3IAM6

Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, reduced, 2 mol/asu, with bound nadh
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
161
structure length
144
Chain Sequence
EREGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDAQADVMIVAGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFNNYAIVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVRGQAYNERGERLPPVAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-quinone oxidoreductase subunit 1
publication title Structural basis for the mechanism of respiratory complex I
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 35
structure length 144
sequence length 161
chains with identical sequence F
ec nomenclature ec 1.6.99.5: Transferred entry: 1.6.5.11.
pdb deposition date 2009-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
6 PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12280 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iam600
3IAS6 2FUG6 3I9V6 4HEA6 5LNK6 3IAM6
chains in the Genus database with same CATH superfamily
3RVLA 3HKEA 1V1MA 1E3WA 5CNKA 1Y5MA 4N12A 1KTIA 4D74A 4PRZA 1E94E 3I2HA 2YZKA 5DF1A 2X2OA 5FNVB 3NPMA 4UZEA 3DE4X 3I4FA 1GZ5A 3NH9A 3HUEA 1GN8A 4F12A 3ZX4A 5ETJA 2H4FA 3RVPA 1QFMA 3H16A 3PYMA 1AKRA 1FFGA 2DPYA 4YB8A 2C5BA 3B3JA 2WM3A 3UJBA 3UMVA 5BPHA 2PR7A 1UDAA 3CF6R 4L0MA 2QTHA 3INTA 3KJEA 3IKLA 1HM5A 3KLMX 2RH8A 1G8HA 4JELA 3EPPA 4M1TA 4WKOA 3VR6A 5HJ5A 1VP3A 1C8BA 3G49A 4XSHA 3DBLA 4BIIA 4KAXA 3S8YA 3BBLA 4HH3C 4O25A 5CDUA 3QEAZ 1GQRA 3Q7QA 2DWUA 1R8JA 1VKZA 3BICA 3MA0A 3LBNA 4MVJD 3P9IA 4MYUA 4RY2A 2PT5A 4N3CA 1ZCZA 4DBLE 4X84A 4PV7A 1NVKA 2XOKA 1EJ6A 3EWIA 3PVSA 1UZMA 5TQ0A 5LYJB 4P36A 5D3MB 3X0DA 1HETA 1F0NA 1X1DA 2WPDA 2CE7A 3HYLA 3LUDA 2WIFA 2WQ6A 1SULA 1UBLS 3DGFC 2NT3A 1O8CA 3DT6A 5FFFA 4AO6A 2IS6A 1DKUA 2D8MA 2Y0CA 3ICPA 4BLQA 4DC9A 4KPEC 1G8MA 3DO5A 4R1PA 4BPRA 2VHVA 1AGNA 4OI2A 1FFCA 4CTNA 3FPGA 1LJUA 4WK6A 5L6MB 3WO1A 1MVOA 2YQZA 1T6NA 1ANKA 1WZNA 3FVVA 3B85A 1LPNA 3ZJYA 5EJ6A 2K5UA 2F4NA 1WMAA 3CLVA 3EIQA 4WKCA 2PUTA 2B94A 3UOGA 4DLKA 4NYIQ 5EE9A 4YMGA 3I09A 1HE4A 1OJ7A 3IRUA 3WYBA 1GYQA 1SUIA 2WDZA 1J6UA 4R71A 1V3VA 2EW2A 4CMEC 3ZEAA 2H07A 4G0NA 3ADCA 1NLZA 1FQKA 4KWTA 2OQVA 3ZD9A 5IJ9A 3A6PC 3GGGA 2JJQA 3FWHA 5CT9A 3VZSA 2O3JA 4OF4A 5CHYA 2GSWA 1PZGA 2JHGA 4IICA 4YRMA 2XT9A 2BZSA 2VYVD 4Q18A 1QAOA 2EFYA 4S2UA 5E2AA 1XIVA 3WYNA 4B6EA 1SHLA 1Y4AE 4OATA 5FO0A 1RRPA 3BILA 3E9QA 3HGTA 4MKZA 4OHWA 4E2ZA 3A4VA 3SSOA 4LJYA 1SCIA 1FVHA 2FOXA 4UBLA 2XVMA 4LVNA 4DY4A 2W83A 4DA6A 1IHDA 3DG9A 1T4CA 2GASA 1U0GA 1ZN8A 2GHIA 2XH8A 3IO5A 3QLUA 4KE9A 1JPNA 1UFVA 4ZDWA 4YRNA 5A7FA 4BE4A 4QG3A 4N0DA 1E99A 1KMMA 1XU7A 1P1CA 2DR3A 4Q16A 4BKMA 2WA2A 5BR7A 1EFRD 2G7ZA 1CUFA 2BMFA 2FJPA 5BV8A 2IHVA 4BGDA 4XW2A 4AJIA 2XW6A 4OMUA 2AIRA 5DM1A 5LQSA 1WXHA 2FDCA 2H63A 2ADMA 1B15A 4UHHA 4MK4A 3P5BA 4IDDA 4J1TA 5TVGA 4B85A 4D42A 1RT9A 1YR2A 3H11A 2OCBA 4JL8A 4C04A 1NBOA 3ODPA 3QIAA 3DFUA 5B1SA 3VJLA 2JHPA 2ZVJA 3BIWA 3O8NA 4I08A 2DMRA 5KTSA 3LUKA 3VC1A 1NFQA 2H1HA 2PM8A 2OK8A 3OU6A 3IOEA 4TWRA 4W1RA 5AO9A 3GI1A 2QNIA 4IXDA 5IKOA 3UMFA 3DKVA 1WW8A 3VXKA 2DSNA 3AM5A 3N2LA 3HKBB 3QEMA 4MVJH 2I54A 2AV6A 1JAYA 5FWXB 4JD5A 4LOAA 1MVLA 3GJXC 4GOND 2IEBA 3PE4A 4EHJA 1Y8AA 3PC2A 1G8PA 1YR7A 2X9NA 2Z9CA 3RIEA 1XAGA 1F60A 4OV6B 3AUYA 1DBVO 3GUVA 5JJLA 1V3TA 3B70A 1O8BA 1PFUA 1ORTA 4TKZA 2XDQB 2P7HA 1P0MA 1T3ZA 4FW8A 1QF7A 3AHEA 4BO4A 3SGLA 2H6EA 4ESVA 4RIFA 4D3SA 4M0KA 3RUCA 3N75A 1YRQA 2JFXA 4JJ6A 1VPEA 4CIXA 3PTLA 1DEOA 3A2MA 3ABSB 1DRJA 2PX2A 3GHHA 3GLUA 1VXRA 3I53A 1UWKA 1JIVA 1QK4A 3VFDA 3GG9A 2F43B 2JHAA 1FU7A 4TMXA 4KEAA 4CKCB 3EY9A 3AUUA 5HCIA 3IV6A 2HCBA 3AZPA 3DOIA 3F71A 4Q7MB 1I6WA 2ZR8A 3VGPA 2YIMA 3LYLA 1SOVA 1KWKA 1XA3A 4V39A 3E1GA 2W6ZA 5E7MA 1OZ0A 2BMAA 1BE8A 3BBPA 4D0SA 2J1LA 3K0AB 1S96A 4CIBA 1LLQA 3IUJA 1NX9A 2OGZA 3LNTA 4HDKB 2YWDA 1U9JA 1AKQA 2VK4A 2F3SA 4NMHA 3DMTA 1JJBA 1P0QA 4RUKA 1F0YA 5JCOA 3SG0A 1HQYE 1QOPB 1GU0A 3L41A 4DUGA 3DCJA 4FLFA 5D5PA 1D3AA 1BHSA 1HLGA 5KC9A 1CZOA 3IXQA 3M5WA 5FYDA 5L3QA 2CMDA 4V24A 4OHRA 1SBQA 2MSEB 2RBEA 1TCVA 3H75A 3IAM6 4UD2A 4YP1A 4WBNA 4KG7A 3HVJA 3PU6A 2C7BA 1MAAA 4ZRNA 2XJ4A 1VRVA 2PUCA 4CMCA 1KEEB 2YMQA 3KYDA 2OB2A 3L7KA 5T8KC 3SBEA 4JN6B 2IE8A 1U2DC 2WVGA 4JZKA 5DLEA 3FTCA 1YTLA 4P93A 4Z6KA 2DETA 1H8ED 2I0FA 2PV7A 2WKRA 3AIIA 4LOLA 4NENA 3UW1A 2YCBA 1SVOA 2EBFX 5F52A 4XWKA 3QNUA 1J2TA 4IL5A 5BUQA 6NULA 4PZEA 3B3AA 2Y0BA 1ADYA 2A94A 2ZIWB 3PGLA 3ZEIA 3AJDA 4JUDX 4HLUC 3U62A 1WF3A 2Q8NA 2RAPA 2VF2A 3HACA 5AKLA 3KTFA 3I9JA 3P0FA 1FFAA 1JG3A 1R4ZA 1YQDA 1ECFA 4RVSA 4IHAA 5E9QA 1CY7A 4A6XA 4P4NA 3AU9A 3QLEA 1ZINA 4PZDA 1C5KA 4RPGA 4Q03A 1JALA 1JHAA 4IDQA 1OTXA 2ACVA 8MHTA 1W48A 3DEYX 2Z8YM 3AB7A 4GEKA 2FUG1 2NZYA 2HQBA 4G5RA 4IMIB 4LYJA 4LVOA 2GKSA 2ZRJA 3RD5A 4IRXA 3U7IA 4AO8A 3BRCA 3OLXA 5LNK1 4FZ3A 3B3GA 3T1OA 1T9ZA 2QN1A 2GUGA 3VSEA 8LDHA 1PHPA 3VPHA 4CR8A 2YWXA 3A1DA 5EERA 2GK7A 3VVLA 1DJOA 5FHRA 2H5LA 2YW9A 1LJLA 3PVCA 1ATZA 4B7XA 4XAQA 2JLCA 2D1SA 1SO8A 1H42A 5AM0A 4XDGA 1W1WA 3NHPA 3Q0IA 4G07A 3IP1A 3JSXA 4CETA 1S4QA 2O8DB 