3IAS2

Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, oxidized, 4 mol/asu, re-refined to 3.15 angstrom resolution
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
178
structure length
178
Chain Sequence
FFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHLQVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAGKRLEEIELPGKCGHHVHEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the mechanism of respiratory complex I
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords NADH-quinone oxidoreductase subunit 1
total genus 50
structure length 178
sequence length 178
chains with identical sequence B, K, T
ec nomenclature ec 1.6.99.5: Transferred entry: 1.6.5.11.
pdb deposition date 2009-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01257 2Fe-2S_thioredx Thioredoxin-like [2Fe-2S] ferredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1590 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3ias201
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3ias202
1XWKA 1PN9A 1XWCA 2PBJA 1Q98A 1QXHA 3GV1A 4HQSA 2LTKA 3ZZXA 1ERWA 1YDKA 1XW5A 5HR2A 2DIYA 3WT2A 4MPGA 3CBUA 2F8FA 3TGZA 3TJBA 4ZILA 3NOFA 4HOJA 4ZL8A 3L9VA 3H8QA 1HNBA 1TI1A 2EIRA 4RI7A 2H1GA 3HKRA 4GSSA 1XBSA 4MJEA 5H5RA 2HT9A 3SBCA 3C73A 1GTBA 2C3QA 2HZEA 5F05A 1Q4JA 3LXTA 1TRSA 2G2QA 2FUG2 1GSFA 4YQUA 2IMDA 4IP6A 5ECQB 4N30A 5F8BA 2CQ9A 1X9WB 3QAVA 1JLWA 4F82A 2WDUA 3KD0A 2PN8A 3VWXA 3VI7A 1JZWA 4ECJA 5B8AA 4NPBA 1ERVA 2WB9A 2H6ZA 4EC0A 2L6CA 4G2EA 3TKPA 5G1KA 1X9MB 3R2QA 6GSUA 2X8HA 2PVOC 1NM3A 1ZMAA 2F3MA 2DJKA 4YQMA 1OKTA 2YNXA 2LUSA 2M46A 5DCGA 2V41A 3TUEA 1USBA 4I6XA 5EPFA 1GLPA 3FW2A 1O8XA 6GSVA 2PVQA 5G5FA 2B3SA 3VPQA 2OE0A 2VL2C 4IS0A 4IKHA 4HDEA 3PR8A 3GUSA 1ON4A 2QSIA 3FEUA 4JZQA 4FO5A 2H71A 3QCPA 4EE0A 3GFKA 2VLVA 3HHVA 1JLVA 1AQVA 3QD9A 2N5BA 1V40A 5ECMB 1ZOFA 1S3AA 3KP8A 3ED3A 2RM6A 2E7PA 1G0TA 1PMTA 1EEMA 5IIZA 4XCSA 5IMDA 1NHYA 5G2ZA 3PINA 4KAEA 4WKWA 2HRFA 1UC7A 5ELAA 4D73B 5JWQB 3MAKA 2JZRA 2GSRA 1B8XA 2MMOA 2YZUA 2RLIA 1NW2A 2IN3A 6GSSA 3RDWA 2FGXA 1AQWA 3UARA 4KSMA 4XIHA 1QK8A 4ML1A 2NTOA 4GWRA 4F2IA 3D21A 4MJAA 5KN1A 3ZFBA 3L4NA 4MH3A 1UVZA 1EOHA 1XOAA 4MJCA 2KLXA 2YV7A 1T7PB 1GUHA 5IPHA 1R5PA 2V2GA 4EKZA 5DALB 4N0VA 2FWEA 4KDYA 4K7IA 2E2MA 5AISA 4MZWA 5DQYA 3HDCA 1OE7A 2JL4A 1O6JA 3GRXA 2VIMA 2V1MA 7GSSA 2DJJA 2A2SA 1FO5A 3ZLPA 3BCKA 3HVSA 4XS1A 1X5EA 1SL0B 2CZ2A 1TJDA 1K0AA 5CAXA 4CHSA 1YJ6A 1YKAA 3GSSA 3HYPA 1JZDA 3DEXA 5AIXA 19GSA 5E4WA 1EOGA 2ZNMA 2P5RA 3ME7A 3LXZA 3VWUA 1G6YA 3O76A 1SD8A 3P2AA 1O8WA 4HI7A 2C8UA 1OYJA 4DEJA 1N8JA 1XWGA 3GN3A 3APSA 5D9TA 2J23A 3QAWA 1SENA 2FD3A 1VRSD 1T8EB 1KNGA 1EV9A 3KEBA 5D96A 2LQQA 5F07A 2WRTA 1ML6A 2BMXA 4QQ7A 3FYGA 1F37A 2MBTA 3GX0A 4EUYA 2TIRA 2ZCTA 4YH2A 1EV4A 2C0GA 2P5QA 1X5DA 4PQ1A 4V1Ap 4ECIA 2CVKA 3C1SA 1T4YA 3UJ1A 4GCIA 4KW6A 1GP1A 1A23A 4BA7A 1X0RA 5C04A 3L9UA 1SKWB 2CVDA 1QGVA 4EL1A 4V2LA 5HFGA 4TXOB 3BBYA 1RW1A 3FZAA 5G30A 5INYA 1G6WA 2OE1A 11GSA 4TR4A 3VWWA 1BYEA 2GGTA 4ILFA 4NHZA 1Z7PA 2RM5A 5AGYA 3FR6A 3M3MA 4TKYA 5IO2A 3LJRA 4LMVA 1BX9A 1EGOA 3CXGA 2DJ1A 4MCUA 3QR6A 1Y6EA 2L5OA 2LRCA 4ZBDA 5COHA 1FG4A 1MD3A 2C3TA 1V58A 2ON7A 4ACSA 4ZIJA 4WEYA 3J7Yb 3TDGA 3GA4A 5E59A 2GSTA 1WJKA 3GMFA 1YF0A 1PX6A 1SL2B 2VO4A 3A2VA 4E8EA 3GKMA 1AC1A 1SD9A 5DJLA 2EC4A 2XPDA 1Z7RA 1A0FA 2IFQB 1TU8A 4MF6A 4PNGA 3IOSA 3M1GA 2OBKA 2PMTA 1FAAA 1ZL9A 5ECPB 3FY7A 1GH2A 4IHUA 3W6GA 1WPIA 5D93A 3UOMA 4MA9A 1DE2A 2YWIA 4CDOA 4MF7A 3D4TA 3C71A 5F06A 5B6NA 1A0RP 1VGLA 8GSSA 1F2EA 4HUAA 3KGKA 3RAZA 2YCDA 3ZVJD 4XTSA 3GYKA 2IMFA 3QAGA 1EGRA 1ILOA 2HXKA 3HVXA 3CTGA 3F9UA 3IHQA 2FWGA 4MPFA 2H30A 3GH9A 4ID0A 3KXOA 2LS5A 5IMZA 4EDZA 4MZBA 3G7YA 5IQYA 2V6OA 2FLSA 2JU5A 3C7MA 1PSQA 3U5RE 1X5CA 1GUMA 22GSA 1X9SB 5JCUA 2R4VA 1PL2A 5DAKA 2WULA 4IBPA 3L0HA 3DIEA 4V2NA 3FKFA 3CRTA 5CRWA 3FZ5A 2WZ9A 1SKSB 2H0HA 3TKSE 2ALBA 5HR3A 4RUVA 2ON5A 2DJ0A 1TK5B 2O89A 3D6IA 4I2UA 4O32A 1J08A 1MTCA 3GTUA 1VF4A 2DC5A 4L8EA 4LL1B 2VL9A 2GT5A 1KBNA 2PGTA 3M9JA 4XRAA 5DJMA 1BG5A 5IMFA 3US3A 5GAND 3UEMA 2AV4A 5JWOB 3WGDA 3ZITA 5DALA 1O81A 3HVVA 3IRAA 2VLTA 3EYTA 2IMKA 3VPTA 1UA5A 2H73A 4EVMA 2HI7A 3HY2A 4NV5A 2H1DA 2VCZA 4NWYA 3DYRA 5ID2B 2N5FA 4HJMA 2YPMA 5CRHA 5KEJA 3IK9A 3Q6OA 1M9BA 4KGIA 2IL3A 4L5OA 2H0IA 1XVWA 2IJYA 2XPEA 1QQ2A 4K2DA 3TKQA 3E9JB 3M9KA 3QFBC 1B48A 3EU4A 1YY7A 3BD2A 4RI6A 1J9BA 3F6DA 1FVJA 4PURA 4ECCA 3CSJA 3I6AA 3WYWA 5AIVA 2I3YA 3CSHA 4PNFA 1LBKA 1XXUA 4XS6A 4GQFA 2X99A 2VCXA 5J4UA 5FWGA 3S9FA 2HFDA 3TOUA 5JCWA 3BOAA 4F03A 1M7TA 2IMIA 3O6TA 1OC9A 3DRNA 1W89A 1GLQA 5CYYA 4AJ6A 3KJYA 3LGCA 2FWFA 1GRXA 2L6DA 3DGQA 1PRXA 2ZUPA 3KTBA 1HQOA 3IDVA 3CMIA 2KOKA 1Z9HA 2J9HA 5J9BA 3GL5A 1J0FA 4V2MA 1FW1A 2DSAA 4TRXA 5G31A 5IMCA 3UVTA 2O85A 1TKDB 2FWHA 2E0QA 3U6VA 4TR1B 4AF2A 3VI5A 1HNCA 4P3YB 2JADA 4HZ2A 4L0WA 4K1FA 1THOA 4V1Ag 5IPGA 3IA1A 4WETA 1K0DA 3A2WA 2VOCA 4GSTA 5ECKB 1XOBA 4NV2A 2H1BA 1GNEA 3H93A 4F0BA 1OC8A 2QC7A 3KMOA 3HJPA 1SK1A 1O85A 3GNJA 3ERWA 3EURA 5ELGA 1TRVA 5ECNB 1XCCA 3QPMA 5LD0A 2M80A 5ECRB 3ISOA 1F3BA 1FHEA 2I4AA 4BVXA 1V98A 1T00A 4X1UA 1ERUA 2V32A 2H6YA 