3IAS2

Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, oxidized, 4 mol/asu, re-refined to 3.15 angstrom resolution
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
178
structure length
178
Chain Sequence
FFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHLQVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAGKRLEEIELPGKCGHHVHEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-quinone oxidoreductase subunit 1
publication title Structural basis for the mechanism of respiratory complex I
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 50
structure length 178
sequence length 178
chains with identical sequence B, K, T
ec nomenclature ec 1.6.99.5: Transferred entry: 1.6.5.11.
pdb deposition date 2009-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01257 2Fe-2S_thioredx Thioredoxin-like [2Fe-2S] ferredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1590 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3ias201
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3ias202
2DLXA 1JZOA 4KDUA 4K0GA 2E2GA 1B9XC 4WF5A 3IR4A 1RQMA 2R3XA 3D0ZA 5AIXA 1N2AA 1PKZA 2GGTA 3GRXA 3TOTA 1KTEA 2VLUA 1R7HA 5J5NA 2R4VA 2IFQB 4HJ2A 1TK5B 3GH9A 5KN2A 3PH9A 3IPZA 1EP8A 1AXDA 1GRXA 1SKRB 2HI7A 3I6AA 1NHOA 5IIZA 4XIHA 3ISOA 5IMZA 3KP9A 2RUFA 3LWAA 4F9ZA 1GTBA 3KH7A 2P0GA 4MDCA 4BVXA 1DUGA 2JADA 1F9MA 1XOAA 1THXA 3TKSA 3QDNA 1PMTA 4TR4A 5ID2B 4TXOB 2H75A 1X5EA 1GSYA 2GZZA 6GSWA 3DVWA 1U87A 2MMNA 4HS1A 1A2MA 4OO5A 3FR3A 3W8JA 3HZ8A 4LMWA 5LCZA 4JU5A 1I5GA 1FG4A 2XBQA 2XBIA 5DBQA 3IA1A 6GSTA 2RM5A 3WGDA 2FCHA 1F3BA 4V1Ap 1TDIA 1GSUA 1OC9A 2HSHA 2CX3A 5JCWA 4MF7A 1GSDA 2YWNA 5CAXA 4I2UA 2CZ2A 1MDJA 2CX4A 1Z5YE 2LUSA 3KEBA 2R6KA 3LXZA 3QAWA 20GSA 2HT9A 2C1YA 4EVMA 1NW2A 4H86A 3GIXA 2KP1A 4I97A 3VFIA 5IM9A 4BVYA 12GSA 4NV2A 2VL9A 3IXRA 4YQMA 3F4TA 2JL4A 2NDOA 4K9ZA 1XIYA 1M2BA 4JE1A 3Q18A 2KUCA 1XW9A 4PQ1A 5KN0A 5DCGA 4MZBA 4XS4B 5LD0A 1O73A 4E8HA 5B7CA 4QQ7A 5CRHA 4IJ3A 4J56E 3BBYA 5GSTA 3L4NA 3MWHA 2B6MA 2F8FA 3KZQA 1FHEA 2CVDA 3CTGA 5KN3A 1ERUA 1SJZA 3EURA 4F0CA 3F4SA 3VWVA 2ALBA 4NAXA 3MAKA 2IPAA 3KGKA 5EY6A 3EC3A 3TCOA 2GT6A 2DJ3A 3F3QA 3DYRA 3F3RA 1TOFA 5INYA 2HZEB 3F6DA 1K0AA 4ZB9A 2LNSA 5G30A 2CV4A 2MBTA 1M2DA 3FK8A 1FOVA 1MTCA 1TU7A 4MABA 3HY2A 3ME8A 2C0GA 5IMCA 1J0FA 1C72A 2LKUA 1M99A 1EP7A 1N8JA 4BA7A 5KEJA 3QD9A 3ERFA 2YWIA 3P90A 2MMZA 2YZUA 1GNEA 2H0GA 3WGEA 5D9WA 2DC5A 3G9BA 1M7TA 5HFGA 3TJGA 1YKCA 3M1GA 2MBSA 4XS6A 5IMDA 2F51A 3F6FA 1TI3A 1Z6MA 1VGLA 4TOPA 3DMLA 5CREA 2VLTA 4MP4A 2H1DA 1VF4A 2CVKA 4IVFA 3VI5A 1A23A 2YWMA 2XC2A 4CW9A 2DJ0A 3TJFA 3VK9A 1U3IA 3LFLA 2C8UA 2IMFA 1OKTA 1PL1A 1TU8A 2WRTA 5D9TA 4TR0A 4EE0A 2FUG2 2GVPA 3QR6A 2X8CA 4KSMA 3HVVA 2B3SA 4L0WA 3GTUA 4MPGA 3O3TA 1B4QA 2AV4A 1EV4A 3IHQA 5F07A 2FA4A 4BL7A 4F2IA 4ZB8A 1T00A 3E3EA 9GSSA 4KCAA 2JSYA 4N30A 2BJXA 14GSA 2HXKA 3LYKA 3DXBA 5COHA 4V2NA 5D9XA 2AJQB 4F82A 3ZMLA 10GSA 2GQMA 3BCIA 4N10A 1K0BA 4TR1A 2P31A 4ACSA 1XZOA 3HA9A 3H93A 1SD9A 1JHBA 4MLYA 5JCGA 2LQQA 1V57A 1F6MC 3APOA 2VAFA 4MJEA 5IMFA 1V98A 2X8HA 4PURA 3TRPA 3H8QA 3TKPA 4MJBA 4HU9A 4J2FA 3CTFA 2YOIA 3FYGA 3IRAA 1O8XA 3A2XA 4MA9A 4KA0A 2GSSA 4EF0A 4LA1A 4ZL7A 2H6ZA 2NBSA 2C3NA 4I6XA 5GZZB 1GTIA 3HDCA 4Q5RA 1SYXA 4YQUA 1LJRA 2WCIA 1FO5A 5EL8A 2O89A 1Z9HA 4ECIA 1XVWA 1T3BA 2IWTA 8GSSA 3TJBA 3UJ1A 1ERWA 2FLSA 4POLA 1TXXA 5DQSA 4TVEA 4WBJA 3WGXA 2GZPA 1GLPA 5DJMA 3J7Yb 4ECBA 2EC4A 3LORA 1Q4JA 2JSZA 2LNTA 2H6XA 4KDYA 3GL3A 5DAKB 4GTUA 4TKYA 1K0OA 3G7YA 3M3MA 1A2JA 4AJ8A 2HSYA 2YJHA 2A2RA 5ENUA 1UC7A 1YZXA 4K7NA 1JZRA 2NVLA 5E4WA 2OKAA 2L5OA 1GWCA 1X5CA 2N5FA 4KB3A 5B6MA 2IFQA 4N11A 1J9BA 4WR4A 4FYCA 4POBA 3QFBC 1X9WB 4IGJA 1XWAA 4OFTA 2O85A 3IK7A 2LJKA 4CDOA 3HVXA 2GQLA 1TI1A 4D73B 5H5QA 4ZBAA 4KX4A 3D6IA 3KMNA 2OE1A 4E8EA 3U6VA 3UVTA 1OC8A 2FA8A 2TIRA 1B48A 3PGTA 1QUWA 2B5EA 5G5FA 2JZRA 3D4TA 2PMTA 4K0NA 4TXOA 5ID2A 2VD0A 4JR4A 4EO3A 1F3AA 4ZXGA 3F0IA 4IW9A 2JZTA 5ECHB 4MJCA 3VWXA 1U6TA 3TOUA 4X1UA 5JCUA 3QCPA 3WT1A 17GSA 1GNWA 3P7XA 2I4AA 4HZ2A 2H76A 1O8WA 2WJUA 4FYUA 4OFMA 1AUCA 3H4KA 5DDLA 2TRCP 1G7EA 1TRUA 4Q5NA 2LRNA 1IYHA 2LQOA 1AW9A 5FT3A 4GXZA 1URMA 1MD3A 2PVOC 4K6XA 1PA3A 3GX0A 2JZSA 3BOAA 3L78A 1GP1A 1BYEA 2PU9C 2VCQA 1U88A 5DJLA 1VF2A 4HEA2 2H70A 3F63A 1WRYA 3RHBA 5IO0A 2H8LA 2PERA 6GSXA 3ZIJA 5A4WA 2V6KA 4MCUA 4P3YB 4IBPA 2VCWA 2EIRA 3PINA 1SENA 2VL2A 3VWWA 1GTAA 3VLNA 2VCZA 2KOKA 4I5QA 5IO2A 2I1UA 1WIKA 2B7KA 2GTUA 4MJAA 1J08A 2D2ZA 3TKRA 4NPBA 1FVKA 5AN1A 4XS4A 1OE7A 1E6BA 4AJ7A 1X9MB 1AIUA 4WETA 3A2WA 2HRNA 2H71A 3LEFA 1O6JA 3ZYWA 4GQCA 2F9SA 4IP6A 4OD7A 5IOXA 1EGOA 1M2AA 1DE2A 5G5EA 3S9FA 2H19A 1BJXA 4K2DA 4POKA 3KD0A 4K7IA 22GSA 1ST9A 2VOCA 2IMEA 11GSA 3APQA 3AY8A 4IJIA 2OA7A 2CZ3A 1UA5A 3CBUA 2CT6A 3DEXA 3F4RA 2C0DA 2HZEA 1SYRA 1TK8B 1ZL9A 1ACVA 1VF3A 2LJRA 3CYNA 3RPNA 3FZ9A 1S3DA 2N5AA 2R5GA 4QL7A 4OCEA 3FR6A 1WJKA 3R2QA 3M0FA 4MH3A 4GF0A 3GHAA 4MZWA 3EMPA 5D93A 2V2GA 3C7MA 3IE3A 2I81A 1EV9A 4TN8A 5DALB 2L5LA 4L0UA 4EDZA 2J9HA 5G1KA 5G1LA 3GN3A 1XW5A 1VRSD 2CA8A 2E7PA 3QOUA 3TKSE 1SL0B 1W89A 1FVJA 3UEMA 1OAZA 4KGIA 1TW9A 4N0VA 