3IAS6

Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, oxidized, 4 mol/asu, re-refined to 3.15 angstrom resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
161
structure length
145
Chain Sequence
EREGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDARQADVMIVAGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFNNYAIVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVRGQAYNERGERLPPVAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the mechanism of respiratory complex I
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords NADH-quinone oxidoreductase subunit 1
total genus 36
structure length 145
sequence length 161
chains with identical sequence F, O, X
ec nomenclature ec 1.6.99.5: Transferred entry: 1.6.5.11.
pdb deposition date 2009-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
6 PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12280 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ias600
5LNK6 3IAS6 4HEA6 3I9V6 2FUG6 3IAM6
chains in the Genus database with same CATH superfamily
1OZFA 1C3JA 3TFWA 4PIPA 2OV4A 2QMYA 2VJQA 1NMXA 5T64A 3GFVA 5IMBA 4XVHA 4F3YA 3STWA 2NVOA 5IKMA 1J2TA 2ZITA 5LYYA 3WWCA 1J09A 1KQPA 1QO9A 4N5MA 4X94A 3T5TA 4R41A 3PHBE 1YRQA 4HAOA 3WAKA 5EL0A 4LDJA 3RS7A 3BKXA 1MX1A 3NIWA 3FSEA 2CEAA 3KAPA 1H65A 1O6ZA 3CT4A 3X2FA 3ENKA 4ZQGA 1PDVA 4MV6A 4TS3A 5D85A 5IJ9B 2Q3JA 3FHTA 4TMWA 3I83A 4AZ0B 5KAPA 4BO5A 5LZ2A 3WA7A 4OQMA 2CL7X 2CXRA 1RBMA 2ZRCA 1ENPA 3AUFA 1HE1C 3MINA 4H0FA 1Q6YA 1RR6A 2JIQA 1YQQA 1RP7A 2AL7A 3MUNA 3DE5X 3M4XA 1PF7E 1U98A 1LBIA 2FCRA 3VPHA 2F55A 2H63A 4KQKA 1D2NA 1HA3A 3L9XA 5D1NA 3ZLUA 1FK8A 2GTPA 4EQ6B 3DLPX 3E58A 1SK8A 4RA6B 4YT5A 2ZTLA 1QHEA 1CIJA 4NYJQ 2P91A 1VJ5A 1J7JA 2WIDA 2Z9CA 4GPEA 1P7VA 2M6LA 2E2WA 5HSGA 1CQPA 3DVQX 4G0OA 3WLNA 2JFWA 5SY6A 1MFPA 3BWCA 4CNBA 2QUIA 2IHJA 1CJTC 3GUHA 3OEEA 1YRBA 3W6PA 2WKQA 1JMKC 1QHFA 5KPJA 5LR6A 2CHEA 3JW8A 1YA6A 1HNZB 2PMFA 1FTNA 1CY4A 1C3XA 3PGLA 4B3HA 4FKBA 1XQYA 5KKNB 1HSOA 2Q4EA 4NIMA 1K7EB 4FMCB 1WEHA 1RJFA 5K2OA 1PAUA 4D42A 2ZRMA 1EK6A 2GXQA 4G86A 5CLLA 3WDMA 4JOCA 1GVNB 3O8BA 4BNJA 1ODKA 2QTRA 1N7IA 1UMCA 1WSAA 2W90A 2FG7C 2QLTA 1ZY2A 3ES9A 1DAKA 1TGYA 3P19A 3QG5A 3FFWA 4UU1A 1Z6PA 2QNBA 4RLQA 4CIWA 2RGGA 3LQKA 4M37A 5CB4B 2EFEB 2QX6A 2Q5CA 3HGQA 4BMYA 2O23A 1KRHA 2FW8A 1ISGA 5HIAA 3IOBA 1P2UA 1P6XA 3QLUA 3W2GA 4LFBB 5FJIA 3II6X 4QM6A 2B35A 1E66A 1KOJA 1J9GA 2XGSA 1ZGJA 3REOA 3DEKA 3VO2A 1BCRB 5KTRA 3Q10A 3ZJVA 2FE1A 3JVEA 2FR8A 1D2MA 4FYVA 2QV7A 2WUGA 4ONEA 5JJLA 1XPUA 4IILA 3ML1A 4C1BA 4PGFA 3RT7A 4KNWA 4YQFA 2HCTA 1WW8A 3ZHZA 4U3JB 3ECCA 2E49A 1NOJA 1NFFA 1BXZA 5AXDA 3ZJ4A 5KU1A 4DARA 1TC2A 1G3MA 5B55A 2WR8A 3PIRA 1NWCA 1W0JD 4ND1A 4OFWA 4A9AA 3K9BA 5F7JA 3H7AA 5J2UF 2QR2A 4M9CA 4NU5A 4CEJB 4J07A 1EUCA 3NJ4A 4OLAA 3KTAA 4JL6A 2FW9A 5AKIA 3JZIA 2CBZA 1QHGA 4J6FA 1QF9A 5FX2A 3CKYA 2XUIA 4MICA 1HL3A 3EVZA 4F4FA 4NTZA 2IW1A 2EKLA 1U3VA 2SCUA 4CMEA 5KINB 4BFUA 4E14A 3GB9A 3RPEA 3HCNA 2ZI4A 4LJAA 1NBWB 2VI5A 3SK0A 4CRWB 1QG4A 1B8OA 1W4LA 2JIMA 3JQ9A 2EX0A 3MJCA 5IU6A 3GZNB 4M87A 1JU4A 3IALA 4DUGD 4W4TA 2I03A 1UDWA 2GB4A 2A0UA 1MC1A 2J4FA 2VHWA 4GOXA 2NU7B 2X0NA 1K89A 3L7NA 1NI4B 3U5ZB 4M98A 3E8XA 3IT2A 2HA6A 4W8OA 5LLSA 2Q3FA 5REQA 2NSYA 4JVSB 4BCDA 2BH9A 3BPSA 2PWBA 5IK2D 4DV6B 1VMAA 2PRJA 1NMYA 1R18A 4RSRA 1G18A 3H8JA 2WNSA 1VC2A 5IJWA 3R3WA 3A9CA 4BNUA 4OHPA 1W59A 3T0IA 1J2EA 1DOZA 1ZUHA 1ECLA 1QB8A 2AQIA 2QW1A 2V97A 4L15A 1GPBA 2D7CA 3TQQA 1RZRA 4K28A 4C87A 4JVMA 4QOJA 4C89A 4XFJA 4OI0A 2I71A 4XQEA 1V1MB 2VSOA 3GZJA 2CJWA 3NAQA 4I9HA 3TL6A 4LAFA 3V7NA 2DLDA 5FTNA 1O0CA 4KRYA 2A8YA 4FJ1A 5FL7D 3K0AA 3H84A 1KYZA 1JYEA 2QL6A 1WB6A 1XQ1A 3ZDXB 3TAXA 4ABTA 4RL6A 3E9NA 4I3GA 1OJLA 5DBIA 4ZT2A 3W7VA 4R6XA 1WKBA 1ML3A 2XNCA 1RWPA 2FMHA 3KHKA 5SY9A 1YR3A 4NBSA 1BWQA 2JLBA 4DA6A 3AY7A 4IUDS 2NO4A 3Q9SA 1EQ2A 3E3AA 1GPMA 2FJUA 4YRIA 5BQFA 3VOBA 3AUSA 3G88A 5JOQA 5CYGA 3RSHA 2FWAA 4EI8A 2HGSA 3IJPA 5KIAA 1VL2A 2XEXA 5J4VA 2X2EA 3UMMA 3BB3A 2VQEB 3NKFA 4DKJA 2XB8A 3C5WP 4OHFA 2FZ5A 3L93A 3P9NA 4BNGA 2Q62A 3BHJA 4E13A 4X1KB 1FY2A 1DC3A 2P6NA 3BYZA 2GCOA 4H3HB 3KWJA 4XCXA 6PFKA 3HDYA 5CLHA 5DI3B 3V2IA 3GLFA 3D6UA 3CY6A 3EIWA 3HWX1 1B6RA 1AUVA 3PX7A 2O05A 4N3CA 5I6DA 2R60A 3FPGA 5JW6A 1ACMA 1HZJA 1WTAA 4B3JA 5JZMA 3QYAA 5AKZA 5A6SA 3K70D 1P0MA 3E15A 2PLRA 3CRZA 4F2PA 2RHBA 4R83A 4X7BA 5T67A 1YB5A 3IKTA 2CFRA 3F73A 4C2BA 1B3BA 1YB7A 5FD8A 4JLOA 3DZIA 3D1JA 5COBA 3V1MA 2PR7A 4I6EA 3VR4D 1GFSA 3LFHA 2GXUA 3S27A 4Z4CA 4ALIA 2AOXA 1QGOA 5E4YA 4ECEA 1LXCA 2L82A 1TGVA 3QXJA 2C9MA 1T3GA 1P77A 5DISB 1PGOA 2J3HA 5CNIA 3UV3A 5B4TA 3HB9A 4Z53A 1RM3A 4WZZA 3B1VA 3DZHA 2WFLB 4Y67A 5I5GA 4YALA 4XWOA 3QKUA 2CLSA 3N0RA 2F00A 5LYJF 1P29A 5BW4A 4J16C 1XTUA 1C3LA 3KUKA 3TZKA 1Y9EA 5E4JA 1WCXA 3GPBA 2BCJQ 3BK2A 1PVVA 2G6BA 1L5ZA 4FS8A 4GM0A 4MVJI 4RX1A 1NRXA 3D3QA 3PRKE 3VC2A 3GNSA 3BTUA 4TKVB 3NBQA 5K0GA 3MTAA 3BTVA 3G5TA 1FTGA 3LXMA 4ZOLF 5F4ZA 5J40A 3LW8A 4O33A 4DCNA 5BXQC 1M8FA 4I9NA 5JXWA 1X80B 4DV7B 4DCCA 1IG0A 3R7BA 3W5BA 2A1TS 5SZKB 2F8SA 2QXYA 4HD8A 1VLLA 3SHWA 4HP8A 1PGPA 