1U3AA 4NMUA 3ZREA 3TKSA 2GDRA 1NHOA 4KCAA 1A2JA 3ZYWA 2VUPA 3GURA 2LNSA 1MEKA 1SJZA 2VL2A 1QFNA 2A2RA 2D2ZA 3GX8A 3KIJA 4K0NA 2B5YA 3IV4A 5LCZA 3UIWA 2P0GA 4O7HA 3N9JA 5HFIA 4FYCA 4IW9A 5A4WA 3RBTA 2I81A 4NXIA 5EVOA 2VCTA 1DSBA 3Q19A 1FB6A 2GQMA 2LQOA 3FZ9A 4FYUA 1MDIA 2A4VA 1PGTA 5GAPD 3TJJA 4PUAA 3ZMKA 1K0NA 4WBJA 3E3EA 2NPBA 17GSA 1ZCPA 3QOUA 5H5SA 2CA8A 4PGTA 1R26A 2R3XA 2CVBA 1ZYEA 4KDXA 4YAVA 1WRYA 2XC2A 2GZZA 4ZB9A 5JWRB 4ZL9A 1ACVA 5DBQA 1R7HA 4ECBA 4ZBAA 2VD0A 5B6MA 3KM6A 5G5EA 2VAFA 4GRFA 5EY6A 3GH6A 2HZFA 9GSSA 2LJAA 1Z3EA 4G10A 5D9WA 3VK9A 4DSSB 3HD5A 5CREA 2FY6A 4Q5QA 2DMLA 1GTIA 2FA8A 1XWAA 2BJXA 3F3RA 1PL1A 2R37A 4K6XA 1B9XC 2IMEA 1TDIA 3F4SA 4TN8A 2MMZA 1HYUA 4MLYA 1SJ6A 4X43A 4H86A 4BVYA 1TOFA 1V57A 4JU5A 5H5QA 2MBSA 3FHKA 3IE3A 3MSZA 2MMAA 1WOUA 1U6TA 2K8VA 1R5AA 1KTEA 2YOIA 2LRTA 3G7JA 3P7XA 4MP4A 2PUKC 4IELA 4Q5RA 4RQRA 2H19A 3E0UA 1O73A 1VF2A 4WF4A 3GHAA 3ERGA 3F0IA 1A8YA 2GT6A 5D73A 4JR4A 3CSIA 2B6MA 2GZYA 1PD21 3NIVA 5CNWA 1OKDA 1BEDA 3ZFLA 2VM1A 1PX7A 1IYHA 3Q18A 3KH7A 3WD6A 3I43A 3ZVJA 1XPVA 3L78A 1YEXA 3I69A 2PPTA 2LKUA 2VL3A 2HYXA 2H66A 3LYKA 2C1YA 4IP1A 2LEGA 4TVEA 5A4VA 2DIZA 5HR1A 3HCZA 2GSSA 4HU7A 3J7Yk 4HJ2A 4ZL7A 1GSQA 1BQ7A 6GSYA 4BWSA 3CTFA 2YZHA 1G7OA 1ERTA 4MJBA 4KCEA 3IPZA 2L4QA 1TTZA 2GSQA 3GIXA 3W8JA 1GL8A 1KEBA 1CQHA 1AAZA 2JSYA 4TW5A 4O5RA 4EDYA 1EEJA 5ECSA 4OFTA 4ISDA 3RPPA 2IIYA 3ZMLA 2K18A 2HSYA 4JEDA 2IPAA 4XHMA 4MH2A 5L71A 3TCOA 2CZ3A 1K0BA 1WIKA 3UVHA 2O87A 1GSYA 4KX4A 4WR4A 2H6XA 2OA7A 5ECHB 2X8CA 2YWOA 3IC4A 2L4CA 3EWLA 3SWLA 4CW9A 5FHIA 3LEFA 5J41A 2C80A 2L59A 3MNGA 3GKXA 3W8SA 4J56E 4TR0A 2EIQA 2R2JA 3QMXA 1SJIA 3ZIVA 2YV9A 4AJ8A 1SL1B 1XIYA 2PWJA 3N5OA 2AJQB 2EIOA 2VCQA 18GSA 4OFNA 1U88A 2JSZA 3Q74A 1A2MA 1RQMA 5KN3A 4L5LA 3JCML 2YJ7A 5EL8A 1OVNA 4RQXA 1R4WA 2MZCA 2QGVA 1GULA 2B7KA 1K3LA 2Z9SA 2KP1A 4K9ZA 1PA3A 3H79A 2R5GA 4N0ZA 3D5JA 4OWYA 2X64A 4MZCA 3KP9A 2B1KA 3D0ZA 1PKZA 4EF0A 3QFAC 4F0CA 2MYGA 4HQZA 4N10A 4PX1A 2C4JA 1B9YC 3BCIA 3MDKA 5J5NA 4OO4A 2F9SA 4OCFA 3HZ4A 3WGEA 3EE2A 2OACA 1GSSA 3UBKA 1S3DA 4DSSA 4FH8A 1EP7A 3WT1A 3V1WA 1FOVA 5J9CA 3UBLA 5A4UA 2CAIA 5G1LA 4LLRA 2LRNA 2H01A 2H74A 2RUEA 3RPNA 2VM2A 4GLTA 5DDLA 4K8MA 1TK0B 1A8LA 2RIIA 4WBRD 3APOA 3I9V2 2B5EA 4MK3A 4QL9A 13GSA 4IN0A 5GSTA 1THXA 3GKNA 1S3CA 5J3RA 3TKRA 4ML6A 4XRDA 1XW9A 4LA1A 3K8NA 3IR4A 10GSA 2VLUA 3OR5A 2WCIA 2LSTA 5HR0A 3KZQA 2WS2A 1FVKA 2OJLA 2C3NA 5DQSA 2E2GA 5KN0A 3A3TA 2CAQA 3RHCA 5KN2A 3KTLA 4MF5A 3UAPA 1XW6A 2HRNA 2HSHA 3HZ8A 1G7EA 1GSEA 4DSRA 3IAM2 1EZKA 2WFCA 1GWCA 3LWAA 1Z5YE 2HE3A 2M72A 3F4RA 2OE3A 3A2XA 4Q5NA 2R6KA 1BJXA 3DXBA 3TRPA 4PQHA 4HS1A 5CRDA 2L57A 3ZL5A 2VCVA 3TKSC 2LV3A 2IFQA 4KB3A 3ZRDA 4JBBA 3FK8A 5IMVA 5CP1A 5ID2A 2H70A 4LMWA 2CX4A 1M99A 5JCGA 4X0XA 2H75A 3IK7A 4KUNA 1XZOA 4I5QA 4Z7XA 2DJ2A 4IJIA 1M2AA 1TK8B 5GSSA 5IOXA 4ZB8A 3L9SA 2OADA 2V6KA 3EINA 5ECOB 1AUCA 4J57E 4TOPA 2FA4A 4Q5FA 5B8BA 3APQA 1Z6MA 4IJ3A 5GZZB 4POLA 1TU7A 4POKA 2WJUA 1WE0A 1O7UA 2FNOA 1F9MA 1F6MC 1CQGA 1EP8A 1AW9A 1XWBA 1DE1A 2K9FA 5CRGA 2AYTA 2WGRA 5IMAA 4LL4B 4ZBBA 2JZSA 3G7IA 2L5LA 4XS4B 1YEPA 1F3AA 3IXRA 4KA0A 1SU9A 3RHBA 2GLRA 1XVQA 4E8HA 4GSNA 1SYXA 3ZTLA 2XBIA 1LJRA 1UN2A 2H0GA 3DVWA 3EVIA 4J2FA 4EXJA 5ABRA 1I9DA 2DMMA 4IQAA 3LG6A 3DMLA 3DWVA 1V2AA 5AN1A 1JHBA 1TI3A 1K0CA 3F6FA 5DVBA 2K8SA 4MABA 1YF1A 2HZEB 16GSA 2KHPA 1JFUA 1TW9A 3H4KA 3HA9A 3TJGA 3EU3A 3DKSA 4OO5A 4KE3A 1H4OA 4KDUA 4K7OA 1B4QA 3D4MA 3CYNA 6GSTA 4BWQA 2MMNA 3F3QA 2VD1A 3C1RA 12GSA 1TRWA 2XBQA 1MD4A 2CV4A 3GSTA 4DVCA 2JZTA 3NZNA 3ERFA 3KMNA 4ZXGA 1K0OA 4L0UA 2FCHA 4POBA 2OBIA 1E6BA 4TXVA 3TRQA 1M2DA 2H8LA 3G9BA 4IQ1A 1M9AA 2HLSA 2AB6A 2DBCA 3TJFA 1IYIA 1TP9A 1A24A 3M0FA 2DJ3A 4YQVA 2FHEA 3LFLA 2IWTA 1TRUA 3PH9A 2C0FA 3HXSA 3TOTA 1EWXA 14GSA 3D22A 3VWVA 1PQNA 2AAWA 1VF1A 5CO3A 1I5GA 4WXTA 5IOWA 4I2TA 2DLXA 2AHEA 3C8EA 3UL3A 2QKEA 1H75A 1JZOA 1T4ZA 1C72A 1ZYQB 3MWHA 1ZGNA 1OC9B 4PXOA 1M0UA 3FRCA 4IGJA 1ST9A 2GZPA 5HQPA 1T3BA 1B4PA 1WMJA 2ES7A 1K3OA 6GSXA 5DCHA 1LU4A 1JZRA 4KSOA 5D9VA 2LJKA 4GF0A 4GQCA 3FZ4A 3UMAA 2G0FA 2KUCA 2KP2A 5A5KA 1QUWA 5DAKB 4AJ7A 1U87A 2OKAA 4POMA 3QDNA 1SK2A 3VURA 1URMA 1DBYA 1N2AA 1YZXA 1U3IA 5ECIB 4K0GA 4PQIA 1GSDA 4WF5A 4DSQA 2AUVA 2I9HA 1E2YA 1Z6NA 4FIWA 4I97A 2F51A 4O92A 2I1UA 2JACA 3GL3A 4NHWA 4JRRA 3LYPA 2C0DA 5ECLB 1K0MA 2GVPA 3VFIA 4KH7A 1SYRA 1W4VA 1GNWA 1PKWA 3IBHA 1TXXA 3LSZA 5B7CA 4GXZA 5FT3A 4XS4A 4TR1A 2PU9C 3ME8A 4WR5A 1V9WA 1YQ1A 4K7NA 2B1LA 4N11A 3EC3A 1HNAA 1FB0A 1XFLA 5LNKe 4PUFC 2XHFA 1OC3A 1AIUA 3P90A 5ENUA 4HEA2 4MMMA 4ULXA 5HFKA 2X8GA 1K3YA 4MDCA 3EMXA 4YAPA 2GTUA 1ABAA 2LNTA 2HNLA 2YWNA 3F8UA 3EMPA 4KNDA 2CT6A 1QMVA 5F0GA 1YKCA 2F8AA 2RUFA 1RK4A 3FR9A 2H76A 2NVLA 2PERA 2YWMA 4JR6A 3GTUB 2GS3A 3TRXA 4AGSA 4F9ZA 2REMA 1WWJA 3WGXA 3F4TA 1ZZYA 4GTUA 5D9XA 3H1NA 1OE8A 3A5WA 1GUKA 3F63A 3BJ5A 4OFMA 1SKRB 5IO0A 3CRUA 3AY8A 4OCEA 4FYBA 2O7KA 1WP0A 2K6VA 3DD3A 4TR3A 2VCWA 4BL7A 2GQLA 1A2LA 2C0EA 1Y25A 4OMVA 4ZB6A 3KCMA 2LJRA 2YP6A 4I8BA 1GSUA 5C00A 1OAZA 1NSWA 3DVXA 5IM9A 1GTAA 3HJOA 4HZ4A 1AXDA 2B7JA 2NBSA 4G19A 1DUGA 4TXOA 4G9HA 2N5AA 1GTUA 20GSA 4JE1A 3PGTA 1VF3A 3P8WA 3LORA 3LQ7A 4BPYA 4QL7A 3IAS2 1M2BA 3GKKA 5D8IA 2H1AA 2NDOA 4EO3A 1BAYA 2B5XA 4HU9A 2O8VB 2YANA 3VLNA 2H72A 1AQXA 3M8NA 4NAXA 3KH9A 3HJMA 2GQKA 2BTOT 3TJKA 2CX3A 3TB2A 1HD2A 2P31A 1MDKA 2YN1A 3ZIJA 2TRCP 1SK0A 4IVFA 2YJHA 3FR3A 3O3TA 4OD7A 1T1VA 4D73A 2TRXA 1MDJA 6GSWA