3O6TA 5DQYA 3UBKA 1BX9A 3TGZA 4MMMA 4O7HA 4LMVA 1PRXA 4WR5A 3GSTA 1PD21 3KXOA 2PUKC 3H1NA 2N5BA 1HNBA 3ZITA 4K7OA 3ZVJD 2MZCA 2FHEA 3NZNA 5H5SA 1TRSA 4WKWA 2CAQA 13GSA 1ON4A 3ERWA 2L4QA 1BQ7A 4GCIA 1KBNA 4XRDA 3GNJA 5ELAA 2B1KA 1GUMA 2VCTA 5IMAA 3CXGA 4ML6A 5AISA 5B8AA 5J3RA 4AJ6A 1SL2B 3GUSA 2QC7A 1MDKA 1A2LA 3ZIVA 2DJ2A 1ZOFA 4RI6A 5JWQB 1XPVA 4ML1A 3VWUA 3EVIA 2H0IA 4HJMA 1XW6A 3PR8A 5ECRB 4RQRA 1AAZA 2YANA 1YKAA 5DVBA 2QKEA 4KDXA 2B1LA 2FD3A 1B4PA 1PKWA 2L6DA 4TRXA 5IPGA 3ZFLA 3NIVA 1XXUA 3LYPA 3ERGA 4EC0A 4L5OA 1EEJA 1K3LA 3GH6A 1FW1A 1R4WA 4BWSA 4XCSA 2YWOA 4ZB6A 2AHEA 5ECQB 1ML6A 1GUHA 1SJ6A 2ON5A 3GSSA 3DD3A 3TKSC 3Q74A 4NXIA 2C80A 2M80A 1V9WA 1I9DA 3C1SA 1PX6A 1ZYEA 5J4UA 3HKRA 4HU7A 4GSSA 1OVNA 3FHKA 2GT5A 2PN8A 4F0BA 2MYGA 3RDWA 1UN2A 1YDKA 3M9KA 1NM3A 4O92A 4LLRA 7GSSA 5JWRB 2JU5A 4KH7A 5KN1A 1YEXA 1YQ1A 1WP0A 3MNGA 5CRWA 1TRVA 2GSTA 4DSSB 2BMXA 2VIMA 3D22A 1G6YA 5ELGA 2LRCA 4NV5A 4IS0A 1KEBA 2I9HA 18GSA 1PN9A 3TRXA 1GUKA 1A8LA 2E0QA 3GFKA 5DAKA 4WEYA 4MH2A 2GLRA 2WZ9A 2GS3A 2VUPA 6GSVA 5D9VA 3SWLA 4IN0A 4XRAA 4CHSA 4KNDA 1JLWA 4BWQA 1Q98A 2LJAA 3QAGA 3IBHA 3GKMA 2QGVA 1TJDA 2P5RA 3HJMA 5F8BA 1WMJA 3HYPA 3HCZA 2C3QA 5FWGA 3ZZXA 2FNOA 2IIYA 4D73A 3A5WA 1B9YC 4EXJA 5L71A 1YF1A 1X5DA 1XWKA 4K1FA 1Z7RA 1B8XA 3Q6OA 2VM1A 4JEDA 3LXTA 5HR3A 5B8BA 2WFCA 1SKWB 4DEJA 3ZLPA 4LL4B 1A24A 3D4MA 1M9BA 1O81A 1ZGNA 2VLVA 4OMVA 2H66A 2KHPA 4RUVA 2BTOT 2V32A 3D21A 1VF1A 4DSRA 4EDYA 2IJYA 4X0XA 16GSA 4JR6A 2ON7A 1X0RA 4L8EA 4RQXA 4XS1A 5G2ZA 1DBYA 3KTBA 2LEGA 1H75A 3F9UA 3OR5A 1O7UA 3VURA 5CO3A 4GLTA 5E59A 1YF0A 6GSYA 1T8EB 3HVSA 2HE3A 1QK8A 2FY6A 3N5OA 2HRFA 4NHZA 3IDVA 2OACA 2EIQA 5A4VA 1GSFA 2L4CA 3LG6A 2LRTA 5FHIA 2MMOA 3GX8A 4GWRA 5F0GA 2RLIA 2ES7A 1OC3A 4IP1A 1XBSA 2AYTA 4ZBDA 3ZVJA 2EIOA 1OKDA 4IQAA 4KE3A 3W6GA 2WB9A 1SU9A 3HJOA 2HNLA 1GTUA 4XTSA 2PVQA 3G7IA 3IOSA 3C1RA 2YV9A 5ECSA 3TJJA 3DGQA 3IAS2 2MMAA 1XFLA 2RUEA 2XPEA 3DVXA 3TB2A 4PQIA 3C8EA 3GL5A 3WD6A 4YAVA 2X8GA 3BD2A 5F06A 4KUNA 3KIJA 4ZL8A 3DRNA 3LSZA 5CRGA 4ZBBA 2GDRA 5ECIB 2HZFA 2H6YA 4IHUA 2FWGA 5ECPB 2GZYA 1E2YA 1X9SB 5ABRA 2AUVA 3EYTA 5IOWA 1Y25A 5GAPD 1KNGA 2XPDA 2F8AA 3GV1A 1GL8A 2IL3A 3BJ5A 4JZQA 1OE8A 2GSQA 1JLVA 3IK9A 3GMFA 4MPFA 2VCXA 1FB0A 3TKQA 2IN3A 4O32A 3FY7A 3KM6A 4IKHA 3LJRA 4KCEA 2CAIA 3H79A 1QQ2A 3C71A 1HQOA 5ECKB 1ZZYA 5ECOB 2X99A 3LQ7A 5DALA 1AQXA 4HZ4A 1THOA 5IQYA 5J41A 2A2SA 2K18A 1G7OA 2X64A 1T4ZA 2OJLA 2TRXA 4TXVA 2IMDA 4O5RA 4V2LA 3EE2A 4NMUA 2PBJA 2DIZA 2V41A 2CVBA 4HI7A 2O87A 1SD8A 3G7JA 4HUAA 4QL9A 3I43A 1M0UA 4OCFA 4GRFA 4FYBA 5D96A 2DJJA 4NWYA 2LTKA 1WPIA 1GSQA 3A3TA 2HLSA 1QGVA 3KTLA 4PUAA 2LS5A 2V1MA 2PPTA 1NSWA 2VO4A 3VI7A 2VM2A 2ZUPA 4ULXA 1EGRA 4G2EA 4AF2A 4PXOA 2H1AA 4Q5FA 3HXSA 1WE0A 1XOBA 1JZDA 3FKFA 3UIWA 1V2AA 3CRUA 3MSZA 3FZAA 1HYUA 3RAZA 1O85A 3CSJA 3IV4A 3HHVA 3HD5A 2KLXA 2OBKA 4OFNA 1QXHA 4I2TA 1ERVA 3APSA 1H4OA 3CRTA 2K8SA 1BEDA 1SJIA 4ZILA 2LSTA 3FR9A 4FIWA 3W8SA 3I69A 5J9BA 5HFKA 5AIVA 1W4VA 3MDKA 3UARA 5IPHA 1GULA 3GA4A 1V40A 1S3AA 5B6NA 5HQPA 2Z9SA 1A0FA 4G10A 1YEPA 2YPMA 1LU4A 5G31A 2H01A 3K8NA 4HQZA 2M46A 1EWXA 4MZCA 1F37A 3DWVA 1AQWA 5GSSA 1F2EA 2WS2A 2WULA 3EU4A 3E0UA 3RHCA 3U5RE 3ZFBA 3ZMKA 1A0RP 5ECMB 1EOGA 3HZ4A 4IELA 3UAPA 4YH2A 3F8UA 4PGTA 2H73A 5D8IA 4WF4A 3FW2A 3QAVA 1OC9B 2DIYA 2L6CA 4V1Ag 3DIEA 3RBTA 4WBRD 2H74A 2WDUA 2HFDA 1XCCA 4V2MA 3NOFA 2C3TA 4Q5QA 2H30A 5C04A 5HFIA 2F3MA 4KAEA 4XHMA 3ZREA 1SL1B 1K0CA 1U3AA 2AAWA 3L9VA 1AQVA 1TKDB 2IMKA 3CMIA 1PL2A 3QMXA 1BAYA 1WWJA 4DSSA 4KW6A 3CSHA 2DSAA 2R37A 3EMXA 4AGSA 2YZHA 1IYIA 1ABAA 1WOUA 3D5JA 2B5XA 3A2VA 3IC4A 4YQVA 1SK0A 2C0EA 4MK3A 5LNKe 3GYKA 1RK4A 2REMA 2FWFA 3ED3A 3BCKA 3IAM2 2JACA 3M9JA 3TRQA 1G6WA 2VL2C 3LGCA 3KP8A 1R26A 1CQHA 3US3A 4KSOA 1ZMAA 3KMOA 3KH9A 1Z3EA 1K0MA 1PX7A 4GQFA 1Z6NA 3E9JB 1ZCPA 4TR3A 1OYJA 5D73A 3CSIA 1TK0B 3GURA 1K0DA 2H72A 4F03A 1DSBA 5AGYA 2K8VA 5JWOB 2R2JA 1XWCA 2KP2A 3JCML 4EL1A 1USBA 2I3YA 5IMVA 1V58A 1SK2A 2FWEA 2AB6A 5ECNB 3RPPA 3GKKA 1MEKA 1XWGA 5HR2A 3O76A 1HNCA 3UL3A 3L9SA 4DVCA 2B7JA 5CRDA 4Z7XA 4G19A 3V1WA 1ERTA 1T4YA 2GQKA 3N9JA 5A5KA 3UVHA 3VPTA 1EOHA 1TP9A 2PGTA 5EVOA 1M9AA 2DMMA 4PUFC 4I8BA 4WXTA 4GSNA 1Z7PA 1GSEA 1PGTA 3FRCA 2PWJA 4HQSA 3FEUA 4JBBA 4G9HA 3ZL5A 4POMA 3ME7A 2YP6A 2OADA 1ZYQB 4K8MA 4ID0A 4TW5A 3SBCA 2RM6A 4FO5A 3TDGA 4ZIJA 1RW1A 1YJ6A 2XHFA 3GKXA 2C0FA 3EINA 1GSSA 4LL1B 2QSIA 3C73A 3TJKA 2HYXA 1EZKA 2YCDA 2G0FA 2IMIA 1K0NA 3KJYA 3EU3A 19GSA 5C00A 4ILFA 4ECCA 5CYYA 4YAPA 4PNFA 4HOJA 2ZNMA 2O8VB 3Q19A 2L59A 2YJ7A 5ECLB 2NPBA 3QPMA 3DKSA 4NHWA 5H5RA 1YY7A 3P8WA 2V6OA 3GTUB 2WGRA 1T1VA 2VL3A 2A4VA 4X43A 1FAAA 4PX1A 4PNGA 2K9FA 2FWHA 5F05A 3UBLA 4ZL9A 3UMAA 5DCHA 1XWBA 1QFNA 4BPYA 3UOMA 1NHYA 4OWYA 5GAND 4J57E 1GH2A 3TUEA 5CP1A 1SK1A 2YNXA 3ZTLA 2DBCA 3FZ4A 1MD4A 6GSUA 1G0TA 2OBIA 4FH8A 2LV3A 2K6VA 4N0ZA 1LBKA 4TR1B 1UVZA 1ILOA 1HNAA 2CQ9A 3GKNA 3VPQA 3ZRDA 3FZ5A 3I9V2 3L9UA 4EUYA 5HR1A 1MDIA 4DSQA 1HD2A 2G2QA 2VCVA 5HR0A 1A8YA 4EKZA 1JFUA 2RIIA 2YN1A 2DJ1A 6GSSA 2H1BA 2DMLA 5A4UA 1S3CA 1TTZA 1K3OA 4ECJA 5J9CA 1PSQA 1QMVA 2OE0A 2YV7A 3QFAC 2GSRA 4JRRA 2OE3A 3WYWA 4IQ1A 2M72A 1SKSB 5EPFA 1GLQA 1T7PB 1JZWA 1K3YA 3EWLA 2H1GA 1CQGA 1Y6EA 4MF5A 2B5YA 3KCMA 2VD1A 4RI7A 3L0HA 2P5QA 2ZCTA 3WT2A 2J23A 4L5LA 4GSTA 3P2AA 1R5PA 2H0HA 2FGXA 4MF6A 1FB6A 1PQNA 1EEMA 4PQHA 2DJKA 3HJPA 1R5AA 2NTOA 4ISDA 5CNWA 4OO4A 2E2MA 3J7Yk 2O7KA 4HDEA 1BG5A 1AC1A 1XVQA 1DE1A 2C4JA 3M8NA 1TRWA 2L57A
