1Q11A 4C1BA 1CDOA 5FFMA 2O1WA 3PGKA 2CJWB 4YJ2A 5C18A 3PR1A 3U4MA 3LECA 3DBHA 1PDOA 2VDRB 4IFBA 3IOYA 1OGIA 4H6PA 4ZEXA 4UUPA 3RGGA 3REQB 2BEWA 4HUQB 3O3OB 4LDZA 1WMBA 1ZN9A 2Q4BA 4HZUB 1B8UA 3JR3A 3DMYA 4LXYA 2IZ0A 4QJBA 3JQ9A 3VDMA 1AUVA 2YXPX 1RXWA 3D4IA 1U90A 4DQDA 4DV2B 4EA6A 4EI2A 2NVUA 4NFYA 1JSXA 2M1XA 3HZHA 1VJRA 3A1VA 2QXYA 2Z2JA 4FHEA 4GG1A 5I7EA 3J80A 4M1KA 1CCWA 2EXXA 2UVDA 2DCMA 3BD8A 2ZIZA 4B6JA 4RXUA 1E9SA 1NW3A 2WJPA 1YGPA 2VP3A 4LRTB 2O3JA 4I36A 3RNLA 4U5QA 1FP6A 3A6EA 2DHEA 4TLLB 2Q1UA 3EZGA 2GCOA 2JLCA 1UQRA 3IA2A 3Q3VA 4DJTA 2VDLB 3VZSA 4EGJA 3QPAA 2VAVA 1W48A 4I81A 4OXQA 3BWCA 3IALA 2MSDB 3KQQA 5HIKA 5HNKA 3M9WA 4ZI7A 1GQQA 3Q2IA 5LDHA 1WXWA 2Q5HA 5K3DA 3TEJA 2Q2VA 4GKBA 3WHLA 1WKCA 2RGWA 2IUSA 5DI3B 3A58B 3JTEA 1AB6A 2FMIA 2WSLA 3LT0A 5EZYB 1M72A 3B52X 3WIDA 1KBOA 3N2GA 4AZVA 1EGQA 5IDWA 2ZSFA 2JAHA 4EABA 4F04A 4GKJB 2SICE 1W96A 5DCLA 1G55A 2CEKA 5CT9A 5HW0A 3A2MA 1I1NA 1B93A 3ACCA 3E5MA 1M67A 4R2MA 2H1OA 1L5GB 3GCGA 1UR5A 2J9FA 2VTKA 1Z6ZA 4IO1A 5AKJA 3GT7A 4GPAA 2QTWB 1LDGA 3DFMA 1DTSA 3FNRA 3FMVA 5T4EA 4YV1A 3RVLA 1ACJA 1A71A 3D3JA 3MGBA 1YFZA 2RGGA 2NSDA 3C6KA 1YI1A 3TVDA 5JPIA 2QX6A 5KWVA 1D4ZA 4I1VA 4MCHA 1CUHA 3IAM1 5EIXA 3U62A 3ZGOA 1PBTA 2V5AA 2FMFA 3UMMA 4PC7A 1T5TA 2QTRA 4MVJG 4LOHA 3VVBA 4CT5A 2HHAA 3EXEB 1PDWA 3A3OA 2BBOA 2A1TS 5GJVC 2W4MA 3UUFA 3QFCA 4C6TA 3BWYA 2HF9A 1T91A 3IELA 2C9BA 4QFBA 1Y3BE 2QVBA 3D5TA 4XSGA 5E7MA 4LZAA 3ISJA 1RLIA 1OA1A 3GXOA 4PNPA 4N01A 4W63A 4HAXA 1JHDA 1JNXX 1X80B 3NWJA 1S89A 3HCCA 2Q6TA 4ZCIA 3K70B 3LUJA 3HLYA 1EVLA 1Z8HA 4KGZA 1QRTA 1Q22A 1M2JA 4MV1A 2IBMA 3IH5A 4AX4A 4EAQA 1CRLA 2HFKA 1L5RA 3JZFA 4B85A 3BGOS 1OXMA 3NKVA 4P98A 2XF2A 2Z5FA 3AF1A 4IJ5A 3ZWNA 3KZCA 1ZP6A 1DO2A 1E1MA 4ZJZA 1F6BA 2QD1A 3A4VA 4QYXA 4DIBA 9ABPA 2FUKA 1V9CA 3N2IA 2IH4A 1V5WA 2CLDX 2Y8EA 4P7GA 2NTYC 2QA5A 3V1YA 3ENZA 3HUUA 2J6BA 4I99A 5K3SA 2IPOA 2PAAA 1ADCA 1MMFB 3A9WA 4MQ4A 5CYFA 2QM8A 5THQA 4E22A 5J1TB 1QK5A 2IQ5A 5AKHA 2VT6A 4DARA 4AURA 1SWVA 2GEBA 2J3DA 3IV9A 2FPOA 1CB0A 1I1HA 1OKKD 2GARA 3QV1A 3O38A 3REFA 3CB2A 4NYJQ 1V3TA 3TDNA 1EQUA 3F5DA 1FP4A 4CDGA 1QV9A 3WXMA 1BWSA 3AEKB 2YV3A 4ZQCB 1IOZA 2BJWA 3L04A 1NVTA 2QEQA 1JQ3A 1EWTA 4RMNA 2P6PA 3PGA1 3RTAA 1CEXA 3TX2A 3VR3D 1O54A 1UJMA 4MQEB 1T3GA 4BPBA 1GAXA 2XUJA 3PSHA 2FQ1A 2IIVA 3H1BA 1DEKA 2IITA 4MUHA 3AESA 1X92A 5EA2A 3HWX1 2BYTA 3HJUA 5DYNA 1DB3A 4H7FA 4F5YA 4KO3S 3OQNA 4XWAA 3TZKA 2GPTA 2BZ1A 3HFGA 3W7AA 1FS4A 2BP7B 1LV8A 3UUGA 5FI5A 2YIDA 5M7EA 1T9GR 4E5YA 4L76A 1SK8A 4DLNA 1T8SA 3OPYI 2D5CA 3GJ0A 2X23A 2DLCX 4A0FA 5DMXA 2NUAA 2ZWVA 5LUBA 5F5NA 5AVWA 3ZCSA 4GMDA 2P1DA 4LTMA 3DPIA 2JGIA 3L6BA 3PC4A 1JTFA 1XTKA 3PI7A 3H4IA 4JBXA 1RI1A 4O33A 3NUQA 1Z7EA 2XDYA 3ZY6A 1FMJA 3W3AA 1EDOA 1ND6A 4A2PA 4R7ZA 5IRCD 3U40A 4IMJB 1CEEA 2I2FA 4Q18A 2X0DA 1AZSC 1MBZA 3OEEA 4BO4A 2IYNA 3NIFB 5U4QA 3Q7TA 1K5HA 1FP7A 5K8LA 4Q05A 4GKAA 4DM4A 1JHMA 4YAOA 1VSVA 5EAIA 5AKLA 1BHSA 4GOMD 4D6PA 3CXRA 3DZFA 4ZVRA 1W0CA 1N57A 2R87A 4IFIA 1EHCA 6NULA 2D62A 5BV7A 4MS3B 1G8PA 4X8OA 4DM7A 1U0TA 3HYRA 3SLGA 1RACA 1G9SA 2Q3JA 3HY6A 3HSYA 4NECA 3TLYA 4TTAA 4Z7QB 2VQDA 4RZHA 5EPUA 2VSOA 4URVR 1EFUA 3IT1A 5E6RA 3S1SA 1KQPA 1OCEA 2PMCA 3PYLA 1VECA 3WLPA 3DVQX 5EC8A 3OJEA 4RTQA 2FZGA 4GPBA 5C35A 4CKEA 3NBYC 5C4GB 5J4KA 1CUUA 3PNSA 3SHQA 5EHZA 2BEUB 4LVCA 3T5MA 2PU7A 1A9YA 2XHZA 3PC8C 4XOIA 2R8PA 3OP4A 4DCJA 5AESA 2DHDA 3IQWA 2ETVA 1KY4A 4NOLA 1I7NA 1IHUA 4R81A 2JANA 3BHIA 2Q29A 1A9OA 4BVAA 5I8ZA 2I6QA 2R85A 3GLSA 3UWPA 4RQAA 3WZMA 4DCOA 4GGPA 4DIEA 3H18A 4IQGA 2NYUA 4UZEA 4KP7A 3EOAI 4H60A 3OQMA 3B1JA 4L57A 1N7HA 4WLNA 4H16A 3UXMA 2EFHB 2I1WA 5HFAA 4JYAB 3FJ1A 2H5IA 2ID8A 2WHEA 4NG5A 5IDVA 2WHXA 2XRZA 2VSXA 2Z5LA 5IDXA 3FPJA 3CNEA 2INGX 3GVXA 1ZMXA 2E4XA 2GF0A 2X2EA 3IJ5A 4LE2A 5AK5A 1GKYA 