chains in the Genus database with same CATH superfamily
3HGYA 3MFKA 5DV5A 3LWFA 2A07F 4ON0A 1XWKA 3V42A 3RTRA 1PN9A 1XWCA 2PBJA 3GLLA 1Q98A 4WK8F 1QXHA 3DWLE 3GV1A 4HQSA 2LTKA 3ZZXA 1ERWA 2JSCA 3P5JA 3CLOA 2VJIA 2KQRA 1XW5A 1YDKA 1HW2A 2M3AA 1SAXA 1TQIA 5HR2A 4PJJA 5D6EA 1FLIA 2DIYA 3WT2A 5IT9Z 2DA5A 2MLKA 4MPGA 3JR9A 1YO5C 1U5TB 1PUEE 2F8FA 5F0CA 3CBUA 3TGZA 1A31A 3TJBA 2XC7A 3BLYA 2KDOA 3NOFA 5G5EA 4HOJA 5KCMA 1OR7C 3L9VA 3S2DJ 1D0ZA 3H8QA 4ZL8A 5J6XA 1LDDA 1HNBA 4TV7A 3LMMA 1TI1A 3CUQC 4QIWN 1ZR2A 5IOZA 4MTDA 1PP7U 2EIRA 2H1GA 3HKRA 4GSSA 1XBSA 4RI7A 3QYBA 4MJEA 5H5RA 1R4MB 1B9NA 3WTVC 3HBLA 1VQNI 2HRKA 3CJQB 2HT9A 4S0HB 4CHUA 4PJNA 1MKMA 4G7OF 3SBCA 2R7OA 4G8XA 3C73A 4GYGA 2QSGX 1TP4A 1GTBA 2C3QA 2VASA 4XRMA 2DBBA 2HZEA 5F05A 1Q4JA 5LD2C 1WHUA 1YIJI 3LXTA 1TRSA 2KRCA 2O61A 3BZKA 2G2QA 1LEBA 2FUG2 3K1MA 1KZHA 1GSFA 4YQUA 4D7MA 2UUZA 5LLQA 2IMDA 1WPKA 2E7WA 2LC2A 1GXQA 2QQ9A 1CQTA 2XIGA 4IP6A 3GF2A 3HRTA 5ECQB 4MEYF 3BJAA 1J59A 4N30A 2JRTA 3TO7A 2TRTA 5F8BA 3U9GA 2YU9J 2CQ9A 2P5VA 1K78A 1X9WB 5FLXZ 3HKZA 3QAVA 1JLWA 3KEQA 4F82A 2EFWA 1H0MA 2HVSA 4I0AA 1N77A 2WDUA 3KD0A 2PN8A 1S3RA 3VWXA 3ZQCA 1OCCH 1JUMA 2C6YA 4IHVA 1K4TA 4RLQA 1JZWA 3VI7A 3F6VA 4ECJA 5B8AA 4NPBA 3HJEA 1LFUP 1K61A 1L3LA 1TC3C 2EZHA 2HVQA 3ROUA 2CYYA 2FBKA 3P7NA 2K86A 3LNQA 4B48A 2FEZA 3HPGA 3ML6A 3HSFA 2COBA 1QZYA 1ERVA 2L5QA 1UHSA 2WB9A 2ZB9A 2H6ZA 2BEOA 4EC0A 4I0BA 3C1DA 4M3EA 2L6CA 3ZMVA 2K4JA 5ILUA 4G2EA 5J4YA 4Y15A 4HF2A 3TKPA 2MLGA 2OU2A 1Z91A 3D5RC 5G1KA 1U5TC 1X9MB 1DPUA 3R2QA 1BOBA 2HYJA 2LK2A 2VODA 4KA4A 2X8HA 6GSUA 3A03A 1HW1A 3IKTA 2HEOA 2PVOC 2ZCWA 1NM3A 1ZMAA 4HZ4A 2R7VA 2G7HA 3GTGJ 1XCBA 2CW0F 4KIFA 4ZH4F 3GX4X 2WB1A 2F3MA 2DJKA 4YQMA 2F2EA 3MKWB 1OKTA 2XF5A 3WGGA 2LUSA 2YNXA 2M46A 2QKMB 4ZILA 5DCGA 2XHKA 3TEDA 4IQ4A 3IH4A 2V41A 1Z0XA 4UUVA 1USBA 3TUEA 4I6XA 4IVNA 1W0UA 3C7JA 4XR6A 1GLPA 5EPFA 2R93J 3FW2A 4G0KA 1O8XA 3I4PA 3LFKA 1HCRA 2XB0X 6GSVA 4ESFA 2PVQA 1DGWY 4L5IA 4Q4ZF 5G5FA 2ZO4A 4XSXF 4BVXB 3K9TA 3OYIA 4KF9A 2F5EA 1YX3A 3FXMA 3PO2J 2ZXWH 3S8PA 2DOFA 3S1MJ 3BR6A 3K10A 2B3SA 2OE0A 5D8LB 2JPBA 1HKTA 2VL2C 2P7CB 4IS0A 4IKHA 4HDEA 5HDNA 4DGWB 2NVUB 1GDTA 3PR8A 4HF0A 4A2UA 5HLGA 2BVLA 1I39A 3GUSA 4QTRA 1ON4A 2CUFA 2QSIA 1FIAA 3BTCA 3B6CA 3FEUA 3DV8A 2H71A 4CXFA 3QCPA 4FO5A 4JZQA 1QZZA 4WXHA 4A93J 4EE0A 4YKGA 3IRQA 5L3CA 1R49A 3NARA 4LK1F 3L2RA 3IRRA 1JJ6C 1O7LA 2AXTC 1RR7A 1REPC 4MTEA 4U7BA 1WJAA 3GFKA 2VLVA 3HHVA 1JLVA 2STTA 2DMQA 1AQVA 1X1CA 2GLOA 3BOQA 4K2XA 2ME0A 2M30A 4R8HA 3QD9A 4OWRB 3ECHA 2N5BA 1V40A 5ECMB 1W7PD 3QU3A 1ZOFA 4JX6A 1IRXA 5DCMB 4ZTFA 1S3AA 3KP8A 3ED3A 2RM6A 1S3JA 4O6JA 1MDMB 1AA7A 2E7PA 2ZXJA 3RJPA 2NRAC 3MZYA 4XLNF 1JKPC 1BI2A 3TDZC 3CCEI 3H3UA 3RKQA 1G0TA 3HTUA 1PMTA 1O4XA 1ZHFA 1IRZA 4QWQA 4YEJA 1LE8A 3FK6A 1EEMA 1ZG1A 5IIZA 2X1DA 4XCSA 4B3XA 5IMDA 4IJAA 3K6GA 4E7ZA 2R7SA 4I76A 4JK1X 1NHYA 5G2ZA 1FNNA 1W5TA 2BHZA 5E1ZB 3PINA 4XLCA 4KAEA 4IKFA 3FXOA 2HRFA 4WKWA 1UC7A 5GTHC 5ECPB 3G4SI 5ELAA 3GFLA 4D73B 5JWQB 4DBQA 3BDDA 3WTYC 1Z6TA 1JHHA 2V1XA 2JZRA 3GUDA 2IAIA 3S1RJ 2HOSA 3MAKA 2GSRA 1B8XA 2MMOA 2YZUA 2RLIA 2F5VA 1NW2A 2K3PA 3CJTB 4Q48A 2IN3A 6GSSA 1DGRM 3RDWA 2FGXA 2W48A 1AQWA 4KSMA 4XIHA 1QK8A 3UARA 2LD5A 1Y39A 4ML1A 2EZIA 3R6SA 2DJIA 2NTOA 3HKZN 3MN2A 3H0DA 1ZYRF 1P7IA 2DT6A 2OTJI 2Y0MA 4GWRA 5ED4A 1PP8F 3FMWA 4F2IA 1QQIA 4M3GA 1G59A 2IA1A 3EUKL 4AIJA 3CP8A 3M7GA 2CO5A 3M1EA 3D21A 4MJAA 3F21A 1MSFC 2CRGA 1BIBA 5KN1A 2W4SA 2R7DA 1VTNC 2IEKA 3ZFBA 3L4NA 5J40A 4BHCA 4MH3A 1Z67A 1HBXG 1UVZA 1EOHA 1Z77A 2K02A 5B1AH 2E7XA 3HOYJ 1IXSB 2EZLA 2R7XA 4G7HF 1XB4A 1XOAA 4MJCA 2KLXA 1QZEA 1V5FA 1MJBA 2YV7A 3PM1A 3G6EI 2I5UA 1T7PB 1GUHA 4S04A 5IPHA 1X1PA 5IP7J 3Q0VA 4NC8A 1FPQA 1K6OA 3KP6A 5FFXA 2DMUA 2FU4A 1R5PA 2IP2A 2V6CA 3LSPA 2V2GA 1F9NA 2H8RA 4QPQA 2BW3A 4EKZA 1OLTA 4B47A 2DA2A 3I64A 3NEUA 5CKTA 5DALB 4N0VA 5LRSA 2FWEA 2JT1A 4KDYA 4K7IA 2DT5A 3O3KA 1FT9A 1OYYA 2DDAA 3F6OA 2O9LA 2E2MA 5AISA 4G94A 4WXCA 2A6EF 4MZWA 1MNEA 5DQYA 2EWNA 3HDCA 3JTGA 3IC8A 2Z1DA 5GPCA 5TISC 1OE7A 5IP6A 1ZREA 5EJCA 2JL4A 1AOYA 2DKIA 3TQNA 1O6JA 3GRXA 2VIMA 2K3FA 1RPWA 3DU5A 2V1MA 2QA4I 4N9HA 2A2SA 2DJJA 7GSSA 1FO5A 5IM9A 5A2QZ 3ZLPA 5FD6A 3BCKA 3HVSA 3SHFA 3S3MA 1VQ9I 4AC0A 4WR4A 4XS1A 5ECHB 1MZBA 1X5EA 1SL0B 2CZ2A 1GHCA 2CWEA 1TJDA 1K0AA 5CAXA 2DYSH 3CLQA 4N4NB 1ZN2A 1PVEA 2IGNA 2W24A 4UVAA 5CPRB 4CHSA 1YJ6A 1YIOA 1YW7A 1YKAA 5IT3A 5A2QK 1QA6A 2R7ZJ 3GSSA 3HYPA 2OUMA 1UB9A 3R0JA 1JZDA 2ADUA 3DEXA 2UXXA 1OCRH 3SFZA 2KIUA 2NVYJ 1Y56A 3DTEA 4BQQA 4DYQA 19GSA 5AIXA 5E4WA 2HQ5A 2WBMA 4KMFA 1EOGA 1LNWA 4LOCA 2V1DA 2ZNMA 2E71A 4M71A 4RB3C 3GTJJ 3TL4X 1XS9A 1RESA 4WXDA 2P5RA 3ME7A 3LXZA 3IHGA 3VPQA 3VWUA 1MBKA 4U88A 1G6YA 3O76A 3AG2H 3HC7A 4OIPF 1J0RA 1SD8A 1WQ2A 1Y1WJ 4FQUA 1FSHA 3P2AA 1O8WA 4HI7A 2C8UA 1WI3A 3HPHA 3KP3A 1W0TA 