3CVWA 3AM4A 1DARA 2C9YA 2HJ9A 2HD4A 4KIJA 1N33B 1YWGO 2W2XA 1SY7A 3IRUA 4AXXA 5E2AA 2YV5A 4F5ZA 4M46A 4C6TA 3GD7A 3WL8A 5AM0A 1P2GA 1QRDA 4K6OA 4ND2A 3OHPA 5E6UA 4U7FA 2CL6X 4RZUA 1SKQA 1P4GA 1ZI8A 1GEEA 2EX1A 2I4TA 3AEQA 1OLSA 2IGBA 2WOJA 3AWDA 1KI2A 1TL7C 1UMKA 3D2LA 3FDZB 3NMUF 4CFZA 2ALJA 5ITZB 2HMVA 4PHHA 3C6XA 4RVOA 2ECOA 2R9VA 1R6VA 3S29A 1FJXA 3MN1A 4KVGA 4P36A 4GYJA 4DCOA 1FXWF 1M6VB 1UL1X 2ZYUX 1V11A 4REMA 5DBFA 4II2A 1VDMA 4PLCA 3SHFA 3QV1A 3G2MA 4LF8B 1ZP6A 1AO3A 5K4AA 4C03A 4H4DA 5DZSA 2Z58A 1C7JA 3EAGA 3RUCA 3S40A 3MCTA 5HCNA 4NU6A 1H5QA 2PO5A 1DRKA 1ANKA 3IV7A 3TZHA 1W36C 3F4BA 1XZJA 2QRVA 3R5KA 1KMCA 2ZDQA 4FZJA 1GRVA 5DTIA 1NBMD 1VSTA 5KNBD 4YV1A 4LRYA 2FMTA 2QSUA 4FDAA 4P31A 5KJEA 2BELA 5HFJA 4Z9YA 3KOZA 2PL1A 3OLVA 1YT5A 4OGWA 2EYQA 2IYLD 1JHAA 3HNOA 4H18A 1E0JA 4G8DA 5EE0A 5EI5A 1P91A 4IJQA 2O59A 1OROA 4C0XA 5F12A 4AK9A 3DOHA 1WUTA 3DFMA 1NVXQ 2HJHA 3W5SA 1Y5LA 5CH8A 3GEDA 1Z4MA 5I01A 5EP2A 4CU5A 1N6KA 3QU4A 1NSYA 3KJIA 4WFIA 5ALUA 4J7AA 4ZGGA 2YV2A 2IXBA 2FZCA 4TXMA 1QIDA 2A33A 4AQYB 4HNVA 1F8UA 1XU9A 3IVXA 3KQMA 3DMRA 1EUZA 3IT1A 2WHYA 5JVDB 2C5BA 1U7HA 4NFYA 2RCNA 3ELBA 3UCXA 3ZIDA 1KMNA 1I80A 5A7GA 1NN5A 2VDLB 3W6OA 3HFGA 5H5JA 2BPOA 1WP4A 3GFRA 1NN3A 2O57A 3PUJA 4P80A 1SRQA 1CRZA 1XJQA 3HR4A 4JJ8A 4MVJH 3RJ5A 3OMXA 4DV3B 3H5VA 5JNUA 1E9DA 1TIPA 3WJ7A 1A8IA 4RIGA 3A9RA 2Y1FA 2VDOB 3DTTA 4GU5A 3WLKX 3MJDA 3NPAA 4GX2A 4V0SA 4G0ZA 4P3OA 1D2RA 1DHRA 2G63A 3TLMA 1SVIA 1TTQB 1U0JA 1TD9A 4RV4A 2V7QD 2AFHE 3OCVA 4TMTA 4XLLA 1TPYA 3UJ8A 2E4ZA 4ZDKA 3GIDA 4Q15A 2QN6A 1A82A 2GHQA 3AYXB 4CETA 2ZWOA 2ZYHA 3AR3A 1D07A 3JWJA 2Q07A 4A8TA 4RORA 5KQGA 4ESVA 1GYRA 2JCGA 1REQB 2C7RA 1SUCA 1RU3A 4BDSA 5I4KA 2XQIA 2SKCA 4HPJB 4Q1BA 4NCIA 2WAXA 4YAKA 1L5OA 2BR5A 3KXKA 1WSWA 4Q19A 2BF7A 3GW8A 4LJ7A 4YR9A 1YZ3A 1NRJB 2EP5A 1QIFA 1F4PA 3EW7A 2OORC 3RABA 3KKOA 1XZCA 2Y1DA 4RNCA 1TCVA 1MP0A 1XZFA 1ORVA 1PO7A 2EZ8A 2VRCA 3G2KA 3M6WA 4LN1A 5D3ZA 4ZMRA 5KPDA 2OMEA 4QUHA 4NNOA 3OFKA 3MBKA 4XIJA 2JEOA 2CMGA 2BUCA 2PSEA 2BEWB 1WOMA 3SIPA 3HI6A 1BTOA 3LLUA 1M7HA 5AJTA 3I2FA 5JC1A 3ZWXA 5COAA 1EYZA 5GPBA 2FDXA 1M74A 1CD5A 3PQ5A 3C4VA 2H7XA 4R0NA 4DMGA 1X7ZB 1MOZA 5AHWA 1IU9A 3KKMA 3D02A 1RXCA 4XCQA 4KX3A 3DWFA 3DMDA 2FRDA 5H82A 1TZMA 4CUZA 1NY5A 1EJ0A 1OBOA 3KJNA 2I0FA 3MTEA 3MOIA 2SECE 4J0IA 2FMFA 1K66A 3E82A 3K4HA 5E0OA 1IJFA 3X1ZA 1BVHA 3H5TA 4JNKA 1U1DA 2I3GA 1T8PA 4CIXA 3DKVA 3BSSA 1V8OA 4G1CA 2BW0A 4FTWA 2H1FA 2WAYA 2Z30A 4U2KA 1IIBA 4TGLA 3E22B 2XYRA 3S70A 5J2UB 1UWCA 4RLHA 3O21A 2GJ4A 2WYUA 3K30A 2CJWB 2QZZA 3UUEA 1I2ZA 3CX7A 3MCWA 4YRZA 4NY1A 4ENUA 2Q5QA 4OMUA 4XQ0A 4EVRA 3UMJA 3LVRE 3R6DA 1ZGZA 2JH9A 3KZNA 4FINA 4J9VA 1L7PA 2C4TA 4OP1A 2QZ4A 2D5LA 1YB4A 4PGMA 4UD2A 3AF2A 2W7TA 2G7ZA 4BRUA 2NP6A 1C4XA 3CCCA 3A36A 3AXTA 1RYYA 1QTRA 3QVKA 4H59A 1EJBA 3A6GA 4B40A 2X5XA 4H4EA 3AGPA 3IKMB 1RPTA 4MA0A 5CH3A 5AW1A 3FPBA 4MVWA 3WG9A 1USUA 3FYTA 2O0LA 2Z4SA 1BJRE 1EX6A 1E3WB 1W49A 4XOIA 3HL0A 3ROGA 3V1LA 3VMMA 3W2EA 3ZY4A 5EIEA 5FPSA 2JLSA 3M33A 3ELYA 1DKPA 2OHVA 3A6DA 5K8IA 3KQWA 4D4KA 4NMMA 2VP2A 1Q44A 5HJ2A 2OD9A 3GNTA 3SJZA 4KACA 3UWPA 4CV3A 2PQ0A 1WL8A 4YJ2B 1U7DA 2VSYA 4PW0A 2ONJA 4BWVA 9ATCA 4Q7LA 4MWTA 3JWIA 4ZO4A 2COEA 1L4YA 2DUNA 3CGGA 3LBFA 3ROMA 3WL7A 5KTOA 2CD7A 3ZIAD 1QV9A 3KAKA 1YXMA 3WIDA 1LBTA 3L4EA 4GZLA 3EPLA 2AN5A 4DE5A 4F04A 4HDCA 4UBOA 3V8QA 4D45A 2F9FA 3JQFA 3QEJA 3DE7X 2C1ZA 5IAEA 3CLTD 3HU2A 2MT9A 2ZS7A 4UTOA 1C14A 2ZQYA 4KTTE 4RXMA 3UJ9A 1RAFA 1R9JA 4G85A 3F5QA 2C88A 1YQDA 1BEZA 3NBYC 4HT3B 3H05A 2IZ7A 4P54A 4QUKA 4W9MC 5LBUA 3WGKA 2XGOA 2EEPA 4MJLA 1JNYA 4WLFA 5LA6A 2JKZA 5CA0F 4F91B 3K9NA 4G0WA 5EMKA 1D2CA 1XZKA 2BZSA 5AKEA 2YWHA 3A28A 3DONA 3KSDO 3Q2KA 3TRKA 2N3ZA 3WLHA 4EAAA 4XQGA 3Q7SA 1L5FA 1Q7GA 4N49A 5C7LO 2B4RO 5G53C 2D1RA 3NOQA 2JJ2A 1QLWA 4NOMA 3TCXB 4RHXA 4IIEA 4DV0B 4IXMA 1ISHA 3BWDD 4UFNA 3TEJA 1JIVA 3A0UA 3K16A 3OU2A 1NJFA 3MLBA 3V1UA 1VL0A 1QPBA 1V43A 5D8DA 3EHDA 3E22A 4NZMA 1LNSA 2DULA 3RFUA 3IQHX 1ZN8A 2O2JA 1KMMA 4M1MA 4UD6A 5NULA 1B7GO 3V33A 2Q8NA 3EIFA 3EN0A 2PUHA 4QG7A 5TRTA 1HMPA 1D0SA 3WLRA 1IBRA 3QEAZ 3AG5A 2AMFA 3EMBA 4BB6A 4CLEA 1GPWB 3QPDA 3MT8A 3ESYA 1S2MA 3KR2A 2DBRA 1WDTA 2Z2ZA 1H2FA 3DNFA 2WU4A 3G23A 3H2JA 3PXBA 4G63A 3HCDA 2VCHA 3MJRA 5GZ1A 1JEEA 9MHTA 1PRYA 2WKRA 2VF8A 2FWJA 2QZJA 4IFTA 1PK8A 5LP6A 5AVQA 3LXRA 1E3EA 3N3BC 5E3JA 1DKOA 3PZBA 3DE4X 3QUQA 1M67A 4ZC1A 1A5TA 4RVUA 3K9FC 1UXJA 3QXGA 1YB6A 1FDWA 4WNAA 5EMNA 4KXXA 4OU5A 3UTDA 2F17A 2O07A 3KUCA 2SBTA 1KAGA 5DV9A 3A1TA 4P86A 1BKSB 4XYGA 1R0LA 3TLEA 2VQFB 2O8FB 5EE9A 4HADA 4UHJA 1ARZA 1T5TA 4FEGA 4HNUA 3DUFB 2FN3A 2Z98A 1CF4A 1ESMA 4G0XA 2DOKA 3QUSA 2GVNA 1UJ2A 4HEA6 5EXXA 2RARA 3QSYA 5G0UA 1LK0A 4CM8A 4F4IA 2IZOA 3MAJA 3OECA 1TMKA 4XI9A 2GF9A 2OHHA 1Y89A 2W2PA 4PAMA 2P2LA 1IZYA 4M8SA 5BUSA 4UUPA 1QO7A 3O8RA 3KELA 3NBXX 5CYPA 2QX7A 2N1MA 2X0KA 3TCKA 2Y6UA 4KXNA 2XWQA 3V46A 5K8CA 1GPYA 4GE3A 2PLWA 5TR9A 3JZFA 1A7UA 2BE9A 5HKOA 1KP3A 5K20A 3LQFA 3D4LA 3QEOA 2B1JA 1XD9A 2OVBA 3MMXA 5C8YF 3PTZA 4OH7A 3SDSA 3D3WA 5EPEA 1BDHA 1PZFA 2CUTA 1QHYA 4HX5A 4MITA 3PFHA 5LQAA 1RKUA 1SC6A 3MF4A 