2GD2A 2IW1A 3KTAA 1RXEA 3DW1X 4ZT5A 5KBYA 1XHLA 4QGAA 3KD3A 5ADUS 1E6WA 1GNTA 4BFLA 2DE0X 2DBVO 4Z4FA 3R3HA 2DPHA 4AXXA 1P5FA 5CX1A 4DLZA 5KS2A 5LYJF 4BBZA 1SO8A 4QUHA 4XJTA 1CRQA 4YHBA 2X0FA 1L7BA 3WAKA 1E9VA 4YRIA 3JX9A 4NMMA 4I55A 3JALA 5ITZA 1PJSA 3QI2A 4D9FA 2R6DA 4HQOA 3KBOA 1EVYA 1YZHA 2PSJA 1A95A 4HI0E 3A32A 4N6OA 4CEJA 2JGEA 3MM4A 1G60A 1LX7A 2IYAA 4OHRA 5DYTA 5AT1A 3WRYC 3PJEA 1HOTA 1P6QA 2A33A 2B9EA 5FV7A 4IDOA 2VO1A 3I4LA 1T26A 2HHLA 2HWWA 2GK4A 4O1HA 4D9HA 3C3JA 2CCJA 1UPCA 4FS3A 1JXQA 5JLJA 3SQWA 1ZFNA 1FQJA 4PPYA 2QL6A 2OHGA 3TOCA 1YA4A 3G6KA 3SQOA 1OU0A 2VHUA 3GEMA 3OZWA 4EFMA 4UULA 5EMLA 3PA6A 2REOA 2B30A 1H0SA 4FU0A 1Z5GA 4WV3A 4R83A 4AC9A 5BWNA 1X74A 2GWRA 2L0XA 3CLTD 2NUTA 4B9AA 4CKYA 5JOQA 4IYRA 2BCEA 4YUZA 1SXJE 2HTEA 5IEJA 5HVNA 4OQXA 2W4QA 4GP7A 4TYPA 3ZNQA 4FYIA 5TGTA 1PWZA 2GVNA 4Q47A 3OKAA 1CUFA 5E7QA 1SHTX 5IKPA 1ESZA 3SHFA 2XUDA 1EFVB 1RQGA 3OURA 5F7OA 4DV1B 2AXPA 1HZJA 5KDOA 4B6SA 2RBKA 3D7KA 4RKFA 1H69A 1IG3A 3IEVA 1UWKA 2QTGA 4EKYA 2FW7A 1E79D 3PUWA 3JQRA 5IHPA 3EDCA 3K0SA 3MUOA 3TLZA 1S1CA 2JLYA 1NVXQ 4FJ2A 2VCEA 4XLTA 3RUIA 1XVLA 1X3SA 2OWEA 2L18A 3SYTA 3DTVA 4XTRA 4YMLA 3OZCA 5BMOA 1Y8RB 2V6BA 2AOTB 3X0DA 1E0DA 1EP2B 3N3BC 3QXSA 4YAFA 4ZREA 4BO1A 5D51S 5GP1A 5DNEA 3GT4A 1NQVA 4KPUA 1CLUA 1R74A 4RSRA 3CW8X 3KKQA 4W5HA 2ACEA 4F1JA 5C32A 3OCVA 2HO4A 2OKGA 1U3GA 2ZUTA 1QHHB 3ZQJA 2DBYA 1PLKA 1DJMA 3GA7A 4HB4A 2O05A 2CYAA 4KVAA 3CBGA 3VR6A 4QECA 4CUJA 3FVWA 4LQ4A 2MYUA 3V4RA 1YSCA 2JD0A 3WLFA 3HBLA 4ZOLA 1UBMS 2PHZA 3IIJA 1Q7EA 3LXMA 2PX2A 4NYMR 3G0CA 3RI3A 1YJ8A 1KEZA 1WMAA 3C43A 3NRCA 1UC8A 3H6GA 1WZCA 3AL2A 1QYIA 1Y98A 4JY7A 3QHPA 2QMZA 4TGLA 2XVYA 4J3JA 4LQLA 4YDHB 1J8DA 3TUZC 3IO3A 3MN1A 4JB8A 5EZQA 3AM5A 4I4NA 4MR8B 1KDVA 5D1NA 5L4NA 1YZQA 3JS5A 1QP0A 2BBWA 3DM9B 5JG7A 3S2YA 1HFJA 1F1BA 4AJ1A 4P4SA 3TSOA 4DUGD 2FPUA 3ETNA 2LGJA 1C81A 3FLMA 4YVFA 2DPLA 3UJBA 2PGLA 1QF7A 2IYLD 4F6RA 4Q6BA 3KCQA 1BRMA 1NRWA 1GSOA 1MEOA 2QRGA 3BRSA 5K0EA 5K4HA 4FUTA 3WGVA 2H17A 4JVMA 5C5EA 1PEKE 1G0OA 3RROA 1SXIA 4Q3KA 2UUBB 3IHKA 3D3WB 4E32A 1IH8A 2CNLA 3DLAA 2R1VA 3WA7A 2B82A 1W5TA 5FUWA 1U8EA 3MD9A 3OCXA 2P6MA 4PIPA 4FPXA 3AVQA 2J3MA 2OILA 3HU2A 4KLZA 1TCUA 1QC5B 2GYUA 5SZHB 1VYHA 1P3DA 3UT0A 1FL9A 4JH0A 5JISA 1D1PA 3EAGA 4PY2A 4TM7A 1UK9A 4X94A 5TT0A 4N7MA 2Q6LA 4F7WA 1T8YA 5IABA 2K7ZA 3N0XA 5AW8A 2G9VA 3IHTA 2RSLA 2R2AA 2EG5A 2ZJOA 3MUNA 4R1MA 2PNJA 4YT5A 2QJTA 5FTLA 5DEOA 5A3JA 1RFLA 1US8B 3IBFA 3RRNA 4HXFB 3A3YA 4FSDA 4GDMA 4PAOA 2WD7B 4QYIB 5L3RA 4BEBA 3CB4A 3P19A 1GZUA 1XTPA 1TZKA 2GFIA 4IIHA 1TPYA 2GBPA 2UV8A 1I6MA 2V0GA 3G85A 3PUHA 1MA3A 4RZIA 5KTYA 2VXOA 4BECA 3VJMA 1XQVA 2WKSA 3BWVA 1TCBA 2AKAB 2P0YA 2DPGA 2VH2A 3MMXA 4WBSA 5IASA 4FNMA 4YCAA 3CX6A 4WRRA 3K7EA 2K5UA 1K3TA 1OXVA 1KC1A 1UPXA 2ZBVA 1WOYA 3HFRA 3QVJA 3U6KA 2BFDA 2ZS7A 1R50A 1AGXA 1T5DX 2P9CA 2EJVA 4RQBA 5IBQA 2BKAA 4HRVA 2DT8A 4YUYA 4DIOA 4BV9A 2IIBA 2YICA 3AFIA 1KWGA 1CRPA 2GCGA 2E1RA 5KMGB 4TRRA 2FZLA 2W6CX 3DHEA 3VO9A 3LNCA 3LQ4A 5KX5B 1L7MA 2W2VA 1TYDE 5A6VA 3TXAA 5HFNA 1ONNA 3I2HA 3LLCA 3V4PB 4LHSA 1M8PA 4RIHA 5ALEA 4R4JA 5AVRA 5TPWA 3DL7A 4UDOA 3UANA 3PC8A 1KQGA 5FX2A 4EJFA 3JQ6A 4IKEA 5EKSA 4R3WA 1ZVVA 3RJTA 3HO1A 4W99A 3LQYA 4N9WA 5H3HA 1QQ6A 2QTFA 1OREA 1YCHA 3NBAA 5CT4A 5G02A 1WF6A 1D1SA 1U7TA 3Q0IA 2VFAA 2LW7A 3ADBA 5KYYA 1C7IA 4QWMA 2Q4DA 1XZHA 1UT8A 4MI9A 1T5SA 4RH1A 1PVDA 2JI9A 3CISA 4KRGA 1N0VC 3AKDA 4I66A 1A2BA 2YBDA 3L0IB 3TCNA 5A3QA 2I1QA 3CF4G 1KTVA 2DUMA 1GIAA 4I3FA 4S2UA 3GVPA 2ZBPA 5I7HA 1KFEB 1T2UA 1LSJA 2FRDC 3GBSA 2HA7A 4HNHA 1PNTA 3JCZA 4NZMA 5CTAA 2J0UB 3GLHB 2BRUC 3FB4A 4FFLA 5BVHB 2ZIEA 4G86A 3TQHA 4I6EA 4RENA 2FPIB 1DRJA 5DP2A 4A0GA 2V3CC 4X97A 1KGDA 1GTJ1 4DLYA 3ZK7A 1HZZC 1FUYB 1SQ0A 3FBTA 1IIBA 2HJGA 1QRRA 3HL4A 2OAP1 1JBEA 