3ERMA 1VQ5I 1S7EA 1ZH5A 1HSJA 2H94A 1OYJA 5BPIA 4A3FJ 4DEJA 5BNGA 1N8JA 1XWGA 3GN3A 3APSA 5D9TA 1CF7B 3H92A 3VSKA 2J23A 3QAWA 5HLIA 4IOAF 2HDDA 1SENA 1ZK8A 1BR4A 2FD3A 1VRSD 3A5IA 1KNGA 1T8EB 4F92B 1D3YA 4ZYEA 3J80K 1EV9A 1MNDA 2KDZA 3KEBA 1TWFJ 2ELKA 3FM3A 1ETOA 3W2WA 3HOUJ 2OZ6A 1GLNA 5D96A 5HS7A 5J1RA 2M8GX 2LQQA 5F07A 1ZELA 2FQ3A 3CC2I 1HSTA 1LVAA 2M34A 3DKWA 3K1PA 2WRTA 3MKZA 1ML6A 2BMXA 3OIQA 3FYGA 4QQ7A 5BOXA 1F37A 2MBTA 2RV8A 3W2VA 2N8GA 1OFCX 3G2BA 3R0AA 1WSUA 3GX0A 4EUYA 2TIRA 1STZA 2ZCTA 4RGRA 4A5NA 4YH2A 2A3SA 1EH8A 2CV2A 1D8JA 1EV4A 1LDKB 1XSVA 2C0GA 5JFRA 2CFOA 5C3EJ 2P5QA 1FOHA 1X5DA 5ICFA 3JRHA 4PQ1A 4V1Ap 4ECIA 2HQNA 1YJ9I 2RQQA 2CGPA 2CVKA 4HNUA 4HNVA 3C1SA 1K6YA 4BEHA 2PLYA 4Y3OA 3S1QJ 1T56A 1IJWC 1T4YA 2BBYA 4L18B 4GCIA 1AHDP 5L3EA 3BG3A 4KW6A 3UJ1A 2FOWA 1GP1A 4YIIA 2ID3A 4HX7A 3H3ZA 3ABUA 4N9IA 1A23A 4BA7A 1X0RA 2L3DA 3JRFA 3ZN1A 5C04A 2QSFX 3L9UA 1TWGJ 1EH6A 4YIRX 1IDZA 2HPMA 2EQRA 1SKWB 2R7RA 4FQGA 2CVDA 2A68F 1QGVA 2COMA 4EL1A 3MMYB 4OAZA 2R92J 1ZYPA 4V2LA 5HS8A 4E7LA 5HFGA 4PSWA 3PQJA 4TXOB 2CUZA 3BBYA 1ZRCA 1BC8C 2F48A 1RW1A 3FZAA 4M72A 2ESNA 5G30A 2BZTA 4II2A 4BE0A 5JHFA 2D1HA 2YX4A 3BR3A 3ZCOA 5J4VA 1G6WA 5INYA 4FISA 5E8IA 2OE1A 1YW9A 3AG3H 2X51A 2GA2A 1Q1HA 2CG4A 11GSA 1EKEA 1E3OC 4DIQA 3LA3A 2KJBA 4L9TA 3UNGC 4TR4A 3VWWA 1IC8A 1G3SA 1BYEA 1LJ9A 1KA8A 3S2WA 4GXOA 1BR2A 2GGTA 2H1KA 4ILFA 4NHZA 3FM5A 1S9HA 3H9QA 2VI6A 5F0FA 1QVUA 2GA1A 3CO6C 5DM6F 1Z7PA 2RM5A 1WJ5A 3FR6A 4E70A 1R00A 3M3MA 3V4GA 4TKYA 1SD7A 3LJRA 5IO2A 3ZQLA 2W00A 1N78A 3LSGA 4LMVA 2W25A 3WU0A 1BX9A 1EGOA 2DPUA 5CQGA 2HDWA 1MJ9A 3CXGA 3ESWB 2DJ1A 4A0ZA 3ZQIA 1CGPA 2PG4A 1J2XA 2DJNA 1ON1A 4MCUA 1IRFA 2M5WA 3QR6A 2EPFA 3SZPA 1DP7P 1XSXA 2H6BA 1U8RA 3K1NA 1SD6A 1Z1DA 3K4NA 5EEGA 3OS2A 1Y6EA 2L5OA 2BOLA 2LRCA 5COHA 3K4LA 3PNVA 3WTTC 4ZBDA 3C2HA 1FG4A 1MD3A 2WB1N 1JXSA 2VBXA 2C3TA 1V58A 2L2OA 2ON7A 4ACSA 2NS7A 4F55A 2L9VA 4KYWA 4WEYA 2ZSHB 4ZIJA 3J7Yb 3GEZA 3TDGA 2Y31A 3LQQA 1ETXA 1WI9A 2WADA 3UKGA 2ELHA 3GA4A 5AGYA 5E59A 3AFHA 1RETA 3HUGB 1VQLI 1MGTA 2JJ7A 4PDKA 1Z3XA 2GSTA 1WJKA 4PK4A 2BY3A 3OYDA 4GDFA 3GMFA 1YF0A 1PX6A 3VDXA 3JRGA 3K7AJ 1SL2B 4UNOA 4GO1A 1BOAA 1UZCA 2VO4A 3A2VA 3GKMA 1SVOA 4E8EA 3DP7A 4RAFA 1AC1A 1SD9A 3FXJA 5DJLA 2EC4A 4BEHB 4XORA 2XPDA 2VQHA 4ZJZA 1Z7RA 4RDUA 3J81K 1FJLA 1MJAA 1YYVA 2A05A 1A0FA 4BJ5C 1FWZA 1V54H 3U2RA 1RKTA 2ZC2A 4CH7A 4E7KA 2IFQB 1SMYF 1TU8A 1FSEA 4MF6A 4PNGA 3D1NI 3RZDJ 3IOSA 1LVKA 1TQPA 3M1GA 5ICGA 3RIRA 3REOA 2OBKA 4NC7A 2F5CA 3F8MA 2DA1A 1VQOI 2E1NA 1IN5A 3FBNB 3ZQGA 2IS6A 2PMTA 2CQKA 3A2KA 2QLZA 4JX4A 3ASNH 4IEJA 4LD5A 2P7VB 2IW5A 1FAAA 2NNYA 2A69F 3ZQHA 2B9SA 1ZL9A 3OIOA 2E36A 2RREA 3KZYA 4XN3A 1GH2A 1TZLA 3FY7A 4IHUA 3W6GA 2O0YA 1WPIA 5D93A 2EA4A 4FCYA 3OYFA 1HW5A 1D8KA 1TNTA 1YJNI 4D9JA 2R7UA 3UOMA 1A6QA 3BG7A 4B1RA 3GFMA 4O5QA 5L3GA 4MA9A 5K1YA 2W82A 2VBYA 2BV6A 2XAGA 2YWIA 4CDOA 1DE2A 3I55I 4MF7A 3WTSC 4JBAA 3HHGA 2ZMEA 3KETA 3D4TA 1RUOA 4RM3A 3C71A 2KLOA 5F06A 4H0EA 5B6NA 4NUBA 2XAQA 5GPAA 1ZGWA 1A0RP 6PAXA 2W57A 3FKJA 1VQ4I 4EJOA 3HOTA 1VGLA 8GSSA 1F2EA 5D5VB 4HUAA 4NC6A 3KGKA 2R5ZB 1BIAA 1D5YA 2LREA 3A0BC 1RRJA 3TGNA 1HF0A 3EPTA 3HGGA 3IV5A 1EJ9A 5DM7F 2YCDA 3RAZA 3MYDA 3ZVJD 4XTSA 3JAMZ 1Y8QB 3EDPA 3IL2A 4S05A 3SDGA 2FXAA 2QWWA 3WODF 4X4JA 2EFQA 2EFPA 4ESJA 2HXIA 2BXYA 3GYKA 1KQ9A 3F8FA 4B43A 2LFBA 4BY1J 1P4AA 3HUGA 2BE5F 5H2FC 2M45A 3E0JB 2R5ZA 2IMFA 3K0LA 3QAGA 1ETQA 4LITA 1M1EB 5LGUA 2ZJRF 3OOPA 1ILOA 1EGRA 1T6SA 4J19A 2HXKA 2ZKZA 3CTGA 3HVXA 3I3LA 1YG2A 3M8JA 3K70C 2XRNA 3CP2A 4HPQA 2FWGA 3F9UA 3IHQA 4MPFA 2H30A 3GH9A 1R5ID 2L01A 4ID0A 5AONA 4KT5C 1LPQA 4EATA 4QLCU 1FTTA 2R0GA 3H1CA 2LS5A 3KXOA 2E5NA 3EQLF 3EPZA 5IMZA 3K69A 4FTHA 4EDZA 3IWFA 4MZBA 3G7YA 5IQYA 3QU6A 2JRMA 5IYBJ 2V6OA 4H4KC 5GAHJ 2FLSA 5BQTA 2ISZA 3FX3A 1TW2A 1ZQ3P 1X58A 1PSQA 2JU5A 1GUMA 1X5CA 22GSA 3C7MA 3U5RE 5DDGA 1X9SB 2F4IA 4XRSA 1BL0A 3WE3A 5JCUA 4BQOA 1OCZH 2RAEA 2R4VA 1F5TA 2XKOA 1PL2A 3RKWA 1LB2A 5DAKA 2WULA 3DEUA 3CQZJ 2JA5J 4IBPA 3BJ6A 1FTZA 1X19A 1FYKA 1YHQI 3S2HJ 3GYHX 2DFIA 3RI4A 2L7MP 4YFXF 3L0HA 3O8GA 4B8XA 3F8CA 3DIEA 4V2NA 3MKYB 2W84A 2AXLA 3M9AA 3FBIB 2VBZA 3KMOA 2EFOA 5DUIA 4Z2YA 3FKFA 5M5WJ 1T0FC 2ECCA 1RNLA 3CRTA 3FZ5A 5CRWA 3GO5A 4HOBA 4XLAA 3OYBA 2WZ9A 1SKSB 4MLOA 3CO7C 2H0HA 2A5YB 3LSKA 3TKSE 4CY8A 4EGYA 4A3LJ 2VJ4A 2O03A 4HNTA 4K5RA 2ALBA 4D5CA 2QCOA 2LBFA 5FRNA 3BPVA 5HR3A 4RUVA 2ON5A 2DJ0A 2FE3A 2YUSA 3HSRA 1TK5B 1ZLKA 4I02A 2JUCA 3IH3A 1I3QJ 2O89A 3D6IA 4RB2C 4C3HJ 4I2UA 3M8EA 1J08A 4O32A 5K5QA 1BBYA 3OYCA 4XIDA 4XOTA 4KUMA 3WGIA 3CD6I 1O3TA 2HRAA 3F3XA 4FASD 5JR3A 2PJRA 1HC8A 3SEQA 3U21A 1MBEA 1MTCA 4A3JJ 1VF4A 3GTUA 3RZOJ 2DC5A 3BTLA 2I10A 4CZCA 3ONQA 4L8EA 4LL1B 3QPLA 2W7NA 2VL9A 3L2WA 3TMOA 2GT5A 1KBNA 4BGDA 1IXCA 3KCCA 1MBFA 4PSXA 2PGTA 3M9JA 4XRAA 5DJMA 1ZGAA 1BG5A 5IMFA 3FDYA 3US3A 5EZHA 2IVMA 5GAND 3UEMA 2NOJB 2NVQJ 2AV4A 3CC7I 1SMTA 3KP2A 1R5GA 1RKWA 2DI3A 3WGDA 3ZITA 5JWOB 2QQ8A 3GW2A 3LW9A 1YLFA 3LSMA 4PUSA 1IN4A 2BYVE 3QPTA 4HQEA 1LE8B 2O8KA 5DALA 1TWAJ 1O81A 3CMAI 3HVVA 4XONA 5LGNA 5FO5A 3IRAA 1S29A 2VLTA 3PIPF 1R5HA 3FK7A 4ENMA 2DXIA 