3Q5EA 5DYGA 2C61A 3IVRA 2Q7XA 2VIIA 4WZBA 1M1NA 1OIWA 3BFKA 3M2TA 1KH3A 3R0JA 2B78A 3CF4G 3IR6A 3Q15C 5HUHA 2PKEA 1NDQA 4IF4A 1S6YA 4G1VA 5DW0A 4KOEC 3JAWA 2XXAA 5EUQB 3GCZA 4GOLD 1A27A 2Q3DA 3S55A 3PUKA 1XE3A 1Y7TA 1WJGA 1SQ0A 2GCEA 5FOSA 1Y5IA 1E0DA 1ZMOA 2FWIA 2GK3A 2J3QA 2OV3A 4GZ6A 2J31A 1SHZA 4LXQA 3TAHA 3ZWNA 3E35A 2H6EA 3H75A 2H11A 5AJUA 4Z7QB 1R0KA 4CUKA 1JEOA 4A0RA 2MR6A 5JI2E 4P9NA 1NI4A 3UGKA 1VLQA 1YI0A 1ZOOA 3EVTA 3OZUA 4I7EA 4Z2YA 4Q37A 5JSHA 1ZG3A 1ZNZA 2B9VA 1WCIA 1OGYA 2PRKA 2PT6A 3LC7O 1DQRA 4KTVE 1N78A 1UKCA 4MW4A 4COOA 4MIOA 2QTGA 2ABWA 2YS6A 3PFIA 5DCWA 1NT4A 3RUEA 1W19A 3H11A 2Q2NA 1AF4A 3FHCB 2YIDA 3ZGNA 4C76A 1BQ4A 1GR0A 1T5DX 4O1IA 2ZBDA 3IEUA 3T94A 2FZVA 3PEEA 1WVIA 3RTCA 3GJZA 2OB2A 3PSHA 4OHBA 2OYCA 4F84A 3K92A 3IO5A 3A1SA 3K5PA 1QGUB 3NH6A 4UTXA 1X7DA 2QK4A 3RJZA 2JI7A 1MCZA 3HDJA 4GX1A 1PJAA 4RD3A 3LD9A 2C07A 1CZRA 3HZZA 1K8RA 1T1EA 4REQA 4QPDA 5EIWA 1Z6QA 3U4MA 2TYSB 4NVRA 5HIKA 3H87A 5AVYA 3I30X 1U28A 1LW6E 3VR4H 4UBLA 4CIDA 5FI5A 3WC4A 5F98A 3GDWA 3FCXA 3OZBA 4YWHA 2JCXA 1CR2A 2ACVA 4B83A 5FUMA 5J5VA 3W9UA 2I34A 4JP2A 4EF6A 4ND7A 1T36A 1DAIA 1N0UA 4BTLA 4AMBA 4II7A 2VPPA 2BI4A 2D1FA 2IHTA 1QFSA 2KB0A 3B7PA 1CKEA 3ETDA 3IOCA 4KHPB 1DXQA 1K5HA 1KK0A 4KXLA 4R81A 1BMFA 1FLNA 5AT1A 4BJ5A 1J23A 4LHEA 3VHRA 4FD2A 4UUBA 1N5DA 4UPEA 2MSWA 1NPTO 3V8VA 4XD2A 3NIBA 3H13A 1P44A 4BKOA 1RRPA 1YOVA 4KYIB 3O93A 4L51A 3W9YA 2HXGA 2XBLA 4KDCA 4MRMB 3PDWA 2A14A 1OA0A 3U56A 3GEPA 1I1NA 1O97C 4AECA 1N2GA 3KSUA 1XQVA 5B53A 3U80A 2IPLA 3C7TA 5BMVA 4AMGA 5EKSA 1VKOA 4FFRA 1D3AA 1UPBA 5K8UA 2X8WA 3AFOA 4LE2A 4LNUA 2VJYA 4UBNA 4I6JA 3CT6A 4R2JA 2ARKA 2VUTA 4ARAA 2QYTA 2OAP1 2P4HX 1WCWA 1JQDA 1Z68A 2PH5A 5AUOB 2EBWA 3TXAA 2ZPUA 4ND8A 1OBVA 4PBSA 3TDMA 3CNOA 3LRPA 2WT8A 1E61A 1I4EB 2BFEA 4E30A 1SK9A 1SU8A 2K7ZA 3KT6A 2IUSA 3HACA 4OQQA 2F64A 1O94C 4QNMA 4TLDA 1SULA 4C4AA 3OCUA 4ZAXA 3IBSA 1QKKA 2DHQA 1E32A 1QH9A 4OI2A 3MAGA 3MUFA 1NVWQ 3I9MA 3VKFA 5CDTA 1N2HA 2WIKA 5IHPA 4FGZA 1G9SA 1JG7A 4MIKA 3ZI7A 1OH7A 2E48A 2GA9A 8ABPA 4R1LA 3IOYA 2CCGA 3NRJA 3Q6IA 2YFQA 3TTSA 1Z3CA 5E9JA 1F60A 4M21A 3C1TA 2WUFA 3KZ1E 2DY1A 2F7SA 3MEQA 4LXXA 4EG6A 1Y8CA 1ZIDA 1KE2A 2O5VA 2XZDA 5C18A 2WINI 2FSFA 4Z0HO 7MHTA 5FV7A 2UZ1B 2DXIA 3T38A 1DL5A 4RKQA 3WRYC 1JFRA 1L9KA 3DVAA 1VE5A 2V8OA 3OTHA 1NYTA 5CA1F 1QP0A 4K86A 3QBEA 3R5SA 1NASA 5BO5A 1HFWA 1TJ3A 2VNAA 4UQLA 1GD1O 1OYYA 3EC2A 3MVEA 2WFAA 3ZXYA 1GZHB 2PS1A 2Z5GA 3PCTA 4OKNA 2RHJA 3QTBA 1DUIA 2KQUA 4P4GA 1NQWA 4GLBA 5D84A 3ZDEA 3IODA 3ENZA 2HAEA 2Q8QA 3JWPA 3GGGA 3BWMA 1EQUA 3LA8A 1ZX1A 4MB2A 1W9MA 4EDFA 1UWVA 4PLPA 1HK7A 2DFNA 4ZTZB 5AVSA 2B82A 5IT9A 1NKVA 2H2IA 3SYRA 1R15A 3E3LA 2IHKA 3FKJA 3ODGA 2ZBGA 4HN2A 3EMVA 5C4IA 4O08A 1Y1RA 4MQEA 2XOEA 2OXIA 5CB0A 4M7PA 1GQOA 3QP9A 4ESHA 4W5NA 2B69A 3IR5A 1X39A 4L50A 1MIHA 3IT3A 3HGMA 3O3NB 3ETEA 2ENUA 3LUCA 1EX7A 1L5KA 5C5CA 5IN4A 1MMFB 2CVHA 4G1UC 2NWQA 3GGOA 1TJPB 3OJXA 3PDCA 2XX3A 5DDIP 1KO1A 2NP7A 3AJ8A 2VDJA 3LPDA 1EGMB 3FUCA 2ZTUA 5ES4B 1QVWA 3AW8A 1JJIA 1T4DA 2FK8A 3SEAA 4FHFA 3O91A 3PNOA 3BAFA 4L16A 1IN4A 2FG5A 2V4ZA 1RKVA 3CR7A 4KXMA 4GDFA 2D6FA 3LOPA 4PX9A 2IODA 3HSYA 1N2BA 5CJJA 2QTTA 4DTCA 3N58A 4WASA 1RLUA 4ARUA 1BNCA 5I4CA 4IS2A 5JAHA 1M2FA 4OAQA 3ZG6A 1T6XA 4PAOA 3M3PA 4A73A 2LWIA 3KT3A 2C2MA 3ONNA 3OPYI 1T1IA 4XM0A 4OX9Y 3KTAB 2WI8A 5AUPB 3CBGA 1O94D 2R6R1 1CJBA 3I01A 1G9XA 3IL2A 2FOIA 5BYJA 3F9CA 3HA5A 4KKVA 3EQ8A 3FTCA 1QMGA 3HWSA 1XZGA 3OM9A 2PX3A 3OZSA 4IJMA 5JZOA 1WD7A 5YASA 4EX6A 1MAHA 2OENG 2UAGA 3A04A 5TT1A 2I6SA 1EFHA 3UH0A 3V2HA 3HP7A 3GPCA 3GP8A 2H57A 3PUIA 3AEKA 3GEMA 1P7PA 2QROA 3OU7A 2HU5A 3V8MA 5F7XA 4MARA 3C1AA 4IJKA 3R5HA 2DQZA 4DR4B 5BV2P 1OV4A 4UXIA 3FCUB 3U3RA 1H42A 3VPSA 3NUZA 1V7PC 2PUWA 1F6WA 3EZ6A 1YC5A 3FXAA 1U65A 2R1TB 3GJ8A 1YKGA 2IIVA 3CVYA 4XGKA 4GQBA 3CO5A 1LI7A 1M1YB 3HMKA 3W6UA 5T57A 4BE9A 4IDCA 1G5QA 2R1VB 4D9EA 3ZWMA 5B2FA 2E7ZA 4RTPA 2YYYA 1ZXLA 3SQWA 3E4DA 3EYAA 3VR5H 4LTDA 4TRNA 1T2EA 4M0CA 1WP9A 2GARA 1OLUA 4Y2RA 3MJ4A 1W0CA 1RNLA 3M5WA 2BTQA 4IO1A 5IXSA 4EPVA 1GQFA 5IFLA 3H3JA 4IIVA 1MB0A 3BSYA 3K1JA 2FETA 1J4AA 5BR8B 3VH4A 3EOZA 4IIYA 3UEOA 4DMMA 1JKFA 4P33A 4ZIRA 2AQ8A 8GPBA 3V5NA 1QU3A 3N9IA 2H3HA 1L5WA 2HHCA 2WYOA 2JFNA 2WVAA 3DP7A 3L7OA 1MZPA 2YTZA 2B5OA 5IT0A 3LWDA 6ABPA 5L6LB 1ZGCA 4LZOA 2JZNA 2WM3A 3KV3O 5BVHB 1AM4D 4LPSA 1MJFA 1GPJA 2VT7A 3LLCA 3O8DA 1W2HA 3H17A 4MKZA 5HKAA 4UDYX 2OCPA 1V3TA 1OI7A 2XTMA 5C8YB 3FFBA 3C5HA 3BIXA 4D3DA 5BVGA 1VJGA 1AF7A 4IKEA 4EEZA 1KBZA 4CCSA 1HT3A 1KY4A 2YBEA 1QH1A 3DHYA 1XZHA 3CF0A 4LK3A 1F2VA 1S1CA 1IHUA 4GMKA 4OTZA 5ALKA 1XVAA 1AGXA 2WVGA 4D9CA 5BNWA 3IEPA 2NV6A 3WNCA 1QO0D 3LT1A 4YQEA 4L5YA 3E7PA 4J9UE 5DWQA 4X7RA 3CVJA 3JXEA 3PLNA 1JH8A 2H5LA 4TZTA 5BSVA 5LCXA 2WWYA 5TC4A 1U0LA 3HHEA 2GKSA 1YKSA 2ZAMA 4RZSA 1YIOA 2QM7A 1REQA 4RZHA 1D6MA 4DHWA 4XM1A 1TRKA 3D0RA 3BMCB 4BKRA 4B2IA 3W5AA 1IG3A 5BR7A 3CXRA 2AB0A 1PHRA 2IS2A 2CZCA 1Q1NA 3KR1A 5H7XA 2C95A 3IQXA 5F1KA 3BM5A 4YQYA 1FLDA 2WB2A 3RU3A 3A70A 5KC9A 4M1EA 4PC2A 1NVVR 4BB0A 2B8NA 4EG5A 1M0SA 4M53A 1JEJA 1JAYA 2GASA 1B93A 4G0NA 1EFPA 1JR3D 1KYIA 