4XYEA 5EEHA 1HO3A 2PH7A 3B82A 1RQLA 3AKEA 3GRAA 4NFLA 1A8UA 1FSSA 3HKEA 4GRIA 1C8KA 3LPMA 4LV5B 3KZKA 4OQEA 3A1DA 4U2KA 3ZCRA 4DC0A 2CLSA 5GAJA 1JLKA 1SZCA 3ITEA 4CCYB 1ZU4A 1F9EA 4LC0A 1JL3A 2D5IA 1TAQA 2OLEA 2J3QA 2X7JA 4G26A 3ZCQA 1Z22A 3IPYA 1U99A 3K96A 3WRYA 3ESAA 4P4LA 2W8ZA 2HB6A 4LYAA 2HLHA 3CZQA 4MEAA 5AKXA 1DAGA 1GFSA 3L7AA 1E8DA 4EQ6A 1Q2UA 2GHQA 1GR1A 2Z6QA 3ECAA 2RHWA 3TLGB 3O7WA 3TRJA 3K9HA 3WXBA 2P90A 1W85A 4KIFA 1FK8A 1Z68A 2OGZA 2C5SA 3W34A 4CIYA 1BTOA 4MV5A 4OU4A 3RC9A 2BFEA 2D7JA 1WDKA 3AU9A 4CTKA 3UYLA 3AY6A 4ZT4A 1D8TA 3LBAA 3VUEA 2BTEA 3AQIA 4ZV7A 3IQFA 4ZAFA 2IWRA 3B6EA 4NS1A 1KI3A 1Q44A 2C2MA 1LSOA 3UHJA 3SF8A 4G9BA 1RKUA 1Z6XA 3DEJA 2BF4A 4JNKA 5C8YF 1O3YA 3FBGA 3GBVA 2EYQA 3KXLA 5CG1A 2WIFA 2RGDA 5HX7A 1FFSA 1HV8A 1U3TA 3ZDQA 4OJQA 2C5GA 2PXHA 5I7SA 5KTOA 3KEGA 3WK5A 3B9QA 4WOBA 4WZ6A 4YTEA 4GNKA 5CYGA 3M8KA 1XRQA 3UH0A 2POQX 5ADHA 3NC4A 5F1YA 1KEEA 3IEUA 1VRCA 1VRVA 1UOOA 4R3NA 1E89A 2WAOA 3RE1A 4OMDA 3TIIA 3WGHA 2FWBA 3F67A 1NUUA 3DE2X 3DMHA 1V3VA 3O4RA 4O4HF 4PTYA 5C7LO 4F72A 1I5OA 5K45A 3CLSC 3H84A 5JVDA 1B3RA 3EFBA 3QYPA 5DX0A 2O8DB 5IAEA 5JNUA 1CYEA 4YBRA 2XYGA 1FDRA 4JB2A 5C8YB 4W5WA 1G64A 2JLAA 4P7FA 1VE7A 1PTKA 2W6ID 1RMQA 1T4CA 2Y1CA 4X41A 4XASA 4BQQA 1R0CA 2UUPA 3RAFC 4B75A 3WBKA 1UDAA 3FOAA 4OXYA 1WNTA 1A8PA 1UJ6A 2F3UA 2IXAA 1WP9A 2JBHA 2PPLA 3OY2A 1VDZA 2FEOA 4NOJA 5DTIA 4ZVOA 3NTVA 1Y7PA 3L8EA 1JSLA 3GDFA 1TDJA 4MVJI 3VKFA 1YB5A 4PIVA 3D6MA 4JIGA 5C9ZA 2W00A 3G17A 2IS1A 4OLFA 1TCAA 5ICMA 4MP6A 1CIVA 1V11A 2VJCA 3KB6A 1ESMA 2EAUA 4AP6A 4QM7A 1JMYA 1VTKA 1VLZA 1ZIDA 2J9ZB 2V3VA 4MV0A 1GCUA 5CXUA 5DHRA 1CETA 1G41A 3FNGA 3OF3A 4GMKA 3GMSA 1QORA 3T1OA 3DR3A 3ONVA 1U8ZA 1JAYA 5SY4A 2BGWA 1T3LA 2FN9A 4Q4JA 5EJEA 4DHEA 2C3YA 1Z6PA 2QMEA 3ONEA 2G9QA 2MSKA 3JQQA 4RFVA 3LWZA 4RTMA 4PV7A 4RORA 3PDWA 5L3ZA 4WXYB 4DQ0A 4C87A 5CYOA 3SN6A 3E1KA 1A0OA 1JQEA 1H6BA 3RFVA 2HZ7A 1JDBC 3ZCTA 2ZGVA 2ZJ6A 4P8RA 2YWEA 4JQCA 3HYLA 1VE9A 1ZC3A 2FWPA 4UD6A 1W88B 1Z2DA 2OPBA 1FYWA 4MWSA 2J48A 4AYTA 2JFUA 1ST2A 2C9CA 2VQEB 4DNFA 2C29D 4KXNA 3R7BA 2G8NA 2W70A 4PS1A 1KBQA 4LY0A 2XVZA 2YZKA 4QUIA 2J30A 1H1TA 4QQNA 3O1HB 4UE6A 1T4MA 3WNCA 1DO8A 1IPHA 2XNCA 3O4JA 4JJZA 4C7KA 2HXSA 3JD4A 5T8KC 1GRQA 3EHEA 2D3TA 4IIXA 5DBFA 1W30A 3ORFA 2PQ6A 2RDMA 4X62B 2WAXA 1I3CA 4XUDA 4Q9JA 3AIOA 1KJYA 4M4SA 5TVGA 4F91B 4RV9A 1OZGA 1N1MA 5EQFA 1YAHA 4C4XA 5CFRA 3KVRA 3EG9B 1DDGA 5LXTB 1N8SA 3QRWA 5A06A 3ADKA 4MS4B 1U31A 1MJGA 1UM9A 1QZTA 3NEAA 2VJAA 4UBJA 1CY0A 3GFSA 3WYCA 4RD0A 3SKXA 4NXMB 1O96A 3VR1A 1FXSA 2FW9A 5ALQA 3VYSB 5EWLA 3BMCB 5FR1A 1U9JA 1YU9A 5KOYA 3I01A 2CUKA 4YJ3B 1P39A 5FPTA 4IDQA 2AJCA 4M38A 5B4TA 1W46A 3CZ4A 3GP3A 4ZK6A 2Y1LA 2P9JA 4RESA 4MYCA 2JJ2D 5EWJB 2VDJA 4DSNA 2ZBDA 4NPAA 1OZHA 2JH3A 3WGGA 4LE0A 2MIIA 1KVUA 3K8QA 4PBRA 5FNVA 1ZK2A 4YY3B 3ZE0B 3K20A 1JG7A 3GP5A 3P9SA 3CGGA 1TO1E 4WXEA 5HF6A 4BB9A 2H08A 4DRZA 4P4GA 1GAEO 1UM8A 1TT7A 3WL4A 4S0ZA 2WMOB 3TYXA 2WHPA 3CNBA 3RVOA 1HF3A 2NM0A 2VHXA 3FVTA 2EW1A 3EGEA 1E61A 5KCMA 2WIGA 1QVAA 2V8BA 4U6QA 2ZIUB 4NZ9A 3C87A 3TJMA 3V1MA 5JANA 4L9SA 1U1GA 1YL6A 2P7HA 3LFTA 5DF1A 1F2TA 4D98A 2QD2A 3T4EA 3HMKA 3U49A 4DN6A 4R8LA 5JO0A 3KZMA 1J8YF 1HLGA 1ZRHA 2FWJA 1J0DA 2QN1A 4NS4A 4RVGA 2BUCA 1DRKA 4IIEA 3VTZA 1DJNA 3ZHQA 4P0PB 3R8FA 1FNCA 5ILGA 3WKAA 2BJHA 5LOVA 1E9BA 5J2UB 1FSFA 1MABA 4KDRA 4H27A 3V8MA 4DLAA 1BN6A 3AINA 3GR6A 4MJ7A 2I2DA 3S44A 3GPDG 1DC4A 1DTWA 1HGXA 1T6NA 4LXQA 1DKRA 4LOKA 2IBTA 5AK0A 1E1CA 3DLPX 3E9QA 1XDGA 3NCTA 3EEBA 3R5SA 2FRDA 3IC5A 4M53A 3X1XA 2DJ5A 3CURA 4P93A 1J21A 3VHXB 3DFZA 4IJUA 5AXDA 1KZHA 1ADJA 4JVNA 2R62A 3WICA 2Z04A 4MQUA 4P0TA 1E66A 1EK2A 3IAFA 2MWMA 2BIFA 5FTNA 5CFNA 2D7CA 4U7FA 3WKCA 1RJ9A 2JCBA 2CVFA 3EXIA 1P9NA 1YKFA 2EZUA 2G7MC 3AEXA 5AI0A 4MVWA 4IJVA 5D5PA 2IIQA 