2X48A 2IMKA 3JRAA 3EYTA 1VI0A 4L9NA 2H27A 1UA5A 2M7AA 2H73A 3VPTA 4XSZF 4BDYA 4EVMA 2HI7A 2VQGA 1Z9CA 3HY2A 2IGOA 2DDBA 2CW8A 2WV1A 1ZG3A 3H9JA 2XAFA 2VOPA 3CTAA 3RCOA 1T38A 4I2OA 2H1DA 2XAJA 2VCZA 3DYRA 3S3OA 2N5FA 1YX5A 5EGOB 4HJMA 5ID2B 3G1MA 5FKNA 4E6KG 1WJBA 1O3RA 2QA1A 2YPMA 1BI1A 5CRHA 3OYJA 5KEJA 2FOKA 3IK9A 3E97A 1JTXA 1M9BA 3Q6OA 4KGIA 4BXXJ 3OS0A 2IL3A 3F9KA 2JMWA 4L5OA 3GZNB 3KYCB 5JLWA 3S3NA 3FZVA 2H0IA 1XVWA 2IJYA 4RM2A 4EEFG 2XPEA 2EV6A 1O3QA 1QQ2A 4K2DA 4RA2A 3E9JB 3SEZA 3Q9SA 4G6TB 3M9KA 3QFBC 3TKQA 2JK3A 3E5UA 1B48A 5IP9J 2MFZA 1YY7A 3EU4A 2JPCA 3BD2A 3HDDA 4RI6A 4Y33A 3Q0UA 2MYSA 1J9BA 1FBSA 3F6DA 2OQRA 1FVJA 4PURA 4ECCA 1F43A 3LOCA 2VT3A 3CSJA 3PSFA 3I6AA 3GLXA 1R7JA 3QODA 3WYWA 3COAC 2VBWA 1ENHA 5AIVA 1R22A 3RYRA 1PUFA 2I3YA 3CSHA 1S8NA 2DK5A 1SVLA 2ZJ2A 1JTYA 5H6QA 4PNFA 2L4AA 3KZZA 1LBKA 1XXUA 2IA2A 4XS6A 2HYGD 4MFDA 2HKXA 4GQFA 1QNTA 2MH9A 4GYIA 4GGGA 2X99A 2VCXA 5J4UA 1B59A 3FMSA 5FWGA 3S9FA 1B8IB 2HFDA 2DAOA 4ESBA 2K5CA 3OR2C 2Z5UA 3ULQB 3TOUA 4XKVA 4NDLA 5DS9A 4A3DJ 5JCWA 4AM3A 1RC9A 3BOAA 4F03A 4GCVA 4M9ZA 1W5SA 1M7TA 2IMIA 3O6TA 2QENA 3S32A 1OC9A 3DRNA 4ZTJA 1GLQA 1W89A 4MHGA 4G0IA 2KIQA 5C44J 2XV4S 5CYYA 2F5FA 4AJ6A 4NBQA 3KJYA 3DLLF 1Z3YA 3LGCA 4CYCB 3QOEA 2FWFA 1GRXA 2L6DA 3DGQA 4D7NA 1L0OC 1PRXA 2ZUPA 3KTBA 1HQOA 4DYRA 3IDVA 3CMIA 1P4XA 3L2VA 1VF9A 4WCGA 3VYRB 5GP9A 1E2XA 2FNAA 2ZFUA 3BWGA 4C2UA 3OSGA 4Q5SF 1ODDA 1Z9HA 2KOKA 3I4NJ 2J9HA 3FKIJ 2M87A 4A0YA 5J9BA 3GL5A 1J0FA 2RGVA 2E1OA 3DLAA 4EJVA 4BJ6C 2HS5A 2JA6J 2NS0A 2O6GE 5DCMA 2HU9A 5IPAA 2PN6A 3FMRA 4BHBA 2KP6A 4DZPA 4V2MA 5F1JA 2FBHA 3JREA 2X0LA 1FW1A 2DSAA 1ZGJA 4TRXA 2V9PA 3E1SA 2EJRA 2ZMEC 5EGOA 3HL2A 1NH3A 1IUFA 1DP3A 1T2KA 1HOMA 3MIXA 3BG9A 3K4MA 2O85A 5IMCA 3UVTA 1TKDB 1W4MA 4BL0B 2FWHA 2E0QA 3U6VA 4TR1B 2KHMA 3HTSB 1D1CA 1MMSA 1SEUA 2ICWG 4E4HA 3DCFA 4AF2A 1ETWA 3VI5A 1G3TA 2XGCA 1HNCA 4P3YB 2BXZA 2GIVA 4M74A 4WF2A 1O57A 2JADA 4HZ2A 4L0WA 4K1FA 1XX5A 1THOA 4V1Ag 5IPGA 2LVSA 3IA1A 4WETA 1IN7A 3E6DA 1K0DA 2K27A 3A2WA 1YOVB 3CCRI 2X9DA 2VOCA 1QRYA 1JT0A 4GSTA 3OYNA 5ECKB 2M4GA 3QP5A 1XOBA 4NV2A 2CU7A 2LY2A 4HA8A 4P96A 4B3AA 5TRDA 1S7OA 2XVCA 2KPMA 2H1BA 1GNEA 4CGZA 3H93A 1XMXA 3G3ZA 5E8GA 2VJ5A 4F0BA 1ERDA 1V5GA 2A6HF 2FRHA 1OC8A 4OMYA 2QC7A 2MD0A 3Q5FA 3KIOA 3PFYA 1SK1A 3HJPA 2B0LA 1O85A 1XMKA 2E2JJ 3GNJA 4PFOA 3TW6A 1H88C 5M3FJ 3MD2A 4EVIA 4QPOA 1TWHJ 4KN4X 1R1TA 4CO8A 5L3BA 3ERWA 1T08B 2WAFA 2W85A 3MKLA 4I6ZA 1M3IA 1TRVA 3EURA 5ECNB 5ELGA 3RDIA 1XCCA 3QPMA 2DFEA 2NXNB 2UV1A 3K4JA 4J00A 2VB6A 4EIQA 1D1BA 1X3UA 4LG0A 1I50J 4XICA 1XDUA 1UHMA 1YRNB 1KU7A 5LD0A 5F08A 2FD5A 2M80A 3WG7H 2RQPA 5ECRB 1ZYNA 3M07A 2BGCA 3ISOA 4YFKF 1F3BA 1FHEA 2I4AA 3A0HC 1FOWA 4BVXA 3BTIA 2PEXA 3TBIA 1OYWA 1T00A 2MC4A 2X85A 1UG2A 2LSOA 3TO9A 4MO7A 1V98A 4ZC3A 4X1UA 1K78B 1ERUA 2V32A 1A04A 2NNNA 4BXUA 5J8FA 4LG0B 2H6YA 4EMSA 2R3SA 2ZFWA 5DTDA 1R4NB 2XAUA 3ABKH 1U3AA 2QF7A 3S15J 4NMUA 3ZREA 3TKSA 2GDRA 1NHOA 5KVRA 4KCAA 1A2JA 1ZKGA 3WHCA 1U9OA 2LH9A 3ZYWA 3HRMA 2VUPA 4RBOA 1LUJB 1XMAA 1WJFA 3GURA 4NQWA 3TP3A 3VB2A 5LHGA 1YFHA 2LNSA 5B5EC 1MEKA 1SJZA 1W5CC 3B02A 4LG3A 3FISA 2XGEA 3CJRB 3CMMA 1QFNA 2VL2A 2K9MA 3SZGA 4DBRA 1JKQC 2A2RA 2XF7A 1I1GA 2D2ZA 1HXDA 3GX8A 1X4OA 3KIJA 4K0NA 3DBHB 2VPRA 5BPDA 1BN5A 3KEYA 2B5YA 3IV4A 5LCZA 3UIWA 3I58A 4G7ZF 2MGQA 1K79A 1H9GA 2P0GA 4O7HA 1VFCA 1U6GA 2CQQA 3N9JA 3BR2A 5HFIA 4ZDLA 3VOEA 4FYCA 2H6CA 4LIUA 3FF5A 4IW9A 2M4KA 4D1QA 3J7AY 5A4WA 1NK3P 2DQLA 3RBTA 2I81A 2X4HA 4NXIA 5EVOA 3E7LA 1DSBA 2VCTA 1YS7A 4DNCA 2CS3A 3Q19A 1B72A 1FB6A 2MSYA 3H35A 2GQMA 2IS1A 2LQOA 4ULXA 2ZNZA 3GTMJ 4O3MA 3FZ9A 3PPUA 2E2HJ 4FYUA 4W1UA 4I09A 4M6VA 1QHHD 1C0WA 1QPMA 1MDIA 5FFZA 3L9FA 5F64A 4YKFA 3MQ0A 1MMNA 2A4VA 3JRBA 1PGTA 4MNNA 5GAPD 3TJJA 4PUAA 1IGNA 5CVRA 3DBRB 3ZMKA 4BXFA 4BQAA 2EB7A 1K0NA 4WBJA 3E3EA 2NPBA 17GSA 3KLOA 1ZCPA 3F0CA 3QRFF 3QOUA 5H5SA 2CA8A 4PGTA 4PTSA 3HZJA 3D5SC 4OINF 1R26A 3SYTA 1H89C 2CVBA 2R3XA 1ZYEA 3J81Z 4KDXA 4X1EA 3F22A 4WX9A 1WJEA 4YAVA 1WRYA 2XC2A 1WGXA 2WY8Q 2GZZA 4ZB9A 5JWRB 1ACVA 4ZL9A 5DBQA 5HNFA 4ZDPA 1R7HA 2V1UA 1XG1A 2KT0A 4I98B 4ECBA 1ZARA 3J7ZI 2LKPA 4ZBAA 2VD0A 5B6MA 3KM6A 2VAFA 4GRFA 3WGHA 4M73A 1D0YA 3GH6A 5KNLA 4UB6C 4Y52J 2OZUA 2XAHA 2HZFA 5EY6A 2LJAA 9GSSA 1Z3EA 1UELB 3I53A 4G10A 1I3AA 2X6OA 5D9WA 3RQ4A 3VK9A 3BJOA 4DSSB 5HLTA 3TP0A 3HD5A 4JOMA 2V1NA 3EUHC 2F5DA 3CMEI 5CREA 1AU7A 2FY6A 4Q5QA 2DMLA 4LJZF 2L9NA 3IC7A 1GTIA 4ZYDA 2FA8A 3S14J 3E5XA 1XWAA 1WZ2A 1VQMI 2BJXA 1PL1A 2R37A 3F3RA 4K6XA 1B9XC 3K4BA 2IS2A 2OC6A 3NWTA 2IMEA 5LEJA 3CCUI 3PUFA 1TDIA 3GZ5A 5F1RA 3SDBA 3HXLA 3KLNA 4PFPA 4BJTA 3F4SA 1OISA 1NHAA 4TN8A 2MMZA 1HYUA 4MLYA 3ECOA 2ZXIA 1SJ6A 4X43A 4H86A 1BW5A 4BVYA 1D0XA 1TOFA 1V57A 4JU5A 5H5QA 2MBSA 1EH7A 4PCQA 3FHKA 3IE3A 5D4SA 1Z6RA 5JI6A 3MSZA 4CCNA 2MMAA 5FKOA 3S93A 1OKRA 1WOUA 1ZLJA 1LKXA 3PNTA 4W97A 2XUBA 4FETA 1APLC 1U6TA 2DMPA 2H8WA 2K8VA 1RR8C 2RNGA 3J7YJ 1OMIA 2DN0A 3FXKA 1R5AA 3WHBA 4BDZA 2V9VA 4LK0F 1KTEA 2YOIA 2LRTA 3WTZA 3G7JA 1V55H 5LHHA 2PUKC 3P7XA 4IELA 4MP4A 4Q5RA 3CMYA 4RQRA 4O5UA 2H19A 3E0UA 1O73A 4N4OB 2CH0A 5IYDJ 1VF2A 4WF4A 3GHAA 