4I50B 4B2PA 2ZWPA 5CG1A 2CFTA 1GSAA 3K8YA 4RVNA 3BD6A 5H80A 3KVRA 2GAIA 3L7MA 3LQRA 2WV9A 4KX5A 5DLQC 1P5FA 5ALRA 5EQTA 1KS2A 3BDAA 3H1BA 4KR0A 1SPBS 4TTPA 1OCEA 3NANA 4IOJA 3PX3A 1Y4AE 3IV9A 4V02A 3LCVB 4Y8VA 4EMSA 2ZRAA 2J0QA 3A1VA 4PCAA 5K3AA 1MORA 4X71A 4FDVA 4PSUA 1TQ6A 3LUKA 1NLZA 3ONEA 3RRFA 2IGTA 1VXRA 2ZBEA 4WN3A 1XAIA 1RI1A 2DKOA 2XTAA 3D6NB 3NH9A 1NNUA 4X44A 4D25A 2BZ0A 2R47A 4ZK2A 3ICPA 1G8AA 2ZIFA 2ECKA 3WWZA 2PUCA 1M72A 2GEDA 1KI6B 1PJZA 2XNDD 1F7VA 1U1IA 3BGIA 4M1ZA 4U7PB 5DWDA 1YASA 1L7OA 2OUIA 4JLNA 4WZAA 3LIPA 4UBKA 3OE5A 4F3CA 2QN3A 3X43A 5K45A 3AF0A 1HQDA 2NZYA 5T41A 3ZBTA 3UBTA 1EUYA 1JQEA 4DAOA 1LVHA 2ZTVA 1UBOS 4CDRA 2CXNA 1IZ8A 3E23A 4N8EA 2C8VA 5M7EA 4EB3A 5CTAA 1MOPA 5KREA 1BDIA 3ILSA 1ISIA 5DE3A 4HDSA 2QTCA 3TNFA 3QYJA 3GAZA 2ZATA 3IJRA 3TLKA 1FPMA 1L7QA 3ASUA 4HXYA 2MSCB 1ZD3A 1SVSA 4XSHA 5EIFA 2GH1A 3WMWA 4BP3A 1O6FA 1P2SA 1G5FA 2QM0A 4MS4B 2YWDA 4XTRA 1MQAA 3G2JA 3MCUA 3QW2A 3H5LA 4F2DA 1VKNA 4AKGA 2TRSB 4QOHA 2O4CA 2NU7A 1HT1E 2OLJA 5TE9A 1GQQA 3DWGA 4J94A 2OBMA 3DG9A 4PHFA 3V4FA 4UUQA 4RDCA 3MD9A 3ROPA 1FTSA 2ZYSA 3U5TA 6REQA 2X40A 2DRIA 3GC6A 3OD5A 1Y3FE 2OECA 4BQFA 2APJA 3IXMA 2UZ0A 3HBLA 3R6GA 5A03A 1MN6A 4IXNA 2WJ6A 3WJAA 3I52A 3CRQA 3R8FA 3RBAA 1EP9A 2A5JA 3D8BA 1BHJA 5G1NA 1DELA 5I8ZA 1UMBB 1E5XA 4PNZA 4YIHA 1EU1A 2QN9A 3UB4A 1VJDA 3DULA 3O4HA 3WGNA 5LPNA 3UAVA 2HDHA 3MCVA 4IF6A 4CQMD 1YFJA 2HLNA 4YUYA 1XKTA 3OU6A 4M0LA 5BSTA 4R71A 3FDZA 5I3CA 5EZYF 3Q3EA 1J5EB 1UBUS 1EXMA 1XMVA 3GCWA 2ZIVB 5K0LA 3PR1A 5KSPA 2DH6A 3ZQ4A 3ZE9A 1GT6A 2VHCA 1Z6XA 3Q11A 7YASA 3WK6A 5BORA 2BYTA 1NJSA 2O0MA 3Q40A 4J75A 4C6TB 3CCBA 5IAOA 4RTMA 4JBHA 3E4CA 1UC5B 2HU8A 2WTEA 3NCTA 2IYFA 1FUEA 1LTQA 5DOVA 4OYHA 1E2EA 1LUAA 4LSWA 1ISMA 1NW3A 1I5OA 4PO9A 1EDBA 2Q6LA 1JFSA 1TTHA 4TWIA 1Q14A 4I4TF 1BRTA 1YZTA 2W4IA 1TJ4A 3BB1A 3KPVA 3L8YA 5AHKA 3KKZA 4A23A 2AZ4A 1G9TA 3S81A 4RM2A 121PA 2WU0A 3T12A 1P31A 2FPIA 4KFTA 3C3EA 1XL0A 2C7GA 4O29A 4TV9A 2NUAB 3UMCA 4MVJM 4DSOA 2EDAA 2HJRA 3N2ZB 4YMWA 1ZJJA 2W6QA 4A1OA 1JSCA 3STXA 3VR1A 4HGOA 4WBNF 2QMQA 4W5QA 2WIJA 1AMNA 2DT5A 1KSGA 1FXWA 3QKSB 1W6RA 2ZR0A 1ZH0A 4JBXA 3T61A 3X2EA 3LT4A 2HMSA 3W9SA 5LJIA 2ZSKA 1O7JA 2W93A 2ZRGA 4TYWA 2Q4DA 3L0BA 3NASA 2P9TA 2PZEA 3ER8A 1JVBA 2NYAA 2LD4A 4JR0A 2X0IA 4MUXA 3PCRB 3UICA 1QS0A 3CPJB 2BFDB 4BP1A 1LFDB 4KWHA 4BNVA 5MN6A 3NWOA 2W2QA 3ZXUB 1YMUA 5CCDA 1E9CA 1QAMA 1VKHA 3LCRA 4EJFA 4TYMA 1YBAA 1KYWA 2PZJA 3PNQA 1HNXB 2PKQP 4I55A 1JL3A 3RHZA 1WXXA 3F9IA 5AWFC 2J9FB 2WTUA 2ZUFA 2OD2A 4LDPA 5AW0A 2PGNA 4CKEB 2NSLA 4YMLA 5LM3A 1RXVA 1XIVA 1V5EA 5ENZA 1JLMA 4JJ7A 3TYXA 5D5QA 4BEVA 1XK6A 5FBRB 1MIOA 4F60A 1PVDA 3TSZA 4A5SA 2R65A 1RABA 1NDUA 2Y3IA 2DTDA 2FE4A 3BORA 3MJVA 2GJAA 1YI8A 1DADA 2QQEA 1OW3B 4Q4AB 4YXFA 5C5IA 4OBWA 5AJYA 3G02A 3UAWA 4YJGB 1AXEA 2WSSD 2DT8A 2J30A 3KU1A 3G9XA 3FLEA 2P9FA 4FEAA 3X1DA 1SCUA 3RHFA 3EVFA 1ZUNB 1KFJB 4A16A 1V2HE 3DYBA 4MTLA 3U4GA 1F1BA 5LB2A 1WZEA 2AYZA 2IWRA 5C51B 1NP7A 1NQVA 2XB4A 2XCIA 4JUDX 1GG2A 3SKYA 2V3VA 4A8PA 1TOAA 1M5TA 2CJFA 4Z8XA 3A1DA 1Y1QA 5CVTA 1K68A 3ZX4A 1JDUA 1EE2A 1PGQA 2Q5JA 3RIEA 4GR5A 3AVWA 4B84A 3T95A 4N6NA 1J8FA 3W8EA 4NH0A 1KZHA 4YT4A 4AJ2A 2FKNA 1W5SA 3BXXA 1V16B 1WZIA 1X7HA 2HRRA 2NSJA 2W9XA 3VTKA 4R9RA 1QIEA 1XZBA 1L5HA 2QMZA 2OFFA 4F8YA 4WA8A 4ZVSA 3ETGA 2EKPA 3VH2A 3G8CA 4KXVA 4Y6GB 3NBZC 4L72A 2R8XA 4TKUB 1V6AA 2HTEA 5LBIA 3B6JA 1DKMA 4KE9A 4Y9TA 5HXAA 2ODTX 1RRCA 2ZYDA 2IX3A 4FFWA 2QB5A 3RFCA 1ZHOA 1PUXA 2P7IA 4OQEA 1Z16A 4ARZB 3ZDBA 3EQ2A 4RPJA 3CVVA 2QUJA 3WP1B 1NXQA 2P9ZA 2TMYA 2YMPA 3PQ3A 4LY3A 3CH6A 2IU0A 2JIRA 5CMLA 5B3KA 1IN6A 1XCJA 5REQB 5T6MA 3S1SA 1LVUA 1YCHA 1SOWA 3EF0A 3H6HA 2G70A 3GEIA 3MIIA 4L76A 1QV6A 1RZ3A 4N03A 1FUYB 1WCYA 5JQGF 3EH1A 2CLOB 1C2YA 3EVEA 2VAPA 4G4IA 5BOVA 1NKTA 3OJLA 4X6LA 2YIVX 3EBPA 4ZVUA 2DBZA 3CUSA 3L0IB 3WGZA 2P75A 4IDAA 2SCUB 5LQNA 4KGXA 3U81A 4HLUC 4FFSA 5F2EA 3A4NA 3MIZA 3BHNA 3EJWA 4F93B 4NCBA 4NDNE 5DM60 3HB1A 3I2GA 5DBEX 1TM5E 3MB8A 1TO2E 4F3RA 3DYIA 3MWDA 3KKPA 4TRJA 3ET5A 3MJSA 3PUHA 1LDEA 3CBQA 5TF4A 2ZSIA 4RHUA 2C9ZA 5D5PA 4LFCB 3SOPA 1KKMA 2JFFA 2MYTA 1ULUA 4G8CA 5TEVA 5TPWB 5JBQA 4NYIR 3FTFA 1NFRA 4LKRA 2G3YA 3P9SA 1O6BA 1USWA 3RIXA 2R6ZA 1GTZA 3FPSA 1IXYA 5DGTA 1Q1EA 1F8GA 4U4AA 1K8XB 4MQLA 4V1CI 3VU1A 4FFBB 3EAFA 4GGPA 3ONWA 2ZANA 5IYZF 1JYFA 1BWRA 2FN7A 4C04A 3GGDA 3JZDA 2AVDA 1JSLA 2X8LA 4BUCA 3RODA 5DNVA 4OYYA 5F7OA 1RQPA 4QOEA 3O2QB 4RZ2A 2VQ6A 1NHGA 2E5LB 1BWSA 3BE6A 1SNYA 4P3YA 3JQ9C 1R7RA 3MGGA 6LDHA 2PS0A 4L75A 1J06A 4RIHA 2CXQA 4DLSA 4QHTA 2WIAA 1FRNA 1XNQB 3D7NA 4TV8B 2BZGA 4PQEA 4MIYA 5ALOA 3AHGA 2JI9A 4IZ6A 3ZDZB 1FYEA 1GZ7A 1ODSA 1LBHA 3M6MD 3OKFA 4YP1A 1F3LA 4UUOA 1XC7A 3LPNA 3CVOA 1O8CA 1J20A 3GT4A 3ROKA 3JSAA 3MB5A 1W73A 3OLWA 5EEHA 3D2CA 2JGNA 3GHHA 4X20B 1QAOA 3ER6A 1JFTA 3PTAA 2IOQA 3JQQA 2BUAA 2J3KA 3QG1A 4Q7MB 5EP1A 5F2KA 4X62B 1T8SA 4FWBA 1P9LA 3ZE2B 2I6TA 4LXYA 4B81A 1YVEI 2NVBA 1MPTA 3AU8A 1XTPA 4EY5A 2G8NA 1FRVA 4TOIA 5JANA 1XDSA 2QY9A 3DCIA 5K0SA 3B9PA 2OO5A 5LP6B 3CA8A 1B43A 1UXOA 3AB8A 1L5MA 3PNYA 1EGVB 2YC4C 4GBGA 1ORWA 3DE2X 4PPYA 2IHYA 1RI2A 1XROA 4I1PA 