chains in the Genus database with same CATH superfamily
2GOXB 3W6JB 2DLXA 4R79A 4FETA 3O8GA 1ZG3A 1JZOA 3FHZA 2YPRA 3HDDA 4K0GA 2BEOA 1XOBA 2E2GA 1EH6A 4KDUA 1B9XC 4WF5A 3P9KA 1Z0XA 4IRIA 4II3A 3IR4A 1RQMA 2HYGD 9ANTA 2R3XA 2Y9YA 3D0ZA 1QNTA 1K7AA 5AIXA 2E7WA 3WGHA 2OPTA 1N2AA 3UNGC 1PKZA 3CP8A 4KISA 2GGTA 2PMUA 3GRXA 3TOTA 1KTEA 3E5XA 1GT0C 1IXRC 2JVHA 3E0JB 2L5QA 2VLUA 1R7HA 1YIOA 2QA2A 5J5NA 5K1YA 2R4VA 3WODF 2Q2EB 2GOMA 5D4SA 2IFQB 4HJ2A 4IJAA 1TK5B 3GH9A 5KN2A 1UG2A 3D5SC 4EATA 1K4SA 2LR8A 4IKFA 3PH9A 1L0OC 3P7NA 1D0YA 3MKWB 3IPZA 2MD5A 1Y6IA 1AXDA 1EP8A 4ZTJA 4HNVA 1JXSA 1SKRB 1GRXA 2VBZA 3QYBA 2HI7A 2DA1A 1HDDC 3I6AA 1MBGA 2OV7A 5CVRA 1NHOA 1MBFA 3S14J 2XGDA 1MW7A 5IIZA 4O6JA 4A5MA 4DYCA 2LKPA 4XIHA 4MTEA 3FMWA 3WU1B 3ISOA 3D0SA 4OMYA 3OR1C 1UZCA 2Y2ZA 5IMZA 1HKQA 2XAGA 3KP9A 5M5WJ 2RUFA 3LWAA 4YKGA 2HTSA 5BOXA 4F9ZA 5DUKA 4O5QA 1KU9A 1GTBA 3KH7A 2XAUA 2P0GA 1K61A 4MDCA 3F8CA 2BOLA 3BROA 4BVXA 3SDBA 1VQMI 1DUGA 2JADA 2XSJC 2V9PA 1BJAA 4MFDA 3ZOBA 2KDOA 1KA8A 1P92A 2DJIA 2FMYA 5FLXK 1F9MA 1R22A 2CUZA 5F0CA 3BJOA 3EUKL 1I39A 1KGSA 3BDDA 3BCAA 5KAFC 3HB9A 1THXA 3T0YA 1XOAA 2LC2A 2O6GE 2VXZA 4GYIA 4RGUA 5ICEA 3J80Z 2ZNZA 4IRGA 1FOXA 1PMTA 3QDNA 4TR4A 4TXOB 5ID2B 3CQZJ 3N4MA 1YO5C 1EH8A 1BR2A 4RAZA 2H75A 1X5EA 1GSYA 2GZZA 6GSWA 1MMSA 1S72I 2OD5A 3DVWA 2DOFA 4G6DA 4J19A 2XDVA 2E2JJ 4BIKA 1U87A 2MMNA 3A4CA 4OINF 1TWGJ 3RSNA 2HKOA 1A2MA 4HS1A 3FXRA 3FR3A 4N4OB 5KNLA 1ZGWA 2EA4A 3HZ8A 3AG2H 4LMWA 3W8JA 5LCZA 1MDMB 4JU5A 3TDZC 5J1UA 4UUTA 1I5GA 1FSEA 4BACA 4ZYAA 1FG4A 2Y69H 2XBQA 2XBIA 1I3QJ 2I8DA 2LREA 1DP7P 5DBQA 3IA1A 3QWLA 1FWZA 3DXJF 1ITYA 2RM5A 3WGDA 6GSTA 2FCHA 2ID3A 2E7XA 1W0TA 1F3BA 2KIFA 2DA2A 2CW8A 3CJQB 1IDYA 4V1Ap 3M1CA 4D7MA 5FLMJ 3A1YA 1GSUA 1OC9A 1TDIA 2HSHA 4RGSA 3I53A 2CX3A 5JCWA 1USSA 3D1NI 4MGRA 3JTGA 4RB1A 1GSDA 3BR3A 4MF7A 4KITB 3Q0WA 2VOPA 2YWNA 5CAXA 4AWXB 1P7IA 2OU2A 2FNAA 3F22A 2H8RA 2CZ2A 4KIGA 4I2UA 1MDJA 2CX4A 4G94A 1Z5YE 2YWIA 4CSWA 4HX4A 4BXXJ 4PFOA 1VQKI 2LUSA 3KEBA 3DEWA 2R6KA 3LXZA 3QAWA 1G2HA 2XV4S 20GSA 4LGWA 1BC7C 3GVAA 4KIFA 2HT9A 3OYBA 1FP2A 2F5EA 2ESNA 2ICWG 3DTKA 4J01A 4I6ZA 1NW2A 2C1YA 4EVMA 2M9HA 3JRHA 2CWEA 3C3WA 3BTLA 2VT3A 4BXFA 4H86A 1WI3A 3GIXA 2KP1A 5E1WA 3GFIA 4CCLA 3M07A 1XN7A 1ZTRA 1WHUA 4I97A 3FXLA 2JA5J 1ZYPA 3VFIA 4GXOA 2K4JA 4D5CA 5F04A 3UKGA 1VQOI 1D5VA 5IM9A 1X4OA 12GSA 4BVYA 4NV2A 4LK0F 2HDWA 2VL9A 3VDXA 1HC8A 3LW9A 3IXRA 1YW8A 2CMPA 4AVPA 5LEJA 1UHWA 5FRNA 2DA3A 1H9GA 4YQMA 1FOWA 3F4TA 4A6EA 1FY7A 2JL4A 2NDOA 2IBDA 2LD5A 4K9ZA 3NWSA 2HOSA 1XIYA 4HF1A 3CLQA 4BE0A 4IHWA 4N9IA 4IHXA 2EWNA 5KAIC 1M2BA 2GIZA 3KEYA 3D5LA 2L7ZA 1Y8RB 3KZIC 5D5XB 4JE1A 3MEXA 1WPKA 3Q18A 2JUGA 2KUCA 3CESA 3ZQGA 1XW9A 2X6OA 4PQ1A 5KN0A 2IP2A 1ZR2A 1ODDA 2K86A 5M3MJ 3FBIB 3H9QA 1XG1A 5DCGA 4EM2A 4Q47A 4PJLA 4MZBA 2NS0A 2V9VA 1ETVA 1JTXA 4XS4B 5LD0A 1O73A 4XLFA 2EFQA 4E8HA 3H3UA 5B7CA 4GCVA 1IRGA 4QQ7A 5CRHA 1MMNA 3M8EA 4IJ3A 5LGNA 3K10A 4KYWA 1R1VA 3HGGA 4J56E 5IY5H 4EEFG 1P4XA 3QRFF 3K6GA 3BBYA 5GSTA 2M7BA 3L4NA 3I4NJ 2ISYA 3MN2A 3S3OA 3MWHA 1WJBA 2B6MA 2F8FA 3KZZA 3KZQA 3K4MA 2IXSA 1IN7A 3H5NA 4Y33A 1FHEA 4CUGA 2CVDA 3HHGA 3ZN1A 3BC8A 5H6RA 1ZREA 1Z7UA 3CTGA 4ZZDA 4HSCX 3ECOA 5KN3A 2Z16A 2NVQJ 1ERUA 1Z6TA 5LFAA 4I01A 1OCOH 4IOAF 1SJZA 3EURA 4CYCA 2MH2A 2L01A 5B5EC 3GTLJ 4F0CA 3BWGA 1F43A 1UB9A 3F4SA 3GW2A 4XLNF 3VWVA 2ALBA 4NAXA 2Z2SB 5J3LA 1D8KA 1MKMA 4L5JA 4CCMA 3L2RA 5JVGF 4H4KC 3CMYA 4XNFA 3MAKA 2IPAA 1XDSA 3KGKA 5AONA 3BLYA 2QVOA 4IPAA 5GP9A 2B7EA 1N77A 5EY6A 2DMTA 2JK3A 1FBQA 3EC3A 3TCOA 3TMOA 5F0HA 2GT6A 3PQKA 5GAHJ 2DJ3A 3F3QA 4PSXA 2NXNB 3CUQC 3DYRA 3F3RA 4E7SA 2F4IA 1QVUA 1TOFA 3A01A 5INYA 3LSKA 2HZEB 3F6DA 2HEOA 3K4LA 2CG4A 1K0AA 2CV1A 2CQXA 2V1DA 4ZB9A 3ABMH 4M9ZA 4BGDA 2LNSA 1W4MA 2X1CA 5G30A 1JUMA 2CV4A 2MBTA 2JVGA 2ZXIA 2XUBA 4O5VA 1M2DA 2H8WA 3CO6C 2DT5A 2L54A 4A3FJ 4OAZA 5JI6A 1MIJA 4QSHA 3KE2A 3FK8A 1XB4A 1FOVA 1MTCA 1T98A 4EVIA 2YSRA 1ULYA 2CQKA 2RQPA 5D5UB 3KIOA 1TU7A 1HKSA 3S2WA 2F5DA 3L2UA 3G6EI 1PDNC 2VKVA 2C0GA 3HY2A 3ME8A 5IMCA 3G4SI 1U2WA 5DCMA 1J0FA 1C72A 1XSXA 4Y7NJ 2R5ZB 2LKUA 3MVPA 1M99A 2NS7A 3SZGA 1E0EA 3K70C 5C4XJ 1EP7A 2DAOA 5LBQA 4YEJA 3O3KA 4HSRA 4N0BA 3E7LA 1A6QA 3E1SA 4BDZA 2GA2A 1QZEA 4LLLA 1N8JA 4BA7A 5E18F 5KEJA 4RGRA 2YU9J 2H1KA 3QD9A 3ERFA 2F48A 2TDXA 3WHBA 1WKMA 3QP6A 3EDPA 5J1RA 1FOKA 3HTSB 4A3GJ 1PUFB 2MMZA 2YZUA 3P90A 1GNEA 5L3FA 2AS5F 1OPCA 2IS6A 2H0GA 3WGEA 1WSUA 5D9WA 3WGIA 2DC5A 2VIXA 3G9BA 2ELKA 2EFWA 1XMAA 1FX7A 2LSOA 1M7TA 1U9OA 1WJDA 4PJ0C 1VQ6I 5BS6A 3G1OA 5D4RA 5HFGA 3TJGA 1YKCA 4B1RA 3M1GA 2KL4A 2MBSA 1PN0A 5DM6F 2ZXJA 4XS6A 2VKDA 3S3MA 2F51A 3F6FA 5IMDA 4PJNA 3RKQA 1AU7A 1TI3A 1Z6MA 2P81A 1VGLA 2PG4A 4TOPA 1OCPA 2O8KA 1VF9A 1BIAA 1P7JA 5JVTA 3DMLA 3GFJA 5CREA 1MBJA 1BR1A 2DKIA 2VLTA 2H1DA 4MP4A 3CJRB 