3C3WA 3ERGA 4KT6A 3VEPA 3R61A 1ONVA 1JKRC 2AS5F 1A8YA 2E35A 3F0IA 1JGSA 2GT6A 5D73A 3MAJA 3CSIA 4JR4A 2B6MA 4HBLA 3C2BA 2GZYA 3ZQQA 1IUYA 2DOEA 5IY5H 4U0YA 1PD21 4BY7J 1VQ6I 3NIVA 2EFNA 3L7WA 5CNWA 4F52A 1GUUA 1TWCJ 1BEDA 2JA2A 1OKDA 3ZFLA 4IX7A 2VQCA 2JTVA 2VM1A 4KJZA 2ID6A 1NG6A 2DPDA 2HOAA 1PX7A 1IYHA 4BS9A 3Q18A 3KEOA 3KH7A 4G0LA 1YQAA 3WD6A 3I43A 2L54A 4EV0A 1M3JA 5EG0A 3ZVJA 5CQEA 4G12A 1XPVA 3OL3A 3L78A 1CF7A 3HOWJ 2XPUA 3H5AA 3IHUA 1YEXA 4CYCA 3I69A 2MD5A 2PPTA 4Z2RA 3BY6A 5C4XJ 2LKUA 3B6AA 2VL3A 2WAQA 1B1BA 2CW7A 2P6SA 2HYXA 2H66A 3LYKA 4L9VA 2IA0A 2C1YA 2R7FA 3BQYA 4CDGA 2Z2SB 4IP1A 3ZGKA 3KE2A 2LEGA 3EYYA 3LA7A 4RB0A 4TVEA 5A4VA 2DIZA 4OU0A 5HR1A 1IZ1A 3HCZA 2GSSA 1R36A 4HU7A 3J7Yk 1Z21A 4HJ2A 3GTOJ 4OIQF 1SFEA 3MCZA 4ZL7A 3L00A 3LA2A 1GSQA 3B73A 2IS4A 2EK5A 1MIJA 1BQ7A 6GSYA 3OS1A 4BWSA 4HZFA 3CTFA 2VQLA 4RB1A 2YZHA 1G7OA 2FF4A 2HOTA 1FC3A 1ERTA 4YELA 4MJBA 4KCEA 1I6HJ 2XKPA 5F0HA 4RLFA 1B6AA 2DOAA 4BIKA 3IPZA 2L4QA 2F4OB 1FBUA 1TTZA 5EDNA 2GSQA 2WAEA 4IXAA 3RKXA 3GIXA 3W8JA 2FNPA 1ZG5A 1GL8A 4BVYB 5JHUA 1KEBA 1CQHA 2LY1A 1USTA 3OIPA 1AAZA 2JSYA 4TW5A 1KU2A 4O5RA 3W6JB 4EDYA 5M5XJ 3ZOBA 1EEJA 2Y2ZA 1MBJA 5FJ8J 3N4MA 3DF8A 4XLFA 3L2CA 5ECSA 4OFTA 3BZCA 2E1MB 2KIMA 2UWMA 5E79C 3QQAA 1GV2A 4ISDA 5M3MJ 3RPPA 1WCMJ 3GVAA 1YI2I 2GAUA 2IIYA 2L7KA 1YW8A 2LR8A 3ZMLA 1UMQA 3IP4B 2K18A 2HSYA 1G8XA 3Q3SA 4CA0A 4JEDA 2IPAA 1SANA 4XHMA 3CZ6A 4MH2A 5L71A 3TCOA 3GWZA 2X6YA 3HOVJ 2Y75A 5GAGJ 3ELKA 2CZ3A 2X1CA 2PFBA 1AKHA 2KMUA 3LSIA 5HODA 3ERED 4A6EA 1K0BA 1TT0A 2MW8A 2RC4A 1J5YA 3FXUA 1WIKA 1G3YA 1E17A 2O87A 3JRCA 3UVHA 1GSYA 4P9UA 2L7ZA 4KX4A 1P7JA 2H6XA 2OA7A 1XGMA 1W36C 2X8CA 3G1OA 1X3ZB 3AG4H 3HIFA 3HRUA 4UUSA 2L4CA 2YWOA 3IC4A 1GVJA 4XQFA 3EWLA 3FXRA 3SWLA 4JQFA 1JJ8C 3K2ZA 2ETHA 3PFIA 3A01B 5FHIA 4CW9A 2EH3A 3LEFA 2HSMA 5J41A 2M2EA 2C80A 3CDLA 2L59A 2K40A 4XK4A 3MNGA 3I4MJ 2CSOA 3GKXA 3T0YA 4J56E 2K4BA 2Q1ZB 4K5SA 4TR0A 3W8SA 4IO9F 2DMNA 1XGNA 2JUGA 2P81A 1TBXA 2EIQA 5TGTA 2R2JA 3QMXA 4J01A 1U9NA 4GRIA 3LAJA 1SJIA 3LSTA 4XOPA 2D45A 3ZIVA 4ASNA 3PQKA 2RDPA 4XNFA 4Z6YA 1Y0NA 2KJCA 2YV9A 2QM3A 4AJ8A 1SL1B 1ZRFA 3BG6A 1XIYA 2PWJA 4NV5A 3N5OA 3I54A 2AJQB 2WA0A 3CUQB 5CJ9A 5D6FA 4F93B 2EIOA 2VCQA 18GSA 4A5PA 2L9SA 2ZJPF 4OFNA 2WTEA 1U88A 2JSZA 3Q74A 1XGSA 4WWCA 1A2MA 3CF2A 1RQMA 4M3DA 3VFZA 1XSDA 5KN3A 4HLXA 4HDVA 4CUGA 4F91B 4L5LA 2JA7J 3JCML 2YJ7A 5EL8A 3OY9A 5J47A 1UG0A 1MMAA 4AYBA 4ANJA 3CUOA 3RPQA 4KFCA 1OVNA 4Y4RA 3TO6A 4RQXA 2HVRA 1R4WA 2MZCA 5D5XB 1GULA 2HTSA 1MBGA 4A5MA 1K3LA 2B7KA 2EV5A 2KISA 2QGVA 4CY6A 2Z9SA 4M6YA 1QBJA 4PGGA 2KP1A 4K9ZA 3HYIA 4M6XA 2JQ7A 2VN2A 3CF5F 3L09A 3MEXA 3M8FA 1PA3A 1UFMA 4O5VA 1BJAA 3H79A 2R5GA 1PUFB 3DTKA 3D5JA 4N0ZA 4OWYA 1W36D 2K9LA 2LLKA 3I59B 1W7PA 3T8RA 1MH4A 2K9NA 2ZJQF 2X64A 1R58A 1DUXC 5H6RA 2VE8A 4JYKA 4M9XA 3EETA 3KP9A 4MZCA 4U7DA 2OQGA 1A6IA 2QKLB 4D5FA 2R5YA 1VQKI 2B1KA 2DU9A 3V8KA 1NK2P 2XB5A 3D0ZA 1S7AA 1P2FA 4A12A 4JP0A 1MMGA 3QOPA 2NVTJ 1PKZA 2M9HA 1WH7A 2PMZN 2K7LA 2Q2EB 4LGWA 3M4OJ 5L3FA 4EF0A 1FOXA 3QFAC 4F0CA 2IGMA 2MYGA 3CCYA 4HQZA 4RGUA 2BVMA 4N10A 3BCBA 4PX1A 1XG8A 2C4JA 3T1BA 3A01A 2HFHA 1B9YC 2M7BA 4A3IJ 5LHIA 2QSHX 3BCIA 3MDKA 2K85A 4L9JA 2OBPA 4LLNA 5J5NA 4OO4A 2GOXB 2MBFA 2NAZA 2VKVA 2F9SA 1LFPA 4II3A 4FHTA 5GTIC 4OCFA 4UVBA 3HZ4A 4PJLA 2AO9A 3FXLA 1EF4A 5HLHA 2RKHA 2KRFA 2V9KA 4R1HA 3WGEA 3EE2A 4CCKA 1O3SA 2OACA 1GSSA 3UBKA 3P9KA 1S3DA 5JVGF 2NYXA 4L0YB 4DSSA 4FH8A 1EP7A 3WT1A 1FOKA 3V1WA 1FOVA 1HDPA 1XGOA 5J9CA 3V8LA 2Z99A 5A4UA 3UBLA 1B8IA 2CAIA 4USSA 5G1LA 2LTPA 5E3OA 2HYFA 4LLRA 1V5EA 2LRNA 2H01A 2J5PA 2VKDA 3BTJA 3V7CA 2MH2A 4MFEA 2JZYA 2RNJA 1RUNA 2H74A 2RUEA 2OCCH 4HQMA 3NWSA 2VC0A 5ICEA 2QBYB 3RPNA 3R4KA 1GXPA 2VM2A 2UXNA 2XPVA 4GLTA 4ICYA 5DDLA 4K8MA 2CQ7A 2VXZA 1TK0B 5E3NA 1A8LA 2RIIA 3NAUA 2Z33A 2G7UA 2NOGA 2A5WA 3SFIA 3GTPJ 1ACIA 3LSJA 4WBRD 2BHYA 3APOA 2PQ8A 2LDUA 3I9V2 3BCAA 3HRSA 4FX4A 2B5EA 4MK3A 4QL9A 3IKVA 1R23A 4PGHA 13GSA 4A3EJ 3OYAA 2G9WA 1OJLA 4IN0A 1YS6A 5GSTA 5BMUA 5FD5A 1THXA 3GKNA 3A1YA 3LL7A 2XF6A 1S3CA 1USSA 4KICA 1UAAA 5J3RA 3TKRA 4ML6A 5CVVA 3UR3C 4XRDA 1XW9A 3KP4A 4LA1A 1T95A 2EIKH 4ITVA 4XRSG 4HSRA 3K8NA 3KP7A 3MVPA 3IR4A 2FBIA 1ORKA 10GSA 2VLUA 2ZNYA 4G6QA 3OR5A 2WCIA 3SXYA 2FQ4A 2V6EA 4UHTA 3RQIA 5DD4A 2LSTA 3VPRA 4E7SA 3KZQA 5HR0A 1S6LA 2VUMJ 1KQ8A 4HAMA 4P9FA 1FVKA 2OJLA 2C3NA 2WS2A 5DQSA 1PDNC 3P9IA 5J1UA 2NS8A 3WTUC 2GM4A 1FEXA 3ZPLA 2HPIA 2E2GA 4P5OA 3CDIA 5KN0A 1FMVA 3A3TA 1ZTRA 4IRHA 3CCJI 2CAQA 3RHCA 2GIZA 2Y0SN 2GZWA 4BNCA 3VWBA 4UUTA 3QYFA 3CQFA 5KN2A 3E6BA 4EM0B 2DMTA 3KTLA 2R0PA 1WWXA 4MF5A 3DEEA 3UAPA 1FBQA 2B63J 1XW6A 2HSHA 2HRNA 3HZ8A 1G7EA 2ECBA 3BG5A 4EGZA 1GSEA 4DSRA 3IAM2 3ASOH 4U0WA 1EZKA 5ICCA 1U8BA 1K7AA 4UUSB 2WFCA 1SFKA 3MWMA 3H5NA 2EIJH 4KN7X 1T98A 4BAYA 1DDNA 1FMWA 1GWCA 2HZDA 3LWAA 2NVXJ 1Z5YE 4BACA 2HE3A 4NQWB 2M72A 3A4CA 3F4RA 2BW3B 2MG4A 3TOBA 2OE3A 3A2XA 4Q5NA 2R6KA 1R1VA 1BI3A 2HDCA 2VT2A 4ZYGA 3VYTB 4I99C 5DCFA 3OR1C 1Z05A 4RAGA 2ELJA 1BJXA 3DXBA 1VQPI 3AL0B 3DEWA 3TRPA 4AVZA 4PQHA 2BY1A 4ENNA 4CZZA 4HS1A 4HYEA 5C4JJ 4CCJA 5CRDA 1KU3A 4HW0A 2L57A 3ZL5A 2HOEA 