2N3ZA 3R4CA 1FVOA 1VKZA 1ZK1A 2ISCA 2NT3A 1NMZA 3F8SA 2DU8A 4RIFA 5DBIA 1JIJA 4UTNA 3DAPA 3DL2A 1W1IA 3DAFA 4O4LA 3VZCA 1VBFA 2C78A 3PX2A 3CLHA 4GPTA 3GY0A 4MWGA 3PT9A 3QUTA 4FMDF 1ZJZA 2OAEA 1KARA 3DEHA 2WMNB 2IEGA 4Y18A 4Y9SA 1UWVA 1XMIA 2X76A 4YX9A 3HDGA 3CX8A 4ZIRB 4GF5A 2QMHA 2JJ1D 4BU1A 1GOTA 2AKYA 2G1KA 3AZPA 4G3XA 5E9AA 2EATA 3LQ1A 4HQ6A 1EM6A 1NWHA 2GCIA 4BB0A 3BICA 2I71A 1ZJ4A 3JQEA 1VQ1A 2IYYA 3LDHA 2EZ9A 3R4VA 4OL9A 1RQPA 3HDTA 2B8JA 1RM0A 4UHHA 2VJPA 2A9QA 1OX5A 1H0HA 4KH0A 1RWXA 5ALYA 5BSTA 1ATIA 2PANA 3NT5A 4MGHA 3G5TA 3KQSA 3UUWA 1FU4A 3O8CA 4FMDB 5CHEA 3AHCA 2ABWA 2YRWA 2X22A 2A57A 3NGXA 2YWHA 3PUYA 4GOKA 1JA9A 2V1XA 4AKHA 4YRSA 1XFDA 4IHKA 1UMBB 3PGMA 1QX3A 4DADA 4OQLA 5FI1B 3SG0A 1NI5A 3ICCA 4RYLA 5E6SB 5DWQA 1CT9A 1Z0JA 4I6JA 3ROZA 1T2FA 1H3FA 3QUCA 1PUJA 4BFYA 5KTKA 1DV1A 2TMYA 2X2PA 3FJYA 2W2KB 3U61B 3THXB 2GN0A 2CNWA 2ZR9A 3FSGD 1E69A 1WBJB 2QTZA 4DBZA 1M8GA 1NYQA 1YS7A 2J31A 3QOFA 2QQEA 1R0KA 4GMGA 1IZ9A 1CY2A 5MF6A 4YP1A 1S8OA 3RRYA 1LF5A 1MC8A 1WTAA 2B1JA 1CKEA 4MRVA 4RIIA 3WGOA 2I3DA 3DWEX 2NUBA 1OXUA 3CRZA 4W7IA 1AKNA 3RSQA 2FQQA 4EKIA 3KWFA 5B7PA 4B4KA 1ZM9A 1M2FA 4LWQA 4OGWA 5J5AA 5ICCA 1SHLA 4ZDIA 2BC9A 2HGSA 1Z0DA 3GFTA 5A3RA 2HM7A 4LPKA 2B0JA 4EJ2A 4CM8A 2POCA 2VTBB 3IUBA 1CE8A 1Z4IA 4J0CA 1EFRA 2ZZKA 2D0DA 1IHOA 2NU7B 3KEFA 2PXXA 1ZD8A 2GT1A 4EYKA 4F3TA 1ZK4A 2A7QA 3I2GA 2Y27A 2YIMA 3K8OE 1MENA 1OX6A 3N05A 2PYZA 4E94A 3EY9A 4XZ3A 1L4MA 1AV6A 2YN2A 1ZZGA 1MXHA 3ENQA 1KIFA 1JB1A 3MC1A 4P2BA 4F71A 1QGOA 4U63A 2A1TR 2BR3A 2V6MA 4C7OB 2XUZA 3DMGA 1YOVB 2ZUEA 1L9XA 1NJ5A 1E5DA 1TEZA 4PANA 3I6BA 4FFWA 1UC5B 5KQPA 3QBVA 3QJYA 4M76B 3HDHA 4UNPA 4BZWA 4JYZA 1C8VB 3ZD7A 2VLBA 5DHFA 4JX9A 4JHXA 4BIIA 1HOXA 2FH5B 4PO8A 5ICEA 2YJGA 4LQDA 4Z1MA 5JSQA 5DSXA 2ZJ8A 1O97D 4IDBA 4PX2A 4EHNA 3IOCA 4QE3A 5CXSA 1L4FA 4HN4B 5EXPA 2V7BA 1XVAA 2ICAA 4FDMA 2EJUA 3LUPA 3TZ6A 1I5RA 3ZDZB 5J2TB 3CF6R 4N0PA 2GHRA 2OCAA 4XVHA 4HEA1 2WG1A 5JNTA 3PWKA 3LOQA 3EF1A 3S2IA 4GSKA 1E4YA 1VPLA 2GGSA 2QJRA 4QDKA 2B2XA 1EUZA 1T9DA 4N0DA 1CQZA 4IMPA 2QN2A 2JVIA 4GM4A 3QPUA 3NVDA 3C1OA 3E9EA 3PV0A 1E3MA 3FUCA 1QU3A 3Q3IA 3CIFA 2J8ZA 2HT6A 5T8KA 2PWPA 1Z8NA 3CLVA 3EGDA 3FAZA 1O97C 3M34A 3WYGA 4DEVA 5LSAA 1FFHA 1TZJA 3H5RA 3ZJYA 4AN4A 5HS6A 4F96A 2JJ8A 3KHTA 4ZOQI 1E2JA 1Y1KE 1PJ8A 4GAEA 5ESRA 3VMFA 2V97A 5C3MA 2BSQA 4WN9A 1Q84A 5C80A 5K6TA 4LZPA 3IE1A 2LCFA 1SB9A 4LC1A 4GM1A 2J85A 2R8XA 1GRVA 2QN3A 4FP9A 4YB8A 3NYWA 5CXXA 1IZ7A 3ZUPA 2G4LA 3E27A 2ZVJA 3L4SO 1PNOA 1RR6A 3E35A 1C0LA 5JR3A 4DZRA 2QVYX 3KE9A 3WHKA 3LC1O 1VFPA 4TWIA 4PBTA 4E12A 5CA0B 4OMFG 3K70D 4NCAA 2DSNA 4TQ9A 1E6KA 3HUDA 2XCIA 3Q6MA 3UG7A 4PR3A 1CY8A 3M82A 3EH2A 5BWCA 3FLEA 4O4IA 4ZYVA 1H6DA 1QLHA 1CF9A 2A9PA 1HE4A 2DUWA 2OORC 1JEDA 3JQGA 1WL8A 5CDUA 3TRHA 2ZM6B 3PWTA 1ULBA 4NBKA 4OU5A 1OZ0A 3PEVA 1MNAA 2WPDD 1PD0A 1MFZA 4D02A 4IVPA 1U3VA 3ASYA 3R3SA 1Z28A 2IXTA 3LDFA 4KC0A 4MRMA 4NJEA 4R6XA 4UVIA 2QN7A 4HFJA 3L7KA 4Q6WA 1MC1A 3BJZA 5HK8A 2RGUA 4NPCA 2F8LA 2Q07A 2YINC 3L0DA 4HNTA 3K70C 3AR5A 3EPRA 5CLIA 4YR7A 5CEJA 1JLMA 4QAJA 4K9RA 1IBCA 1LBSA 1KU6A 3PQCA 2JLUA 4PZ9A 1VL5A 1IEWA 1JDZA 1TKAA 1AUPA 1WVIA 2CFCA 2PXCA 3BMXA 1WUKS 3CPSA 3OZSA 4UDNA 3R0VA 5CRIA 1EGHA 3WQRA 2QE7A 5G2OA 3GO4A 4JLPA 1EQAA 4N5MA 3PNKA 4HSEA 1V35A 1DX9A 2EL7A 4ND8A 1DC5A 1V16B 2C57A 3V2HA 1Z2AA 5DCUA 2HW8A 1H1LA 2OV2A 1A2QA 2EX0A 5JD6A 5FHRA 5KOHA 1VKOA 2X6RA 4BASA 5HJ5A 2AYZA 3FOWA 2QQ5A 3FVQA 3ET5A 1MAUA 1ZUNB 2DQYA 1XNHA 2XKAA 1P5ZB 1IC6A 3L5OA 1CG6A 1U7DA 4L50A 3EQ8A 2ZB8A 4Q16A 2H4XA 4QT0A 5AJWA 3EQ2A 5FLYA 1FJHA 2R44A 9MHTA 2PJDA 1MVLA 3FPEA 5EQDA 3ESZA 1XZBA 4P08A 3VOBA 2X2OA 1EFPB 2QHXA 1XAHA 4HDKB 2JCXA 2BHSA 2PBZA 4FINA 1KWKA 4ARCA 2IXFA 4EYSA 5DYWA 1BXRB 4CI0B 4BEWA 4G0ZA 6LDHA 1YZYA 2VDWA 1BA2A 1HG1A 2V5UA 4WT7A 