1OV4A 4C4TA 2X5JO 3OJLA 2XKJE 3VPXA 1THGA 4FWTA 1RI3A 2XNKA 2YV1A 4PXAA 1UWLA 1Q1GA 2C7QA 5TT1A 1E4EB 4IG9A 1JLKA 4PR0A 1XU9A 5C53B 3H87A 3AF0A 4XEUA 4C29A 3BXOA 5IJAA 4BCCA 3KVYA 4M60A 4JSTA 2MINA 1QZ3A 5E6SB 3WGIA 4C0AC 1JDBC 1L1RA 3QV2A 5DP1A 1WF6A 4WY2A 2QU7A 3DV0B 5DK6A 3A4IA 4GECA 5C1BA 1R3DA 2A1UA 3IDQA 2O2XA 1XC7A 5HGJA 3N2YA 3HYRA 5ESRA 1FNNA 1VLHA 2ZW9A 5HA5A 5CDFE 1XPOA 1K4YA 3EAQA 4FKMA 1KYVA 4N18A 5JS7A 1TQ2A 4AIRA 2QJRA 4X44A 2O7QA 2ZRIA 1MB0A 1QIEA 3NZEA 3K71B 3HB4X 4I4TA 1ZHOA 1K8QA 2YWJA 4MKFA 4Q82A 4CF4A 1DQYA 3ED5A 1FJHA 2VH2A 5IKPA 2XD4A 3S2IA 3FWYA 2X1MA 1QAMA 4AY3A 2VBFA 3OZFA 4EUEA 1I32A 1KPGA 4G41A 2VWGA 1J0CA 4TGLA 5FWYA 1G3UA 3L4EA 1YQEA 4RL4A 1L7EA 3KKQA 4LAFA 1XCPA 2XODA 2BEJA 3GVCA 4WCVA 2VUUA 5HBRA 3LQ2A 2AVNA 4U2BA 1D6SA 1FPQA 4F4FA 5BSVA 5KWIA 3WYGA 1BEUB 4LQCA 4WEOA 4XGRA 3HN7A 4OFXA 3GLQA 3K1TA 2ECKA 4R2LA 3I9NA 5KIAA 1KJWA 4PC2A 4B9EA 3IUPA 1ISFA 3GR6A 2FPPA 2HCRA 2QRPA 4HQKA 2J30A 5AI8A 2EFDB 2XMRA 1F8YA 4AF6A 5ED0A 1TQ8A 3KYIB 2ZUDA 4AICA 4C3VA 1MC1A 4ETIA 1DCMA 5A2QA 3FPHA 5THXA 2I2CA 4HVAA 3ROEA 4C3UA 3GPCA 4MKIA 4N8DA 4KMMA 1P9WA 5HKAA 4K86A 2ET6A 1F4PA 5JSYA 1KEWA 2INGX 1QK3A 2WP0A 4WL0A 5A4AA 4G5HA 5EPUA 5F1YA 4GYKA 4ANFA 4BS9A 1EDDA 4CF6A 2BMEA 4PQFA 1VJ0A 2K2QB 2NSLA 2JGIA 4RJKA 5GV7A 2IYWA 3QXJA 3HDTA 4I5IA 3OC0A 3SM3A 3ZKAA 4A5OA 4CM4A 5BPFA 1Y8QA 4IMJB 4A1FA 3E1KA 3EISA 1XZHA 1N9ZA 3L8DA 3K9NA 2BZ0A 1OB5A 2GM4A 2YJ5A 3ZJUA 3EPHA 4R2JA 3W2FA 4H2DA 1J4AA 2ZB7A 3T1TA 4O63O 2G1PA 1IJBA 5DV9A 2WC1A 3TZEA 4EEZA 2BGGA 1K68A 4G1CA 4DSAA 2V5UA 5AHRA 2XEXA 1KSGA 1Q1BA 3CN9A 4OBBA 3IQZA 2NUBA 4G9GA 5L3ZA 4FYYA 4PANA 2OO5A 2FEOA 3TNJA 1BXGB 1JA9A 1JU3A 3LDAA 1IUNA 4DLSA 1PR3A 1IDN1 3IQDB 4GM1A 2ZITA 4XTCS 3WLMA 4ENUA 4QRIA 4AAYA 4GIBA 2B4KA 4KV7A 1U7WA 3IAS6 3JQAA 2C77A 5P21A 1Q7RA 3SFTA 4S05A 3A9RA 4Y2GA 2IEYA 1VFPA 4EW3A 3A3YA 2O8FB 3AHGA 3V4VB 3ZCSA 5BYAA 3UHPA 5L45A 5DYGA 1W36C 5TMPA 2IDKA 2WYOA 3BMOB 4ZRMA 3REOA 4TKVB 1VHLA 4PE5B 1T8UA 5ESDA 4A03A 3ESYA 3RNOA 4O02B 2QLNA 3OOJA 1HRKA 3N76A 5AR1A 1JHRA 2AGVA 1KKMA 3JX9A 4Q7EA 2HIHA 4MW7A 1JBEA 4UE6A 1VB5A 3FDZB 1Y34E 1E2EA 4I6JA 4YJ3F 1CETA 1WPQA 2W2QA 4MHTA 2OOSA 3GK3A 3ZXSA 3EQ9A 4MRMB 3OE7A 4UULA 1KK3A 1LPMA 1O9GA 3IRVA 4GUAA 1KJQA 5FL7A 4Z4CA 2P2ZA 3CJTA 2ZXEA 5JNSA 2EC5A 1P75A 4KH1A 3VGJA 4NULA 1M5RA 5KO2A 2PZJA 3L0OA 3PGVA 5DI3B 4DG5A 2ATVA 3KK0A 4KIGA 4NBKA 1KJNA 4LBWA 3CV3A 4COOA 4A5SA 1IN1A 3C1AA 4BX8A 1R15A 1DU4A 4M53A 3STYA 4CEIB 1QKIA 3Q12A 4H0CA 2VYND 2C8VA 1RAIA 3K2IA 3T99A 1U3GA 4DWOA 1YIOA 3PTAA 5M29A 2BGRA 2BTQB 2QLMA 1N7JA 1M33A 4JKOA 3JRXA 5C8ZA 4UZFA 4DXAA 2M2IA 4OAOA 2PUWA 2XQKA 3KVVA 1BQEA 4A8JC 1U8UA 1VCMA 3PHHA 3MG9A 3ET5A 1UFKA 3GCXA 3PJGA 3FNBA 4LHEA 3RG8A 2DAPA 3DZCA 3ICCA 1KDTA 3EUEA 1UXKA 1TKBA 3GZ4A 3HA7A 1T9HA 2DYKA 4URVR 3JZDA 1YB7A 3KR1A 4IDOA 1RTKA 4JI5B 2NAFA 2VNJA 3L0SA 4OLHA 2G1UA 4X24A 4B2IA 3IQGX 4I1VA 1C29B 1X87A 3ONDA 1IY9A 3KV1A 1JZQA 5DFAA 1SEPA 4B3CA 3ZKWB 3KB2A 4B1FA 4P82A 4M7WA 4BYMA 1QF6A 1JEAA 2AFRA 4F6CA 3G0OA 1HLDA 3JV7A 1KK0A 4HRYA 1EVQA 1HG1A 2F64A 2P3QA 4XM1A 4QBIA 2O14A 4UCWA 2QBYB 4ZEOA 2CGEA 3KJXA 1NBMD 1NFFA 1BS1A 1P7VA 4LK3A 3WRXC 4NX2A 3ZK7A 2DH6A 4Y2UA 4O2LA 5KBYA 3WIVA 2GOYA 2D62A 3HMQA 1X0VA 2VH5R 4FE4A 5H82A 2EBUA 2R4TA 3V2GA 4UNSA 1YJQA 2WG2A 4BNLA 5CCXA 4A6EA 5CCEA 3KE9A 3LGAA 1SWWA 2J09A 2E3JA 5F51A 1IB6A 2X0NA 4GZ3A 3U31A 1P4HA 4FXPA 5ALHA 3GU3A 2W2OA 3AEKB 3MCWA 4ZU6X 4E1AA 3B7PA 1YS4A 3I6YA 1F06A 4RGYA 3HCAA 2AXEA 2VT2A 4TUYF 3SXPA 1FSGA 1M34B 4RQBA 1UM9B 2PN1A 4WXEA 5JQGB 3FCUB 3BAZA 1CUUA 2PZEA 4Z9YA 4ZKEA 2XMBA 2GAOA 3VYTB 5CB6A 1OXUA 3NH6A 5FPSA 4K6FA 1PR1A 2FN4A 2BKXA 2E7ZA 2VQDA 1HT0A 3IEIA 3MLBA 4HWOA 1N5JA 2J3JA 2VZ0A 2VAVA 5HS6A 5BSUA 3WIOA 1TJPB 4AK9A 1XA4A 2ZSAA 2B82A 5J63A 2GXQA 2IPXA 4J0JA 3ZDYB 3OLCX 1L4MA 4DHEA 3B52X 3URMA 3U7EB 1VTKA 3G23A 4JNKA 1BXRA 3WMXA 3MLAA 2BBOA 1FDIA 3L49A 5DNCA 5HRUA 2PWPA 1TO1E 5EXXA 2XVXA 3WYEA 4NZOA 2CUKA 2X8JB 5J2UB 5EVCA 4KLRA 3L82B 1L7OA 2QDKA 4WKPA 5BT9A 2VWHA 4Q4LA 2Y9MB 3D0RA 4QYIA 4TLLB 3HGMA 1B0AA 2C0CA 2E6UX 3JVUA 4OL0A 2C4UA 2FSGA 4L6IA 4MYCA 3SBXA 4JI0B 1ZMOA 3JYNA 4HPXB 2XYPA 1UEJA 1Z17A 2YFYA 4FEYA 4JWTA 2WT8A 4R9VA 5G0SA 5L7WA 3GC6A 3SBOA 1Y48E 1FXWF 1CF4A 4G67A 3S1SA 5J3JA 1J8VA 1L0BA 3RKRA 2P2SA 1XDWA 4RFVA 1BN6A 3TX2A 1A5ZA 3OKCA 1RXVA 4DCTA 4H6WA 4DLWA 4D02A 2RAVA 4WLFA 1GTL1 4RK1A 5F2KA 2IYZA 3EGDA 4BRUA 3OUZA 4UTNA 1XL0A 3OI7A 1XXHA 4YMVA 3M6XA 1U4SA 1NDQA 3QZUA 2OTCA 1QIHA 1GPJA 2CSXA 1M66A 1KH3A 1Q50A 3DQZA 3C1TA 2D1RA 1MGOA 3MMSA 4DM7A 2Q0XA 1Z0ZA 3SS8A 2RGNA 5J4KA 3DFMA 4H1UA 5IJ0B 3OY7A 4RGQA 2ZT7A 2XWQA 5B3AA 5C4MA 5D7NA 2VSQA 2RCNA 3DDNA 4D8YA 1ZU4A 2UDPA 1NXWA 1W93A 3KXDA 5B2EA 1E1MA 1DZIA 5EMLA 5EJFA 3G0HA 5DGHA 5AM5A 3I62A 4GT1A 1MENA 5LXTF 4BJ5A 3H9UA 2BBWA 2Q2NA 3WDSA 2F3PA 2OQ2A 4OHXA 5A5FA 2VATA 3Q10A 4EKIA 2R96A 1W19A 2D2IA 2QQ0A 2ZQ5A 4GFDA 4PIPA 1RMTA 3GFBA 3TQSA 3COVA 2XLBA 2YL2A 1DKPA 1JYFA 3ZWWA 1GG2A 2R1UA 4M1OA 4YJ2B 3ROQA 1KSHA 2DBRA 1PWYE 3CLHA 3INRA 1R4MB 4WLNA 3Q3EA 3L07A 1A77A 2VDOB 3X1KA 1I1OA 2IVFA 2VS1A 3WL4A 2GBLA 1N2JA 1BHQ1 