2VCVA 3TKSC 1KU9A 3GZ6A 2LV3A 2ZSIB 4YG2F 2IFQA 5IT9K 4KB3A 1IXRC 4ENJA 3ZRDA 1WJCA 3W6KB 4JBBA 5HNHA 3FK8A 4B4CA 5IMVA 4BU2A 5CP1A 4AIHA 3ZQFA 4CYDA 4AVPA 2G0EA 2H70A 4LMWA 5ID2A 2CX4A 2M1BA 1M99A 1KYWA 1R6RA 4LIVA 3HSEA 2A2PA 1ON2A 5JCGA 2TDXA 2HNHA 2VKEA 3S17J 4FE7A 4X0XA 1XN7A 5F6FA 1E0EA 2H75A 1T3BA 3IK7A 2LBFB 4OIOF 4KUNA 1AKHB 2CJJA 2JVHA 4BBRJ 4Q47A 2P0WA 4C2TA 2K9SA 5HDGA 2L9RA 1F4KA 3HEFA 1XZOA 3ZN0A 2O3FA 4I5QA 4Z7XA 1A5JA 3I5UA 3FMQA 2DJ2A 2IXSA 2RN7A 1V3FA 3LAPA 4KNYA 4IJIA 3DPLC 1M2AA 1TK8B 2P5KA 5GSSA 3OSFA 5IOXA 1WKMA 1DPRA 1MW7A 2ZMEB 4N0BA 4ZB8A 2Y48A 3L9SA 1X1DA 4A69C 3QPSA 3S1NJ 3Q0WA 2OADA 2V6KA 1GVDA 2DFFA 4GFBA 3EINA 1S72I 4L0ZB 5ECOB 3BPXA 1AUCA 4J57E 4Z2UA 1LFBA 3H0GJ 1OPCA 1V4RA 2Z9OA 4BBSJ 4U87A 3T5XA 4TOPA 2WAQN 2FA4A 4Q5FA 4HSTA 1HLVA 5FLXK 2FSWA 5B8BA 2DK8A 2VL8A 1U3EM 1Z6MA 3APQA 4IJ3A 2Q0OA 5GZZB 4POLA 2IJLA 3ZR8X 3HOXJ 1TU7A 4POKA 4XM3A 4Y7NJ 2WJUA 1WE0A 4ZYHA 2ISYA 3K4KA 2QGUA 3A02A 3FXQA 1H9TA 1A36A 2OTLI 1O7UA 2FNOA 1F6MC 3RYPA 1F9MA 1XDSA 3L2UA 1CQGA 1EP8A 4CCOA 2DTRA 1YE9A 1AW9A 4KISA 4HX4A 2Z16A 3NRVA 1KQ0A 1XWBA 2PX9A 3JCUC 2FMYA 1DE1A 2KRHA 3H5RA 5HS9A 5DD8A 2H09A 1EA3A 2PMUA 4E7JA 4BQNA 2K9FA 1J7KA 5CRGA 2AYTA 2L4MA 1MNMC 3RSNA 3X2QH 4MQVA 3OYKA 3OYMA 1B4AA 2CQXA 2WGRA 5IMAA 4LL4B 1HQCA 2FJ1A 1YITI 4ZBBA 1HKQA 2JZSA 1Z7LA 3G7IA 1MH3A 2L5LA 4XS4B 5D5UB 1YEPA 1XC5A 2QYOA 4XL9A 5FB2A 1F3AA 5G31A 3GMEA 3IXRA 3J7AO 4KA0A 1SAUA 1SU9A 3RHBA 2GLRA 3RPUD 3KYLA 1RIOH 1XVQA 3OMYA 1HKSA 1W7PB 4GSNA 4E8HA 1X4PA 5F04A 1SYXA 1SD4A 5LGTA 4XBFA 3ZTLA 2XBIA 5BMZA 1LJRA 1UN2A 1FY7A 2R5YB 2R7TA 4AIKA 2H0GA 3DVWA 1IDYA 3EVIA 2CFXA 2DQRA 5H20A 4J2FA 5EF6A 4EXJA 2OD5A 5EZGA 5ABRA 1I9DA 2DMMA 3VSLA 3W6VA 5EYRA 2IPQX 5KOXA 4NHJA 2V7FA 4IQAA 1Y1VJ 2OF7A 2HQAA 3LG6A 2WWYA 3DMLA 1V2AA 3DWVA 5AN1A 4RAYA 4UXNA 4DYCA 1JHBA 4NNJA 4CCLA 1TI3A 1K0CA 2KKOA 3F6FA 5DVBA 5B3SH 4EJTA 3CCLI 1RI7A 2K8SA 1FP2A 1J09A 4MABA 5E1WA 2VOOA 4A0XA 1QHGA 1YF1A 3DBLB 2HZEB 16GSA 2ZBKA 2KHPA 1JFUA 1TW9A 3H4KA 1SD5A 1NG7A 3HA9A 1OR7A 3TJGA 4HX8A 1JHFA 4UV8A 2GOMA 3D5LA 3DKSA 3EU3A 4OO5A 4OIRF 4KE3A 1IW7F 2YX7A 5HDKA 1H4OA 3CESA 3TDUC 4KDUA 3PO3J 4HG2A 4IHXA 4B44A 1XD7A 4K7OA 4IHTA 3HB9A 1FX7A 3OV8A 4QSHA 2ACJA 3K2AA 3D4MA 1B4QA 2EILH 2MC3A 3CYNA 2DT7B 4M3BA 3I56I 3LSHA 4CCMA 3JRDA 2X1EA 6GSTA 4BWQA 1X1BA 3ABLH 1G3WA 2LF8A 2MMNA 3F3QA 2VD1A 2KIFA 5CVJA 1J75A 3C1RA 12GSA 2LG4A 3E6CC 4B09A 2QVOA 1TRWA 1FP1D 2XBQA 1MD4A 2CV4A 1P6RA 4IQJA 3KZIC 3GSTA 4DVCA 2F4MB 3RKYA 5IOYA 2JZTA 3NZNA 2AHQA 4XMYA 4YFNF 5BS6A 4C3JJ 1W1WE 2QA2A 3HM5A 4CICA 3FHZA 3ERFA 4IZZA 3KMNA 4ZXGA 4L5EA 4PJMA 4X0GA 1K0OA 1F36A 4IHWA 4EJWA 4L0UA 2VONA 2FCHA 2VC1A 4POBA 5AIQA 3TW7A 2OBIA 1TTYA 4A6DA 1IN8A 3FHNA 1E6BA 1DU0A 5DYMA 1OCOH 4TXVA 3TRQA 3OYHA 3E3VA 5ILSA 4C3IJ 2W1OA 2PMZA 4EQQA 1M2DA 2H8LA 3G9BA 4F7ZA 3JW4A 2TCTA 3M1CA 4IQ1A 1M9AA 1PN0A 1VNDA 5CVUA 2HLSA 4X6AJ 3DPUA 4EIPA 2AB6A 2DA7A 1SFUA 4IHYA 2DBCA 3TJFA 4HLYA 2CV1A 1KGSA 4HRIA 3GTKJ 4RAZA 1IYIA 2CMPA 2HKOA 1TLHB 2ME6A 3E5QA 4XKWA 1YTYA 2OV7A 1G2HA 1U78A 4A3BJ 5EEHA 1SFXA 1TP9A 3HVNA 3QPHA 2B7EA 5E17F 1A24A 3M0FA 5FRMA 2DJ3A 4YQVA 1BJZA 2LF7A 3W3CA 1IF1A 3VODA 2FHEA 4Y13A 1U5TA 3LFLA 3WE2A 1RZ4A 4HSCX 2XGDA 2Y9ZA 5K7HA 5J3LA 3IH2A 2DKHA 1FOYA 3ZMUA 1TRUA 2IT0A 2IWTA 3PH9A 3HG9A 1G6NA 2VXDA 1TW3A 2DCEA 3PSIA 2E1CA 3SQNA 3BROA 3W2AA 2C0FA 3HXSA 2M0MA 1EWXA 3TOTA 14GSA 3D22A 1R71A 3VWVA 3G71I 2X6XA 5BRTA 3PJRA 4A3GJ 1PQNA 2Q2EA 1K83J 5K5OA 2D5VA 1VF1A 2AAWA 4XKBA 1YRNA 1I5GA 5CO3A 4WXTA 3KX2A 5IOWA 4I2TA 2J5OA 2KZVA 2DLXA 1B72B 2AHEA 3ZQ7A 2R0CA 4Y17A 4M3FA 1ETKA 3ZMDA 3FIWA 3CC4I 2QKEA 3C8EA 3UL3A 2LP0A 5L3DA 3C2GA 1H75A 1JZOA 3S16J 3O6BB 4EJUA 5FLMJ 2DFHA 1C72A 1T4ZA 1ZYQB 3CJNA 1UCRA 1OCPA 3F8BA 3MWHA 5HOOA 1ZGNA 1IV8A 1FYLA 5LEKA 4G9YA 4OOIA 1H8AC 4MEXF 2EIMH 4R79A 2M8EA 2VE9A 1AWCA 3BP8A 4LFUA 1OC9B 4HV6A 1Y6IA 2UZ8A 2OCEA 3WTWC 1R1UA 2KL4A 4LLGF 3H36A 4EM1A 4P55A 1G4DA 4A3CJ 2DLLA 4PXOA 2X6WA 1M0UA 1PYVA 3FRCA 4IGJA 2XASA 3QWLA 3ZXSA 1MDMA 2XDVA 1ST9A 2GZPA 5HQPA 4ABZA 4FX0A 2DA4A 3V7SA 3DKYA 5KHDA 5CVIA 3OL4A 1ZR4A 1QPIA 3LQRA 1I5ZA 2FX0A 2K9QA 2EINH 3C18A 1B4PA 1WMJA 5B66C 2ES7A 1K3OA 2VJJA 6GSXA 1T39A 5DCHA 2R7QA 2HWVA 3AL0C 1LU4A 4BL7B 1S5LC 1NTCA 3TOAA 5KAIC 2YR2A 3L2QA 5B1BH 1JZRA 4KSOA 5D9VA 2LYCA 3MZ8A 2WV0A 5F27A 2LJKA 4GF0A 4GQCA 2QEXI 4IRGA 3FZ4A 3UMAA 2G0FA 2GBYA 2KUCA 2EBIA 3R60A 4YIFA 1LEAA 2KP2A 1E3PA 3H9GA 4I01A 4F3QA 5KK1A 5A5KA 1QUWA 4IVFA 5DAKB 4AJ7A 2MA3A 5LBQA 4AUXA 1U87A 1BR1A 5M5YJ 5GADJ 1EV7A 5FLVA 2OKAA 2L7FP 3JRIA 4KDPA 5E18F 3QDNA 4POMA 1SK2A 3VURA 3DKXA 4DW6A 4DQ2A 2IBDA 3EUHA 1POGA 1URMA 4XRFA 1N2AA 1DBYA 5ERIA 4LB5A 3P9CA 1OCTC 1YZXA 3PUBA 1J9IA 2YSRA 1U3IA 4BKXA 3VYUB 4DZJA 5ECIB 5LRRA 4K0GA 4PQIA 2JVGA 1GSDA 5TJJA 1IG7A 4WF5A 4DSQA 3KPHA 4BYYA 4AD9A 1T8IA 2DO7A 2AUVA 2I9HA 1SVMA 2HTJA 3H3VK 2FMLA 5E20A 3MZHA 1E2YA 1Z6NA 3GXOA 2LKXA 2HI3A 1LDJA 2QZ8A 1FIPA 3IUOA 5JLXA 4FIWA 4I97A 1JUSA 2F51A 4O92A 3BQZA 1WJDA 3IWZA 4BH9A 2I1UA 4YRVA 2JACA 2L0KA 2L02A 5K5RA 4V2GA 4ENKA 3GL3A 1UJ8A 5J8CA 4NHWA 4JRRA 5IYCJ 5ILVA 3LYPA 2C0DA 2LNBA 5D4RA 2JSPA 3GFIA 