2FA9A 1GCOA 1OAOC 1KJZA 4U63A 2Q4TA 4GIBA 4R6WA 2D0PB 4TTAA 1R8YA 3L1KA 1GU0A 3THOA 3ZV3A 3E9YA 2IHNA 2OYRA 1XA3A 1J90A 4N41A 3CHYA 3O5AA 2BGIA 3BA1A 3D7SA 3W3ZB 2ADOA 2ZRLA 4JXJA 3WY9A 3MFQA 5LMCA 4YLGA 4ZO9A 3HXMA 2XQGA 2PQ6A 4XCVA 2YNMC 3QWBA 3TDNA 1NUPA 5MDHA 3AHFA 1U1EA 4B3TB 1I2DA 1LS1A 4W1RA 3RVBA 4Q4JB 1NULA 2MTBA 4TTQA 5JHHB 5AI5A 4AVYA 5I51A 5TIIA 3SMVA 3IVCA 3OETA 3ACDA 2E0IA 4L9SA 2C42A 5CDUA 3INGA 4QSMA 3IH5A 3M9WA 1MIOB 5E7IA 3TEMA 4BX0A 4LOKA 3V8NA 5IYZA 1W1IA 2FPXA 3M82A 2AD5A 2EBUA 3KD3A 1EK1A 2JK0A 3C2QA 6GPBA 1XO1A 1UBCA 1E1KA 4BLUA 1X7ZA 5LDHA 2ZVQX 1XVIA 4RMIA 3M6IA 3N2KA 3X0DA 5ALXA 3TW8B 1W8DA 3VNSA 4EHBA 1N1DA 4BYGA 5D5HA 4DV2B 1AG9A 2PAAA 2IIBA 2JFBA 5KNCD 2DWCA 2QAIA 2QRHA 1UM9B 2ZWIA 4FU0A 1O08A 4MHSA 3VISA 4KE8A 2JD1A 4H1VA 5L4SA 3NTRA 3SYMA 3DNPA 2AQKA 1G19A 3OOJA 1HNWB 3PQCA 3LGSA 4XDGA 3VHXA 3DFKA 4AP5A 1JHZA 3BRQA 2ZCUA 5IN5A 4IO0A 1NJGA 1T4GA 2P4QA 2NYVA 4JLUA 5AICA 3PUXA 5MFPA 2QPAA 2RHHA 4JIMA 5I7VA 1UOQA 1JG4A 1N2CA 5BWBA 4TRRA 3FYUC 3PC4A 2OFOA 1CY8A 4B47A 4HXFB 1Y37A 3UMRA 3MLAA 1CTQA 1RWMA 2A86A 1BGXT 3PNSA 3ROXA 3ZDCA 1XP5A 4R8KA 2FX2A 4AKIA 3H2IA 2PMDA 2OCYC 2HT6A 3BUSA 3U39A 4ZRMA 1GIAA 5SY4A 3LY7A 2X22A 1EZ4A 4KO8A 1ADJA 1R10A 3HCRA 4WESB 3ZDQA 4E11A 3TOZA 2BHTA 3GEBA 2CXSA 2Q9CA 2JAWA 4ER3A 2D13A 2YH2A 4JS0A 3ZYCA 4AJPA 1DGQA 1BCRA 4FFLA 5JNTA 5L7YA 4X1YB 2BFOA 2HO5A 1VA5A 4TVBA 3ACBA 4FMBB 1EINA 3R3VA 3OPYA 5T5QA 3U48A 4JUFA 1AN9A 1JHXA 4MYSA 3X1XA 2H1OA 4PF1A 2YIJA 4G67A 3WDLA 5KJCA 4LS3A 5H3CA 5KQMA 4JGGA 3DOOA 3OMWA 1IK4A 4OCZA 3P71T 3PQFA 3H5WA 1QC5A 4OXNA 4NRDA 4P81A 4TMYA 2VTKA 3G17A 3P8ZA 5JCZA 2E5FA 4KRGA 3RQSA 2P77A 4CL0A 5J3JA 1P3JA 3HCOA 3IQZA 3L8CA 5L4LA 1S4MA 3GDOA 3KOWA 5SZJA 4MKHA 2X0EA 2PS3A 3RF7A 3W79A 3HK2A 4KI7A 5JSZA 3PNPA 3GY0A 4EGCB 8LDHA 2PUBA 3JY6A 4YV2A 1RRFA 1Z3IX 3HKCB 5EC8A 4DQKA 5CXSA 2B0JA 3RR2A 5LNK6 3HVUA 4OQXA 4HTFB 4IYJA 1E3WA 1PT7A 3PUYA 4H1HA 4J0EA 4QRIA 2IV3A 1DMSA 2HKIA 1HFKA 4WFQA 3WGYA 3PHHA 4H6XA 4JLWA 2B1GA 3T5PA 3IP8A 3IEMA 2PFSA 2ZJ8A 5A9TA 2R6HA 1ZOLA 1YCDA 2VYNA 3JARB 1X1EA 4XB6B 3GP3A 5ALPA 2IPMA 4E2ZA 1OXXK 1J2JA 5CNMA 5DVZA 2UUBB 3LF1A 4BNWA 1Z26A 5K0EA 3WL3A 1PDOA 2H1CA 3QIAA 2NACA 4I4LA 4N5HX 2IYTA 4HWKA 3ZZMA 2ZI9A 2FEAA 1E8MA 1OJ7A 3I4FA 3WV5A 3TTWA 3ZOKA 1NQUA 4B45A 4EYEA 2BEVB 4OJKA 3G0CA 1QE5A 1A2KC 1FC0A 4PC3A 5H83A 1NRWA 4NEGA 3V8PA 1DDOA 1HI9A 2PPLA 4PHGA 1E6WA 2ILVA 3VDMA 2W2LD 1V4BA 4O3FA 4EYKA 3D8NA 1SG0A 1K8ZB 2C4UA 2B4KA 3IUNA 2YVAA 4NOKA 4KXFB 1BC5A 4J29A 3AKZA 1WQ4A 3E3NA 1L7BA 1I8TA 3ONFA 1FUUA 5CA0A 2EP8A 2FPKA 2GF2A 1NQOA 4NC9A 2RGNC 3CB4A 3HFSA 1OMOA 3AOGA 3RRBA 1YBHA 2PM8A 1DDIA 2LP4Y 1MPXA 3ILHA 3JD4A 3BJEA 4KN9S 4QBGB 4RPLA 4A10A 1H2WA 1VPDA 2XW6A 5E1BA 5LQSA 4CF5A 4ICIA 2C5FA 4N54A 1MHPA 3BWEA 4TN1A 3SE0A 5KYYA 2GJSA 2O20A 2ZUVA 2O8EB 3DL7A 2G82A 3UJCA 4HFNA 4DIKA 3C3CA 1ZVMA 1NURA 4Y1EA 4Y9UA 5DCLA 1ESNA 1Q7RA 1F6BA 1XRJA 4QARA 2IUFA 3WIBA 2HN9A 1L4KA 4A0HA 2GESA 1QTIA 4M0KA 2HLDA 1WXWA 1GPNA 2WW8A 5DYNA 3ADBA 3IE1A 1WTCA 1IOWA 4LSZA 1AA9A 4O0LA 1KDPA 1Y7HA 3C3JA 3UXEA 5MN5A 4IG4A 1XG5A 1NNSA 2I33A 2RH5A 3B9QA 1DAMA 1T6YA 5ENDA 2ZJYA 3LX6A 4NPHA 3NOVA 3DYVA 4R54A 4JEIA 3MM4A 1O9GA 4TLLB 3QXXA 3LOUA 2K2WA 2PKQO 4B76A 4WBXC 3ET4A 5B7QA 3VOAA 1GV0A 1US8A 4N0PA 1MO6A 3J81k 3WX0A 1WBBA 3BFXA 3FZQA 1WF3A 3GOQA 3I28A 4ZO8A 4B8YA 1CZOA 3L7BA 1NMEA 3I39X 3VMFA 2QE7A 1UPTA 4TS4A 3NFYA 1ENZA 1IZ7A 1NI5A 1JKIA 1HT0A 1P39A 1CZUA 2A57A 2P6UA 3KC2A 4S1PA 3ASYA 3TL2A 3WKCA 2P1DA 4PLGA 1U63A 3AY0A 3MUOA 2H5EA 3GLIE 1OPXA 3V9PA 4RPCA 5C32A 2E87A 2OCXA 2QVYX 3SIRA 1RJEA 4B4WA 2UYHA 4PSVA 4RULA 4NBTA 2RE8A 4KZPA 4QYTA 4UM9B 1NW4A 1SKAA 2DFDA 2WMDA 4LCJA 2WSLA 1R4ZA 3COYA 5E4TA 5EXPA 3UUFA 1HTTA 1IEQA 4IP0A 3W5HA 5JVDA 1VPLA 3U3KA 4BNDA 2ZUEA 2EKZA 3GCDA 4GPAA 1F2TB 2WJZB 4WX2B 4YJFB 4L4RA 4ZAYA 1J5XA 2P2SA 4I36A 5JECA 1IDOA 3GK3A 2F3QA 1CZKA 1GDDA 4G5SA 4KI0A 1DEOA 1N34B 3K0EA 4MV3A 2ZUDA 2X4LA 1N2OA 1CUIA 3ECAA 1WPRA 4OHOA 5LA6B 4AWAA 3OEHD 4JJAA 1JDPA 3U7IA 1IY2A 1IHXA 2COUA 1PKXA 3PF8A 4CG2A 4CNQA 4HEJA 1EFDN 4K9LA 1OR8A 4UFOA 5AH0A 4C43A 3PHIA 4E2WA 3T1VA 4YAWA 1U6JA 2VDMB 4URZR 4PX5A 3EK2A 1G3IA 3DF9A 4Q1DA 5FUVA 5HILA 2Q6TA 1O8BA 2DH5A 4ZT4A 4CTNA 3MSCA 1LLQA 3OF5A 1QANA 3BAZA 3MMSA 4C2AA 5EG5A 1IUNA 1SZJG 2JIZD 4DNQA 3EGCA 1A88A 1EHCA 4DZZA 5IT5A 5CXXA 5JG7A 4WMLA 1QQAA 1UZUA 2D2FA 5ES3A 2XCSB 2JFUA 3IAS6 3THWB 4LDAA 2YYAA 4Q3DA 1X1RA 1CWUA 2F1HA 2PO7A 2J7KA 5B1SA 2CLMB 5AKYA 3I23A 1QYDA 2AXNA 3OZCA 2COKA 4TTSA 4OX9B 1X7XB 2HCFA 1N2EA 2HC9A 2VP6A 3FVWA 3M6UA 4FE4A 5E7QA 5KSWB 1FFDA 2EZUA 3O73A 4L4SA 4PFSA 2HHAA 1H3FA 1QG0A 1G8MA 2RGBA 3SIXA 3U7GA 1JR2A 4Y18A 1VKJA 1G3RA 3KFLA 3PUVA 4RXTA 3ZTTA 1CBUA 2AN9A 4BAZA 2PZFA 5A2GA 1VFPA 2PMCA 2BMDA 5D6NA 4XGQA 2R8ZA 3CF2A 5FTMA 4FT4A 1M6NA 3ZD7A 3ESQA 1EBBA 3EMDA 3IPLA 5BV8A 1FSPA 3AGQA 4AJLA 1ULHA 4GXRA 3LQ2A 1EDDA 2WOOA 4I5IA 4MEBA 1YFLA 1XPOA 3CEHA 3LX4A 3PP8A 4QL3A 2BJVA 2C5HA 3FVTA 1KYQA 1ZLXA 4U02A 2VTBB 1XZEA 4Y9DA 4FT2A 2KBFA 1V9SA 5FNVB 3LT5A 4DR2B 4G0QA 3BRWD 4K6GA 1RLIA 4ZYXA 5B7NA 1PZEA 3A14A 1BVUA 3FYHA 3GPDG 5C1PA 