1VF4A 5EYRA 2CVKA 4GGGA 4E7HA 5FFZA 2HGCA 3BQZA 4IVFA 3HYIA 3MIXA 1A23A 3VI5A 4GRIA 2YWMA 2I5UA 2F2EA 2XC2A 4CW9A 1TQPA 1ETOA 3I59A 2IA1A 2DJ0A 4RAGA 3TJFA 2A69F 1IV8A 1SD7A 2HDCA 3VK9A 4M72A 1U3IA 3LFLA 2C8UA 3MQ0A 1B72A 4XRSG 4BJTA 1OKTA 1PL1A 1TU8A 2IMFA 2WRTA 2CFXA 2R7OA 3CTAA 4M73A 3JTHA 4A0ZA 2BYVE 2QQBA 2H1LA 2R7FA 1Y39A 2E1CA 4TR0A 3LSIA 1IUYA 2KIUA 2B0LA 4EE0A 5DTDA 2FUG2 2GVPA 1GUUA 4LD5A 4WXDA 1V55H 1V54H 5CKTA 3VOEA 4ZDPA 1DU0A 5HLGA 1EF4A 4UV8A 3QPLA 3QR6A 1LDDA 4IHVA 2GLOA 2X8CA 4KSMA 3HVVA 3K0LA 4HW0A 2M0MA 3FX3A 4KMFA 2B3SA 5FKMA 1ZRFA 4L0WA 5B66C 4FE7A 3H1CA 3GTUA 1NTCA 3L9FA 5FB2A 5EG0A 2W7NA 4MPGA 3IKTA 3HKZN 3O3TA 3OOUA 4IQ4A 4F91B 1TW3A 2V1UA 1B4QA 3DU6A 2AV4A 2D1VA 1EV4A 4XONA 3M3YJ 3IHQA 2FQ4A 5F07A 2FA4A 1FYLA 3PUBA 4BL7A 2ZNYA 2M3AA 3QAHA 2E5NA 2FBIA 3H9JA 2HDDA 4ZB8A 4F2IA 1ZAOA 2WY8Q 3FBNB 3R6SA 4XLPF 1T00A 3E3EA 9GSSA 3TKSA 2P4WA 2VQLA 1W5TA 4KCAA 3SEZA 2X0LA 3ZMZA 2BJXA 1NG7A 2JSYA 3BJ6A 3VFZA 4N30A 14GSA 1F36A 2QZ8A 4WX9A 3TW6A 2HXKA 3FMSA 1BBYA 2R4GA 3EUHC 5CPRB 3VSLA 3WU0A 3LYKA 3HUGA 2E1MB 2F4OB 1ZYRF 4BBRJ 3TBIA 3Q5FA 2EZKA 1X58A 3DXBA 1UJ8A 1N78A 3F6OA 5COHA 2EZHA 5FROA 4V2NA 5D9XA 2L9RA 2M4GA 3KP7A 2AJQB 1EA3A 4F82A 1O3RA 3ZP5A 1M1EB 3ZMLA 2DPUA 10GSA 2GQMA 4E7JA 3PIOF 1OKRA 4A2UA 3F23A 3BCIA 4N10A 4UB6C 2PJRB 5BPDA 2R0QC 4A3IJ 1K0BA 3PNYA 2WV1A 5CLSA 2ADUA 5LD2C 4TR1A 4ZJZA 2JA8J 2P31A 4C3HJ 2C6YA 4ACSA 4ZYDA 2HPMA 1B9MA 1XGNA 4RAYA 2JUCA 5ILSA 3CC7I 1XZOA 2EB7A 1FSHA 1TWAJ 3T5XA 3HA9A 3H93A 3AG4H 2K7LA 1SD9A 1JHBA 3EPZA 2ZSIB 4MLYA 4UNOA 5JCGA 4Y3OA 4V2LA 2LQQA 3HSFA 1V57A 3ZPLA 1F6MC 3APOA 2B9SA 2VAFA 4MJEA 5IMFA 5LHHA 4FX4A 1DDNA 1V98A 3ZMVA 3I4PA 3TL4X 5JR3A 3QP5A 2VC1A 1S3RA 1XMKA 4I0BA 1VQ4I 2X8HA 1HF0A 5LGTA 4PURA 1S9HA 3DBHB 4IRHA 3TRPA 3H8QA 2HZDA 4XOPA 3TKPA 4MJBA 1RRJA 2QLZA 2LG4A 4S0HB 4HU9A 2DYSH 2O0YA 2ZJ2A 4P9FA 2IS2A 3KP3A 4IHYA 4J2FA 3ZXSA 3FXOA 3I71A 4RB3C 3CTFA 2XVCA 2YOIA 3FYGA 2PMHA 2ZJRF 3SZPA 3TO7A 2FSWA 2ZSHB 1O8XA 3A2XA 3IRAA 4MA9A 2IVMA 5L3CA 4M3BA 3DPUA 4G8XA 5EJCA 4KA0A 2GSSA 3TKYA 1O57A 2L7MP 4LA1A 4EF0A 4ZL7A 1USTA 1Y56A 4LFUA 2XC7A 3OL3A 1X1DA 2VUMJ 2H6ZA 3OSFA 4HOBA 2NBSA 2C3NA 4I6XA 5GZZB 1GTIA 2MC4A 4A6DA 2XF7A 2DMQA 2P7CB 3HDCA 2Y9ZA 2M34A 3TP3A 1FYKA 4EJUA 4FQUA 4Q5RA 5BMZA 2FQ3A 2MLGA 1JKQC 1SYXA 2ID6A 4ITVA 2K5CA 1WCMJ 4WK8F 2ZJQF 1SVLA 3FKJA 3FK7A 3CZ6A 5FGMA 4XRSA 3RZDJ 4YQUA 3MAJA 3K1PA 1KQ0A 3NAUA 2GQQA 1LJRA 2LBFA 2WCIA 1YG2A 1YOVB 2A68F 4ZYHA 5J8FA 1FO5A 5EL8A 3OYAA 1SVMA 2X9DA 1J5YA 3F6VA 5KK1A 5HLTA 1POGA 1Z9HA 2O89A 4ECIA 5EEAA 1RR8C 1YE9A 2KP6A 2VI6A 1BM9A 2M8EA 4YFNF 1T3BA 1XVWA 2IWTA 1R58A 8GSSA 3TJBA 3UJ1A 5BQTA 4XM3A 1OMIA 2NNYA 1PP7U 1ERWA 2FLSA 4POLA 3G1LA 1WI9A 1T95A 2OTLI 3SYTA 4RB2C 1TXXA 1YYVA 5DQSA 3Q3SA 3EYYA 2MC3A 4PGHA 5K7FA 4EJTA 4HSTA 4TVEA 4WBJA 4PK4A 2BY2A 5GAGJ 3WGXA 2GZPA 1GLPA 5DJMA 1U5TA 3J7Yb 2JA2A 4G0KA 2O03A 4ECBA 1R23A 1YX3A 4IVNA 2QA4I 2EC4A 2CYYA 2EIJH 5JFRA 1G3TA 1Q4JA 2JSZA 2EILH 3OYDA 3LORA 2M87A 3S1MJ 2LNTA 2V7FA 5K7ZA 1G6NA 2IEKA 2H6XA 4A3KJ 4KDYA 1OCRH 1HW1A 1ZG1A 2VJIA 3GL3A 5DAKB 1B8IA 1BOBA 2DFIA 5CQGA 4GTUA 4TKYA 4UY8I 3PJRA 1K0OA 2IGNA 3ZQQA 3G7YA 3M3MA 2D2WA 1A2JA 2ZXHA 4FX0A 4RGXA 3GKXA 3O6BB 2HSYA 2VPRA 4AJ8A 2YJHA 1ENHA 2A2RA 1MNMC 4YG2F 2Q8KA 3RTRA 2HQRA 5ENUA 1UC7A 1YZXA 2DA5A 3CC4I 4K7NA 2X1EA 3QQAA 3WTUC 1JZRA 2NVLA 5E4WA 1JUPA 4WXHA 1MJAA 3JRCA 2B63J 2Q0OA 3LSJA 2OKAA 5DYMA 4OIRF 2L5OA 2QM3A 3E5UA 2O8XA 1H88C 3G73A 1GWCA 3MD2A 1X5CA 2HSMA 2N5FA 1TNTA 2VQHA 4ZYGA 5CJ9A 3H3VK 2Q2EA 4KB3A 4CCNA 2IFQA 5B6MA 1S29A 1MJ9A 3J80K 1BI1A 4N11A 1J9BA 3BZCA 2EFNA 4WR4A 4FYCA 4POBA 1TQIA 3H36A 2EH3A 3GTGJ 3QFBC 1ERDA 2ZMEB 4AD9A 2FF4A 1YI2I 4X4JA 1X9WB 4IGJA 1XWAA 5IOYA 4OFTA 4XLAA 2O85A 1RKTA 4XSZF 3IK7A 2ME6A 2YX7A 3CCMI 2JRTA 3S2HJ 1OCZH 1DGRM 2IGOA 3Q0UA 4MEYF 2LJKA 3BR6A 1LKXA 4CDOA 1I27A 2GQLA 3HVXA 5DS9A 1TI1A 4KF9A 3QU6A 4D73B 3KPHA 4USSA 3ASOH 1OYIA 3HC7A 3VYUB 5F64A 3H5AA 5H5QA 3J7AO 2EZIA 2GAUA 4ZBAA 1LFPA 1PVEA 5H2FC 4KX4A 2CUFA 3JRAA 4A3JJ 3CD6I 3D6IA 3HG9A 2BV6A 4QPQA 3VB2A 4YIRX 2OE1A 3KMNA 5IYBJ 5IPAA 3U6VA 3UVTA 1VQ9I 1OC8A 2DDBA 2QSHX 2FA8A 2STWA 2UXXA 4RM2A 2RN7A 2LY1A 4BBSJ 3LSHA 2TIRA 1B48A 3DCFA 1LQ1A 1D0ZA 2R7QA 3PGTA 3S15J 1QUWA 2HWVA 2B5EA 5G5FA 1E17A 2JZRA 1QA6A 3D4TA 3I55I 2PMTA 5IP6A 4K0NA 4TXOA 4HG2A 5ID2A 1KONA 2HYJA 2VD0A 1U8BA 4JR4A 3DU5A 3IL2A 1D8JA 2A61A 4EO3A 1F3AA 4ZXGA 4EGZA 1OR7A 3F0IA 3RKXA 2OJED 1T2KA 4XSXF 1Q1HA 4IW9A 2JZTA 5ECHB 2BY0A 3FF5A 1W7PB 2ZO4A 3IP4B 4BH9A 4MJCA 3VWXA 2TRTA 1BOAA 3GO5A 2FX0A 3F21A 1MDMA 1FBSA 2EPFA 1S3JA 1U6TA 4HA8A 3TOUA 2RREA 1SMYF 4HPQA 5FKOA 3LA3A 3QCPA 4X1UA 1R36A 2LMDA 2WTEA 17GSA 1X1CA 1DQUA 4MEXF 3GTKJ 1GNWA 2I4AA 2H76A 1O8WA 2WJUA 2M0CA 5GPAA 4F3QA 2XRLA 2VE9A 4FYUA 5D6FA 1T38A 4OFMA 4M6XA 3HOTA 1AUCA 4B47A 3W2AA 2TRCP 2EJRA 3H4KA 5DDLA 1G7EA 4E4HA 1TRUA 4Q5NA 4Q48A 2FU4A 3QU3A 2LRNA 2W00A 1IYHA 1AW9A 1ZYNA 2KISA 2F4MB 2LQOA 5FT3A 5J40A 4K2EA 4YKFA 4GXZA 1URMA 1MD3A 3S2DJ 3EPTA 2PVOC 4K6XA 1PA3A 3GX0A 1A36A 2JZSA 3ZQFA 3OY9A 2PN6A 3BOAA 3ONQA 3L78A 2CO5A 3KLOA 3OV8A 1X3UA 3W2WA 3OL4A 3RKWA 1KQ9A 1GP1A 