2E37A 2NADA 2YJTD 3V42A 3I61A 1A9RA 2GNOA 3BOSA 1DDGA 4O4IA 3C0KA 1M34E 2ZE6A 2CD7A 1ZH4A 1UXOA 1T8WA 2J7PA 1U8CB 1X8KA 3N59A 3HXPA 4Y67A 4X5OA 4M1QA 3K9LA 1K66A 1IJEA 1UBTS 1NVXQ 1UANA 1VMIA 3I8OA 4G1BA 4WZAA 3IUBA 1GTRA 2EQBA 4UXJA 3F1KA 1BWRA 2H0RA 2V6BA 3AR6A 5EZ5A 5ICEA 4MI3A 3GFOA 4PS1A 1ESZA 4O2BF 4BV9A 4R16A 4G4IA 4DABA 1N77A 1NVWQ 1EB9A 1PNVA 1ZOLA 2GPJA 4IIVA 4TWBA 2IV2X 5FPPA 5IXYA 1Y6GA 5C32A 4DG8A 1Y8RA 2Z1MA 3L4JA 3J80A 2NSHA 2QTAA 1N2XA 4UUBA 1OYWA 2IF0A 3EXEB 4H7JA 3T1VA 3U44B 1OGJA 1PL6A 1AK9A 1E7SA 5HQJA 1Y4SA 1X2BA 3ZQJA 1NVVQ 4N4AA 3JSAA 1HNXB 4HDNA 2QTNA 2X8LA 3NRBA 1AHHA 2EYUA 2XUHA 1M73E 3ZHCA 2D0DA 5JS8A 3KKZA 4ZQBA 3OWOA 5DOZA 4B34A 3IR7A 1J42A 1KMCA 2DUUA 1PP4A 2J0EA 2V7VA 2I1QA 1SBHA 3AX6A 3AHHA 3HO6A 2KE5A 2ZRLA 1GXSB 2YWFA 4R8MA 3LY5A 1EZZA 1JR3D 5I9SA 2ZBUA 3INYA 4UNIA 2NT4A 5DO9A 1EFKA 3N07A 5FX2A 4KHPB 4FMPA 4HEHA 1OFTA 1Q1AA 2I99A 2IVZA 2OHFA 3R5TA 4GW3A 2JFOA 4LDQA 1MO3A 3BMQB 4WWHA 5KNBA 5HK8A 3C3EA 5AJZA 1COWD 3FZNA 1KVSA 3O91A 2Q4TA 5LIPA 3NEAA 4KYUA 3ZWXA 5D87A 3ETGA 2DPLA 3JZAA 3MTGA 1LPBB 4B3TB 4G5FA 3L79A 3NBAA 3PR1A 1DHTA 1UBEA 3TTWA 2QTCA 2P8SA 3NVKI 1RVV1 3JPWA 3NDPA 3H97A 2GBIA 4XJVA 1GSHA 3DUFB 3KZXA 1V16B 1XEFA 4W5RA 3TZ6A 1YQWA 3VH4A 2VRWA 1CQIA 2Y1GA 3GLTA 2C58A 4W99A 3ZHUA 4IJ5A 2Q6KA 3L6OO 1P0IA 1PW7A 2G06A 2V0NA 3EQZA 4HH1A 4F93B 1PKXA 1C7ZA 4KXQA 5FI5A 1VZ3A 5D3ZA 1NUUA 1W44A 1OX4A 1EFCA 3FDFA 1EPUA 2CLHB 1VJRA 4PNPA 1ZITA 4HEA6 1QGZA 3D1VA 1ULUA 3D3QA 4AP6A 1XDBA 4QAJA 1YJBA 3DZIA 1F8XA 1HSZA 1T91A 1QGYA 1Z3CA 2DFTA 2JCBA 3FFBA 3GHYA 3H99A 3PR2B 4PXSA 3EVCA 3C8ZA 2J3QA 1P4RA 2KBEA 4JT2A 1MTZA 3NUGA 3E3OA 4RKFA 3LUJA 3N6XA 4RKWA 5KX5F 4WCFC 4IHJB 2DQZA 4HJRA 3R7NA 2A78A 2VHYA 3I04A 5L3RA 3LA8A 1YQXA 3AEUA 5KNCD 4EHKA 2V0CA 1AZWA 4ZO6A 5CB8A 2XMSA 1R9MA 1CDDA 3E53A 2ID7A 3L3BA 3F4KA 3GQVA 4MPDA 3X1JA 4ARVA 2REOA 4K6CA 5IN4A 3QM1A 1DC7A 1VC2A 2PD6A 3GNQA 4PY2A 1S8AA 1KEKA 3L8MA 3DWFA 1GNTA 2B8JA 3AESA 3MS7A 2ZAGA 3E3MA 1KO1A 1ZDMA 2P2NA 1VG8A 4XUDA 1RI4A 3EXIB 4C0KA 1L5QA 2EIHA 5C7YA 4B17A 1TA4A 1ODJA 1Y6QA 2WMOB 4HMQA 2OM2A 3HJCA 4KXFB 1EFPA 3WGKA 1SG9A 3LPDA 3HXLA 1FNSA 1Z0JA 4QDJA 1KZ6A 1U2RA 3IIMA 2QROA 4B76A 2PSJA 5HRCA 4LY3A 4L78A 2QX7A 2VHJA 2WUWE 1SD2A 3AP2A 1KY5A 3S7ZA 1IBLB 1KR2A 5FUXA 4YH1A 1JKMA 1JLRA 5A0TA 1QJCA 2PTGA 4U2DA 4G6ZA 3EVGA 2L2QA 2FE4A 2VJPA 4J16A 1MPTA 3I01M 4WOPA 4GE3A 4U5QA 2ZGVA 4XWAA 3LCJA 2E2WA 1SCUA 2EP5A 1T0BA 4TLMB 2YIVX 3BJRA 3H84A 4NIMA 3BMNB 4J7XA 4HGRA 3TM5A 3VBEA 6ABPA 5CMLA 5ALNA 2LDBA 2W6JD 2A0YA 4Z0HO 2OXRA 1M2EA 1N6RA 4K81B 3ZHBA 2EZTA 3RI3A 2V58A 5I9TA 5IAGA 4PC7A 1IXZA 2N9UA 1CK4A 4NYJR 3AY0A 1VE5A 5DGTA 5DLDA 3H4VA 2WD8A 4LDPA 3KVOA 2HWUA 1N2IA 3QNMA 4PHHA 4IV0A 3D0OA 4CI9A 2QVLA 4MWSA 4G81A 1H2AS 3SEAA 3BERA 4X3CA 1FRZA 1VPLA 1V37A 2J67A 3FWKA 4WFJA 1S9HA 1YR3A 3H13A 3KDSE 5E0KB 4DT1B 2X1VA 3VJRA 5DTJA 1IPHA 2ODNA 4MV8A 4GI1A 3IQFA 1TECE 2SNIE 2PA0A 3PC8C 1C9KA 3V8BA 3IKVA 4U2FA 4F6RB 4IDFA 1ZVJA 5C5DA 4DC0A 1GP2A 2ORYA 1DBPA 3CB2A 3FNQA 5BQXA 2IUUA 4E2WA 2OAP1 2JIRA 3UFXB 3GWGA 4NBLA 1HPLA 4D98A 3N6VA 4YLEA 5DT9A 1FZQA 1D1TA 4HQLA 5DYWA 4OCZA 2B61A 1AGRA 1PG2A 4L5AA 1XHLA 4DQ0A 3SVLA 1E7WA 2WM8A 3OUUA 3QU5A 4UMVA 2BISA 2DTEA 2ZTHA 4KQ9A 3BXHA 2CLCX 2GFQA 1Z13A 1N0UA 1I3MA 1DAIA 1T1IA 1X94A 3ZVLA 3LG2A 3ZU2A 2GCGA 4MW1A 5HR5A 3IJPA 5KNCH 4KR3A 4PLHA 5IBCA 4GC5A 1CR0A 4CN8A 1RLOA 2ENWA 1L8LA 2IYVA 2ZROA 4QJBA 3B8HA 2D1YA 3KUUA 4QUDA 4UOZA 2PWZA 4G23A 4G37A 4LN1A 2NU8B 4ZGGA 3P96A 3K5WA 3SZUA 3JAMA 3JQBA 4U9UA 5ILQA 3WB2A 4YV1A 4RX1A 5JDIC 1Z06A 1AF4A 1JDZA 3I6QA 3M70A 3QELA 3R3HA 4X91A 4PRLA 1FU8A 1L5MA 3NV9A 5EZYF 5TC4A 2X3YA 3GAFA 2R00A 3R7WA 5IF9A 5LL6P 1RLIA 1YULA 1GVNB 1TFUA 3QOFA 2FFHA 3FR8A 3AEZA 3K0FB 4WJZA 5CH8A 1IQPA 4ZK2A 1NSFA 1H0HA 5JYDA 1F2UA 1UBOS 4RLFA 4AMYA 4Q1AA 2Q62A 2G04A 2AUMA 3TXXA 3AXTA 4KAFA 1V39A 5G0VA 4DYDA 4GKKB 4C0XA 3EXFA 3GELA 4OP3A 1JB1A 4DXDA 1NURA 2EWMA 3BRQA 3DZBA 3QSGA 4W1PA 4DR1B 1NWHA 4RM2A 1GAXA 2DKOA 1YL6A 1MQAA 4ZI7A 1AS3A 4D3XA 1MX5A 2VJOA 3B7GA 3I34X 4LXQA 4DV7B 2FPUA 2PZKA 2W6NA 4H7FA 1FDRA 1AQ6A 1RYDA 3JQ8B 2OT3B 4QICA 1ZJZA 2ZSJA 5JDCC 3C24A 4FVTA 4CDGA 6GPBA 2P6UA 2IA5A 1MH1A 1E59A 1VE9A 1Y37A 4FMCF 4EUFA 1W581 1QRRA 4XJSA 1YBFA 2V7QA 4KRGA 4RDHA 2MHCA 3TBKA 1CHNA 2PVCA 4WACA 1I13A 5KJCA 3NGXA 1SU6A 4PAMA 2D5CA 4RHYA 3R75A 5HSGA 3SWWA 1WETA 3L84A 2PU5A 3L1UA 1W2GA 3VAAA 1H85A 3SN6A 4Z3DA 3C8DA 5BN5B 5CB4F 1XTRA 2EP8A 3CRW1 4B47A 4X1YB 3G82C 1TEZA 1JEQB 2W98A 4Z1OA 2A59A 3GUUA 4M9XA 1XFAA 3K09A 2D74A 5ALTA 3LBFA 2V4MA 5CEEA 4EHIA 3EA0A 1B6TA 3TIFA 4HTFA 4DDVA 2VL7A 1NONA 1IULA 3DS8A 3GRPA 4NOMA 4S0XA 3QVVA 1NBHA 1NG1A 5A3JA 2H4YA 3PQ2A 3Q0TA 3QQPA 4W8OA 2J87A 4YAKA 5B1EA 3F96A 1E5XA 5IUNC 4PHTA 5K0SA 5LLDA 4QTUB 2P9BA 3G5MA 4K46A 4OLJA 3PEWA 4L0QA 5EXEA 4B7ZA 3D3JA 2JBWA 4YP9A 3TOZA 5B7QA 3I0NA 5I01A 1NTOA 3CSDA 3VZDA 1H5QA 1XTZA 3D8NA 4WUVA 1LDNA 4ZDIA 4IMPA 4RDIA 4B71A 4UBMA 4CV0A 2GD2A 4BKRA 3TUZC 1CJUC 4ZU3A 1KFCB 4GX5A 2IHBA 3IOYA 3PPVA 2QAGC 4IIDA 5A9TA 1MB9A 2QSZA 3F6YA 2C88A 3EXHA 5AHXA 5F76A 5JZBA 3AR4A 3B3FA 4D2IA 2CLOB 2PH5A 5DCWA 