2RD2A 4FOLA 1IL0A 3P4XA 1CJSA 5BUZA 1DJMA 4LKOA 2WUDA 2AJBA 3BMOB 3LU1A 4X66B 4J0QA 1JJ7A 1D04A 4JELA 3OCJA 2PNJA 2JA2A 1TQ4A 4N1AA 5FLKA 2QUKA 2X4GA 1RHUA 4FWTA 4P4UA 1M54A 5KMGB 1L7MA 3R41A 4NOLA 3RSLA 4N3GA 2DAPA 2IV2X 2X5OA 3KPUA 5JCOA 3O8QA 5C34B 3R7LA 3ONVA 5K6AA 4PZCA 1EMDA 2QTZA 2SICE 3ZQ6A 1Q0LA 4PC7A 5NLLA 1HL7A 2H0AA 3D8SA 3HCPA 3VTFA 2YIMA 1KQOA 3HVKA 3AVTA 2C83A 4HX2A 2GWHA 1H85A 3A6ZA 3A37A 2Q45A 3A32A 1IZZA 3SBOA 3CV3A 3GP5A 1W8IA 1NE7A 3CR8A 1PJQA 3DCJA 1XZNA 1EBFA 3OZXA 5F3DA 1NLUA 1N1EA 1XCOA 1KBOA 1GKYA 1V0JA 3DGFC 5HS6A 2VVTA 2V0GA 1AQYA 4HEQA 4NMWA 1NMZA 4E7OA 1YQWA 4R8MA 2WSYB 5IVIA 2W6PA 4CBVA 1K4YA 3AESA 2RGNA 1ADFA 4QPPA 4OLJA 2ZK7A 4C7JA 4DPLA 3TQHA 3H6GA 2XUHA 2D1YA 4H31A 1G5PA 1QV7A 2JDID 1ZJZA 1G66A 2GEJA 4X8OA 5TVKA 5HTOA 1OYWA 5B12A 4PG4A 1J8QA 4HPXB 3CX8A 3AEUA 1XQ9A 4TV8F 5EXEA 4AC9A 1GAQA 2ECQA 2JGJA 3L82B 2NVUB 2CLIB 2X15A 4YRKA 4MW7A 1XF9A 3H1AA 1BZYA 3JAMA 1OWLA 3FSRA 1VL1A 3KVOA 1ZYUA 3DOCA 2ID7A 4RH0A 1T29A 2C97A 2POCA 2QTLA 4W1QA 5AR1A 2P5TB 5JQGA 5BWCA 1TU3A 2IXTA 1J0XO 3PFKA 1ZIOA 4TQAA 4EPRA 1WD5A 3NVDA 1FFXB 3PYXA 1YRWA 2VQSA 4FN5A 1RYNA 1Y48E 1LPPA 1FFXA 2HIHA 3UHOA 4DCMA 2BF4A 5AHOA 2I4RA 4HNTA 2PYDA 5HQTA 3L43A 2XOKD 1PX0A 3DBOB 2OHIA 4JP8A 4OM7A 2PBFA 4JU8A 3M4ZA 3IX7A 4LQLA 4ND6A 4Y2JA 2IOFK 3NALA 4X9XA 2OWDA 1X9HA 3QIVA 4GLOA 1L5NA 4CKEA 4L7QA 3FYUA 4HUQB 1MO5A 1FEZA 1O96B 3DUWA 2ON6A 2XGGA 1EUDB 4OIFA 4YH1A 4EB6A 1C7IA 4U0JA 2V3CC 2QJRA 1Z7BA 4K9SA 1TT7A 5A3VA 3RYHB 4C4PA 1HDZA 2ZJ6A 3P97A 4ZVRA 4ZOQI 5JJ5A 4KQIA 4PBRA 1NUHA 3DDZX 4MP3A 4QDJA 7REQA 1MFZA 5JSKA 4DA8A 1NJ1A 2MYNA 2A1UA 1BGWA 2Y8EA 2QI9F 3SF0A 4Y1GA 4E09A 2VEOA 2NTJA 3N6RA 4XGNA 5K03A 2CDAA 3ROFA 3BIJA 3GO4A 5KNDA 2OGTA 4NMLA 2G88A 4GL4A 1L4EA 2H5IA 2YYZA 3OOYA 5ALJA 2BTQB 4N39A 3G1WA 1M33A 4AKSA 2J9XB 5P21A 3ANTA 2ISCA 5KC8A 4GP7A 2C4VA 4DR6B 4FC6A 4C01A 2QKYA 2H59A 2H54A 3RANA 4HNAB 2V1UA 4BQOA 2JS7A 5CX4A 2ZEJA 4UVGA 4I5DA 5CIQA 4DMKA 5C1IA 2RFLA 4J1QA 3RWOA 1J8YF 4IIUA 3LTNC 2O2EA 4WDRA 5TJHA 3I9FA 2I6GA 3SBXA 2J33A 1B16A 4ARBA 3UV7A 5HDBB 3ZVNA 4QXQA 3WYBA 4J0DA 5BRNA 4FHGA 1CQXA 1MRSA 1OLSB 2R3SA 1R3DA 4ZYVA 3A7EA 4MHTA 2JAUA 4IIJB 2CNKA 1L4BA 2EFJA 4IDPA 1YS1X 2BD0A 2A9PA 1SIBE 2BEUA 4H1TA 1XRRA 1A96A 1GCUA 3NTOA 1C29B 3FNFA 4AAYA 5KSZA 1T36B 2F8LA 2W0MA 5BV1A 2I1WA 5L8VA 2F3PA 1X8LA 2DG2A 1EB8A 2NQTA 3E03A 4W1PA 1G6KA 1HG1A 5M29A 1ESEA 4MUHA 4DF3A 1IWPB 3DEJA 2WNIA 4MOWA 1KARA 1W93A 5B2ZA 4MCIA 4XX0B 4OA8A 3HDTA 3OQIA 1Y6GA 2C92A 2WKSA 3D6MA 3DPUA 3ZX5A 1TNDA 1JKMA 2RDMA 3RUAA 4FIZA 4M0UA 1UKEA 3UC5A 3ADCA 4B3RB 2AEEA 1XDUA 1CUZA 3QY9A 3SICE 1HLPA 1DQNA 4ARVA 3JQ7A 1TVCA 1P75A 4RZQA 1U2DC 4KWIA 3V48A 3EIXA 3INNA 3B1FA 3EPKA 4QDUA 1Z8HA 2HMUA 2V3WA 4EUNA 2JHGA 3DMYA 2I2FA 1UBKS 3HU3A 4P5DA 3K09A 4P4SA 3E9QA 4I46A 3SOZA 4L9AA 3DHVA 3E70C 4HV4A 1SUIA 2QL7A 2OKCA 1I2MA 1PTJA 3HMQA 1PK9A 1CUVA 4UHCA 1E9EA 2ZIUB 4ZC8A 5H3LA 1J8VA 3SLRA 3T41A 3ZHBA 4B3FX 3SC4A 3RO7A 3PJFA 5ARDA 5AW5A 1NDHA 3FX2A 1P5RA 3MZ0A 4YJ2F 3FPEA 3ZPXA 1EB9A 4JLSA 3G59A 2QJWA 3IKJA 3BZWA 4MVCA 2O52A 3RS4A 3WLMA 3CPSA 3DTYA 5EJGA 1EX9A 5E0KB 4QQFA 2ZBRA 1QWSA 1OZ0A 1T3TA 3CLUC 2LUOA 5G2OA 4CQLB 1UBRS 2HSWA 4LE0A 1ZK2A 4Q16A 4Y2TA 3TR0A 3ZU2A 1B0UA 1KOGA 1V1RA 1E5DA 1E3QA 1YJBA 3I2YX 2PVSA 3ZDAA 1KTVA 1PJSA 2CWWA 3F5FA 3I2JA 4JCCA 4CZ2A 1SM4A 4KYTA 2DUWA 4QULA 4BNIA 4OUKX 2O6HA 5IEBA 3DV0A 4X65B 2CBGA 4WCDA 1HZZC 3N7AA 4R9NA 3EA4A 3RUIA 1CT9A 1VPWA 3VR3A 4ZN6A 2A4MA 2OMKA 3ITNA 3B5JA 2Q1UA 4FOTA 2BEJA 4TLMB 4QVIA 3AI3A 2PNFA 4YAEA 1K7SN 1IUKA 4N8DA 4Y0VA 5K3BA 4JMLA 4A92A 5JCXA 5JDCC 3TQFA 1ZNXA 1W4RA 3CNBA 1ODJA 5ALGA 2HXYA 4DDTA 1GYPA 2VJLA 1PR9A 3WRXC 5ILOA 5DMHA 3TGPA 3AY3A 1ZH4A 5HMLA 3UO8B 3I32A 1OU4A 5AK0A 4PCVA 4X5OA 1J49A 3C98A 5FPQA 4ZZ2A 5LZ9A 3H1EA 2HV9A 3AU9A 3UATA 3GLSA 4N3BA 3IVMA 2O0JA 3C8HA 3KEGA 3GUZA 1XN1A 4E46A 1MGOA 4C14A 4E15A 4C3VA 2BFFA 3G2LA 4IJ5A 3T15A 1OXUA 1NC1A 4TTIA 1AXRA 1OBCA 2Q0SA 2WLSA 3ZJ5A 1YCGA 3COJA 4X92A 5GINE 4CMAA 2V6GA 4L2IA 1Z37A 2IWHA 4FR2A 4BP8A 3I34X 2DM6A 2J9FA 2R0QC 1LSUA 4J4HA 1RXUA 3ZV4A 2H2HA 1T1JA 2PX5A 3BEDA 3C4JA 3PZRA 1II8A 2W2VA 4OBXA 4ACBA 4EY7A 4ZHQB 1CJMA 2WJ4A 1DIAA 3IIKA 4BMXA 3OCCA 2RC6A 5D3MB 3RSGA 4F21A 3FTEA 3NG1A 4WFJA 5CP8A 3FWYA 1ZRSA 2ATXA 3H5IA 3WLJA 1X2BA 3HJGA 4QGGA 1UKAA 5EOVA 3JR3A 1WZUA 2SNIE 3PXDA 4KU4A 3QITA 1GPKA 1UPAA 5F5NA 2QD3A 3RKRA 4BO6A 4ER7A 2A0KA 1DOAA 2NTYC 1NKSA 2XY4A 2BV3A 4MRRA 5CFZA 1E0KA 2EAUA 4UQPA 3WSTA 2KE5A 2D4AA 1FCJA 2FMIA 4RVSA 1VI2A 1T26A 1X7WB 1I10A 3AF4A 2ZLBA 4XX1A 3ZTYA 4CLOB 4E21A 2PBZA 2QW0X 5GVRA 1HDIA 1XCLA 1F48A 2Y67A 1BVYF 3IPRA 1XV5A 2OKGA 3JASA 4PCLA 5LSAA 1HM5A 3IELA 1RBZA 1MVLA 1Y9AA 4BFVA 1P9RA 2ZZMA 2WF7A 1VJTA 2HZ7A 4KO1S 4MK4A 4PWZA 4URYR 3UXYA 3GRZA 4FEYA 4FNOA 1E69A 3LXUX 3AL2A 5IK2A 3C1OA 1WXHA 3U3MA 1TM4E 2R6JA 4F2HA 1SZCA 1DHTA 2FFRA 2GX6A 2O8DB 1AHNA 3AFGA 1SOAA 3FCAA 2GRUA 2EW2A 3NHYA 1TAQA 3U4HA 3VZSA 1YK1A 4CM4B 2GLTA 2IL1A 1D4FA 1O95A 4Q48A 5FJJA 3K4PA 4G97A 2WYHA 3P0JA 5HRCA 1J39A 2ECPA 3KXDA 5KYXA 5C46F 2IS6A 2LR0A 1DBWA 3QPAA 4LQ4A 3S28A 4DUGA 3Q3VA 4N8SA 2TS1A 4PWYA 