4P83A 3VKGA 2Z4TA 2J3HA 3GEPA 3IJEB 5C0OE 4DG9A 1IVSA 2QJFA 1QP4A 3DKKA 4EY6A 3GJ7A 1SUBA 4N3BA 1PT6A 4D25A 5KCZA 3ESDA 2JFNA 2Z4RA 3H4MA 5BWBA 3F6PA 2NPIA 1XU7A 4UNSA 4MH0R 2LNDA 4TUYF 5H3LA 3VISA 3JWJA 1E77A 1PNQA 3HACA 1YKSA 1JVSA 4AJKA 5D85A 2JEZA 4HNUA 4BAUA 1GTL1 4UJ5A 1EXVA 1EIZA 1EGMB 1K8XB 4OYRA 2WIDA 2XRFA 2Z0MA 5SV2A 3U3ZA 4YP6A 4MVYA 2YUTA 2V0CA 5CBPA 2V7TA 2DETA 2XMDA 2HQOA 1E3JA 1VCMA 4TKLA 4RADA 1AQNA 3BL8A 2JZCA 3VR0A 3CKMA 5ADVA 4GT1A 3R23A 2XWSA 4NENB 5D3QA 2Q1XA 4YR9A 1GNRA 1RYDA 4IGEA 3Q3EA 3S8MA 1U4NA 4YMUA 1GG2A 2WWTA 1WQ3A 2HRZA 4Y67A 3S7ZA 4IEEA 4TSKA 5JJKA 1XL0A 3JD0A 3Q9SA 1FFEA 3L7DA 4J29A 1L4BA 4IO0A 4N5NA 4X00A 3KQVA 1KI4A 1OTHA 5D3ZA 1E9CA 3OQ6A 3N0TA 4ZZ0A 1YBFA 3KQTA 3JATA 4WZBA 2QW0X 3G2PA 3I45A 2DUUA 3OQPA 2ZQZA 4O2AA 2H07A 3BXOA 1YIDA 5AUQA 3LX8A 1AHIA 4G0PA 5AM3A 3QUQA 3NH9A 4HWOA 1IIRA 2PL5A 3GD7A 4RW0A 2PUCA 4TM8A 4HKTA 3QG1A 1LDBA 1POXA 1NQUA 2I5PO 1ZRNA 3IMEA 4OG2A 5I51A 1I0LA 1NUPA 4DLVA 2D1FA 2VH1A 5IHXA 3GEBA 3RYFB 4EX6A 3BTSA 4CUKA 1GCGA 3EZ6A 3QVGA 1NXWA 1NXPA 2O14A 2J0QA 2HMTA 2R66A 4GVLA 5CTJA 4HP8A 5JZBA 4PLHA 1SIBE 4GZLA 4TQGA 8GPBA 1AZLA 2F6RA 3SD7A 2NXEA 2WTNA 3BRWA 4D4MA 5I01A 1TK2A 5I3CA 2IPAB 2BM0A 4Q1BA 4C4TA 2PGNA 4AF6A 4MQMA 1T1IA 3M6VA 5AVVA 1A7AA 2VVTA 4LRWA 5TF0A 1XWFA 4A10A 2VZ9A 3LT2A 3B6JA 3GHHA 1IAVA 4DMMA 5DM4A 4TYWA 4FTWA 3QITA 4MIEA 3RU3A 1N3BA 3GH1A 2KMLA 1CUSA 1OLXA 4TV9B 3I76A 1YE8A 3P9KA 3OIYA 5IBRA 5A0VA 4EG5A 1P5HA 4YRJA 1JGTA 4FLMA 1CS0B 2P2ZA 2CV1A 2VAWA 4EKDA 2GTIA 2Q46A 4DJJA 1DLIA 3H4TA 5CLFA 4ENRA 4PHTA 3MTQA 1GT91 3CZRA 4J0GA 2WSSA 3KAKA 4KIJA 1F5SA 3M1AA 3RJ9A 3ZBQA 4POOA 2ZSUA 3QEBZ 1BJKA 1DAKA 1E3TA 1W9HA 2OENG 3M3HA 4BS9A 2E5LB 4CQMD 4B7CA 3EQZA 3I3OA 4P82A 2BSAA 1UAAA 3HA3A 3UGKA 3ABIA 3BGSA 4H3KB 1RBYA 4LZOA 1JKIA 4J0HA 5JH7B 1F8YA 2Z9BA 5LQJA 2QM0A 3WQSB 4TMFA 1QYXA 4BGEA 5JNLA 4BVLA 1GDHA 2VBIA 3HEBA 1JHUA 3ZD8A 1BDBA 1Q1ZA 4LNUA 1IBSA 1LBEA 1GARA 2Z6VA 2VUUA 1HH4A 3HGTA 4LTNA 5HWSA 2QG4A 2IOQA 1EFHA 1G98A 4OLJA 4TS3A 3VPCA 4GOJA 1LEHA 3K8YA 4L6CA 5BPHA 5JROA 5KWJA 4OEHA 3K09C 4UPEA 3ULKA 3NDRA 4FYMA 4QFMA 4J3FA 3IHLA 2PUHA 1DFGA 1E9FA 3BAZA 4PIMA 4QATA 4JJ8A 3O8OA 4EW1A 3R7WA 1CXZA 1NQWA 2QAGC 4CN9A 5ECGC 5KDDA 5LZ7A 3KZVA 2OGSA 1DEOA 4QODA 4YJGB 4ZMBA 1Z8DA 4ZAGA 4CEHB 2AQKA 1P81A 2PLAA 3GAAA 4NZPA 1J33A 4DDHA 3ICEA 1FLVA 2WD8A 5LP6B 4QOFA 4PSUA 2NSJA 1WM1A 1ZLXA 3TOVA 4ASUA 2ZSIA 3ROFA 4IQ8A 4MVCA 1QH9A 1N2BA 1YVPA 3VPGA 3VYRB 3C14C 3BGDA 3PC3A 3S27A 2G82A 1TTHA 1MX1A 3G2QA 4LOIA 4BLWA 4B35A 5GOZA 1V2HE 5HILA 4K9QA 2BSXA 4MW0A 3SAJA 2R00C 4KO8A 2NZJA 2PMBA 2YMMA 2H2DA 3A7DA 3ADOA 1K3UB 5FUYA 3SNHA 4EUSA 5I6DA 1E4EA 3Q3HA 2KWIA 4MULA 3DZ8A 3NYRA 1S4QA 2JD2A 2XRYA 3OTWA 3TLBA 5B58C 5BQ3A 3LFHA 1JQJC 1JHXA 1WXFA 4PZUA 2XTAA 4B4OA 3F73A 3L43A 4HR7A 1OFUA 3UICA 1LJLA 3ELBA 4CKWA 1DZIA 1CZUA 1P7WA 2SCUB 4RACA 1JHOA 1BXGA 3W04A 4DUYB 4EM6A 3GDWA 4QM6A 1LWOA 5BSWA 3SZGA 2YBEA 2ZANA 4BX2A 2AWOA 1W4RA 2P2LA 4MGYR 1GRNA 4IEIA 5AW5A 2OGUA 5HA5A 4ZJPA 4A03A 2F1RA 1PJRA 2E4VA 4C20A 2YUIA 2VHZA 3BIWA 4PXYA 2ZM5A 2P3SA 5ERYA 5K0JA 2WWHA 4CKBA 4CFYA 3IAXA 3V00A 1II8B 1NRXA 3ZE2B 4DV0B 5JSZA 2WJIA 4AZ0B 2A0UA 4BPRA 2LD4A 1BMTA 2DFKB 5E3HA 3ITNA 1KOGA 5IBCA 3O31A 4AB1A 2AK3A 2CF6A 4KBFA 4XFDA 3S68A 3FYDA 1QKJA 3GEDA 3TRIA 5MN4A 3AEQB 3QU9A 4LRXA 4BWGA 4B7AA 2AJDA 2ATIA 3KKMA 1JHRA 1LCIA 4FOPA 1PG5A 3EK2A 4AKTA 3H0KA 4HY3A 1PV2A 4MB0A 4QEZA 3MCAA 3TD9A 2X15A 1M6YA 4CLRA 2PKEA 4BMDA 1TQHA 5G0WA 2VATA 1KAMA 1KVSA 3ZNPA 4KI7A 3HK2A 1X7GA 4UD2A 4V1CB 5JFGA 3OOWA 3GA5A 3PFFA 3QYAA 2RCNA 1I4TD 3QE0A 4N18A 3TS1A 1JLHA 5H5JA 3B51X 4UHEA 2WB4A 1A72A 3DAGA 4A27A 1QIMA 2DKOA 4PZLA 4PLFA 4AS3A 1Y6FA 1WO8A 2EEZA 1VG1A 5HPYB 3IDZA 4FYKA 1WDMA 4HO1X 1Y3DE 3IEPA 1E1RD 4MRSA 3VYVA 5PNTA 4E5DA 4QJIA 