1I51A 1EZ1A 3R0QA 4QPZA 4ZYZA 3FOEC 1LGYA 4XPIA 5SYAA 2WINI 3TLGB 3NTXA 1OI3A 3F67A 4S24A 5K1ZA 5E3IA 3T6KA 3WB1A 3MWFA 2CFOA 1G8SA 1QO9A 3HCRA 3NXKA 3ZDZB 3WAJA 2XF2A 4BYGA 5TF0A 4KHZA 1HT3A 4D5GA 3CLRD 1NQOA 4NNJA 1MNAA 4AECA 1BA3A 4RCVA 4L4UA 4CEJA 1VKHA 3K8ZA 1E20A 1WS6A 2X41A 1Z5GA 4IO0A 3S2ZA 4QNMA 1RKBA 1VQ1A 2CBZA 3HJTA 1ORVA 3KELA 3MMXA 4JDUA 1YBAA 4K3VA 5AM3A 1M6EX 2NX2A 1NBIA 1JQDA 1CT9A 2N42A 3GDWA 3TSYA 3ASYA 1XN4A 1JTEA 2WD7B 1EM8A 3KPWA 3PXEA 5DTIA 1YZQA 3MAAC 4RESA 2LDXA 2PYDA 3WWZA 3P8ZA 2R48A 4JI1B 1QDEA 2BFDA 3GBSA 2Z5GA 4TTRA 2GM3A 1ESNA 2NVUA 2EFEB 4NG5A 3P0EA 4W63A 3IR6A 3GRCA 3ILXA 1FTSA 2QU8A 2UZAA 1E3EA 1R37A 4M22A 4X9XA 4RIIA 2Q7DA 1YQTA 2A7QA 3ZCRA 4BATA 2FZ5A 3FNEA 1VG1A 2JANA 3A2KA 1XVLA 3QMVA 5CXQA 2JVKA 3DXXA 2FW1A 2C99A 2FEPA 3MD9A 1C1DA 4LCJA 4V0NA 3SCZA 2ZR0A 3K16A 4LRYA 2E5LB 1VBKA 3U3XA 3F5SA 3KUDA 4XGQA 5IM4F 1UJ4A 4QNNA 4N5NA 3DEKA 1A4IA 4YMLA 1U28C 1US8A 4IEEA 1VHQA 1T9KA 2UYCA 4N48A 1OF1A 3IDAA 3V2IA 2EEZA 3AOEA 5AI4A 4BNTA 2BI7A 3HBMA 4L8GA 5JCXA 5JO0A 1R6BX 1ZXXA 1C9MA 4L6CA 1N5IA 2NUPA 3B60A 3W8DA 4M9QA 2CHEA 4EKEA 1TU3A 2OP0A 3R3VA 1N8SA 1SC4A 1O94D 1T1RA 1Z2AA 3L06A 2PY6A 3VPBA 4DQVA 2FUKA 2WU0A 4FT2A 4JL6A 4ZO4A 1IOZA 3TI7A 1Z4IA 4FI3C 5K3DA 2BHRA 1MX1A 3NTLA 5ALJA 3O94A 4CM3A 5JTUA 3AONB 3K7EA 1WVGA 4JITA 1TM3E 5C8DA 3CF4A 1TRHA 3RVNA 2W42A 2MR5A 4YT5A 3B6MA 3FUXA 5ALGA 3V4OA 1XLWA 3UWOA 1KRWA 3W34A 1ZH2A 5H5JA 1ISPA 3T95A 1R8QA 1LLCA 2NLOA 1F38A 2Q4BA 4U7JA 2XYGA 2QIPA 4NBUA 4X90A 3RUFA 1QYCA 3U3RA 5CLJA 5FAKA 1WSDA 1MRNA 3K6RA 2NVOA 2WIGA 3BYZA 3JWGA 1E3SA 2ZWIA 1E1RA 1L5GB 2H0AA 1AB6A 1A2KC 2VUSA 4UVEA 3THSA 3TMAA 5J58A 2HSJA 2FNAA 2J6IA 2WFLB 4NHOA 2W6OA 5CLGA 3SQDA 3O8RA 3DO6A 4YVFA 3TL6A 1BKYA 1GA4A 3ZHTA 3ROZA 4XVRA 1RRFA 3WRWA 2CXRA 2QQFA 1NVEA 1OZFA 3EVAA 1MIOB 3I52A 4FYIA 4QU5A 1XR3A 5H3CA 1IXKA 1JLMA 1NMZA 3FM9A 4Y2XA 1M7GA 5FFNA 3WAKA 2AX4A 1CP2A 2YFKA 3P4UA 3RFTA 3FRJA 5IS2A 2ISSD 4R1QA 1QQBA 4JB2A 3ZVMA 2AC2A 3NMUF 1EVEA 2W6ID 3QTBA 3AINA 5EWMB 2J3EA 4BZQA 3PI7A 4I1OA 4PCAA 2FPWA 1TT7A 4CLRA 5SYNA 4CM4B 3OEEA 4CZ2A 2DFVA 4IRUB 4IQ8A 1I36A 3UUFA 5IYZF 4D0LB 4ZCMA 3MYYA 4E5DA 2ORWA 4F3TA 4GKAA 4YUZA 1SQGA 2WG0A 5FXMA 5A9RA 1I33A 2IEAA 1XZEA 2WV7A 1POXA 3CH6A 4F9GA 5AVKA 3RUDA 4NV0A 1X7XB 4L8FA 4HFNA 2H17A 2H2HA 5LZ7A 4JU9A 2A9QA 2X2PA 4R9NA 4JLDA 3R0VA 1IUKA 4O4LB 1L8QA 5H0IA 3WB9A 1P60A 1I24A 3PLRA 5MN4A 2QUBA 4TV8F 1UK7A 3I01A 4G24A 5J40A 5ADUS 3X2EA 1EXVA 2XCSB 2R7KA 1T5HX 1ZESA 3PRJA 4DADA 1Q22A 2XGSA 3KJNA 1I5OA 3OCZA 1MC5A 1PL0A 5B3JC 4R05A 1O08A 2M9MA 4MR8A 4RZUA 3E3AA 3R20A 3KSZO 1WZ2A 3QXXA 5JJKA 3CVWA 2ZJ5A 2SCUB 3CWCA 4IRMA 3A2NA 2QMEA 4NBSA 4DMUB 5CA0F 5HHTA 3EUAA 1OREA 4EGAA 2VPWA 4W5HA 1BAPA 1Z6XA 4OGLA 4YCCA 4RDCA 5T4BA 4TTQA 2DY0A 1S3IA 2C7GA 3N70A 1VYTA 4JJFA 4BV3A 1E9VA 3CNOA 4IMRA 2VTBA 2O2YA 2EF1A 3R3UA 1S1MA 4CFSA 4EVIA 2O5CA 4DLYA 3TL3A 1NXQA 1P8JA 1X9HA 5EIFA 3PIIA 4MYTA 4RTOA 1QIFA 5A3SA 1KXJA 5JANA 3DZGA 3K6SB 2BMDA 2OECA 1R9GA 3GLRA 3KXPA 4EG3A 3U60B 1B0PA 1QUFA 2GFIA 3OA2A 4JUBA 4AJ1A 3N7TA 3NG1A 1U99A 3K20A 3OCXA 2R87A 2ZIAA 3LYAA 1NAIA 4FC6A 3ZCPA 2YJGA 4TKUB 3ZWCA 4BUJA 1E7YA 4HGOA 4QVIA 2I87A 3TOCA 3L6EA 3ROKA 2A84A 5CVDA 5EJ7A 1UKEA 4Q9LA 4DUPA 2DRIA 1R6TA 4CIWA 1SBYA 1ZSVA 3I28A 3SX2A 2JCSA 2NACA 1CIPA 3UXYA 2DE0X 5M3BA 4E5MA 3PCRB 4E7OA 3NHWA 3KC2A 3T3GA 1XAJA 5BOSA 1YGPA 4FI3F 3GGDA 4ND5A 2Y1WA 3ESZA 3U0BA 3VHLB 4DCOA 3MIIA 2RHMA 2FN7A 3FAZA 3E9CA 5ADWA 1G6OA 1IBRA 5HE9A 2ZJOA 3I4CA 1K8ZB 2AHOA 3LCUA 2R6ZA 1T36A 2J6BA 4MAAA 1N0VC 1KMHA 3DFZA 4F3KA 4DDUA 3Q8KA 1DAHA 1BDIA 3OAAD 1FFXB 2CF6A 2IK8A 3OIGA 4KJXA 4KKXB 5KYYB 1VA5A 1GZ7A 3I6IA 4R83A 3G1UA 5AVVA 2WWFA 1YBVA 2B9VA 2K2WA 2HKIA 3GEBA 3AR2A 4KNVA 5JIBA 1JSCA 1NMYA 5AW9A 3VDRA 2HRDA 4OYRA 1XTJA 3O2QB 3L05A 3CCBA 2ID4A 3TEJA 2QV7A 1B2RA 3S5UA 1VDMA 1A8SA 4Q4CA 2E18A 5KTPA 5FO1A 4MA4A 2NZUG 3RLIA 5A9SB 2WLSA 5K0BA 3KTAB 1GRVA 2QXYA 5G0WA 3HU3A 4EDHA 2N46A 1C8VB 1ZNZA 4B3MB 4F9FA 4GU5A 3EF1A 2PKQP 1NE2A 1OLUA 2IHTA 1ZXBA 2O2HA 4O4HB 3RRJA 2Q41A 5J47A 4AYWA 3V6LA 1QKKA 3ABRB 2WZBA 3OSZA 1EWYA 1RJ9B 1SUDA 1XUOA 4B32A 2FSUA 5DHUA 5DXAA 4GDMA 4M46A 5EP2A 4NU8X 5IT9A 2R7MA 4IVNA 4Y2YA 2JAOA 4N03A 2D5AA 5ILGA 1P77A 3CPHA 1EQ2A 1OV6A 4QA9A 4C6TB 2FV8A 2Q9BA 1EAYA 2BFFA 3K1AB 1XEWX 4A0QA 5HCUA 2QRJA 2W6QA 2D5IA 5EY5B 4BQIA 1IUOA 2HQSA 2H4WA 4D6PA 4F5DA 1MOQA 3L7IA 2WAMA 4QREA 4Y2VA 2H18A 3C6XA 1FRQA 1SR8A 1BOFA 2X5OA 1V4VA 5KOHA 3P0JA 3RUEA 1XQXA 5KWSA 1LV7A 2IZZA 1XZNA 2RKWA 4GMFA 5F3WB 1VBMA 1NQUA 3KVRA 3GLIA 4CTJA 1F6DA 3OPYI 3T3HA 1ZM4A 1U80A 4G0UA 1YAHA 2FMKA 3L6UA 1L4NA 2Y1CA 3EMVA 4EVRA 1RS0A 2FPOA 4NJEA 2VF4X 1V26A 1M2OA 2HMSA 1QRUA 1VCHA 5GWXA 1PFVA 2BZGA 4UAJA 3RT1A 2F3UA 3B5JA 3FJOA 3MT0A 4MI9A 2EATA 5IVHA 2VJNA 1VE1A 3LQKA 1A5TA 1E9BA 1QE3A 2FP4B 1SK9A 1P6UA 2CEKA 1THMA 2CL7X 1OYYA 1G0OA 3GDOA 3AV3A 3Q8LA 4XR4A 3HS3A 3PIDA 3TM4A 4ZTUB 1LEHA 3AG6A 3JD3A 4LF8B 1PNTA 4LWQA 4AJKA 3OJOA 4C0BA 3HM9A 3KWMA 4UFOA 4WH0A 1GPDG 2WHPB 1GQ2A 3LP8A 4U3JA 3KQVA 4X7BA 1FU4A 1QIGA 3TSAA 3ROXA 3NETA 1EFDN 3HKEB 4FGWA 5E3HA 1FYVA 1CFZA 2C92A 3VZCA 