3EPHA 3O4JA 2A67A 1NJ6A 4MDYA 2ZBUA 1CULC 2GUWA 4TLCA 1X70A 1UQTA 3MTGA 4LI0A 4P4NA 4US0R 3OH8A 3ZH9B 3WYCA 4ETMA 4HUJA 3CKMA 4DEYA 1KF0A 4DRZA 1Q0TA 1GG5A 3HSSA 5BUQA 4JV5B 4OGFA 3W7BA 4DEXA 4YUWA 4RV9A 1HDGO 3Q0EA 4CKCA 1FRZA 2HK7A 13PKA 1G17A 3FI9A 4PIVA 5KJ6A 2PL9A 4PZEA 2AOVA 1U0RA 3AJRA 1WCIB 2EQBA 1EM6A 1QHHA 2IW3A 3L06A 3FMIA 4PLWA 4Z0PA 1PNTA 2P2NA 4QODA 4CHGA 4E32A 4ETIA 1D1TA 4MYRA 3F8SA 3AG6A 1C7FA 3IAXA 5K09A 2Z4RA 2IYYA 2OV6A 2YWEA 3F6CA 1E1CB 1LSJA 4RJIA 1X1DA 5DASA 3A8TA 2HSJA 3AF3A 1P62B 5TJ9A 5EIHA 2FH5B 1IYZA 1PG2A 4YQZA 3HBJA 1FYDA 3M34A 3NORA 3ZUGA 5HQ3A 3OQMA 1U31A 1HQCA 3WOHA 4B75A 3BJRA 3SSNA 4DSUA 4BNMA 3IGFA 3ST7A 4TLEA 1KVSA 1U3CA 5CHEA 2JZOA 3T35A 1MJGM 3HE3A 4DYVA 5AUNB 3EEFA 2A84A 4ZFNA 3I9JA 3D4PA 1ULBA 2IK8A 3C7KA 3ED5A 2ZI5A 1ZN9A 4PYMA 3WLIA 4DEVA 1F2DA 1WHTB 3L46A 3U7EB 3VO8A 4O8CA 1ECCA 3CLRC 5G02A 3ZEAA 4PRKA 4K9RA 4B2YA 3PPVA 4NBWA 4Y6LA 2FG6C 1J70A 3VR5A 4DZRA 1G64A 1W2WB 2C96A 4FFNA 4PBTA 5AM3A 1YIAA 4YUVA 4URWR 1TI7A 2ATCA 2GMWA 3PNKA 2VP0A 4KH1A 4CDGA 5JISA 1QJCA 3IAM1 3NWJA 3IQIX 1XMPA 4CR6A 7AT1A 1FZQA 4LDNA 4WBNA 1DFHA 2AEMA 1AN0A 1G2IA 3NHWA 3F4LA 4C0JA 2XOKA 4AJKA 4EK9A 1W30A 3NGLA 2BDUA 1A72A 4US1R 3VH3A 3KIPA 1OKKD 1TCBA 3ECSA 4YMUA 1YJXA 2Q5FA 4DSTA 2GLUA 3RAEC 1EFTA 5CYOA 3C24A 5KWSA 1E2KA 1K3UB 1T10A 1BS9A 2C2KA 3E5RA 3D31A 4OLFA 4V0ME 1S8AA 3ANYB 1UZAA 5IAKA 3DEIA 4BMCA 3OHSX 2BISA 3GCXA 1NYLA 2PUGA 1EWTA 3AHCA 1PWXA 3QBJA 4FNAA 2PWPA 3DW3X 3JVVA 2BFCA 5FB3A 5DIFA 4NZ9A 4I5EA 1AKMA 1G41A 2R00A 4FW9A 4R2XA 3O7MA 4HAVA 5FYDA 1VL6A 1L1RA 1TFRA 1JDSA 1YVDA 1RFGE 1X1CA 2NXNA 1X8KA 4B80A 3VHLB 3CTMA 3ZW9A 4DS3A 3MGCA 3A2MA 1L4UA 3NGXA 5TXGA 2O19A 2Q1YA 5GM2A 4PNEA 1GG9A 3S7TA 4DUZB 1BU5A 2BFFB 4ILKA 1W44A 5GVSA 3PDJA 3I5UA 4F0JA 3GLKA 3EAQA 1E2IA 1U0HC 1C81A 2XUGA 4I4TA 5HE8A 2EQAA 3OQJA 2BAGA 4L5JA 2NUTA 3D3JA 2LGJA 1XDZA 4HUTA 5DFAA 3RYFA 1IUOA 1GRRA 1PNQA 2GWRA 2ZOSA 3S2GA 2IT1A 2VDNB 1M6EX 4JLMA 5CDSA 5IVPA 4L5AA 5FWXB 3DDNA 2F1JA 2JLRA 4RYLA 1M75A 4HZIA 3L8ZA 2E4UA 2H0RA 5IWAB 3GJ6A 2ZKIA 4A6DA 4GZ3A 3LW7A 2PKRA 4IRUB 3F5DA 4EUKA 1ZCZA 4JU9A 2X6TA 4JZKA 5A0FA 2ILTA 4YMIA 5LQDA 4H1UA 1TVMA 2ZIXA 3PQ2A 2MR5A 3PUZA 2J6CA 2QPOA 5KJFA 4CT5A 4F3KA 4YRNA 1I9GA 4HDRA 2V59A 4MQ5A 4MQ6A 5I7AA 1JA1A 4G0VA 1Z4PX 4M7RA 2ZQ5A 3WP0A 3N05A 3ABQB 1XWIA 4OSPA 5FWDA 4KIWA 1HYHA 1M5UA 2ONCA 1VE6A 5LU8A 2PJUA 4EB8A 5IABA 2W6ZA 1KDRA 1EE9A 3D2BA 1SKUA 4BNKA 1CF2O 3OZDA 4KLCA 3IIEA 1CRPA 3JPWA 5C0OE 3EVDA 3SXUA 1JMVA 3CUKA 4POOA 1FMTA 3ILXA 2XKJE 3BILA 3EXG1 2DHDA 4IOKA 4OHYA 4G4SO 3H4TA 2QGZA 3A4YA 1EFUA 4MDFA 1VDZA 2GA8A 3Q3CA 3NIDB 2C2BA 3GARA 3DMPA 5CG2A 3H0CA 4QUDA 4PPNA 1E2NA 3LCMA 3DM9B 3PX2A 1BAPA 2EW1A 1PWYE 2IEDA 4XAQA 1KI1A 4YMVA 1PGNA 3B78A 1IPEA 4JBLA 1VCMA 1NYRA 1I94B 1KE1A 1GOTA 3NLLA 3DFUA 4ZJUA 3QEMB 2GGSA 4CDMA 1CX9B 1Q20A 1NP6A 5CJPA 3THXA 2WU1A 4EUFA 1YDMA 5IJZA 3B3AA 4M76B 1Z17A 4KBFA 5LWHA 2FP4B 1PJ4A 2QIPA 1JFFA 3Q9UA 1DCTA 3I64A 1XN4A 4OHMA 3UAYA 4MS3A 3AKCA 3UK6A 2O8DA 1X7XA 3IKVA 5EHGA 4EPTA 4XQCA 4PG8A 1B8PA 3ZU4A 3GGSA 4JY7A 1QQBA 4MV7A 3K09C 2O6LA 4EQZA 4IIXA 2AOTB 3RSCA 5JSZB 5JJIA 1SOUA 1ZDMA 4CDNA 4DCTA 2FW0A 1XNHA 2NSDA 2ZQZA 1JVNA 4DSNA 3QOYA 2CYCA 3K32A 4GSYA 4QLBA 4YB8A 2FSGA 4M0MA 1ZCFA 4HDSB 4O02B 4ZP1A 3WGOA 1M73E 1KZ9A 5CDFE 2DKNA 3KZKA 5BUCA 2EKBA 1GEGA 1QKJA 3LSTA 3B38A 5J1SB 2HQBA 1NVAA 4DLZA 2D1SA 2VATA 1N9GB 4EATA 1E1MA 5EHIA 2O2SA 2QYHA 4NBRA 4C6SA 1OC2A 3UOWA 3MWYW 4EI9A 4F72A 3F47A 1IXZA 5AKKA 3ROTA 1Q19A 3VPFA 4FD3A 1KKUA 3R09A 3HCCA 4EJSC 2DP4E 1ZA2A 2WF8A 4EZEA 2GR9A 3ELWA 1MTZA 3KV1A 1TUEA 3BQ9A 3HY3A 1KSHA 2QI9C 4MQMA 3BRCA 2O5EA 2A5FA 1N5KA 2MHCA 1GZUA 1UBEA 2I7VA 2N46A 1DBSA 1BE1A 1LI4A 1YQXA 2AG0A 4PG6A 1EWRA 2AKAB 2PGDA 2ODQA 2WHPA 5CRIA 1OI2A 3TN7A 5KVAA 1DV1A 4JITA 5KOHA 1V6SA 1VLMA 1K7YA 1SVOA 2WJGA 4U8GA 2R7NA 1AQ6A 4N65A 4WLOA 4X8HA 3T4PA 3NV7A 1H3NA 5EJIA 1W5BA 1X7YB 1RHMA 4RVDA 5BW5A 2GO7A 3T3GA 4AU1A 2EARA 1J0DA 1FFGA 2REOA 4LISA 4MI9A 4UUAA 1O57A 2DUJA 5FR2A 4YRSA 5C8ZA 4JA2A 3G9UA 3FSGD 1V8DA 2C2WA 2BGRA 1R0CA 3D9QX 3N5KA 3OICA 3DZ8A 5K6RA 2JANA 3ER9A 3VHXB 4WUTA 1K97A 4ITRC 4DW8A 4D0SA 2RC5A 3SQLA 4P98A 5T8KA 5IMSA 1XI2A 4MB0A 2P40A 4DKXA 4QC2A 4HN4B 1JX6A 3HKEB 1EP3B 4AZSA 4L8LA 5F2NA 1W29A 2RKOA 1UM9A 3F6SA 3H1TA 4IIGA 1Z2EA 2FQQA 2E21A 4R51A 4ZQEA 3KCQA 2PGOA 5ALSA 4DT1B 1BG6A 2J41A 3KOYA 4IDHA 4R1TA 5EMJA 1DB3A 3I6ZA 2HA7A 3N53A 1AHIA 2RCYA 3L4KA 1PFVA 1U4OA 2JFGA 3DE3X 1TCUA 3OHMA 4YDSA 1OUMA 2XE4A 2WF6A 1TA9A 2Z2YA 1OZAA 2R7AA 4FHZA 3PE3A 1NLMA 4I14A 5JATA 1E1DA 2WQ6A 3H4MA 1DAHA 2VBIA 1P2DA 4GD3Q 1XCMA 2WSSA 4IHJB 4QWWA 4X97A 4ME6A 1K5PA 1TAHA 1TIBA 2AN3A 5JAIA 4RD2A 4BRWA 3KLPX 2AUTA 4JB8A 2XCLA 4GF5A 2AZDA 3DV2A 3WMGA 3KDAA 3LDHA 4CMIA 1FFCA 3GFOA 4YJHA 3VM6A 1EWQA 2OUKA 4PZYA 3TSOA 1W7AA 3UXHA 2J0EA 4R2IA 4IDOA 2GK7A 2X9GA 3WISA 2VYVD 4JD5A 1MAWA 2D59A 2XUJA 3ESDA 2GZ3A 4EX7A 3QVTA 2GEVA 2VC2B 2YL2A 5HNKA 2CXTA 2DEUA 1KY2A 5MGNA 1TJYA 2M2IA 2J3EA 4JB0A 4LRQA 4P2BA 1VJRA 5KQPA 1Z5GA 3L2OB 1JHRA 1G7RA 4F8EA 1KVRA 4ZV9A 4ZODA 4AG5A 4LE1A 3BF7A 4Z8YA 4CV0A 1R6BX 3NM6B 3SU8A 