1BYEA 2PU9C 4NNJA 2VCQA 1U88A 1ZLKA 2UZKA 2EK5A 4AM3A 3A03A 5DJLA 2MH9A 4CYDA 1OLTA 1IZ1A 1VF2A 4HEA2 4RM3A 2H70A 1FTTA 1WRYA 3F63A 4DGWB 3CF2A 3RHBA 4Q5SF 2AO9A 5CQEA 3DKYA 1IO2A 4KFCA 2E71A 2H8LA 5IO0A 2PERA 6GSXA 4U7DA 4HV6A 3ZIJA 1IRZA 1PUEE 1P4AA 3I3LA 2KMUA 3V42A 5A4WA 2V6KA 2H6CA 5JHFA 4MCUA 4P3YB 4IBPA 2XGCA 2H09A 2K3FA 2EIRA 3IH2A 2VCWA 3PINA 4AIJA 2KIQA 1LNWA 5EEGA 1SENA 5E8GA 3BG7A 3MKYB 3MFKA 1Z6RA 2VL2A 1XG8A 2ZMEC 3VWWA 1GTAA 3VLNA 1LVKA 1BI2A 3OS0A 1Z67A 2HS5A 1O7FA 2LF8A 2NVTJ 2VCZA 1U0JA 4W1UA 4JQFA 2JSPA 2KOKA 4I5QA 5IO2A 3DQVC 2I1UA 3FISA 4IO9F 5HDNA 1WIKA 3RPQA 3PNTA 2B7KA 2GTUA 4MJAA 3K4BA 1PFOA 4DBRA 1J08A 2D2ZA 2PMZA 4QTRA 3TKRA 4IL6C 4NPBA 2VLAA 1EJ9A 1FVKA 5E3MA 4PSWA 5HS8A 3JRBA 5DCFA 2BW3B 5AN1A 2KZGA 1G8XA 2IGKA 3SFZA 4XS4A 2DMNA 3OSGA 1OE7A 3I5UA 1E6BA 4AJ7A 3OYCA 1T0FC 1F9NA 1X9MB 3C7JA 3U21A 1AIUA 1JKRC 3A2WA 2KHMA 2FOKA 2HRNA 2H71A 1D1CA 4WETA 2QWWA 3I4MJ 3LEFA 3DTIA 1R6RA 1MH4A 1XCVA 4B43A 1ZG5A 2R5YB 1LDJA 2VJ4A 3FXJA 1O6JA 3ZYWA 4GQCA 2ETHA 2A05A 2IAIA 5KOXA 2F9SA 4HAMA 2EV5A 4IP6A 3FWEA 4OD7A 5IOXA 1EGOA 4BY1J 4AVZA 1M2AA 1DE2A 3G2BA 3V8LA 5G5EA 2RKHA 1UG0A 3S9FA 3WE2A 2DMPA 1S7AA 2H19A 2NAZA 1BJXA 2HRAA 3CUQB 4K2DA 1QVTA 1FEXA 3RI4A 4POKA 3K4NA 3KD0A 4K7IA 2XAHA 3SDGA 22GSA 4X6AJ 4PGGA 1JT0A 2GXGA 1ST9A 3CP2A 4AYBN 2DMUA 2IMEA 2VOCA 11GSA 4QLCU 3APQA 3AY8A 4IJIA 2CW0F 4G6TB 2XROA 1R9TJ 2OA7A 3DEEA 4DQ2A 1QU3A 3AG1H 2CZ3A 1UA5A 4RAFA 3CBUA 2QBYB 1IJWC 4HRIA 2CT6A 1BC8C 2L9VA 3DEXA 4W97A 2L3DA 1SMTA 5M5XJ 1MSEC 1LPQA 3F4RA 3ZQHA 3LMMA 4BQNA 3FK6A 2C0DA 5EF6A 2XKOA 3OYLA 1SYRA 2HZEA 1KYZA 1J7KA 1TK8B 1W7PD 2R7SA 1ZL9A 1ACVA 1VF3A 1IAWA 2LJRA 3CYNA 3RPNA 3FZ9A 1FOYA 3REOA 4MQVA 3LFKA 1HCRA 1S3DA 2N5AA 3VYRB 1FIPA 1VQPI 2NOGA 2ISZA 1J0RA 2VOOA 2R5GA 4QL7A 3QPTA 4BNCA 4FTHA 1V5GA 4AIHA 4OCEA 3CCSI 3FR6A 5GTHC 1WJKA 3R2QA 1ZRDA 3M0FA 4MH3A 3ABUA 1MH3A 1N25A 1H9TA 4UUVA 3GX4X 2IGMA 4GF0A 3NWTA 2WAQN 3GHAA 1RZ4A 3GZNB 4MZWA 3U2RA 3PNVA 2R5ZA 5M3FJ 2IA0A 2FXAA 3EMPA 5D93A 1I50J 3BG3A 3H0GJ 1J9IA 4PDKA 2V2GA 3C7MA 3IE3A 2I81A 3B02A 1EV9A 5D8KB 2EQRA 1MNEA 3PFYA 4TN8A 3RPUD 5DALB 2L5LA 2FRHA 3DBRB 3L09A 4A5NA 3E97A 1CGPA 1FMWA 2GXBA 5H6QA 4L0UA 1PUFA 4EDZA 4HNTA 1FPQA 2H6BA 2J9HA 5G1KA 1YX5A 4OU0A 5G1LA 3CF5F 2ZFWA 3GN3A 1XW5A 2YU3A 1VRSD 5GAEJ 2K4BA 2PJPA 4NDLA 2AHQA 5IT9Z 2CA8A 2E7PA 3QOUA 3CCVI 3TKSE 1SL0B 5FRMA 1W89A 2Z5UA 1UHMA 1FVJA 3UEMA 4LB5A 2V6EA 3GCMA 1OAZA 1NG6A 1IG7A 4KGIA 1TW9A 2DYRH 5JLWA 4N0VA 2K40A 2G7HA 2ECCA 3O6TA 1U9NA 5DQYA 1I6XA 4M9SA 3QPSA 4Z2RA 2J5PA 4S04A 2M5WA 2QQ8A 2KDZA 3UBKA 1RC9A 1BX9A 4LK1F 4UUSB 2R7TA 3TGZA 4KT6A 4MMMA 3CCYA 4O7HA 4LMVA 2R93J 1PRXA 4WR5A 2VC0A 3GSTA 1ZGAA 4P5OA 3F8BA 2MGQA 4AC0A 1S5LC 3DLLF 1ZR4A 1VQLI 1PD21 3KXOA 2PUKC 4PUSA 2HOEA 2A07F 3H1NA 3LOCA 2YUSA 4M3EA 2N5BA 2IW5A 3IUOA 3OYIA 4XORA 2CGPA 3GWZA 3KFWX 3CUOA 1LDKB 4MO7A 3H3ZA 2W4SA 4HQMA 4RB0A 2MLKA 3T8TA 1HNBA 3ZITA 1RNLA 3LSTA 4L9TA 3M8FA 3TO6A 2MZCA 4K7OA 2FHEA 3NZNA 2BY3A 1HKTA 4MABA 2HU9A 5H5SA 4IF4A 2QYOA 2HQAA 3KP4A 1TRSA 4WKWA 3SXYA 2CAQA 13GSA 3HOZJ 4WWCA 1ON4A 3ERWA 4G0IA 4E7IA 1UAAA 1ZHFA 2COBA 2L4QA 3TOBA 3GFMA 5DD4A 1V5EA 3P7XA 1BQ7A 2XRNA 1R5ID 1XGOA 3GTJJ 3CMMA 2DA6A 3E3VA 4GCIA 4BQOA 3NQOA 1KBNA 1HQCA 5DDGA 2XB0X 1H8AC 3F8MA 2Y0SN 2WB1A 3M4OJ 5TJJA 3LNQA 2JTVA 1I6HJ 4XRDA 3GNJA 5J1YA 2OQGA 1HDPA 3DEUA 4RA2A 1B4AA 5ELAA 2AXTC 4BYYA 2LFBA 3EUAA 1SAUA 2JJ7A 2B1KA 1GUMA 2VCTA 5IMAA 3CXGA 4ML6A 5AISA 5B8AA 5J3RA 3HSRA 4AJ6A 1SL2B 3FMRA 2QC7A 1N75A 3GUSA 2MBFA 4PTSA 1MDKA 1TWFJ 1A2LA 4DZPA 3KETA 3ZIVA 3A2KA 1E2XA 1TW2A 2DJ2A 2X1DA 3KP5A 3CCUI 1ZOFA 2MABA 4GO1A 4PZJA 3K9TA 5FD6A 4RI6A 1VI0A 2VKHA 1Z7LA 2XF6A 1A5JA 3IC7A 1OQYA 1XTAA 4JBAA 5JWQB 1YS6A 3O2PE 1YJ9I 2OA4A 3GXOA 3K4KA 1XPVA 4NC8A 4ML1A 5EDNA 3VWUA 1OISA 2VBXA 1KU7A 3OYGA 1XSVA 2E36A 2EBIA 3I0TA 3EVIA 1S8NA 2H0IA 1SFOJ 2LLKA 3U1DA 2PJRA 4C3IJ 1ZQ3P 4HJMA 4RDUA 4K5SA 5FJ8J 1XW6A 2KFDA 1OYYA 3K70D 3PR8A 3JSOA 5ECRB 2DK5A 4RQRA 1AAZA 2YANA 2N8GA 4I7HA 4Z6YA 4HLXA 2R7ZJ 1YKAA 5DVBA 2QKEA 2D5VA 4KDXA 3VWBA 5DEQA 2B1LA 2FD3A 2XF5A 1JGGA 1B4PA 2K9MA 1PKWA 2L6DA 4FHTA 3V7CA 3ZQLA 2X51A 4TRXA 5IPGA 3ZFLA 4P55A 3NIVA 2DBBA 2HXOA 3CJNA 3HZJA 3R60A 3HL2A 2VB6A 1J75A 1XXUA 3LYPA 4U88A 3ERGA 4EC0A 2CH0A 1EEJA 4L5OA 3QPHA 1K3LA 3GH6A 1FW1A 1R4WA 1YQAA 4BWSA 2OUMA 4XCSA 3FMQA 2A3SA 5J6XA 1XDUA 2YWOA 4J00A 4ZB6A 2AHEA 1XCBA 4Q4ZF 1ML6A 5ECQB 2HTJA 4L5EA 4YIFA 1B59A 3BG9A 1IN4A 1GUHA 1SJ6A 2AXLA 4ESJA 2ON5A 3DD3A 2R7XA 3GSSA 3TKSC 1Y0NA 3Q74A 4NXIA 2KZVA 2Z33A 4DJAA 3PO3J 5E3OA 2C80A 5GPCA 4AU7A 2ELHA 3F8FA 5TISC 4EIPA 4I99C 3BPVA 4HNUA 2M80A 5LRSA 3P5JA 2KT0A 1V9WA 4ANJA 1I9DA 3C1SA 4OAYA 5JCUA 4GYGA 3HOVJ 1PX6A 1ZYEA 4BHPA 4KMUX 5J4UA 2VBYA 4I02A 2XSDC 2OZUA 4U87A 3HKRA 4DYRA 1MGTA 2F5CA 2DT7B 2A6EF 1J59A 4HU7A 4X0GA 4XKWA 4GSSA 1OVNA 3FHKA 2GT5A 3NRVA 1XD7A 4JX6A 1UFMA 2PN8A 1HBXG 1EV7A 2YX4A 1JUSA 4ON0A 2W57A 2F6CA 1XGSA 3ZMSA 1GDTA 2MYGA 1WWXA 4ENMA 1WJ5A 3WTSC 3RDWA 4F0BA 1WJAA 1UN2A 1YDKA 3M9KA 3ZR8X 2CRGA 1NM3A 3BTCA 4O92A 4LLRA 2QQAA 7GSSA 5J4YA 5JWRB 1X2MA 2JU5A 4KH7A 5KN1A 1VQ7I 1BR4A 3H0DA 1TT5B 