3VUEA 1X8JA 3T52A 3KXIA 4EAQA 1C0LA 3EBOA 4DEVA 1EQUA 1TI7A 3ROTA 5DX1A 2GCOB 3CNLA 1MQ8B 3CX7A 4JODA 4L75A 1ADFA 3ZWYA 2FW7A 1IEQA 3IVAA 2OSBA 2Y0PA 3S28A 5BN1A 4BQRA 3FIUA 3QK7A 2FZWA 5FADA 1T3HA 4HD8A 1DTEA 1PQPA 1H6BA 2G63A 4JIGA 1GPH1 2WTMA 3RF6A 5JYCA 3TS1A 4UARA 1SQ6A 5I3CA 1L7DA 4G86A 2DU8A 1KZ4A 2GM5A 1TU0A 3C6MA 3DCNA 1Z35A 2BE7A 1Q1EA 3PEUA 4G4SP 4UEJA 2HTEA 4HX9A 4NF2A 1H3NA 4DJDC 1XRRA 4RPIA 4AJ2A 3VHXB 4DIFA 2EZ4A 1GVHA 3DAHA 3P0RA 1KA9H 4JX9A 4PS0A 4LHVA 4JLAA 3WI7A 1CY0A 1TB4A 1XZLA 3T9CA 2I29A 1ZAKA 1NP7A 2B37A 3RFUA 3HUDA 4LOIA 3LUHA 2IU3A 3TBHA 3CH7A 2DJ5A 1BE6A 1JX6A 1HNNA 1Q0SA 2YWEA 5DXJA 1PJ8A 3B8EA 5E7IA 3SD7A 4AG3A 4BFCA 4GRIA 1TYBE 3L4KA 2OC9A 5TQ0B 1EFLA 1B8OA 3CUEF 1J39A 3OIYA 2HJSA 3RKUA 3BJMA 3W3AD 1AHIA 1I5EA 4CMAA 3Q6IA 3EPRA 4NEGA 2AJTA 2XZOA 2QVZX 3OM0A 2WMNB 4GEGA 5EXPA 2X0DA 1XRNA 1Z5NA 1R5JA 1ACJA 3R40A 2XSZD 2JCVA 3SS7X 1JBKA 5CYPA 1DX9A 4QTZA 1NJFA 2R6CA 1KE1A 2I4TA 3DWGA 2AZXA 4HHEA 1T25A 5KJ1A 4LJKA 1DARA 3I92A 5E0OA 5SY9A 1JH9A 2O3TA 1TFRA 1HTWA 4LOJA 3VDNB 1DC4A 3VPCA 3GL9A 4ZYYA 4YAOA 2H57A 2YY6A 2FPSA 4MWZA 4BO1A 3OZEA 2HCTA 2QLFA 1GKUB 2XNDD 1YA8A 3LHDA 4LBVA 5IBPA 3UYLA 2PUGA 1VLLA 1YOVB 4FFSA 2PCLA 3Q1LA 4WLVA 2YTZA 3SZLA 2C78A 2JH9A 3BS4A 1SVMA 2VP0A 2B69A 2OCIA 3DOOA 4JI2B 1MA3A 4X93A 5K8LA 2QN2A 1NI4A 3V34A 2Z9BA 4H27A 5AVWA 2V7UA 3KHTA 3AU8A 3R9XA 2Q6TA 2A6PA 1XJ5A 5CT6A 3WBFA 1T4CB 4EB3A 2PL1A 3VR5A 1AKNA 1P72A 3T5DA 2V4UA 4F60A 3LKDA 1GOTA 2ZXFA 3PT5A 4UU7A 3V4RA 4TL9A 1K7SN 4JLJA 4QU8A 4TV9F 3O8OA 2EFJA 2LTAA 3IE0A 1M6HA 3OECA 3KQYA 1N3LA 2EJVA 2QTTA 5FPHA 2WG1A 3HCCA 1PX0A 1ZIYA 1CZRA 2XD9A 4JH0A 5JNRA 2P1DA 2WY2D 2RKOA 2KMLA 5LBTA 1LCIA 4KLAA 4OXXA 4FKZA 5LCXA 3MOIA 4Q4JA 2XNCA 2BFBA 4XLTA 3QXSA 3DMHA 4WOBA 1SWVA 3GEEA 4WGFA 4B4UA 5LQKA 1TW3A 3KOXA 2AG1A 3D8SA 4H1TA 4JLSA 4PONA 2GZHA 4EG7A 3JATA 5FL3A 2BW0A 1H23A 3MC1A 5EN4A 2OD7A 5K01A 1GNRA 3QFCA 1HKHA 4Z1MA 3ZVRA 1FDSA 3PWKA 1JYEA 4PG5A 2QX9A 1GILA 3DD1A 3RRBA 1ITZA 2VNAA 3GT3A 3H7AA 5B7PA 4ND6A 3IAEA 3SVTA 4OJQA 1QB7A 2HIGA 4NCJA 1ZD8A 1B0UA 3S1LA 1AGPA 1DQNA 4UEOA 3GRUA 2PYIA 1SZCA 3U3KA 2UZ0A 1OLXB 3FPSA 1JAHA 2BAGA 4QECA 1H93A 1E6WA 1KQOA 1PGQA 1RPNA 2AS0A 1RPAA 3OE4A 5JJBA 3PDUA 5AJXA 3AQ4A 3DDZX 3WWDA 4TLCA 4YFVA 4Z3OA 1IEXA 1M0EA 1Y5IA 1Z74A 2G1KA 2VDVE 1G5FA 4NBTA 4DXHA 4BVGA 5GJWC 2P6RA 3MEQA 4Y7DA 2ABWA 3FG9A 2H7YA 1M6WA 2GB4A 1VMAA 1HI9A 1RQPA 1RYZA 1J06A 2XQFA 3EMKA 3FMPB 4E2XA 4FX5A 1E60A 2XITA 3Q9UA 4CV1A 2JGJA 4MRPA 1AV6A 3ROPA 3FY4A 1T9AA 2I6TA 1CRZA 3GPDG 3DEHA 3V1YA 2GFHA 2NNWB 3FYUC 1J8QA 4YJ3A 3QYPA 3CE9A 4IDPA 4DREA 2HJVA 1G5HA 2XUOA 3H4TA 1NVAA 4OJNA 4PBTA 5AM4A 4E08A 3HZRA 4F2WA 4F7WA 4ZMRA 5IFLA 5JLJA 1BH6A 2QL7A 3DV9A 4JOSA 4L5IA 4Q02A 4EW6A 3EASA 2FR1A 2WICA 4LRQA 5C4GB 1HRDA 4GLFA 1DV1A 4WN3A 3QF4B 5DN6D 2C96A 1RRKA 1O97C 3OFJA 2WSMA 1JHMA 3O2NA 4QXPA 5FLKA 5KWEA 1PZXA 1TZ2A 1RPZA 2CVHA 4RM3A 1CRLA 4WBNB 5C81A 2CHVA 2HK9A 1BDMA 4OXQA 3RRZA 5B37A 3UXMA 2HHHB 4NFHA 2VTEA 2ZJ1A 3CUTA 4LZJA 5WRFA 1RXWA 3WQBA 1EFVB 3H5TA 4M6WB 3R3YA 4JHLA 5HDBB 1E96A 3KU1A 2EF0A 3ESDA 1S02A 1MRSA 2PBZA 3VKFA 2ZJ3A 3LWNA 1RPTA 2ZG6A 2P91A 1EM6A 1ZGCA 4P7KA 5FBZA 1DADA 1YI0A 2XQJA 5ICSA 4PR3A 4UEQA 2QTFA 4UBKA 5FWAA 4KO3S 3TI9A 2ZJAA 4FYXA 4ZIRA 5I9MA 3NEJA 5IT4A 3E0QA 2P75A 4RTRA 3E05A 3EZGA 4FCVA 4MMXB 2WIAA 2WUGA 3ANYB 4KYTA 1L4LA 2DTDA 1Z08A 2AI3A 3PNQA 3T7EA 3ZXXA 3KRTA 2GZDA 5CDGA 3HK2A 2CSUA 3DXFA 2FPKA 3HKCB 3A6FA 4OQDA 1IBCA 4OP1A 3W5IA 1G5RA 4OQPA 1JILA 1SXIA 1W5FA 2JEOA 3B20A 2ZKIA 3H9CA 4HQRA 5DI9A 3GB9A 4TTJA 1M74A 3VSCA 5CFMA 5K6RA 2GJ4A 3ONFA 1M0WA 5H68A 5JZVA 4QRDA 1EXNA 2JF0A 1IY2A 5HKOA 2QRGA 2CFSA 1ML4A 3DCIA 4A1OA 1IOVA 4ME6A 4QWMA 1WVMA 4RZ3A 4WPGA 4EB6A 5FPKA 5K45A 1Y1SA 2WSIA 4MR7A 2PYZA 3I0ZA 2BHLA 2HIAA 4R8LA 1L5KA 4ZQIA 4I6GA 2Q1WA 3TEFA 2KX7A 4QYTA 2VWQA 3V2UA 4F4CA 2JB9A 2UVQA 3OF3A 5CFLA 2H65A 4UVGA 3EEOA 1LX6A 2B2XA 3LXMA 3GN1A 4ZZ0A 1A5BB 4ZYTA 2Z4RA 3C3JA 3FLAA 2HGSA 3OIFA 5EIBD 3VV2A 2YKGA 1U2GC 2BEVB 4TUYA 1G64A 1Z5ZA 2QT0A 1M3SA 2Y0DA 3PB3A 1U04A 4XPZA 1GV1A 4B79A 2WJYA 2H3HA 2BHNA 3L93A 2ZVDA 3DL7A 3UAWA 4BNMA 1G8GA 2VFAA 3X1YA 3DMFA 3GPBA 3QG1A 5AXAA 4CM8A 3QLTA 4EOGA 3RIYA 2ZUEA 4PPNA 1YS1X 3V8QA 2A1UB 4JBLA 4PWYA 4E46A 4OGWA 5C5CA 2ZVQX 2GHQA 2ZJ0A 4A0FA 4BKPA 2CK3D 2UXCB 5HPYB 2B6NA 3PLAE 5EP3A 2FHPA 4BB9A 4PRYA 2RJNA 4XGNA 3W2GA 1MJGA 2OOKA 2QJWA 4QXOA 1W0KD 3F3KA 4Z4HA 1F7VA 5D5QA 2ST1A 3EIXA 1GNVA 1DWUA 1ZUHA 1C8KA 4Z2YA 3RS0A 5FWYB 4MUXA 2ZSDA 5ITZA 2Q1UA 1VHWA 4DSUA 1N75A 2OZPA 2OBMA 3TE7A 4KV9A 1RM5A 5CNIA 1ZH6A 1FXWA 1Z5UA 1WPGA 1RJEA 2H9YA 2PEZA 4J4HA 2VPXA 4K6MA 1EK6A 4ARCA 1CIJA 4Z9XA 2F8TA 2H8GA 3WV5A 1WULS 1URPA 1CB7A 1N2EA 1YZUA 2BHSA 2CNDA 1JU9A 3JY6A 2VA8A 1VSQA 3BGIA 1O96B 2EJBA 2OK7A 5F1PA 2V5AA 1TM5E 1KEUA 1P91A 4HZUA 1L5YA 1HV8A 1TO6A 3DDOA 2QTGA 4AY4A 5JCJA 1T29A 1KYIA 2ONZA 1F48A 3MWGA 4AB1A 4E1BA 1JEYA 1QFJA 2I1VB 1Q77A 3PC7A 4LWOA 1E7QA 3G8AA 4PYMA 3SE0A 1PK9A 3P20A 2WQZA 3AR9A 4ZD6A 8ABPA 3ZWBA 1RBYA 1R66A 1I9GA 2IH4A 3VPFA 2YHIB 3CZ5A 1YB2A 5IDVA 4OJYA 3LTEA 4MCHA 1A2OA 3KNZA 1ODFA 5ALLA 1JDPA 1WU8A 