1XVUA 4RY0A 1XU4A 2Y4OA 1NJ8A 1GZSA 2Y0PA 2O2GA 4JJEA 2QR3A 2HK8A 5JMWA 3GZ4A 5FI0B 1D7OA 1UBFA 2CZGA 4XDZA 4B3TB 1KI1A 3TLEA 2J59A 1GAQA 4C4PA 1TD1A 1VOTA 2XDWA 2Z2YA 4FE7A 1P4SA 1F6WA 2CFIA 4A2CA 4KGVA 3OQ1A 5KQMA 3EHDA 3Q85A 2B35A 1F48A 1PNVA 1DIHA 2F3SA 3IV6A 2ZT7A 4KBYA 4LZNA 2Q3FA 4YQEA 1FDUA 1HLDA 5CFOA 4EG3A 1TU4A 1L5QA 4LHZA 3NTXA 1K89A 4N5DA 1A50B 1URPA 4Y2TA 3AEUB 4PHFA 3UKJA 1UXGA 3LK7A 4RPJA 5JHHB 1DHTA 2C20A 2H00A 4KFSA 1GYRA 3F1KA 4OK6A 2NO4A 1NG1A 3K0EA 4DTIA 3KLOA 2EHDA 1G20A 1GRRA 1UADA 3ANNA 4Y2QA 5DULA 2C0PA 1OIVA 2BGLA 4BNVA 2NNLD 5I7OA 1BWPA 4NONA 1ZOSA 2GOYA 4IOJA 2EZ4A 5GVRA 1IN5A 3HR8A 5C31A 1T9BA 1TX4B 1J22A 2ZRKA 3HGQA 3OEHD 2IF0A 1M1ZA 4EELA 2JHGA 1P9LA 2R1TB 3HEAA 1AUXA 2VI5A 3DE5X 4JJGA 4RWEA 4W1RA 1N8KA 1R0WA 2OFFA 2HOQA 3LSTA 5U4XA 1ZXXA 2A5JA 4KQHA 4P0QB 1N7IA 1NU8A 2EKQA 2Y1EA 1T6XA 2AV6A 3PUZA 4NE2A 1L7XA 4YWJA 5JAZA 1TA9A 3CVUA 1TQ6A 5EJFA 1V2GA 4AO8A 3MWJA 4US0R 4RETA 4UBIA 3Q5DA 2G70A 2AC4A 4OMCA 2PUAA 2BMVA 3KJHA 4LRQA 3W7VA 1MO4A 2NUPB 5FPSA 2IBSA 4L73A 1B76A 4NIMA 1VMAA 1O4WA 1V1RA 3AMVA 1XDWA 2WK1A 1XKLA 3JWEA 4D8YA 4UZSA 4DLSA 1Q16A 5KPJA 4Q9NA 3MWYW 3V7YA 4NZZA 4DG5A 1L0BA 4A8JC 1DS6A 2E4WA 3WQHA 3ZVKA 1Z13A 2XWQA 4RYDA 3UJCA 1J8FA 2MDTA 3Q9LA 4TXJA 1EFCA 2V4MA 3KUXA 1RYHA 2ZQ5A 4X7RA 5ES3A 2XAAA 1USWA 3DLIA 3BE6A 1U0RA 3GJXC 4QGBA 3V8EA 5AVQA 1H4QA 3M4ZA 1LS1A 3V8PA 2CXTA 3N7AA 1YB7A 1JG2A 3OJ0A 5F76A 4ZGGA 5KINB 1UJBA 4IQ0A 3MHPA 2HC9A 5A3SA 1ZSYA 3M6AA 5EJ2A 2QI9C 3N8GA 4D56A 3L18A 4KXXA 2O07A 4MVXA 4TOIA 4MPRA 3C0KA 3KPYA 5BUCA 4NABA 1I80A 3RF6A 4MV4A 4BE9A 3W2EA 4E5MA 4G1UC 3I8OA 1WAMA 2FPKA 2PZMA 2C04A 4ZD6A 4WCFB 1GQOA 5KJ1A 3Q7SA 2W2TA 2YOHA 4L5CA 4ISCA 2A1UB 3EZXA 2ZI7A 3S1LA 1I4WA 2D4AA 1M1NB 1LTKA 1UMCB 1J56A 4K6CA 3VC1A 4DMGA 4K6GA 1G8MA 3MJCA 4EZBA 1OSNA 3CV3A 1PLLA 2PMEA 1AKQA 2BFNA 2P9EA 1IBRA 1H2XA 2BHLA 3KEQA 4PFQA 2ASVA 5ALZA 5LVAA 4V0NA 3D3QA 1Q1EA 2LIPA 4CMIB 4PLCA 1AKTA 4AZSA 4S12A 1AT1A 2VPYA 1TAGA 4QBGB 1OC2A 5CURA 4L4UA 4YUVA 5IM4A 1NFRA 1N2CB 1E32A 2TSYB 3OFKA 1TPZA 2X1VA 1Y3AA 3OE7A 4OOFA 4UM9D 3LTNC 4XWKA 1PFWA 1S7CA 1T4DA 1U1IA 3DCYA 1BEZA 2O06A 4IIDA 4B33A 3ILYA 3DLBA 4LJ8A 2ZXEA 3EASA 1CY4A 1GCIA 4O1MA 3ZWQA 3WGLA 5A5DA 1NX6A 3A9CA 3SS7X 3DV2A 5DGTA 2FDRA 5BMVA 3RODA 2PGJA 2AFHA 1KYYA 4R0NA 2BUBA 2O3RA 1QCCA 2Q4RA 2QWXA 4JZYA 4COKA 1ZEJA 5GVSA 5EFZA 2O6LA 2WLTA 4RPIA 1NNEA 1MB2A 1MXFA 1O95D 2DFVA 1I36A 2FGJA 1DFIA 3KOUA 3RC1A 2OBFA 3UB4A 2HMWA 4ZAZA 1IXYA 4INAA 3QEOA 1XMJA 5JMPA 1SOAA 2YHBA 1IY8A 3A6GA 4UPDA 5E8JA 3CYFA 4WECA 2XB4A 4C0HA 5K3OA 4DAOA 3L84A 4P80A 2G80A 3PS9A 1SCDA 1N2JA 4BO6A 1Q1QA 3OPNA 2KBEA 3LPDA 5KQRA 1EBUA 3EXG2 3FROA 2FW8A 2AH5A 2QZ4A 4FCCA 3HA5A 2Y67A 4MKFA 4QBHA 1WXQA 4EGAA 2P6UA 3V9AA 3ROEA 4JI0B 4LDRA 4AMGA 4L9AA 3E3AA 2YV2A 1G4HA 1GL6A 1O95C 3GFQA 1SAYA 1AGYA 3MB8A 3OT4A 4EG8A 3KL4A 3WGTA 4GICA 4F86A 1DBRA 1Y8ZA 3L0OA 5KTTA 5FA8A 1PGNA 5B1IA 5HTOA 3OEWA 1ISIA 1LPAB 2PZEA 3BE8A 3IPAA 3WSVA 2VCYA 5FOUA 4DMRA 1S8NA 1S2LA 5AJVB 1IM5A 4MVJH 3CVOA 3FWKA 3WDKA 1VYVA 2JPDA 3AVVA 1RQ7A 2NO5A 4HVLA 1Z83A 3B53X 1JAZA 2GZMA 4C3UA 4NICA 4HNGA 4MWBA 3V2UA 2AEJA 1WY7A 2O7QA 2W8BA 3L49A 4XAQA 3T9CA 3K1AB 5K2MA 3MRVA 2Q5IA 3WL8A 5ILOA 1NN5A 3B6IA 3S8EA 1YS9A 1GZ5A 1L4KA 3DC7A 4KX5A 4NYIQ 4W82A 2CD9A 4LHYA 4W6QA 1NBHA 4GEGA 1CR4A 2OBMA 3N70A 4MTCA 4MYSA 1M2VB 3U4DA 4EF4A 5E4JA 5AM2A 3GUVA 2GZ3A 3RIGA 3LVQE 3WGYA 3TGWA 4AIRA 4FGKA 5C7YA 4PPQA 5SZKB 2AKEA 4DDVA 4GXRA 3EUWA 3PLNA 5BOVA 3MIIA 3QPDA 4C78A 1J06A 1KI6A 1GA4A 5TJHA 2AG8A 5BVGA 3ICOA 5NLLA 3KSDO 1MEJA 1H6CA 3PR3A 3G2HA 4FFDA 2E37A 2XE6A 2Z43A 2EQBA 3S3TA 2ECPA 4KWCA 2FPWA 3CA8A 1GRCA 1ZVMA 1JT9A 2YOFA 5KTMA 3EIWA 4NCXA 2ACVA 4JFRA 4KQ2A 1W59A 2R4TA 3FTDA 4WOPA 2XMSA 3ZIDA 3WIUA 4L8VA 5EHQA 3QPWA 4OI0A 3MF4A 