4XN3A 3F8NA 2KJBA 4JX5A 4NC6A 1YEXA 1RR7A 2DQRA 1IV6A 1YQ1A 2LY9A 3OYMA 1G3SA 3LQRA 3V4GA 3OYEA 3WGGA 1VFCA 2L7KA 1X1BA 1WP0A 3MNGA 1PP8F 1QZZA 4MQ9F 5CRWA 1TRVA 2IT0A 3VYTB 3KX2A 2GSTA 1Y1WJ 2BMXA 4DSSB 3I64A 2VIMA 4A3EJ 2R7VA 3D22A 1G6YA 5KOWA 3HTUA 5ELGA 2K9LA 4HX8A 2X85A 3VSKA 1TT0A 3K1NA 2KQRA 2LRCA 4NV5A 4IS0A 2XASA 1OFCX 1O3SA 3J81Z 3J7ZI 1KEBA 4NQWB 2I9HA 2BXZA 4P96A 18GSA 1SAXA 1PN9A 3TRXA 4BDYA 3JRFA 3IHGA 3HM5A 1GUKA 1A8LA 1H89C 5DV5A 2E0QA 3GFKA 5DAKA 1R1TA 2COMA 1XC5A 4WEYA 2M1BA 2NVUB 4KN4X 3C2GA 1U3EM 1OYWA 3IRRA 2GLRA 4MH2A 2WZ9A 2GS3A 3ZCOA 2VUPA 6GSVA 4BS9A 1OCTC 5D9VA 3SWLA 1ORKA 2FE3A 3ERMA 4XOTA 1MBEA 1BL0A 4IN0A 4XRAA 2YR2A 4Z2YA 4CHSA 4KNDA 4FE4A 3PUFA 2DJNA 4I98B 1JLWA 1Q98A 4BWQA 1YITI 2LJAA 4UV9A 3QAGA 3IBHA 3A0BC 3GKMA 3OIQA 2UWMA 3ABLH 3FHNA 1R00A 2Y31A 3K4JA 2QGVA 1WFXA 1AKHB 1F5TA 5ICFA 1TJDA 3HRTA 1PJRA 3L1PA 1G59A 4H0EA 3EYIA 3K7AJ 4HF0A 2TCTA 2K9QA 4MIMA 5HS7A 2P5RA 4ENNA 3HJMA 5F8BA 1RUOA 1WMJA 3T1BA 2V4JC 3ZGKA 1D3YA 4R8HA 2VQCA 3HYPA 4ABZA 2MSYA 2UUZA 2ZKZA 5E20A 2ZMEA 3HCZA 2RNJA 2C3QA 3C2BA 2W84A 5FWGA 5B1AH 1I3AA 3HRMA 3ZZXA 1T6SA 4BEHB 1VQ8I 2FNOA 1XMXA 2FOWA 3DWLE 4XRMA 4L0ZB 2E60A 2JRMA 2DDAA 3H5RA 2IIYA 2HQ5A 4D73A 4OMZA 3SJMA 3BCBA 1X2NA 3A5WA 5DUIA 4HDUA 1BA5A 1B9YC 4EXJA 5L71A 3IWZA 1X5DA 3T8RA 1YF1A 4KNYA 3OMYA 3BPXA 1XWKA 2P5VA 3O8HA 2MG4A 4E7ZA 3ECHA 5KHDA 4K1FA 3C18A 3CCQI 1Z7RA 2LKSA 5K5RA 1O4XA 3L2CA 1IXCA 1DGWY 4CGZA 2IS1A 1B8XA 4XR6A 2NS8A 3Q6OA 2O7OA 3HJEA 3W6KB 2VM1A 1TNSA 1MSFC 4JEDA 3LXTA 1RPWA 2EFPA 3E6BA 2RGVA 5HR3A 5B8BA 4B44A 1NK2P 2WFCA 3HEFA 3HGYA 1IRXA 1SKWB 1ZGJA 2VXDA 3ZLPA 4DEJA 4LL4B 5HLIA 1A24A 3ULQB 3D4MA 1M9BA 4G9YA 2V1XA 3WHCA 1O81A 4NC7A 3LAPA 4EJWA 1K78B 1R4MB 3M7GA 1ZGNA 2VLVA 1DPRA 4OMVA 2H66A 3OYKA 4XK4A 2OZ6A 3BJAA 1FC3A 4RLQA 1TRWA 2KHPA 4RUVA 1W7PA 3AFHA 2IRFG 1QRYA 3CCRI 2NVYJ 2BTOT 2WWYA 5E1ZB 1VTNC 3B6AA 4CCJA 2NVXJ 2LK2A 3L2WA 3I54A 4E7KA 3AL0C 5IP7J 4MHGA 1HSJA 2P5KA 3J7AY 2K9NA 1QHHD 2V32A 1JTYA 3D21A 1VF1A 4DSRA 2L4MA 3HOUJ 4EDYA 2IJYA 3GTOJ 1HOMA 3FXMA 4X0XA 4JOMA 1W1WE 4G0LA 4JX4A 3VODA 16GSA 1IXSB 1T33A 3FXUA 3A0HC 1W36C 2ON7A 4BE1A 4JR6A 2ELJA 4UVCA 2AQFA 1X0RA 1JI8A 4L8EA 4RQXA 4IX7A 5K7HA 3SZTA 3X2QH 2NOJB 4XS1A 3F9KA 5G2ZA 3RPUA 2O5RA 1DBYA 4BJ5C 3PFIA 3KTBA 2JN6A 4Z2UA 1Q1VA 4LG0B 2LEGA 1SFXA 5J4VA 1H75A 3F9UA 2VPLA 3OR5A 5FKNA 3CDIA 4KJZA 4IZZA 1O7UA 3VURA 2OQRA 5CO3A 4GLTA 5E59A 4MNUA 1YF0A 2R3SA 5FFXA 1T39A 4ESBA 1W36D 6GSYA 1T8EB 2MD0A 4G7ZF 1QBJA 2X6YA 5J8CA 3HVSA 1QQIA 2HE3A 3ROUA 2LY2A 5HNFA 2P5LC 1QK8A 2FY6A 3N5OA 4ICYA 3DF8A 4XRFA 2HRFA 4A0YA 4CCOA 4NHZA 2KRHA 3IDVA 3IHUA 1SFUA 3S1NJ 4B3AA 2PBIA 4XIDA 4OIPF 2OACA 2EIQA 1ZKGA 2XB5A 5A4VA 1GSFA 3ZMTA 5LLQA 2L4CA 1D0XA 3GLXA 1G3WA 1GVJA 4CDGA 2LRTA 2R7DA 3LG6A 4LITA 4HLYA 2E1NA 1E3PA 2V26A 1SANA 3B6CA 5FHIA 1FP1D 4L18B 2MMOA 3GX8A 1PYVA 5A2QZ 4GWRA 2JSCA 5F0GA 1R71A 2ZXWH 1HXDA 6GSSA 2RLIA 4XQFA 4Z2TA 1YFHA 1W0UA 1J2XA 4N4NB 1FBUA 1DU6A 2V9KA 3KYDB 2L02A 5HLHA 1M3JA 2ES7A 4E6KG 4XKCA 4D7NA 5DD8A 1OC3A 4UVAA 4IP1A 1TWHJ 2CQQA 1XBSA 1YW7A 2AYTA 4ZBDA 1Z9CA 2QSGX 2JWTA 4BE2A 3ZVJA 1P4WA 1XS9A 3ZMUA 2EIOA 1OKDA 5HDKA 3LQQA 4IQAA 4KE3A 3W6GA 2HNHA 5L3EA 1IGNA 4FQGA 1SU9A 2WB9A 3HJOA 2L9NA 2HNLA 1GTUA 2E5ZA 4L5IA 4YRVA 3L00A 4FT8A 4XTSA 2BW3A 2PVQA 3G7IA 3IOSA 3BTIA 1FLIA 1ZRCA 5LGUA 3N05A 3C1RA 2YV9A 5ECSA 3TJJA 3DGQA 3IAS2 1FTZA 2MMAA 1XFLA 2GZWA 1S7OA 1MBKA 2K27A 3S93A 2RUEA 2XPEA 3DVXA 2STTA 4OO5A 2CJJA 4PQIA 1YJWI 3TB2A 2R0CA 3C8EA 3GL5A 4AIKA 2R5YA 2E2IJ 4A0XA 1BIBA 2WADA 1YS7A 4C2UA 5AIPA 3R0AA 2XAFA 5BMUA 2Q1ZB 3WD6A 3IKVA 2PX9A 3JREA 3LWFA 4YAVA 3MZ8A 2X8GA 2LKXA 3BD2A 5F06A 4KUNA 3KIJA 4ZL8A 4LOCA 1IN5A 3PSIA 3HOYJ 3DRNA 3LSZA 5CRGA 2L0KA 4ZBBA 5HODA 3CUQA 2GDRA 5ECIB 1SVOA 2VKEA 2HZFA 2H6YA 4IHUA 2Y30A 3W2VA 2FWGA 5ECPB 2GZYA 1LE8B 5DM7F 1I1SA 1E2YA 1YHQI 3ABKH 4Y15A 1WGXA 2X4AA 4K5RA 5ABRA 4U0WA 1U8RA 2AUVA 1X9SB 3EYTA 5IOWA 1X4PA 1Y25A 3WG7H 2CUJA 2DI3A 3TGNA 1UHSA 3GTPJ 5GAPD 3VEPA 1FOHA 2QBYA 2HFHA 2XPVA 5CYVA 4IHSA 3FXQA 4CCKA 4S05A 1MNDA 2NNNA 1KNGA 2E34A 1ETQA 1KZHA 2XPDA 1SD5A 2F8AA 3GV1A 3SHFA 2QQ9A 2IL3A 2LOOA 1G3YA 2JQ7A 1GL8A 4HV5A 3BJ5A 3GFLA 3ISPA 4JZQA 3H9GA 5IT9K 1OE8A 2GSQA 1JLVA 4CHUA 2E1OA 3IK9A 2K9SA 2HPIA 4E7LA 2RV8A 2QEXI 3M1EA 1LEBA 3OYFA 1ONVA 3GMFA 2DTZA 4XLCA 2BE5F 4MPFA 3NARA 4L9VA 5ICCA 2VCXA 1MMGA 1QPIA 1FB0A 3TKQA 1P9QC 4MFEA 1JT6A 2IN3A 4E8EA 2M4KA 3CJTB 4IOCF 4O32A 3FY7A 3BG5A 1B9NA 3KM6A 5E79C 2X6WA 2NYXA 3JAMZ 3LJRA 4IKHA 3HSEA 4KCEA 4Y17A 3BG6A 3BR2A 4XKVA 2ZC2A 3SEQA 2FJ1A 1TWCJ 4BKXA 2CAIA 3H79A 1QQ2A 3C71A 1LVAA 3WTVC 4P1WA 2WA0A 1HQOA 5ECKB 5EZGA 4EV0A 5ED4A 3U1KA 1ZZYA 2QKLB 4EM1A 5ECOB 1A35A 4EJVA 2X99A 1XX5A 3LQ7A 2JMWA 2BGCA 5DALA 1AQXA 2EV6A 1IDZA 1R7JA 2ZB9A 4B09A 4HZ4A 4ASNA 1THOA 1TZLA 1Z21A 3V7RA 5IQYA 5J41A 3QOEA 1R1UA 5FO5A 2R92J 1K4TA 4NHJA 2HZTA 3OS2A 1GV5A 2A2SA 2K18A 4I2OA 2H27A 2R7RA 4LLNA 1G7OA 2IS4A 1T4ZA 2BXYA 2OJLA 2TRXA 2X64A 4U0VA 2BHYA 3K2ZA 3CC2I 2KPMA 4LB6B 4TXVA 2IMDA 3TO9A 3WT1A 4O5RA 1MD0A 1R5GA 2A5WA 4CH7A 1RKWA 1UELB 2XAQA 4EJOA 1MZBA 5L3GA 5L3BA 5K5OA 2JT1A 1CF7B 3EE2A 