1I4TD 5IVIA 1F51E 2R9VA 2SBTA 4QOIA 4JJZA 1TDJA 1I1HA 1YSCA 3IP5A 1Y8QB 4I3FA 2Z8XA 4QWWA 1P0PA 4LJ5A 3UNXA 3ZDCA 1N5MA 5D2CA 3IBCA 1W87A 3V8MA 2AJCA 3LLCA 3KPYA 1P3Y1 2R7LA 2R5FA 2V45A 1NJ8A 3QWFA 1GSOA 1TX4B 4QPDA 3GH1A 2QVXX 2PUFA 4M9SA 3V4PB 5TJHA 1RJFA 2V7WA 4K9RA 4V2UA 1V71A 3LDFA 3VHRA 2WBLC 5BSFA 3P71T 5AKIA 1M5UA 1NG9A 3ZIAA 6ADHA 1OBVA 3I0MA 2PTHA 3NGMA 2G88A 2ZPAA 1CJCA 4OYLA 4O8ZA 1LFDB 1XTQA 1JF8A 2GYWA 3DMYA 4L07A 1RZRA 1WP9A 1SUSA 3IPAA 3LYHA 3LVBA 4O3FA 3ZV3A 3ODGA 1QU2A 5EKXA 3JQEA 2Q4DA 5BSHA 1XVVA 1NLFA 2YH2A 4DR6B 1T1SA 1TT5A 3JQAB 5D5HA 1X0XA 1VGVA 3IIIA 1P44A 4ROTA 3UO8B 1T5IA 2O2CA 3ZPXA 5CITA 4L27A 3BSYA 1SOUA 3B1YA 1YB6A 2WU1A 3D5EA 3MK31 3NV7A 3QA9A 1M7HA 4O2BA 1H3EA 4MA0A 4YLYA 3H4MA 2PL9A 3EGCA 1SUEA 2LBPA 4JENA 4XRGA 3KTOA 2VP9A 1WTCA 4MUGA 3UJ3X 3FPLA 1GQFA 1AN0A 1AHNA 4A0GA 2IWRA 4BX3A 3F73A 3G6KA 3G8DA 4M9ZA 1BVRA 4MPRA 1X1AA 1E0AA 3L7BA 3G2HA 4YNBA 3KAPA 5FTJA 5T3YA 1XZAA 2TMKA 2PL3A 1UMBB 1CUYA 2R8XA 4ED9A 2RHGB 1A9XA 5E4TA 1QCCA 3CNBA 4NDAA 1JI0A 2CDCA 4J0CA 4DBVO 4GZ5A 3DPIA 1E5LA 1S5PA 4P33A 1JIJA 3WB0A 4XSVA 1ENYA 4N5HX 1PWXA 4PPYA 1ODKA 3WZMA 4BNNA 1U3CA 1CUWA 4QFDA 4WMLA 3BMCA 2WHQA 4YRCA 2BMWA 1BSVA 4KYIB 3MGBA 2AJDA 3TUJC 1EK2A 4I8IA 3EAGA 2D0OB 3Q6MA 4FBMA 1WDWB 5FTLA 4PLGA 5E1MA 4WASA 4Z4FA 3BWMA 4YC7A 1FUUA 2C00A 4H35A 4JP5A 3L8FA 2I8AA 4GSKA 1IZ9A 1H3FA 3S2GA 4D99A 5EVJA 4OEHA 2CFIA 3VU8A 4XDHA 3ZGVA 1MJ5A 3VKVA 4FKBA 3IT3A 4EPTA 1E1CB 2JLAA 1XTKA 1TNDA 4PX3A 2P2DA 5FQNA 3VRHA 5JPCA 1L4BA 1VSUA 2BC9A 1NN1A 3BKWA 1XRPA 3B1VA 2W6CX 3CKKA 4A6PA 4KPUB 3ZLJA 2Y93A 5FHQA 3ETCA 1DG3A 1VJTA 2O19A 3ETDA 4MVJF 2X2FA 4AXXA 3VR4H 2IYXA 1ZU5A 1GUBA 3D1LA 1PRYA 2W11A 4G4JA 1XXLA 1RWNA 5KYTA 2Z30A 1KXZA 1XD8A 1XTUA 2FMFA 4D3ZA 5K7SA 1NFRA 5HKKA 4ENTA 2X8WA 5LLSA 5KX5A 2V7XA 3OFKA 4ER6A 3AIOA 2O8BA 2XTZA 2PXAA 3TRDA 1YUNA 5M5BA 1FL9A 3H1BA 1F0PA 1R0SA 1DJMA 3QU2A 3TVTA 1PR0A 3ROFA 3ZJ5A 3R0JA 2XDWA 4EPVA 3HADA 1EINA 2NZVG 4R1NA 2OYCA 3GJQA 3HEMA 3DZHA 3HDHA 4M0DA 4MHSA 5CEJA 1ELOA 1Y5LA 2KI5A 3THYA 1LZKA 5GVRA 1EP1B 1OZGA 5H4GA 3B9PA 3P2IA 1E92A 2XAUA 4P7GA 4C9BA 3KKLA 3E84A 1E2DA 5EKUA 2QTMA 3I73A 4NZYA 3CGWA 4QUIA 1JQJC 1EX1A 4U7PB 4E0BA 4Y7CA 1FNDA 3U1VA 4FOSA 4GP6A 2FUCA 4XX0A 1I1QB 3S2UA 2F1JA 1D0IA 2C5EA 2K7ZA 2YV2A 3PFNA 4HXGA 3PZBA 5CIYA 3BB3A 5KVQA 1JFTA 1R4NA 1TPZA 5IWAB 2ZS9A 3GGJA 3HU5A 4P32A 1U8YA 2I4LA 1XTBA 2EEPA 3KKKA 2QP3A 4MNTA 1SKQA 5IARA 4O3MA 1P2TA 1TF5A 2ZS8A 3O2SB 1NYTA 1ID1A 1X39A 2X40A 3WGHA 1X77A 2JLUA 2B1QA 4QJ4A 1EDEA 3RVQA 1RHRA 3TZLA 1A95A 1DOAA 2BLNA 2HX1A 1YQGA 3LX8A 4H1HA 4LS3A 5FLEX 5KAPA 5J5AA 5BWCA 4YGYA 4MZXA 5GGYA 3DLHA 2ZU0C 5KWJA 2YYZA 4C4XA 4PU0A 2NPOA 1EWTA 4WCFB 4LI3X 4BUCA 3D6FA 4RD0A 2GZ1A 2RK6A 2SKEA 3AILA 1E5VA 3QE0A 4H0NA 4XB2A 5KNLA 3ZN2A 3L7CA 4AD8A 3DF7A 3ES9A 2ZREA 4N9QA 1J1UA 1C30A 3A58B 4DPKA 4YAJA 1AB5A 4JT9A 4IY1A 3RVOA 1K2WA 3TAUA 2KBFA 5CGZA 4YRIA 4IIYA 1DCTA 5B1IA 4R31A 1A1VA 3WOVA 2P3LA 1CJVC 3W4JA 1GQOA 1K75A 3CVVA 3EXG2 4BTVA 2P27A 2FWMX 2IPLA 5CM9C 2A86A 3K2BA 2P2YA 4IX9A 1X38A 4L8VA 2O2DA 2CUTA 4KN9S 2W2KA 4ARUA 4FB4A 3EGDB 1M1YA 5LUBA 4J75A 1Y3CE 1AHPA 3K70C 3FSRA 4E32A 1XXHB 1DDIA 5BWBA 2GPYA 4YRKA 1Z26A 3UOAB 3N8NA 4G01B 3I2KA 1JEEA 2DCMA 2BFPA 4GRAA 4WI1A 2CLMB 4FD2A 3S6JA 4ND2A 4AG5A 3UAXA 4LFBB 1SFRA 3RSOA 2ZRCA 1PBNA 1RHQA 4X65B 1W88A 1PJTA 3GZJA 3ESRA 4PZ0A 2YHUA 3RS2A 3SMVA 4C89A 3ZOZA 3PWTA 4TLBA 4IZIA 2J9GA 5IH7A 2MSKA 2XOEA 2Y1XA 4V3CA 2QZ9A 5FR2A 4UTRA 1I6MA 2HF2A 2AUTA 2JBAB 2OBXA 2QMYA 1M0TA 3M6VA 4EA9A 1KL7A 2QD5A 3IVCA 4ZJUA 3ZDFA 4ZALA 5BUZA 5BQFA 5JMPA 1QGAA 2ZSUA 3R6TA 1ULBA 3G7UA 1O58A 1SBZA 2C2YA 2DOKA 2JVJA 1VSVA 2J4FA 2R6HA 3FMVA 4HWGA 3G8YA 3TOXA 1HTTA 2BFCA 2E4XA 2MSNA 2NIPA 2ZB2A 3AKEA 3W2HA 2IE0A 4QQNA 1ZOPA 4A15A 4E3ZA 1T4GA 1NYLA 3RBXA 4DUZB 5FUMA 1DIBA 1T9CA 3IAM1 4MQFB 3FA2A 3GXOA 3U17A 4DPLA 1LBTA 1RWKA 3VH3A 2XTAA 3GRZA 4QBFA 3THXA 3W5DA 821PA 1HOTA 3PD0A 2IUSA 1G5PA 2XBMA 4IKPA 1SCAA 3PNBA 1BEEA 3MMPA 3Q7TA 4HGYA 5B30A 3BSSA 3S40A 3LCRA 2JIZA 4DWJA 4XM0A 4K9KA 3UHAA 2AH5A 4TL6A 3G2QA 2LW7A 4V0LA 3F6RA 1BWQA 5TJ9A 3OEHA 1IJKA 1FMTA 1L6IA 4QSHA 1E1QA 1GGHA 5IAEA 1Z2NX 4Z4EA 4E2YA 4NZNA 1SQFA 1IDOA 4ASUD 1T13A 2PO5A 4I5FA 1G9XA 4MKHA 3BF7A 1MZPA 2Q8QA 3QH4A 2FR0A 2WIKA 3ZV6A 4OOEA 4AKSA 3N2EA 4FCTA 1ZGHA 2QW1A 4MW9A 1C2TA 1B8VA 1DBRA 4GLOA 1II0A 3X43A 3ZDDA 3K30A 3SK0A 2ERXA 1D9ZA 5ARDA 1XLVA 1QGOA 1O2DA 2XCUA 4GZMA 1O95A 4QGGA 5DGDA 1HZZC 4Z51A 4HDNB 1I2DA 4PC1A 1XDGA 3LC7O 3OG9A 3JALA 4OYYA 4X63A 4E70A 5C8YB 4C7VA 5CJJA 3SXUA 1R16A 1UBUS 1XD2A 1DFGA 5JCPA 4IVPA 4PQEA 4EYGA 1VPWA 1Q15A 2YW2A 1I0ZA 4RGVA 3RAJA 4E09A 2X0JA 1SXJA 2XUAA 1U7UA 4NBWA 1E69A 2FZCA 3VSAA 3IJ5A 3OF5A 4HDMA 5LD2B 2XDAA 4GX2A 4HP8A 2V8OA 5A4DA 1FFWA 1GA1A 2XCQA 3CPEA 1CQJB 3B48A 3BK7A 3IESA 3P97A 5LQCA 4EJSC 1OOEA 1XXHE 3TNLA 3HJGA 3PUVA 2Q1SA 1MJNA 1A27A 5JAIA 3WOHA 3H65A 3RQIA 4HB4A 5I8WA 1PVDA 1G8AA 2YX1A 2I5PO 3O47A 4OKIA 2Y92A 1NY6A 5GPBA 4DR5B 1EK1A 5KQMA 4HB2A 3A1FA 3PVZA 2QN9A 1JR6A 2FDXA 3RREA 2XA2A 2B9EA 2XMZA 1DFHA 2ZI6A 3LX5A 2A0WA 4FYVA 5TX7A 3FOAA 4QOHA 4IV5A 3LY9A 4EJ6A 