3QE3A 2B8NA 3DAOA 3KVOA 1WCYA 2B98A 3SZOA 1F14A 2BFBA 2ZSHA 1FU7A 4R9RA 4ZEVA 4NI5A 3SWWA 3A6HA 2EWVA 1PGOA 2D2XA 2IHBA 3NC0C 4AKEA 3EWAA 4GH5A 4C0JA 4DSZA 1E1RA 3GVCA 4ZT2A 3TOSA 4HTFB 2FEPA 5JNRA 2PR7A 1XJQA 1SIUA 3IP6A 5CH5A 4D4GA 3EUFA 4Y6PA 1SUWA 2C99A 2DBRA 3HS3A 5DYIA 1S4MA 3P45A 2FUEA 1C9JA 2X42A 3EMKA 1W5EA 4HNAB 4U8HA 4UHKA 3VNSA 3C1TA 4C9BA 1SUPA 1OA0A 2XEDA 3CPEA 4YRQA 4EG0A 3TTXA 1G3RA 2CL7X 1ZIOA 3GGJA 1ZN8A 3ZWYA 2PBRA 3OOHA 3NUZA 4H31A 1ZGCA 4G1CA 2J3EA 2GFQA 3ICVA 3M6LA 1X86B 1X15A 4CLOB 1J1UA 4E21A 4HAWA 3BMOA 3VXKA 4AL4A 5SYMA 3V34A 1W2GA 1C0KA 2HY7A 4GZMA 1NXVA 3BJIC 1ORIA 1M7BA 2J5XA 5G41A 1GV0A 3BA1A 2YL2A 2V7WA 3GI1A 3QU7A 4HHEA 3R9IA 4DSAA 5K8VA 3V7FA 4LKRA 4PGAA 3SLRA 3GGDA 4MS1A 1OILA 5H9WA 2PT6A 2IDKA 5LB4A 2XTNA 3DMTA 1XNJA 2H54A 1KBZA 4K9MA 2P75A 5F35A 5EP2A 1XTZA 3FHTA 2XQVA 1T0IA 5DPMA 5A9RA 4HATA 4CNQA 1OYWA 3H42B 2Z8XA 4A3SA 1YJXA 3GDHA 2HU2A 1R66A 1CUWA 2GFHA 5F3DA 2BDTA 3VU9A 1IQRA 3EUEA 4OP1A 3K4PA 2B7BA 5DRYA 2XT0A 3W8DA 3WYEA 4A8JA 1ICEA 2D1TA 1L7DA 4LYEA 4WI1A 1A5ZA 4FQ5A 4DQKA 1SHKA 1RPZA 3PE4A 2QX8A 3B9PA 4N39A 4OJMX 3RCBA 1SOWA 1C0PA 2R7AA 3LUBA 1RXYA 4A9AA 4BX0A 2GRJA 4R7TA 3TW6A 3MWDA 1E0KA 3CRVA 2GZDA 1OTXA 4FHDA 3BHNA 3NYQA 3UJAA 4TLAA 1R6DA 5L51A 4X8LA 4JI3B 2Q4TA 3AY3A 5JJCA 3K6RA 3HJBA 5AO9A 1J0XO 2LCIA 3QP9A 1EUQA 1C3XA 1VL1A 3SDZA 2GN9A 3ZYZA 1Q1GA 4TWAA 2BZSA 4RMHA 2R4QA 5HP4A 3EULA 4IIJB 4OB6A 3IQXA 5K8UA 2AW3A 4CV0A 1ZWKA 3N76A 2NX2A 5L6MB 1T9KA 2F3PA 4IDFA 3OQJA 4S1VA 1E3LA 1N6HA 2JA2A 1AMOA 1K4YA 2G5TA 3GEHA 1EXNA 5AW4A 2W2PA 1XWIA 1Z0UA 3WLOA 5IS2A 1R8JA 4AFNA 1IXKA 1BX0A 1SQSA 1SU7A 2QTTA 2W6NA 1G16A 2A3NA 3PFHA 4MV9A 3FTEA 1BVHA 1I6WA 1P0CA 4LIPD 1XGKA 2FP4A 1JDBB 1ZCZA 2XNSA 4ZU6X 2C5EA 1HEYA 2ZTMA 3ELWA 3LX4A 1WD7A 3OICA 4JQYA 1AS3A 4LBZA 3VR4H 4DIUA 4MP8A 5A5FA 5M34A 3BXEA 2WWFA 2O8CB 2O2SA 2R8RA 1CNEA 3H75A 2UVQA 2SKDA 3R2JA 2OZKA 2RJNA 4D3XA 5BN5A 1JH8A 1P9WA 3D7RA 4ND1A 1CERA 3IP1A 2XB9A 1THMA 1ZIYA 2Q9CA 3KQOA 3WDMA 4EW3A 1DUSA 3FHJA 3U09A 2YJ5A 4RD2A 4G63A 3SQXA 3KYDB 4Q9LA 3QLVC 2FXVA 3QLUC 2LZ0A 1YXMA 3GRYA 4QAQA 1IATA 1BFUA 1P3Y1 3G7NA 1YACA 3L1UA 5TS2A 1S96A 4ZTZB 4X1KA 1YKGA 1L5KA 3BDIA 1J2EA 5KTSA 4B3FX 1O0CA 3UMBA 5KAMA 1AGRA 3BBLA 4ML3A 1C9KA 4E11A 1T2EA 3P0FA 1WHSB 1HNNA 1AN9A 1ICIA 1T1RA 2C9DA 2MSCB 3FUXA 1K3FA 3I04M 4ZI3A 3H5OA 2UZAA 3TR6A 1C3OA 3VHQA 2W2XA 2C77A 2IPNA 2OB2A 5THKA 3ZBUA 2X0JA 1E99A 1AIPA 1VI6A 2ZK7A 4IIUA 1ZGBA 3TO5A 2JLQA 1ECLA 1WSBA 1EP9A 4IR7A 4Y3UA 5AKKA 2B94A 4YPFA 3TZCA 3ZH9B 3GLIE 2OCXA 1KZ6A 1J1IA 3H2ZA 4OQNA 5BN4B 4CM9A 5LQNA 1XIVA 1XF1A 2P9GA 3K3PA 3IR6A 3U3JA 4B4WA 2CHEA 5A0TA 2E4UA 2WTEA 3QX3A 3QVXA 1W8DA 5K0ZA 3HJFA 3CVYA 3UV3A 4MPPA 1QTNA 3IVGA 1RBQA 2CNBA 3Q2KA 1I0IA 4K9SA 4RK1A 3H5IA 3KKPA 3LCRA 2DMRA 3W6PA 4I1PA 4KREA 5EG5A 4R8VA 1BWQA 2VAPA 5BPFA 1S3FA 1OLUB 2NXJA 2J6IA 2WHYA 4ZOBA 1Y34E 1L5VA 4J6FA 2X9NA 2VF8A 2VRCD 3TINA 1DC6A 1MN6A 4P92A 4YI3A 3B3AA 1XCLA 3WMGA 2AN9A 1SR8A 1L1FA 4R1PA 3ZNOA 1Z12A 5FUMA 1XDZA 2JFGA 3JVIA 2PSHA 1PU2A 1LSUA 1WSWA 2E4YA 3NKFA 2G5GX 4Q4DA 3N9IA 1IG0A 1K06A 3GG9A 3R9KA 1PV4A 3F3KA 2WF6A 1YZFA 3G6WA 2X8WA 1XPJA 1WXGA 2QLTA 4JI8B 4MUJA 1NW9B 3GZNA 4WFKA 2J7KA 3DGFC 4FW8A 1O6ZA 5FWXA 3AUUA 1U65A 3FDIA 1YB1A 2FWNA 4H9GA 3LHSA 4PG5A 4DDMA 3O4FA 4FHCA 5CEFA 1M2EA 2ZE8A 2HIHA 2N46A 2G28A 3WNQA 5I5EA 4YO8A 4ZVUA 4RPHA 1EM8A 2AGVA 3IYLW 3QKIA 3S70A 2WJHA 2NTJA 1E0AA 2D1SA 2KHZA 3HU3A 1XBTA 1QYDA 3L6RA 3KR1A 1TYBE 4GQBA 2ODTX 3NM6B 3BIXA 3PVSA 3OJWA 3C39A 5CU7A 3EW9A 4K6KA 4E31A 4EO4A 1RTKA 3S99A 1THZA 1VA5A 1ZGAA 3WGNA 3FPAA 4EVSA 3LYHA 1NDHA 1QZZA 4JBNA 2IHYA 1QCDA 4XCVA 3THYB 3B2QA 1R15A 4BZQA 4LXTA 5EUCA 5HRUA 4ZVQA 5FUQA 1CJCA 5FTMA 3E3MA 3QMVA 4EK9A 1EFLA 3IA7A 3O8NA 4H15A 1NC3A 3UXHA 1QIHA 2E6UX 2XIJA 3HCNA 1ESCA 