2PBJA 2EIMH 2DIZA 2V41A 2CVBA 2DFFA 4B3XA 4HI7A 4CICA 3MMYB 2O87A 1L3LA 1SD8A 4B8XA 4ZTFA 1LEAA 3HKZA 1EKEA 3G7JA 4HUAA 4HZ2A 4QL9A 2G9WA 4CY8A 2MA3A 1U78A 3I43A 3V7SA 4UUSA 2V6CA 4A3LJ 4ENKA 3IC8A 1Y0UA 3OYNA 1M0UA 1BN5A 4OCFA 3GLLA 4GRFA 4FYBA 5HS9A 4X1EA 3E6DA 5D96A 4V2GA 1YRNB 2EINH 2DJJA 4NWYA 3RYPA 2LTKA 1WPIA 5F1JA 3TW7A 4HX7A 1GSQA 4UB8C 1VNDA 3A3TA 2HLSA 4ZZLA 1QGVA 5FLVA 3KTLA 4HDVA 2OCCH 2GIVA 4C9YA 4PUAA 3WTTC 2LS5A 2V1MA 1A04A 1XGMA 2Z9OA 1NSWA 3OOPA 2PPTA 1KYWA 4WCGA 1FT9A 3WE3A 2VO4A 4QWQA 3VI7A 1G4DA 4I09A 2VM2A 3QOPA 2LTPA 3TP0A 4Y13A 2KKOA 1SFKA 3KEQA 2ZUPA 4ULXA 1RETA 1EGRA 2OF7A 3RJPA 4BL0B 4C2MJ 4ZDLA 2XIGA 3BY6A 5GTIC 3W3CA 4I0AA 1ZK8A 4D9JA 5C44J 2H1AA 4G2EA 4PXOA 4AF2A 4Q5FA 5EGOB 3HXSA 2E19A 1WE0A 2QCOA 2WBMA 3B73A 3ZQIA 5F0FA 3ERED 1U5TC 3UR3C 1JZDA 3FKFA 3UIWA 1V2AA 3CRUA 4EQQA 3MSZA 3FZAA 3OWTA 4U0YA 1IC8A 2A6HF 3RKYA 3ZN0A 2FD5A 2JPBA 3IH3A 3CCJI 1E3HA 2K02A 2WV0A 3EUHA 3S32A 1HYUA 3RAZA 2QA1A 4G7OF 3IRQA 4RLFA 1O85A 3L2QA 1GV2A 3CSJA 3IV4A 1TLHB 4M3GA 1XSDA 3HD5A 2LH9A 4NBQA 5C4JJ 2KLXA 3HHVA 2OBKA 3PQJA 1AOYA 1S6LA 1JGSA 2QUFA 2QGUA 4BJ6C 3GZ6A 2CV2A 1QXHA 1HSTA 4OFNA 4GDFA 4I2TA 1X1PA 1ERVA 3APSA 2H94A 4LIUA 1GXQA 5B3SH 3LSPA 1DP3A 4RBOA 4ENJA 2G7UA 2P6TA 2DQLA 3KP2A 3R61A 4XLHA 2L2OA 2M7AA 2RDPA 1O3TA 1X3ZB 1D1AA 2FA5A 1H4OA 3CRTA 1RI7A 2K8SA 2LDUA 1BEDA 1SJIA 4ZILA 2LSTA 3FR9A 4FIWA 3W8SA 3I69A 5J9BA 5HFKA 2JZYA 2OAZA 5FKKA 4GFBA 5AIVA 1W4VA 3MDKA 4P9UA 3UARA 5IPHA 4XN0A 6PAXA 1GULA 3GA4A 1V40A 3R0JA 2VN2A 1IF1A 1S3AA 5B6NA 1IN8A 5HQPA 1JHFA 4BVXB 4LG3A 2Z9SA 4C30A 2LF7A 3KP6A 4D5FA 2XPWA 5D8LB 1A0FA 2JPCA 4G10A 3BR1A 1X19A 1YEPA 2YPMA 1LU4A 5G31A 3I56I 3Q9SA 2A2PA 4A3CJ 5D5WB 3MZHA 1FJLA 2HOTA 2KJCA 5BNGA 2H01A 3CCEI 2M46A 3K8NA 4AUXA 4HQZA 3OIOA 1BJZA 1EWXA 4MZCA 5E17F 3BTJA 1F37A 5ILVA 1FMVA 2GXAA 3VPRA 2PEXA 5ILUA 2ACJA 1STZA 3DWVA 3DPLC 2HQNA 1AQWA 2VT2A 1NHAA 2DLLA 4TV7A 5GSSA 2XPUA 1F2EA 1WJCA 2CS3A 3LFUA 1UMQA 2CSOA 4DW6A 2PI0A 4G6QA 2WS2A 2HXIA 3S1RJ 2WULA 3LSRA 3EU4A 1D1BA 1BW6A 4V19K 3E0UA 3RHCA 2PLYA 4F7ZA 3U5RE 1CQTA 4XICA 3ZFBA 3ZMKA 1A0RP 5ECMB 1IRFA 1EOGA 3J81K 3HZ4A 4IELA 3UAPA 4YH2A 4EIQA 3F8UA 1OR7C 4PGTA 2WAEA 4G7HF 3N97A 2H73A 2Y0MA 4WF4A 3CQFA 1JJ8C 2EFOA 3BT9A 5D8IA 3FW2A 4CO8A 2VODA 3QAVA 1OC9B 2DIYA 2L6CA 4V1Ag 3FM5A 3KYCB 4I76A 2GBYA 2RNGA 1WQ2A 2Z99A 3DIEA 1WVRA 5FLXZ 4WBRD 3RBTA 2H74A 2WDUA 2HFDA 1QZYA 3D5RC 1XCCA 4OWRB 4M6YA 1YLFA 1QHGA 4PJMA 2C3TA 3NOFA 4EMSA 2H30A 4Q5QA 3P9IA 5BRTA 2BVLA 5C04A 5HFIA 3HXLA 1XPXA 4F92B 4RS8A 2F3MA 4KAEA 1IUFA 1QGPA 4XHMA 3ZREA 1SL1B 1QPMA 3DPTA 1K0CA 5IT3A 1OJLA 1X1AA 3DBLB 1U3AA 3WTWC 1SD4A 2AAWA 4BY7J 3L9VA 1AQVA 1TBXA 4UVBA 3OYJA 1TKDB 2IMKA 3CMIA 4BXUA 3KYLA 4YIIA 1PL2A 2DA4A 3CDHA 4KT5C 2XKPA 3QMXA 1BAYA 1WWJA 2VQGA 2ZCWA 2ECBA 4ZYEA 2HOAA 1Z77A 2OC6A 4KW6A 4A3BJ 4DSSA 3BZKA 3CSHA 2I10A 3ZRGA 4ESFA 2DSAA 4BVYB 3ZQCA 1P6RA 2OTJI 4CY6A 4OIQF 2V79A 4L0YB 4FISA 4NQWA 3KEOA 4DYQA 2R37A 3EMXA 3MWMA 2YZHA 4AGSA 4IEJA 1TQMA 3QYEA 1IYIA 1ABAA 1WOUA 4JK1X 1V3FA 2B5XA 3A2VA 3D5JA 1EH7A 1T56A 2IJLA 3G1MA 2R7WA 1D5YA 2BY1A 3GBGA 3IC4A 3FIWA 1SK0A 4YQVA 2C0EA 4MK3A 2W85A 4II2A 3S3NA 5LNKe 5LEKA 3RQIA 3JRGA 1WJFA 3GYKA 3HOSA 3P9CA 1RK4A 3FKIJ 1KQ8A 2REMA 2FWFA 2FBHA 3ED3A 2CQNA 4HF2A 2HR3A 3BCKA 3IAM2 2DU9A 2JACA 3K2AA 3M9JA 3TRQA 4F93B 3IV5A 1G6WA 3CDLA 2ME0A 3ABTA 1P2FA 2VL2C 3JRIA 2RQQA 1A31A 2HI3A 1AKHA 3NEUA 3LGCA 3LSMA 3KP8A 1R26A 1W5SA 1CQHA 1QO0D 3US3A 4KSOA 3G71I 2R7UA 1ZMAA 3KMOA 3KH9A 4A3MJ 3AG3H 1Z3EA 1C0WA 3I58A 3F72A 1I1GA 2CW7A 2KRCA 2M2EA 2R0GA 1K0MA 1PX7A 4GQFA 4PJJA 4Y52J 4XBFA 1Z6NA 1ZCPA 3E9JB 3KZYA 1OYJA 5D5VB 5BPIA 4TR3A 2IA2A 4XKBA 3S16J 3CSIA 5D73A 1TK0B 3GURA 2DOEA 1K0DA 1FZPB 3BR0A 1LFUP 2H72A 4OOIA 1R4NB 4F03A 3ML6A 1DSBA 5LRRA 3HHHA 5AGYA 1V5FA 2W1OA 2O3FA 4L9JA 4BEHA 2MYSA 2ZBKA 1AWCA 3Q0VA 2VE8A 4HYEA 5FKLA 1K79A 4A3DJ 3TOAA 2K8VA 5JWOB 5F08A 4CYCB 1JKOC 2X49A 2R2JA 1XWCA 2KP2A 1Y1VJ 4KDPA 1USBA 3GF2A 3ZMDA 2MFZA 4AIDA 1SC7A 2I3YA 3BOQA 4EL1A 5IMVA 4HZFA 1V58A 1FNNA 5AIQA 1SK2A 5ERIA 3C1DA 2FWEA 2AB6A 5IYCJ 5ECNB 1ACIA 2X48A 5F27A 3RPPA 3CMEI 5JHUA 3ZVJD 4XLEA 1K83J 2E35A 4PCQA 1MEKA 2L7FP 4NB5A 3DTEA 4R1HA 1XWGA 3GKKA 2FMLA 3MYDA 3MZYA 5HDGA 3R4KA 4UXNA 4M9XA 1GXPA 5HR2A 3O76A 5K5QA 1HNCA 1YW9A 2PMZN 3UL3A 3L9SA 5FD5A 1SFEA 4DVCA 5E3NA 2B7JA 1MJBA 5CRDA 4Z7XA 3MKZA 4G19A 1LFBA 3FZVA 2XHKA 2P0WA 3LA7A 3V1WA 4RMNA 1ERTA 1H0MA 1T4YA 3A01B 2GQKA 3N9JA 2QENA 2DODA 3AL0B 5A5KA 4ETSA 3UVHA 3VPTA 1EOHA 3K1MA 2A5YB 5HOOA 1VQNI 2HVQA 1ETXA 4HBLA 1TP9A 1ZN2A 3LSGA 2A4HA 2PGTA 2DFHA 1K78A 2FNPA 1AHDP 3GYHX 5EVOA 3JW4A 1M9AA 2DMMA 3GTMJ 4PUFC 3QODA 2W24A 3VYSB 4I8BA 2CV0A 3FM3A 3DKXA 4M3FA 1ZELA 4BAYA 4WXTA 3SQNA 4F52A 4ZC3A 2Z3YA 4GSNA 3JCUC 1Z7PA 1ZARA 1GSEA 3RCOA 3RDIA 1PGTA 1W5CC 2LRDA 5DCMB 3FRCA 3H92A 2PWJA 4FASD 4ZH4F 4F55A 2WC2A 4HQSA 5LHGA 3FEUA 4JBBA 2K85A 1U6GA 2CU7A 3KCCA 3TDUC 3WU2C 4G9HA 3OIPA 3ZL5A 4XMYA 3JRDA 4POMA 3ESWB 1APLC 2DCEA 2YP6A 3TEDA 2OADA 5A2QK 3ME7A 4WXCA 1ZYQB 1ON1A 2WY7Q 2KIMA 4IXAA 3HOWJ 4K8MA 2AQEA 2XGXA 2D45A 4ID0A 4TW5A 1Z91A 3E5QA 4NMUA 3SBCA 4HQEA 