3SFVA 2B4QA 2PZLA 3FZYA 4ZZ1A 5KTKA 4QRDA 4O5OA 1N25A 3N2GA 4GYYA 3U17A 1ZCAA 3UMFA 2WB4A 3DE6X 4Y3UA 4B35A 1X92A 5J43A 1SHLA 1CSEE 2UXCB 3OQVA 3K0CC 3LP8A 3I6YA 1M2WA 3I05A 3IAM6 4LWQA 4BFXA 4GM1A 3G5UA 3O9VA 3WS7A 3FYCA 1N0HA 1HDCA 2XMGA 3A6HA 3FG9A 4XA8A 5TY0A 3W06A 3N2NA 3I45A 1OWPA 4F45A 2F3SA 4D82A 4HDMB 3V34A 2QTHA 1PJTA 3ROEA 3FDJA 4TTTS 4Q9KA 4DGSA 2G1JA 3R9KA 4LX0A 1RWBA 3WLQA 1ZA1A 3RKUA 3BIWA 1N32B 3KKLA 1KC3A 3CURA 5JRJA 1M34E 4RYDA 5EESA 1C2TA 3TZQA 4DV1B 1B6SA 2C58A 3NHPA 3VR2A 4BVAA 2BY4A 4Q1FA 3MTIA 4H9GA 1U8CB 2H7VA 1NG1A 1CUGA 4MW5A 3VPGA 4CIYA 2I78A 3HDHA 1Z0FA 1FTQA 1YJ8A 2A9RA 1RM5A 1KETA 3CM0A 3ND7A 5EXDA 3TNYA 1J9ZA 1U81A 1ESZA 3PT5A 5H9VA 1AJEA 1RAHA 1PFKA 4ZK6A 1NWHA 5FBWB 3HBFA 1KZ1A 2NADA 4M0FA 4OK6A 1G2OA 4QATA 5G3ZA 4QOIA 3WWPA 5L7WA 5LQJA 5AI0A 5GY7A 4A6PA 1NBMA 4MRPA 1RE1A 2BFMA 4UXHA 2AFIA 1WXGA 3UWKA 3V8RA 3ZVLA 4AKTA 5HG0A 1EKXA 2C5LA 3TLJA 1MXFA 1QBGA 2H2FA 3OQIB 1A7JA 4FC7A 3B53X 4PZUA 5AFSA 3EX7C 2YJ3A 1Q0UA 5JRZA 2XT6A 3SR3A 4YYZA 3QF4B 4RSHA 1V6CA 4D0NA 2XJ9A 2HW8A 1YJAA 1ZUD1 1QYXA 3EOBI 3KXLA 2IUUA 3ZWDA 5IRCD 1JHMA 3I4LA 1FP7A 1T1RA 2C4HA 1FDOA 1DSSG 2A9JA 4G1BA 4M1SA 1UPCA 4XYBA 3UJPA 5KVCA 2VFAA 2NZ2A 4IW3B 2VL7A 3VZBA 2PEYA 3DHNA 1KO8A 2GETA 3RVDA 2H7CA 1N6OA 5I9BA 3BSWA 3H5AA 4U00A 4RIFA 3B89A 2BOVA 2CMHA 1H2HA 3K9WA 1YQGA 3BCRA 4WCFC 3TH5A 2R8YA 4EQ6A 1SUEA 2YQ5A 3BJIC 4WY2A 4JI3B 4DLVA 1Y0BA 3ND8A 3ZHTA 1KJ9A 1EDOA 4UTZA 1C9MA 3EA0A 1Q7BA 3HG7A 1VGVA 5GGXA 3O4FA 3TJRA 3TZ6A 1T3HA 3ZV6A 3KSRA 4LVOA 2YXNA 1YJ5A 1L8AA 1OLOA 3L0ZA 3SQMA 1NVKA 1SURA 1Z08A 1J99A 1XTRA 2X13A 2I7DA 5KNCA 5EZ6B 1HEYA 2ATVA 3TKAA 2YXDA 4NV1A 1E58A 3MINB 3OQHA 3FZEA 3IHLA 7REQB 3CZPA 4MW2A 1BXGA 1GQYA 2LDBA 4MI6A 3A06A 3SJ7A 3NT5A 1L1FA 2VDWA 3ADDA 2CLHB 3EVGA 5HZMA 1C3OA 4MMXB 3LKDA 4IVRA 4EPYA 1M0EA 4RA9B 8ATCA 5HHTA 1YE8A 4GKKB 3D0KA 4JCOA 4QDTA 5F52A 4EJ2A 3OQOA 5ENVA 2NTNA 3W5UA 1VJ1A 1D0VA 1T4BA 4HMPA 5LFAA 4GZ5A 2GJKA 2VP9A 2DLCX 1IAQA 4QLOA 1LNZA 2H0QA 5KDDA 3PC8C 3NXKA 4EHJA 4EKNB 1Y6ZA 2KYRA 1CG6A 1Y8RA 1E94E 1EVZA 2VJBA 3A1WA 3BBPA 3K5IA 2IDJA 3SM3A 4DVJA 5A4FS 1GVHA 1FP4B 2DY0A 1JT2A 3TB6A 2WLTA 2WSIA 1D9XA 2GZMA 4RMGA 5ADVA 5H8WA 2B61A 4CF7A 4M2LA 2UXBB 4DQ0A 1U9CA 4LJLA 2Z2IA 2CJXA 1IY8A 1H8HA 1NV9A 4G5XA 4HMOA 4UNNA 4ZOBA 3VAZA 1JP7A 1QB7A 2UYGA 3FA2A 1M34B 5EIAA 4BJ1A 1LJ8A 1P6QA 1FJGB 3IXQA 4JX8A 1HY3A 1UM8A 5CYFA 2OORA 3AM1A 2ZE7A 3T1QA 3L49A 2VHZA 4AJEA 5CXQA 3D59A 3VVLA 1CW2B 1ODLA 2BJWA 2PWZA 1T15A 2VTVA 3WLOA 4B79A 2XCRB 3H18A 2HDWA 3B1KA 4IH4A 4C4SA 2NPIA 3V7FA 1KORA 2OLEA 5DSTA 2VA9A 4C4OA 4B7ZA 3RIHA 3QEBZ 4JWKA 3UWSA 3QYFA 3M9LA 3CLHA 3ITKA 3LVFO 5JMOA 1CZLA 4K9KA 4MR9B 3GJ0A 3SHTA 2FMKA 3U40A 3PHJA 5K99A 1E3MA 1T2NA 4ZCPA 3DT9A 3CONA 5IKOA 2C0PA 1DIRA 1KA9H 4QASA 2EF0A 3CWCA 5CTJA 3RE1A 621PA 1GAWA 3MT7A 3FMPB 4FKZA 4HO1X 1X3SA 1S02A 1X14A 1SXJD 1G20E 3LPCA 4Q3AA 2W2OA 4C78A 1EXDA 2Q21A 4D6PA 4DWJA 5BSGA 5K4HA 4D8UA 2EKQA 2MSKA 4BV9A 2XITA 5A5FA 1KOLA 5BVGB 4LI3X 3V80A 3VTAA 5A9RA 3VKGA 1TLTA 4NK4A 1J1UA 4ZJPA 1QNLA 2BONA 4EJ0A 1TCAA 3QMVA 5IEJA 1XCGB 4ZPXA 5KOJB 2F1OA 4EG7A 2IYRA 1GGHA 2R96A 2GN8A 3RS2A 1A1VA 2YBDA 1OVGA 3BMOA 4LXUA 4O4IB 1PKEA 4FQ8A 4TTVA 4Z9AA 5TSDA 1EGAA 2BIFA 2JZCA 2X5JO 1DTWB 1YOBA 1HQKA 2A30A 2PX0A 3E9MA 4EG1A 1P60A 4FYYA 2B98A 1CVRA 4QOFA 1DC7A 3VYSB 1FBTA 4N5DA 2Z6UA 4J3NA 3VBCA 1OHHD 1N9ZA 4EG0A 5KNBA 2C4WA 4ZAZA 5J4YA 3E0XA 4M0EA 5A3JA 5CX1B 1O95D 2OTCA 5ADUS 2W4QA 1Z28A 3QEMA 3A7DA 1SEPA 3T9FA 1L1EA 2AEJA 2B7CA 3KP1A 1MJHA 1P18A 3AUTA 2PXXA 2VQ3A 4TL9A 2GYUA 1IB6A 1I3KA 4LJRA 3KUDA 1PJLA 4BMSA 4JQCA 4G8JA 1DZ3A 4R40A 5K9ZA 4UOQA 3W90A 1YHZA 4C05A 3UNXA 4YJ2A 4NECA 3RK1A 1VIAA 4HQRA 4G41A 4PQGA 3GFGA 5TQVA 3PDUA 1T2FA 2ZAYA 4ZYTA 2XB6A 3X1MA 1G21E 5FBZA 4ADSG 4QX6A 2RKBA 1Z8DA 4XB1A 1ZU4A 2PMBA 2LPMA 4Y9SA 1OWNA 4CKWA 4R1OA 2ETXA 3STUA 1VBKA 4JC8A 4ZVLA 4CKXA 4XEHA 4BO4A 1F2UA 2AE2A 3GAAA 3MXOA 4XR4A 3WZ2A 3FTNA 4RBNA 3C5CA 1CJKC 1UMDB 2ODEA 5ITWA 1LC3A 1NMSA 5AXCA 2BGKA 2YX1A 3T5AA 1E2PA 3E8SA 2G4VA 1EEXB 3H4VA 2QLBA 2PBLA 3MNFA 1QOQB 4KN6A 4Q3NA 1W34A 4QOGA 3THWA 1ZJWA 1M66A 1U11A 4GMDA 1HDXA 2C82A 3N0TA 4DY4A 5JAUA 1GADO 3IDSA 5JROA 1C7QA 3W1VA 8OHMA 2PU5A 1L4NA 1C0KA 4GM4A 2ID8A 3CWQA 3HYRA 3LG2A 3V42A 2HHLA 4WZBB 3PFCA 2FQ1A 3R7WA 3WB9A 1OFVA 4DR5B 5JLJA 1F8XA 4FE7A 2YHBA 2YZMA 3X1KA 3KQLA 3RIMA 4WT7A 5IJ9A 3QQPA 4IUYA 1J0AA 2FZGA 5LZ8A 5DM2A 2Q7DA 4AT1A 4NONA 3GQVA 1N1GA 2BFNA 3B6EA 4TT8A 5AIAA 4ZRDA 4D2IA 4PPFA 5BQPA 4HSGA 3MC1A 2Q2QA 4RQBA 5LZ7A 3VPDA 1HO3A 1PJRA 4J03A 2E3JA 4ARIA 1TD1A 2OBBA 1XNRB 3PNMA 1P2FA 2B7BA 1M1ZA 4TL6A 4X41A 1HYGA 1QE0A 3W2TA 1S8FA 4H08A 4R7TA 5CD1A 5B7PA 2XECA 2NZVG 3PA6A 5LU9A 5FFFA 1Z5PA 2DPXA 4C06A 3EVAA 3Q3IA 4QUGA 2JA1A 3N59A 3VJLA 3VR4A 5KX5B 4BO9A 2PR2A 3PGA1 1DUSA 4BNDB 3F1LA 4BKUA 2E5WA 2QT1A 2Z1MA 2AX3A 1AGYA 1Z36A 1K06A 3IHWA 3OKCA 1PGJA 1K98A 3LC1O 2L2QA 1SBCA 1HNNA 4RH1A 4ZCRA 2IFTA 4L4YA 521PA 5EUCA 3PB3A 3NYWA 4MUGA 2AF3C 5JZVA 5A4MS 1E4EA 1YDEA 4BWFB 2YJ4A 2Q4RA 2SKEA 2CVOA 2GAJA 3OZFA 3ZHXA 3SZLA 1ZXXA 2BUBA 2W8ZA 4Q4CA 2G36A 1FYWA 3K53A 5ELLA 3I12A 1HZZA