4QBTA 5G3YA 4OIFA 1OC2A 3N2GB 2NZ2A 5IULC 5B4VA 4N0MA 1QDLB 2ZOSA 3MRTA 1UMCB 4I19A 3R5KA 2YC2C 3SYLA 3DE2X 1J2EA 3EZ9A 3H1PA 3D6JA 1A8IA 1J09A 2I6SA 4DYHA 4ZAZA 2A35A 3W77A 1WXWA 3F5FA 3N58A 2JGRA 4X92A 3RAPR 5GM1A 2NZWA 4P4SA 1SHJA 2VXYA 2QS9A 3I2FA 2JAWA 3GVHA 4CG2A 4GI7A 1NQXA 1RJWA 3NUZA 3WGUA 2C5SA 1YZ3A 5FUQA 1XSEA 1M2VA 4LJ9A 2QQ5A 3K9WA 4MYSA 3AEUB 2WSBA 4AULA 4LZZA 1POWA 1ND5A 5FTKA 2CHUA 2RAUA 3DAYA 3M2PA 2QUIA 4A26A 4K7JA 2O8CA 1YTUA 4YREA 1JDVA 2VHUA 2VP3A 3IHLA 2H31A 3JTMA 1Q19A 4YRFA 3AESB 3DW1X 2BCGY 1M2KA 2QD1A 4ZYWA 1S8FA 1P9RA 3MXOA 1ZNYA 1Z5OA 3HB0A 4CIYA 2WKSA 3T5GA 3CIFA 3SXJA 3C98A 3NBFA 1NPDA 1EFPB 3PHGA 3S99A 2QAGB 3V80A 2DUWA 2FEWB 3NAQA 5AUPB 2WHRA 3LPMA 5D3QA 3VR2D 1QS0A 4FSXA 1J8DA 1NI3A 1I3OA 1II9A 1I3NA 2VT7A 1XRJA 1E64A 4FZ5A 1A9PA 4S1TA 3R74A 8OHMA 2CNWA 2I80A 4A10A 4RK7A 4TXHA 4G8BA 3CZAA 1XDUA 2OMEA 4IX1A 3QVGA 4BVAA 2NU7B 2YUTA 1WR8A 4Q05A 5DVZA 1ZISA 4DB2A 4MDYA 3RU3A 5BQPA 3L9XA 4WKNA 1KK1A 3CTPA 4FLEA 3HCFA 4JFRA 1MKYA 1U2SA 4DJEC 3S8MA 1ZRNA 4IWYA 2O2EA 4AWXA 2E4YA 4URUR 4K6GA 4QYSA 4RPKA 5DTRA 5DU2A 5BUSA 1OC4A 1EVZA 2I7CA 4DJAA 3A6GA 3KAQA 2C7OA 3NANA 2VHZA 3A9VA 3L1JA 3OPXA 5I7FA 5K6AC 2ID9A 4FYHA 5CT5A 3VQTA 3H8JA 1U0TA 2Q5OA 4RCYA 3K0CA 3RCBA 4A92A 1XHFA 2JGMA 1VG9B 5TGZA 3HVIA 4EGQA 2ZBEA 1IPFA 1F9EA 2HK8A 2IOFK 1CD5A 3LT2A 3RVKA 1GD1O 3UHOA 3R6GA 4P1ZA 3WVNA 4EM6A 2ZRPA 621PA 2NVBA 2YY7A 5DNEA 1REQB 5ISMA 4UBJA 3IAS1 3QEJA 2ZUUA 1X6VA 1Q11A 4J7UA 1BMFD 4OO3A 3ZBQA 4D3FA 2BFMA 3IUEA 4RD1A 5EOVA 3BXPA 3N0VA 3CO5A 4JT8A 4FCWA 5JUWA 4UFPA 4UAGA 3TNDA 1ZRSA 3N7AA 3WFZA 4L9AA 5J1TB 5GOTA 4UHKA 2BSAA 1HG0A 3ELDA 3GD5A 4TT3A 1U8ZA 3H1GA 4LNAA 5JNUA 2OCXA 1V9LA 3BREA 3G0DA 3ZTYA 3AHDA 1UJMA 4C0SA 4TKMA 3T7SA 2QAIA 1PT5A 1BU8A 2BONA 1I4EB 4ZOCA 5DBFA 1DOZA 2FZLA 2H7VA 1N0WA 4MV0A 3W8RA 3OOWA 2C7RA 3VPAA 5BMVF 1E4VA 5IYZA 1BX1A 2V8BA 2GK4A 5AM1A 2I7VA 1NF2A 1WPRA 1ISGA 4HAXA 1RHMA 4HQ0A 2HA0A 3R7WB 3KEQA 3ZHVA 2HNAA 3R4CA 4LG1A 3OX2A 2AD1A 2VTDA 4HPJB 4KIFA 4JVSB 3HHPA 5BQ3A 3L8EA 1DO8A 3MSXA 1AIPA 2R1VA 4Q47A 3RYIB 1FMFA 3AB3A 3ILHA 1I7PA 1QJ4A 5K09A 3VM6A 1PFGA 2IYNA 3SQLA 3PNPA 1QYWA 3K53A 1U31A 2R8ZA 4TV8A 1KDYA 1JFRA 2Y1OA 3K35A 1H5NA 1USVA 2GEUA 4X45A 2NO4A 1WXIA 4Y2PA 4IXNA 4O2AF 4U7HA 1T0IA 4UNQA 2WQ7A 4ETNA 4R0MA 3AR7A 4TMYA 1DE0A 1M2JA 2IFTA 2EJUA 5CA0A 2F1KA 2BRUC 1UK8A 10MHA 2VSOA 5GMOA 5GONF 1UM8A 3U39A 4DQKA 2ZKLA 4PW0A 3L8CA 2ZRAA 3DYBA 1BHO1 4KUHA 5CM2Z 1G8KA 3MSCA 4HEJA 4CE6A 2W2NA 1HYQA 3CXUA 1CZLA 1WL8A 2GEFA 4PF1A 3ZHOA 1IWBB 2ODQA 1UAYA 3I23A 1DMSA 3GUHA 1H1LA 1V1JA 4WEQA 3WHIA 4IYRA 4GD3Q 3KD3A 1HLFA 1A9ZA 1NZDA 1U28A 1XJQA 2D5BA 2WJJA 3OKAA 5E1BA 2IDMA 1QX4A 1HEIA 2B98A 4US1R 3RW9A 4UDXX 1R8YA 4CKYA 4UHFA 1ODIA 1PZNA 1UJ6A 2JJMA 2XKAA 4MI1A 4NRDA 3ND9A 1CQPA 1ST2A 2CCJA 4RY9A 1ICIA 5DLPA 1S2MA 1DC3A 4M9UA 5T4HA 1CW2B 1RWBA 1I30A 2OZLB 2QTRA 3OHMA 4IJ6A 4O4JF 5JJIA 4PO3X 3GN2A 5ITVA 1A72A 2XCLA 5T4FA 1LBIA 4D4MA 1CHDA 1AUXA 3Q87B 3HVKA 5FR1A 1II8B 3A8TA 2WUVA 4JBGA 4GR4A 4JYCA 1TCBA 4MHOA 1BXKA 2HMWA 1NJ2A 3SDZA 3C15C 1BE0A 4DR2B 4B40A 4ETWA 3MB8A 3IAUA 1XWWA 2VK1A 1Z8NA 2GBCA 3TQIA 2ZETA 4LV6A 1ZD9A 2VNKA 4EGSA 3RF7A 5KTYA 2DKFA 3NR2A 3OWXA 1AG9A 1F12A 1K7FB 1MJHA 4G9EA 4QYXA 4RCZA 5ARBA 2GJAA 1TTTA 4BFUA 1YUMA 3A1NA 3Q11A 3TZBA 4L73A 4PZ9A 2I2XB 4QG7A 4DWWA 4N1AA 3PC3A 4IUYA 5JAPA 4IIJF 1QTIA 5G4KA 2G17A 5DNDA 1XVUA 2CZGA 3IGFA 3M49A 3H1EA 4XQCA 3RVSA 1ZPDA 4ZJPA 4NXNB 5DBOA 3T9DA 1NR1A 4NBNA 4XPIB 2BY4A 1XZCA 2HRQA 2G0AA 2I1LA 3HBAA 1DXOA 4WZBA 4D46A 1Y7LA 4L22A 1AMNA 4FN4A 2I2WA 2K6GA 1C0PA 1YZFA 3UK6A 2J31A 1EUDA 1U7ZA 2C2OA 3CX6A 4DPMA 5AKYA 1CFJA 1NBWB 1ZK3A 2QZ4A 4GM4A 3AT1A 4QT0A 2ZJFA 5AOVA 3WXBA 3Q41A 2NPFA 4US2R 4JK3A 3GX1A 1SCJA 4PXYA 3QX3A 1NSYA 4MRNA 5D6NA 1D1QA 3WMWA 1FP4A 3N0RA 2FA9A 1IU9A 1DKNA 1W36D 4CKBA 3ZE8A 2CFCA 2GJSA 3CVOA 4DMRA 3OOEA 3WIEA 2VOJA 3OJFA 2RSLA 3C5EA 1EM8B 4JBIA 3A9CA 3K9QO 2C3YA 3NS7A 4D8VA 4P3NA 4M1SA 5IP5A 1P61B 2QMZA 3GLFB 4RVOA 5EE0A 2GTIA 1E2UA 3MQ2A 5IPFA 3F1LA 3TFQA 2YZ2A 4M0UA 2J4DA 2OV6A 4OAQA 4RENA 1BW9B 2JD2A 3E7PA 3ULKA 1ULHA 1M1NA 3F3SA 1DNPA 4B4OA 2QRHA 4YI3A 1QPGA 4XD7D 4EI2A 3F90A 4NXMB 1C1DB 1CB0A 4TSFA 3W1EA 5K8UA 1L7QA 1WZUA 3Q0EA 1DTWA 5EP4A 3OQIA 5EMMA 4L4ZA 2JDID 4WNAA 1OFHA 2ZK7A 1KAGA 3TW4A 4D6YA 2NUAA 5MFZA 2AK2A 3A4NA 4MJ3A 1IIBA 4MKGA 4W7IA 1M1ZA 4P4GA 1A8UA 1NOIA 2XQIA 1YVPA 4OHUA 3TRHA 1KS9A 2NUPB 2V65A 3GA0A 1E79A 5AICA 5KSOA 1QGUA 2EGGA 4IDCA 4KO8A 5CYFA 5EESA 4Q6BA 5SY6A 4BBPA 1VIAA 2V7TA 3N87A 4BV8A 1L5RA 2F9FA 1CY2A 2RHJA 3VNAA 2UUOA 4CM1A 5KYXB 1NQ5A 3B1XA 3OJ0A 2EYQA 2WF9A 4MS3B 2XMQA 2YY5A 3HYSA 3AJEA 4Z9FA 4N47A 3V3KA 3CUWA 3NDRA 1WHTA 4NCHA 2IGBA 2I67A 2PH3A 2NSDA 3DZ8A 3LXUX 4CMGA 4D4HA 5JRZA 4WFKA 2IYLD 4TYPA 1A5AB 1K2VN 4B82A 2ZU6A 3DAPA 2QXUA 1N2SA 2NO9A 3K8YA 4ROSA 2PKYX 4RXTA 1W4BA 3WNDA 3U56A 4COKA 1VDZA 2EFHB 3LO8A 3S2FA 4JLUA 4TZKA 1AQIA 3T5PA 2DT5A 1BX3A 3FGOA 4E5NA 4QQ8A 4DIKA 3G2NA 5L4LA 4F2GA 1WCWA 1JJAA 1G4UR 1L4FA 3MCUA 1WY7A 4MB6A 3KB6A 2YN2A 3P9XA 4LTDA 5GINE 1SEVA 1R6AA 2VJMB 4BUZA 4CHTA 2EXXA 2OCPA 2R8OA 2DKNA 1FYFA 4NOJA 