3DFGA 5ECLB 1K0MA 1P4WA 4JX5A 2GVPA 3VFIA 1IV6A 2OJED 1DU6A 3U1DA 1SYRA 3DXJF 2WC2A 4KH7A 3BT9A 3JSOA 4BE2A 1ETVA 1GNWA 1W4VA 5KAFC 1PKWA 4K2EA 4FT8A 3IBHA 2MABA 1A35A 2V79A 4C2MJ 4IPAA 1TXXA 1PFOA 4XKCA 3GBGA 3LSZA 3OYLA 5B7CA 4IOCF 4GXZA 3CCQI 2IRFG 5FT3A 3CUQA 2UZKA 3RPUA 1FYMA 2YPRA 4UV9A 4AYBN 1TNSA 4XS4A 3AG1H 4TR1A 2HZTA 3PIOF 2PU9C 3ME8A 4NB5A 2RVCA 3U1KA 5D5WB 2R0QC 4WR5A 1V9WA 1YQ1A 2XGXA 4MQ9F 2DA3A 2O7OA 1MSEC 2B1LA 4K7NA 2E19A 2E60A 1HNAA 1FB0A 3EC3A 1Y0UA 4N11A 4BUPA 1XFLA 2D1VA 4G6DA 2P8TA 3GCMA 3OYEA 3PL8A 5CYVA 3AAFA 5LNKe 1SFOJ 4PUFC 2Y30A 2AQEA 5JVTA 3F23A 2OA4A 1JUPA 3EYIA 1OC3A 2XHFA 2GXAA 4KITB 3BR5A 1AIUA 1WRJA 5FGMA 2EV0A 2D2WA 2V4JC 3OYGA 3P90A 3I0TA 2YU3A 5ENUA 4NWYA 4HEA2 4DOZA 3FWEA 1X2MA 4RMNA 4MMMA 2VIXA 4BE1A 3G1LA 4A3MJ 4L5JA 1JGGA 2XSJC 5HVQC 1BC7C 1E3HA 2QBYA 5HFKA 3GTQJ 3DU6A 3F8NA 2QQBA 2X8GA 1K3YA 1U2WA 1MMDA 2OPTA 2STWA 4MDCA 1TQMA 2GQQA 2PI0A 3I59A 3EMXA 4YAPA 1QVTA 2FA5A 1DQUA 1ETYA 3BR1A 2CV0A 1T33A 3CCMI 1JT6A 4E7IA 4MIMA 3T8TA 5EEAA 3CDHA 2GTUA 1X2NA 2AQFA 4AU7A 1R9TJ 1ABAA 2LNTA 1N75A 2HNLA 2ZXHA 4ZZLA 2ESHA 2YWNA 3F8UA 2OAZA 3EMPA 2KZGA 2CT6A 1QMVA 4KNDA 5F0GA 1YKCA 4CSWA 1ULYA 1I6XA 3WTXC 2F8AA 2RUFA 3D0SA 3OOUA 2F6CA 3ZP5A 3NQOA 2JA8J 2H1LA 2XPWA 3F72A 2DW4A 2A6TA 3K4CA 4MGRA 1U0JA 1RK4A 2YS9A 1B9MA 1JE8A 4A3KJ 3FR9A 1IN6A 5FKMA 5E3MA 5FROA 1Q1VA 2H76A 4P1WA 1BM9A 1WFXA 3VYSB 2NVLA 3GTLJ 2DA6A 2HGCA 3L1PA 4BHPA 2XRLA 2PERA 1IO2A 5E3LA 2YWMA 1BA5A 4ZYAA 9ANTA 2XROA 4JR6A 1OYIA 1WH5A 4PZJA 4UB8C 5K7FA 2PJRB 3GTUB 2R7WA 2GS3A 3M3YJ 3TRXA 3ABTA 2O5RA 4OMZA 2HQRA 4AGSA 4F9ZA 2REMA 1WWJA 4PJ0C 3WGXA 4FE4A 2LKSA 2Y9YA 1PJRA 3BZ6A 4IRIA 1ZZYA 3F4TA 2E34A 1Y8RB 3DQVC 2LMDA 3K70D 4GTUA 3O8HA 3BR0A 3LSRA 4Z2TA 4OAYA 5D9XA 4UVCA 2O8XA 2PBIA 4KIBA 3H1NA 4IHSA 2PJPA 3ZMTA 4RS8A 3E6MA 1OE8A 2CQNA 1QO0D 5GAEJ 2GWRA 1HA8A 1T0FA 2DODA 3A5WA 3HHHA 3CCSI 3JSPA 4I7HA 1GUKA 3OWTA 3J80Z 4RGSA 3WU2C 2P4WA 3BJ5A 3F63A 3V8JA 4OFMA 3WG9A 1HDDC 1SKRB 5IO0A 1P92A 3CRUA 2HXOA 1D5VA 3N97A 4D0PA 3AY8A 2X49A 4OCEA 4C9YA 2WY7Q 4FYBA 2O7KA 2JN6A 1WP0A 2K6VA 3DD3A 4TR3A 1FZPB 5K7ZA 2LY9A 4UY8I 1TL8A 2VCWA 4BL7A 3KP5A 3N05A 1TT5B 1IAWA 3CCVI 5E1XA 4V19K 2GQLA 1ZAOA 1XPXA 3G73A 1GT0C 3KFWX 1LQ1A 1A2LA 2C0EA 3SJMA 3LFUA 1Y25A 4XLEA 3Q9VA 1QGPA 3QAHA 4OMVA 2EZKA 2X4AA 4ZB6A 3ISPA 4ZDOA 3KCMA 1P9QC 3EUAA 3BC8A 2LJRA 3O2PE 3ABMH 2YP6A 4XLPF 3KYDB 4DJAA 4I8BA 1GV5A 3AKZA 1GSUA 2KFDA 1VZ0A 4IL6C 5D8KB 5C00A 2DYRH 1Z7UA 2A4HA 4KMUX 1OAZA 1NSWA 4M9SA 5DUKA 2GXBA 3DVXA 5DEQA 1D1AA 4IF4A 2LOOA 4EM2A 3JAMK 1AXDA 1GTAA 2B7JA 2NBSA 4U0VA 3HJOA 4G19A 1DUGA 4TXOA 4G9HA 4V2FA 4LB6B 2N5AA 5FKLA 2GXGA 1VQ8I 3V7RA 3HOSA 2HR3A 1GTUA 20GSA 4JE1A 2V26A 4HF1A 1I27A 5FKKA 3PGTA 1VF3A 2BY0A 3ZMSA 3DTIA 1YJWI 4MNUA 1K4SA 3P8WA 1BI0A 3LORA 1IRGA 1QU3A 2M0CA 3LQ7A 1XTAA 4QL7A 4BPYA 3IAS2 1M2BA 3GKKA 5D8IA 1I1SA 1KONA 4LLLA 3QP6A 5CLSA 4RGXA 2Y69H 2BY2A 4XLHA 2XSDC 2H1AA 5EG0B 2P5LC 4C30A 2NDOA 1MBHA 2QUFA 4HV5A 4KIGA 4AWXB 4EO3A 3WU1B 2VLAA 5J1YA 2I8DA 2P6TA 2A61A 5AIPA 1UHWA 4AIDA 1BAYA 2B5XA 4HU9A 3ZMZA 2E5ZA 4E7HA 2O8VB 1OQYA 2Q8KA 2R4GA 2CUEA 1X1AA 2IGKA 3PNYA 4LMYA 1KYZA 2H72A 1XCVA 2YANA 3VLNA 1VQ7I 1AQXA 2QQAA 3M8NA 5KOWA 3QYEA 3KH9A 2E1MC 4NAXA 4ZZDA 1ZRDA 3ZRGA 3TKYA 2PMHA 5LFAA 2GQKA 2BTOT 3HJMA 1JKOC 1N25A 3TJKA 2CX3A 2JWTA 3R3EA 1SC7A 1ITYA 3TB2A 3I71A 4HDUA 3HOZJ 3DPTA 2E2IJ 2Y0SA 1F1ZA 2CUJA 1JI8A 1HD2A 1MDKA 2EA2A 2P31A 2YN1A 3ZIJA 4XN0A 2TRCP 2DTZA 2Z3YA 1WVRA 2LRDA 3GFJA 3SZTA 1SK0A 2YJHA 2VKHA 3FR3A 1MD0A 3JTHA 3O3TA 4OD7A 1T1VA 4D73A 2VPLA 1BW6A 2TRXA 4ETSA 1X3WB 1O7FA 1MDJA 6GSWA
chains in the Genus database with same CATH topology
1XWKA 3V42A 3RTRA 1PN9A 1XWCA 2PBJA 1Q98A 1QXHA 3DWLE 3GV1A 4HQSA 2LTKA 3ZZXA 1ERWA 2VJIA 2KQRA 1XW5A 1YDKA 2M3AA 5HR2A 4PJJA 2DIYA 3WT2A 4MPGA 3CBUA 2F8FA 3TGZA 3TJBA 2XC7A 3BLYA 2KDOA 3NOFA 4ZILA 4HOJA 5KCMA 1OR7C 3L9VA 3H8QA 1D0ZA 4ZL8A 1HNBA 3LMMA 1TI1A 2EIRA 4RI7A 2H1GA 3HKRA 4GSSA 1XBSA 3QYBA 4MJEA 5H5RA 2HRKA 3CJQB 2HT9A 4PJNA 3SBCA 2R7OA 3C73A 1GTBA 2C3QA 2VASA 2HZEA 5F05A 1Q4JA 5LD2C 3LXTA 1TRSA 2KRCA 2G2QA 2FUG2 1GSFA 4YQUA 2UUZA 2IMDA 2LC2A 4IP6A 5ECQB 4N30A 5F8BA 2CQ9A 1X9WB 3HKZA 3QAVA 1JLWA 4F82A 2HVSA 1N77A 2WDUA 3KD0A 2PN8A 3VWXA 3VI7A 1JZWA 4ECJA 4RLQA 5B8AA 4NPBA 2HVQA 4B48A 3HPGA 1ERVA 2L5QA 2WB9A 2H6ZA 4EC0A 2L6CA 4G2EA 3TKPA 3D5RC 5G1KA 1X9MB 3R2QA 1BOBA 6GSUA 2X8HA 2PVOC 1NM3A 1ZMAA 2R7VA 2WB1A 2F3MA 2DJKA 4YQMA 3MKWB 1OKTA 2XF5A 2YNXA 2LUSA 2M46A 2QKMB 5DCGA 4IQ4A 2V41A 3TUEA 1USBA 4I6XA 4XR6A 1GLPA 5EPFA 3FW2A 4G0KA 1O8XA 6GSVA 2PVQA 1DGWY 5G5FA 4BVXB 3OYIA 4KF9A 1YX3A 3S8PA 3K10A 2B3SA 2OE0A 2VL2C 3VPQA 4IS0A 4IKHA 4HDEA 4DGWB 3PR8A 2BVLA 3GUSA 1ON4A 2QSIA 3FEUA 4JZQA 4FO5A 2H71A 3QCPA 4EE0A 4YKGA 3L2RA 4U7BA 1WJAA 3GFKA 2VLVA 3HHVA 1JLVA 1AQVA 1X1CA 4K2XA 3QD9A 4OWRB 2N5BA 1V40A 5ECMB 1ZOFA 1IRXA 1S3AA 4ZTFA 3KP8A 3ED3A 2RM6A 1AA7A 2E7PA 1G0TA 1PMTA 1EEMA 4YEJA 5IIZA 2X1DA 4XCSA 4B3XA 5IMDA 3K6GA 4E7ZA 2R7SA 1NHYA 5G2ZA 3PINA 4XLCA 4KAEA 4IKFA 4WKWA 2HRFA 1UC7A 5ELAA 4D73B 5JWQB 4DBQA 3MAKA 2JZRA 2GSRA 1B8XA 2MMOA 2YZUA 2RLIA 2F5VA