2DK8A 5JLXA 2DPDA 4ZDOA 1X3WB 2RM6A 4FO5A 2RVCA 4U7BA 2O61A 2M45A 3RQ4A 1JJ6C 2QKMB 3TDGA 4ZIJA 2FBKA 4E70A 2L9SA 3V8KA 4LG0A 4A5PA 2MW8A 5B1BH 5KVRA 3HOXJ 1RW1A 3G3ZA 1YJ6A 2R0PA 2XHFA 2W48A 2HYFA 3PM1A 2W82A 4LLGF 3HRSA 5EZHA 5J47A 2C0FA 4JYKA 1RESA 2YS9A 3WTYC 1GSSA 3EINA 4LL1B 5ICGA 2QSIA 4K2XA 1GVDA 1WRJA 3C73A 3TJKA 2Y75A 5H20A 2HYXA 5LHIA 2DTRA 4BQQA 4B48A 4EGYA 1EZKA 2G0FA 4BHCA 5KCMA 2YCDA 2LVSA 1B6AA 5M5YJ 1E3OC 2RC4A 3K4CA 3S17J 1K0NA 2IMIA 3L7WA 3IH4A 3F3XA 4BUPA 4DBQA 3KJYA 2NRAC 5F1RA 3F0CA 5TRDA 3EU3A 5IOZA 2X4HA 4Y4RA 4BQAA 1TP4A 19GSA 2VASA 1NH3A 5C00A 3BQYA 2VBWA 4ILFA 1UCRA 4WF2A 3I59B 4ECCA 1LUJB 3V8JA 3PO2J 1ON2A 4QIWN 3S1QJ 3GUDA 1GHCA 5E1XA 3SFIA 5CYYA 4NUBA 5CVIA 1B72B 3QYFA 4YFKF 4YAPA 3M8JA 3OYHA 4L9NA 2PQ8A 4BU2A 1HLVA 2VL8A 3DV8A 4PNFA 2M8GX 1J09A 4AYBA 2ZJPF 4LJZF 3RYRA 4A93J 4HOJA 4QPOA 1T0FA 2ZNMA 4M3DA 1YIJI 2O8VB 3Q19A 3BR5A 1O7LA 2L59A 2YJ7A 2BZTA 5ECLB 2A6TA 2NPBA 3QPMA 3DKSA 4NHWA 5H5RA 3E6CC 4KUMA 1YTYA 1HA8A 3PPUA 1GLNA 5IP9J 1B1BA 4C2TA 4C3JJ 1YY7A 3P8WA 2V6OA 2RAEA 5TGTA 3GTUB 2WGRA 4V2MA 5EG0B 4YELA 3GMEA 1T1VA 2VL3A 2A4VA 3GEZA 2M30A 4X43A 1FAAA 1WH5A 4PX1A 4MLOA 4PNGA 1S7EA 2K9FA 1R49A 4EM0B 2FWHA 2P6SA 5F05A 3UBLA 2WAFA 4ZL9A 1KU2A 4M71A 3UMAA 4BL7B 3C2HA 1MMDA 2QF7A 4MTDA 1T08B 1WH7A 2HKXA 3ASNH 3CO7C 5DCHA 1XWBA 3R3EA 3TQNA 1QFNA 4BPYA 1REPC 1TL8A 3PL8A 1NHYA 5D9TA 4OWYA 3UOMA 5HVQC 3LAJA 3K69A 3S8PA 3RZOJ 4KICA 5GAND 2WAQA 3AKZA 3JAMK 4J57E 1HW5A 2G0EA 2UV1A 3HUGB 4KN7X 4V2FA 1GH2A 3TUEA 5CP1A 2EV0A 2LNBA 1SK1A 2L4AA 4KA4A 2YNXA 1VQ5I 3ZTLA 2DBCA 3WG9A 1TC3C 3FZ4A 3PSFA 2HRKA 2Y48A 4PFPA 1MD4A 2X6XA 1HW2A 2KRFA 1FYMA 1LE8A 2GM4A 1SD6A 3AAFA 3A5IA 6GSUA 4UHTA 1K6YA 1G0TA 2OBIA 2D1HA 1Y8QB 1AA7A 4FH8A 2LV3A 2DT6A 1ETWA 2K6VA 1ETKA 4N0ZA 1FIAA 2BBYA 3Q9VA 1LBKA 4JP0A 3A02A 1UVZA 3DLAA 2XAJA 4TR1B 2DO7A 3E6MA 2HVRA 1Z3XA 2E1MC 2J5OA 2V1NA 2HVSA 2DKHA 1HNAA 1WJEA 2CFOA 5HNHA 2CQ9A 1ILOA 2JA7J 3GKNA 1SEUA 2CQ7A 2WB1N 5E3LA 3VPQA 4DIQA 1MMAA 2P8TA 3CCLI 3ZRDA 2EA2A 2FEZA 3I9V2 3FZ5A 1LJ9A 4M74A 3L9UA 4EUYA 3OR2C 4KIBA 5HR1A 3EETA 2IPQX 1MDIA 3WTZA 4DSQA 1HD2A 1KU3A 2DFEA 3BZ6A 5CVJA 2LP0A 2G2QA 1IN6A 2OCEA 2VCVA 5HR0A 1A8YA 1NK3P 4EKZA 3H35A 3JCML 4YFXF 3BP8A 4G12A 1Z05A 4O5UA 4XL9A 2DXIA 1BI0A 2GA1A 1JFUA 2XGEA 1F4KA 2RIIA 2YN1A 2Z1DA 1BW5A 1R5HA 2DW4A 2DJ1A 1JE8A 3LA2A 1V4RA 5E8IA 1S3CA 2DMLA 1TTZA 4OIOF 1K3OA 2H1BA 5IYDJ 5A4UA 1OCCH 4ECJA 1DUXC 5J9CA 2ESHA 4A12A 1PSQA 4A69C 1T8IA 1RUNA 1QMVA 2P7VB 4DNCA 1ZH5A 3GTQJ 2OE0A 2PFBA 2GSRA 4CZZA 1VZ0A 3EQLF 3HBLA 2YV7A 3QFAC 3CMAI 4JRRA 2OE3A 2CUEA 5C3EJ 3WYWA 2DOAA 2E2HJ 4IQ1A 5D6EA 2M72A 1SKSB 3FDYA 4FCYA 5EPFA 3PIPF 1GLQA 1T7PB 3OS1A 3J7YJ 3RIRA 3FXKA 3DP7A 1JZWA 3JR9A 1K3YA 2K3PA 3MKLA 2W25A 3IWFA 3EWLA 4CZCA 1Z3YA 2H1GA 1BI3A 2KLOA 3HPHA 3LL7A 2JA6J 1CQGA 2QSFX 1Y6EA 5CVVA 1MBHA 4MF5A 1ZLJA 4IHTA 1M3IA 2B5YA 2OBPA 2VD1A 3KCMA 4RI7A 1CF7A 1IW7F 3DKWA 1DPUA 3L0HA 2LBFB 2Y0SA 2P5QA 2BHZA 2VJ5A 2ZCTA 4LIVA 1O3QA 4IQJA 2UXNA 1JKPC 2VJJA 1LB2A 2ZFUA 5F6FA 2O9LA 2UZ8A 3JSPA 2VONA 3WT2A 5GADJ 2J23A 1A6IA 3HPGA 3W6VA 4L5LA 4MNNA 3HIFA 2GWRA 1RIOH 4GSTA 1JHHA 4M6VA 4D1QA 3P2AA 5EEHA 2DA7A 4CA0A 1YRNA 2BVMA 1R5PA 4CXFA 2H0HA 2FGXA 4MF6A 1WZ2A 3MCZA 1FB6A 2EZLA 3HRUA 3KLNA 3L2VA 1PQNA 1EEMA 2F5VA 4PQHA 3DFGA 3ELKA 3M9AA 4LMYA 1U5TB 3U9GA 1YJNI 1TTYA 1R5AA 2DJKA 2NTOA 1K6OA 3HJPA 3HVNA 2DN0A 4ISDA 3ZQ7A 5CNWA 1ETYA 4OO4A 3WTXC 3CLOA 2E2MA 4O3MA 5CVUA 1F1ZA 2EIKH 1I5ZA 3GZ5A 3COAC 2O7KA 3J7Yk 1Z1DA 4N9HA 4HDEA 4BHBA 4DZJA 1B8IB 4B4CA 4DOZA 2LYCA 1AC1A 1BG5A 1XVQA 5EGOA 2F5FA 1DE1A 2C4JA 3M8NA 5L3DA 4D0PA 2L57A
chains in the Genus database with same CATH topology
2GOXB 2DLXA 4R79A 4FETA 1JZOA 4KDUA 4K0GA 2E2GA 1B9XC 4WF5A 3IR4A 4II3A 1RQMA 2R3XA 3D0ZA 5AIXA 1N2AA 3UNGC 1PKZA 3CP8A 4KISA 2GGTA 3GRXA 3TOTA 1KTEA 2JVHA 3E0JB 2L5QA 2VLUA 1R7HA 5J5NA 2QA2A 2R4VA 2Q2EB 2GOMA 2IFQB 4HJ2A 1TK5B 3GH9A 5KN2A 3D5SC 4EATA 4IKFA 3PH9A 1D0YA 3MKWB 3IPZA 1EP8A 1Y6IA 1AXDA 4ZTJA 1GRXA 1SKRB 3QYBA 2HI7A 3I6AA 2OV7A 1NHOA 1MW7A 5IIZA 4XIHA 3ISOA 3FMWA 5IMZA 3OR1C 3KP9A 2RUFA 3LWAA 4YKGA 4F9ZA 4O5QA 1GTBA 3KH7A 2XAUA 2P0GA 4MDCA 2BOLA 4BVXA 3SDBA 1DUGA 2JADA 2XSJC 2KDOA 1F9MA 2DJIA 2CUZA 3EUKL 1XOAA 1THXA 3TKSA 3BCAA 2LC2A 2VXZA 3QDNA 1PMTA 4TR4A 5ID2B 4TXOB 1BR2A 2H75A 1X5EA 1GSYA 2GZZA 6GSWA 3DVWA 2XDVA 1U87A 2MMNA 3A4CA 3RSNA 1A2MA 4HS1A 4OO5A 3FR3A 4N4OB 5KNLA 3W8JA 3HZ8A 4LMWA 5LCZA 4JU5A 1I5GA 4BACA 4ZYAA 1FG4A 2XBQA 2XBIA 2I8DA 5DBQA 2LREA 3IA1A 6GSTA 2RM5A 3WGDA 2FCHA 1F3BA 2CW8A 3CJQB 4V1Ap 3M1CA 1TDIA 3A1YA 1GSUA 1OC9A 2HSHA 2CX3A 5JCWA 4MF7A 1GSDA 4KITB 2YWNA 5CAXA 4I2UA 2CZ2A 1MDJA 2CX4A 1Z5YE 4CSWA 2LUSA 4PFOA 3KEBA 2R6KA 3LXZA 3QAWA 20GSA 2HT9A 3OYBA 2C1YA 4J01A 3DTKA 4EVMA 1NW2A 4BXFA 4H86A 3GIXA 2KP1A 4CCLA 4I97A 1ZYPA 3VFIA 5IM9A 4BVYA 1X4OA 12GSA 4NV2A 2HDWA 2VL9A 3VDXA 3LW9A 3IXRA 2CMPA 5FRNA 4YQMA 3F4TA 2JL4A 2NDOA 4K9ZA 3NWSA 1XIYA 4BE0A 1M2BA 3KEYA 3D5LA 4JE1A 3Q18A 2JUGA 2KUCA 3CESA 1XW9A 4PQ1A 5KN0A 3FBIB 3H9QA 5DCGA 4PJLA 4MZBA 4XS4B 5LD0A 1O73A 4XLFA 4E8HA 5B7CA 4QQ7A 5CRHA 1MMNA 4IJ3A 3K10A 4J56E 3K6GA 3BBYA