3ROMA 1L7VC 3PR3A 4LGCA 4NH0A 4X60A 5FJJA 1C9NA 4INPA 1GLGA 5DTEA 2Q49A 4BC1A 4B8YA 2F1HA 4C2BA 4JKYA 1AKYA 4FYJA 4EW2A 4XA8A 3SHFA 5KYUB 4XCVA 2WFAA 2R7NA 4PX5A 4R9SA 4GNRA 4F1JA 4LQ4A 1UJCA 1ZUNA 2VBCA 1OXTA 3KXKA 1JPJA 5LQAA 1QVVA 3MJFA 4MZDA 4NI5A 5U9CA 3QA3E 2WYWA 3P19A 3QMWA 1WQ1R 1E6CA 3U9SA 4ZI3A 5EJ2A 2RHOA 5ALMA 1OA1A 4OFWA 3ZE7A 6REQA 3G02A 1S6YA 2BUCA 1ID8A 3INGA 2QOEA 1WOMA 1GQYA 2R6GA 1QYRA 3L6DA 3OMLA 3HR7A 3Q5DA 4HB3A 3WMGA 3QFSA 3OJWA 1TO2E 3TNYA 1JEJA 1U0FA 2DUMA 1T0UA 3HZOA 4RJIA 4E22A 3GFTA 4CF3A 1M8PA 5TVKA 3W5UA 1BCSB 3BK1A 4BV2A 2CJFA 3PFBA 3PSAA 5JBQA 4GS5A 5TR9A 1WD5A 3SSAA 4NWIA 1EBBA 1X70A 2RHWA 4UHEA 1Q7CA 4GOMD 3HRIA 2IIPA 1EJ0A 1G291 3C85A 3QHQA 3QPDA 4MR8B 4M8SA 3P7MA 3BFKA 1SIBE 3DBIA 3F0TA 1JKJA 4ZP1A 3SEZA 1DEAA 1CUZA 3A9WA 4FFDA 2H4ZA 3C2QA 4I1UA 4JR2A 3EIEA 3Q7RA 2E5WA 2PANA 2HDOA 2PCJA 2Q07A 2BT4A 4HWTA 4X8HA 5LWHA 1WXGA 3UHFA 3FXAA 2C2XA 4XCQA 3P0IA 4DARA 2EWVA 1ORHA 3VHQA 5JSUA 1CTQA 5C5IA 1DIOB 1XRQA 2Q99A 2OXFA 3AFHA 4HEA1 4RIGA 5NULA 3GT7A 3L0IB 4LUCA 4TTIA 2JCXA 3IODA 1RXYA 1ZYUA 2YVKA 2R6FA 1IIRA 4HNRA 5DSZA 5TV2A 4K9QA 5CDHA 3PQFA 3P4YA 3UMYA 2AOWA 1GTZA 4HAYA 3UT6A 5JNTA 4UQPA 2EARA 4FN5A 3NIBA 4W8GA 4S0ZA 1GYRA 1P18A 5AM2A 1WUIS 2PRJA 1WMBA 4EO9A 1VM6A 2YFQA 3HI4A 4KK3A 4F85A 4LYGA 1O9BA 2CY0A 4D9KA 3TJZA 1ZVVA 5L4NA 4DDTA 3L7AA 3NC1C 4MQBA 1MW8X 4JKIA 3ST7A 4FDUA 2ASVA 3U09A 1D2AA 3ASVA 5TLSA 5ALOA 4OM7A 2PPVA 1VI2A 5JISA 1T36B 4ZANA 1SXGA 1GCIA 4MVJM 2R66A 4R98A 4IEIA 5IAJA 3UMRA 2W37A 1QVAA 2D4AA 1EVIA 2HQ1A 1D2RA 5BV2P 3IL2A 5C2JB 3EQ2A 3P94A 2NV0A 2XE4A 1U1EA 1CE8B 2BGJA 2QSUA 1WWKA 1TC1A 4WZZA 3STWA 3DHVA 3NBZC 3VR3D 1ODTC 3ZWVA 4ZYVA 3ORHA 5AI9A 5BORA 4LOHA 3WLHA 2ISQA 2JGDB 2D13A 5K2OA 4PSVA 1B8NA 2VPZA 4NYIR 1CYDA 5HIAA 3UPUA 5FNVF 4UMFA 3QKWA 1SVKA 3EGXA 5IWCA 1KH2A 2IIVA 4XGKA 3HDVA 3FSGD 5FAXA 4JI7B 1K7YA 2GUWA 1OX6A 4UAVA 1LDYA 1Y5NA 5JHHB 3E22A 5I7OA 3VTAA 2OLJA 5KEIA 4ZI2A 1GTVA 2EX0A 2LP4Y 1OWPA 5A05A 1N6LA 1E2GA 1O54A 1VZ2A 3E8MA 4CFYA 4GGOA 4ZEVA 4L3VA 2XNJA 3HUFA 3H8VA 4FFMA 1XEWY 3MGGA 1W94A 1SRRA 3GQBA 2WTBA 4IR7A 2WW8A 1TYEB 3ZV5A 1J22A 1Q44A 1XCBA 2BFFB 2XUPA 5HW0A 3ZY5A 3RJ9A 5HQ3B 3ELBA 3ERCA 1E0SA 5K3SA 4ENPA 2JH8A 1JQLB 3MUNA 2VTKA 4D97A 1YJ8A 8ADHA 2WYVA 5I7SA 1RQXA 1UPFA 4NE9A 4JJIA 2AL7A 4JEMA 4PYOA 5H3LA 5D00A 2C9ZA 4PGFA 3W9UA 5DYIA 3WS7A 3HBJA 2E55A 1AKVA 1GNPA 4KXMA 5LYJF 1TMKA 3P9CA 4LOKA 5J4YA 2A0KA 1FFSA 1WO8A 3PXCX 3PQ4A 2N0SA 4K9OA 2CDRA 4R2WA 4RJLA 3VPGA 5A4MS 4N0QA 3GLIB 3FOZA 1F6WA 3NATA 3HPQA 1X1RA 3NTUA 3UIEA 2NO0A 1VE3A 3UWMA 2PUJA 1OBFO 1RE0A 4B84A 1TM2A 3TTVA 3E9RA 4NJEB 4E5KA 5JWRA 4FEAA 1M2OB 2OKGA 1F4LA 2GWHA 4S3MA 3TJRA 4Z4GA 1EWKA 4ZPJA 5KDOA 4MCJA 2ATIA 1MV5A 1IFXA 3AUAA 3WLTA 1EE1A 3CY6A 1D7AA 2ZYAA 1A96A 4NY1A 4AJ9A 1R0WA 2GILA 3AYXB 1CG6A 1PDOA 3ZD6A 2OMKA 1UMKA 3EDOA 3R9KA 3ZQ6A 2CJPA 3DHEA 3S4YA 3BIOA 3PWSA 4GE0A 1HQCA 2WJ6A 2W4MA 1ACLA 2C5LA 2HLDA 3L77A 4Q3CA 4MJXA 2FVYA 5FIUA 4DHWA 1P4JA 1ZM9A 3K0BA 1JG7A 3A06A 2AFHA 4XYEA 5CLFA 5JYBA 3CUUA 1Z45A 2J46A 3BUSA 2MCFA 4JLKA 2FSHA 3C3CA 3ZWQA 5LP6C 5KMGA 2P8JA 3N7UA 1WHSA 2OHIA 3WWPA 4RABA 4MH0R 3ZGNA 2NTVA 1KORA 4JJEA 2XIJA 1JEDA 3ILVA 1HR0B 2P9GA 4I5GA 4TMTA 4D0RA 1DGQA 2PX8A 2V9ZA 3DVAB 4ZVVA 2C5AA 2RHBA 5A7HA 3TKLA 2Q6LA 4EY6A 1G60A 2AG5A 2BKLA 3NIDB 5DBEX 2A5FA 2BCEA 4EUSA 1YJ5A 3SLRA 3FYSA 3MWKA 4N0EA 1MABB 3PJEA 1J1IA 1NW8A 1G21A 1XOIA 2X58A 2VLIA 3QYFA 2GBFA 3N1UA 2ETXA 4WJKB 4DLAA 5KOJB 5KNDA 3QLVA 1USKA 3BDIA 4L50A 2A5LA 2DEUA 2XWSA 2HUPA 3G89A 4JUFA 4RTNA 3ANSA 4ND1A 4I14A 4NBVA 3TLJA 4G97A 5E7QA 1LI7A 3KUKA 5H3HA 4K9MA 2ORIA 2ZI7A 1VLJA 2ADOA 2H5JA 3V7WA 4C5AA 4K0RA 5JMTA 2HI0A 3EYAA 3V9PA 4CN9A 1DEKA 3OJCA 2VT6A 4JB0A 1KAHA 2Q6IA 4A36A 1WUTA 1DJPA 2V3WA 2IUYA 4FPXA 5HTOA 2ID8A 1EG2A 2O52A 2LNDA 1O94C 1F2VA 3IAAA 4LDRA 2I34A 1VL6A 1U2PA 2F1IA 2QUJA 3PFFA 4PNHA 1TPYA 2VAPA 4HH0A 5F4BA 3RT9A 3ZIDA 5I3ZA 3SJBA 5DJ5A 2VN8A 4UDYX 2NU9B 3O1HB 3FN4A 4TXLA 4TRJA 2C0PA 4KODA 1XYYA 4F3NA 3DAOA 3PUYA 2DHQA 5J2TB 2Q3EA 2VHCA 2XMPA 1LBQA 1I6LA 5EQDA 3GLIE 1ZGGA 5ANRB 2RBKA 1N2HA 4KQ1A 2RONA 3FLMA 3AI3A 2AC4A 1M6VA 3RJ5A 4JQCA 1PT8A 3MRSA 4YDSA 5HF9A 3UAZA 3V1LA 3QP9A 1WDTA 1B7GO 2FPMA 3K1ZA 1HDRA 1J33A 3NX4A 3CKYA 1Y1TA 5HE8A 4GH5A 4ITUA 3AHJA 1NI4B 3VISA 1E5TA 3WWYA 4C7XA 4K3UA 1UP4A 2PUVA 3FPKA 4H4DA 1FNCA 3RANA 4DIOA 5K8IA 1CY6A 2AUNA 1FTGA 3F3MA 1GKIA 4L95C 3BB1A 3UAVA 3LT1A 4BZXA 3OU7A 3EVFA 3CNNA 3SZ3A 2QM3A 4R7GA 1XA0A 1QHGA 3AR3A 3KYCA 3T1NA 5HK9A 5I7HA 4U7TB 3CBQA 4CLOB 5JWOA 5GADl 1BCRB 3BGDA 1IXSB 1BHJA 2QPLA 3FHTA 2FPIA 1PDWA 5KSWB 3P9ZA 4LSWA 3VR1A 4ZGBA 3UWSA 3FKSD 4Q3OA 4Y6LA 3C6KA 2P6NA 3REGA 1FXUA 3U40A 1IMJA 2WWGA 2ZTMA 3GJ8A 3TTUA 5JAQA 5EQJB 5JVDB 2OA0A 3BD7A 3IPXA 1SC1A 1OKKD 3D3WA 4CL2A 2C94A 2H08A 3HGQA 4L2IA 4R69A 1FK8A 2C3UA 2VBIA 2CLDX 2R65A 3U4IA 5BQ5A 4Z4QA 5EYPB 2IYQA 3UK0A 3D02A 1UPBA 3O5AA 1ZW6A 2CV1A 2AN9A 3ZY2A 3O4GA 1IYZA 4XIJA 2XXJA 3W2EA 1Z4NA 5ER9A 2Q1XA 2LUOA 4FSDA 2CWWA 5HJ2A 1WDMA 4LVCA 3EFOA 2CYAA 3IVRA 3UB4A 5EAIA 4RSHA 5AOAA 3SFZA 1G18A 3R5FA 1QWSA 4D9IA 1XT6A 4CKXA 1H2RS 3TZKA 3COZA 1AQYA