1FNMA 2WYIA 2OP1A 4JXZA 3KUUA 4XKJA 3WHPA 1JIKA 5K0TA 1A5AB 1ZD4A 4H0CA 5CM2Z 4EUHA 1UJNA 1YCDA 3KJEA 4MHSA 1E2IA 2I67A 3OJXA 5AW6A 4L16A 2CXUA 3TLXA 2JKZA 1HORA 2OCYC 3LXUX 3NH6A 4J0KA 2YVUA 3EVEA 3KLBA 2DFLA 1C2YA 2I4TA 3OLVA 1GTVA 1EWYA 2CHUA 3AEZA 4PC1A 4G5FA 2ODNA 3H6KA 3MA0A 2B7CA 1T8TA 4HTAA 3JVUA 1A9PA 1JAIA 1TUEA 3C5WP 4HDSB 5FA5A 5K5EA 3QSGA 1FZQA 5MGNA 1V8PA 3D6JA 3P2JA 4HQFA 1P2BA 2I87A 4IHJA 3RSGA 3VC2A 3SVLA 4RTNA 2H9IA 1IN6A 2C94A 3SFVA 1I1OA 1R4NA 4YRGA 5JS8A 3EPHA 2IXEA 1Q0ZA 2WJYA 1Q0HA 4TL7A 1F9AA 4ZOAA 4MR7B 2YTZA 4FT2A 5LR6A 3AJ9A 5K4AA 3OM9A 2VTEA 3N8KA 3KZOA 4GWGA 5DNDA 5IZCA 4JLUA 4F4CA 4TYNA 2FPSA 5G0TA 1D0VA 2BEVB 7REQB 1NBMD 3ZXXA 4EPRA 3LL7A 1DWPA 3JASA 3NHAA 3I30X 4DNXA 3NO4A 3NNNA 4REQA 4UTPA 1CUEA 3TSAA 2HBRA 2NZWA 3JPYA 4OQMA 1EWKA 1W93A 3R3YA 5MFPA 5KQLA 1ESEA 1RHMA 3GGCA 5FUVA 4BWYA 4LKOA 1HNWB 4EY5A 2CB0A 1P2VA 2IC5A 3A3NA 3L8YA 1GG8A 4YT8A 3WWOA 1A9ZA 3G79A 1XAGA 5JAMA 1E3IA 3OQOA 2PYDA 1AUQA 1MKYA 4BUCA 4GGMX 2BMJA 1I7PA 2MCFA 3PQ5A 4A8TA 1HG0A 4BGVA 3AP2A 3HE3A 1GSIA 4FCWA 1Z2EA 3V33A 4C0XA 1XWWA 1M0SA 4MW2A 4LN1A 4YH1A 1OYYA 1KSHA 5B7QA 5JARA 2GSDA 2X3YA 4J75A 4QYMA 3FZEA 1PV1A 2X0IA 4C14A 4IIFA 2MU1A 3HCBA 4Y6SA 4DR7B 3V3KA 3L02A 4U3JB 4IRXA 1K08A 2BGUA 3H5AA 1DBQA 4D0LB 1SCJA 3OE4A 4HUJA 5KZMB 4G0WA 4MRPA 2RAVA 5BV0A 3NHBA 7MDHA 3U3OA 1SU4A 1RP1A 1R2QA 1WDLA 1S02A 5LA6B 3UK7A 4DLPA 1XTBA 4UU8A 2VK4A 3FDJA 3G1TA 3P2YA 1M6VA 1IWPB 4PLTA 1P2UA 2ODBA 4I4IA 4ZAWA 1GGHA 3MAGA 3C48A 4U7PB 1EE9A 5DNUA 1OB5A 1RYEA 2CHQA 1BNCA 4DA4A 2BI8A 3U3KA 4UXIA 3C1AA 2KB0A 1H8ED 2G6BA 2DLNA 2C4WA 2OMEA 3TLAA 2AFRA 3TMKA 5HMLA 3T5AA 2O8EB 1ZPDA 3IP3A 3Q9NA 3ZY5A 1YRLA 3AVYA 1R4MA 3G49A 3ZV6A 1E2NA 1WY5A 3PDCA 4M0PA 2SHKA 4NBRA 3H3FA 3O2JA 4A0RA 2XOKD 3D8UA 2G9RA 3HNPA 2F43A 4QEDA 2LRHA 3GCWA 1IY9A 4K26A 2G07A 4HLCA 3QLUA 5CXQA 2ZJ7A 4ID3A 1FEZA 3BSSA 2CL0X 4U9IS 3ESCA 1Z5UA 2APJA 4MR9A 2JEOA 1LPMA 1W4BA 3EXFA 3GFOA 4NBWA 3WLEA 5F9FA 3FIJA 2JVJA 3TUIC 2PG3A 3CVJA 1VHDA 4N0EA 5K6AA 1JHPA 1XA0A 5LQAA 3JQFC 3C5VA 3AR2A 3ED1A 3SJCA 2ZSJA 1V5IA 3L9WA 5KYUA 4CM3A 2O4CA 3CUWA 4YS6A 1Q6ZA 4A6PA 2WFLA 4YUWA 4CKZA 3U60B 4G89A 4BX3A 1ZD3A 4I08A 4JLNA 2I0FA 1TNDA 4C08A 2AN4A 2PZJA 2IPLA 3TPCA 2XGOA 3DUWA 3HI4A 4PPFA 5JYBA 1M33A 4QXOA 1RWNA 3DDHA 4UNQA 4B71A 1KEKA 1AXRA 1QE0A 4HDMA 2V7VA 5FLXA 4ZQFA 5L9AA 4PC3A 4R1UA 1C3EA 2WF5A 4EZEA 1JLRA 1BW9A 2ZB3A 2VR1A 3PFIA 5ADWA 1V39A 2PS3A 1E96A 4OYLA 1YJAA 1T6YA 3AF2A 4C0WA 1XN1A 3QXCA 4IJMA 1XOIA 5F21A 4KPFC 3EGWA 4FCVA 1GLVA 2PLNA 2AFIA 3R41A 3RASA 3RG2A 2FSUA 1J42A 3V4FA 2UXDB 3CEPB 1OR8A 2QOEA 2I22A 2ZSBA 3C3DA 4QHYA 3SXUA 3W4KA 4C07A 3PDIA 1HNZB 1QUEA 4W5TA 2ORIA 2PRYA 4KG7A 4DJFC 5JWOA 4KQXA 4Q7LA 4F2PA 2VYCA 3GLRA 5EMNA 3PQFA 3ZOZA 5BSEA 4ZVTA 2FOIA 3WK9A 1JU4A 4F3KA 2IPMA 1CVRA 5K4GA 1QYCA 2J07A 4MUNA 5AXCA 3CRW1 4JB0A 5I7WA 3RHSA 1FUKA 2BZ0A 4KACA 3TZQA 1JR4A 1XKQA 2ESRA 2H2GA 4KV7A 1ANKA 3VDXA 3X1KA 3FSJX 1UFVA 2R1ZA 4BMCA 2RONA 2Y0EA 3ZTWA 5TGZA 3RTBA 2ZB7A 4CIBA 3FNFA 1YAJA 2RGBA 2RHCA 1RXCA 2GBFA 3B70A 3C6ZA 4J0FA 4L8WB 4O2BA 1Y4SA 3KSAC 4DV3B 1EH5A 3K5PA 5KQSA 2WTMA 1CUAA 5JSKA 2ACKA 3VSAA 2XNJA 2WWIA 4BNLA 5FQOA 2C3MA 1T4BA 3A1TA 3M89A 2AT1A 1WU7A 4UUBA 3RS4A 3N53A 4MARA 5CAEA 4RVUA 1P0PA 4INOA 2FSSA 1UXKA 2HCBA 1E2DA 1XFAA 2PNFA 2ZYSA 4BOYA 4LNAA 2VZEA 4Q1EA 1HKUA 3THWA 1VDMA 4TT8A 1AS2A 4N6GA 6REQA 2QL5A 1MAHA 4A23A 3E22A 4JI2B 4GE3A 3OG9A 4BDTA 2BJVA 3PGJA 2BFOA 4BXOA 2B78A 3DM5A 3L0YA 1ZQ9A 3C45A 2VZ0A 5IFLA 3VJKA 2XBUA 5LYYA 5BNWA 1JI3A 3Q12A 3CJTA 1PG2A 3L0ZA 3PGVA 1N2GA 2FW0A 3I09A 3JYLA 3NDPA 4UE2A 4EJ0A 4IZHA 1Y6ZA 1VKNA 3U4QA 4TV8A 1BX3A 3H2SA 4C22A 3ANMA 3FFWA 2XCRB 2HXYA 3NBFA 3DO6A 3PNBA 4PLWA 1U0LA 1CUBA 3MQ2A 1K6JA 3W3ZB 2VDPB 4NARA 2AYXA 5EEGA 4S2EA 3VTAA 3EISA 3FYUC 4FZRA