3IB7A

Crystal structure of full length rv0805
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
295
structure length
295
Chain Sequence
LRAAEHPRPDYVLLHISDTHLIGGDRRLYGAVDADDRLGELLEQLNQSGLRPDAIVFTGDLADKGEPAAYRKLRGLVEPFAAQLGAELVWVMGNHDDRAELRKFLLDEAPSMAPLDRVCMIDGLRIIVLDTSVPGHHHGEIRASQLGWLAEELATPAPDGTILALHHPPIPSVLDMAVTVELRDQAALGRVLRGTDVRAILAGHLHYSTNATFVGIPVSVASATCYTQDLTVAAGGTRGRDGAQGCNLVHVYPDTVVHSVIPLGGGETVGTFVSPGQARRKIAESGIFIEPSRRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A mycobacterial cyclic AMP phosphodiesterase that moonlights as a modifier of cell wall permeability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords Icc protein
total genus 89
structure length 295
sequence length 295
ec nomenclature ec 3.1.4.53: 3',5'-cyclic-AMP phosphodiesterase.
pdb deposition date 2009-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3ib7A00
4HD0A 3LL8A 1FJMA 1OIEA 2A22A 1U32A 2BDXA 1T71A 2QFPA 3IB8A 4IL1A 4LTYA 1G5BA 4MOYA 3P71C 4ORCA 3EGHA 4ZVZA 3QFKA 1Z2XA 3TGHA 3QFNA 2O8GA 1NNWA 4H2GA 2NYLC 2Z1AA 5B8IA 1HPUA 2WDDA 4MOVA 4UT3B 2P6BA 3DSDA 4O4KA 5GTUA 1M63A 1OIDA 2NYMC 2DFJA 3EGGA 4V0VA 5C1VA 2AHDA 3K7VC 4H2FA 3K7WC 2IE3C 1SU1A 2ZBMA 2CV9A 2IE4C 4M0VA 3RQZA 1AUIA 4H1YP 1QHWA 3IVDA 3THOB 1S3NA 3H60A 1KBPA 2QFRA 2R17A 4UT2A 5HPEA 1HO5A 4DT2A 2JOGA 3HVQA 3PSNA 4OR9A 2Z72A 1IT6A 2WDCA 4FBQA 4KBPA 4YKEA 3PSOA 1XZWA 2GJUA 5J28A 2BCDA 2HYOA 3RL5A 4DHLA 1OI8A 2BQ8X 3CK2A 1HP1A 4I5NC 3C9FA 4NZVA 5IOHA 3H69A 4V0WA 1USHA 5INBA 5DNYA 4UWQA 1Z2WA 2WDFA 4H2BA 3ICFA 1QFCA 1T70A 4H2IA 3H68A 3V4YA 4MP0A 3RL3A 3T1IA 4FBWA 1UF3A 2YVTA 2WDEA 4B2OA 5F3WA 2Q8UA 3KBPA 3IB7A 5JPEA 1TCOA 4WWLA 2XMOA 4XPNA 1W24A 4O43A 4O24A 4V0XA 4JA7A 4TUIA 4ORBA 4O5GA 5JJTA 1MF8A 1WAO1 1S95A 1S8EA 3E7AA 4G9JA 3N5UA 4Q7FA 2Z06A 3IVEA 4LU9A 2HYPA 4LACC 3QG5C 3AV0A 4I5LC 4FCXA 4ZX2A 4TUGA 1V73A 4ORAA 4KKZA 2NXFA 4DSYA 3H64A 3DSCA 1XM7A 3FGAC 3QFOA 1UTEA 2USHA 4FBKA 5EQVA 4J6OA 1WARA 3ZU0A 2HY1A 3QFMA 4JA9A 4IYPC 4H1SA 3H63A 1S3LA 4F0ZA 2QJCA 1S70A 3AUZA 3C5WC 3DW8C 3H66A 3H67A 3H62B 3ZTVA 5JPFA 3H61A 2O8AA 3GVEA 3THNA 3E7BA 4UT3A 2NPPC 3RL4A 2KKNA 2IAEC 1JK7A 1II7A 3JYFA 1S3MA
chains in the Genus database with same CATH superfamily
4HD0A 3LL8A 1FJMA 1OIEA 2A22A 1U32A 2BDXA 1T71A 2QFPA 3IB8A 4IL1A 4LTYA 1G5BA 4MOYA 3P71C 4ORCA 3EGHA 4ZVZA 3QFKA 1Z2XA 3TGHA 3QFNA 2O8GA 1NNWA 4H2GA 2NYLC 2Z1AA 5B8IA 1HPUA 2WDDA 4MOVA 4UT3B 2P6BA 3DSDA 4O4KA 5GTUA 1M63A 1OIDA 2NYMC 2DFJA 3EGGA 4V0VA 5C1VA 2AHDA 3K7VC 4H2FA 3K7WC 2DXLA 2IE3C 1SU1A 2ZBMA 2CV9A 2IE4C 4M0VA 3RQZA 1AUIA 4H1YP 1QHWA 3IVDA 3THOB 1S3NA 3H60A 1KBPA 2QFRA 2R17A 4UT2A 5HPEA 1HO5A 4DT2A 2JOGA 3HVQA 3PSNA 4OR9A 2Z72A 1IT6A 2WDCA 3D03A 4FBQA 4KBPA 4YKEA 3PSOA 1XZWA 2GJUA 5J28A 2BCDA 2HYOA 3RL5A 4DHLA 1OI8A 2BQ8X 3CK2A 1HP1A 4I5NC 3C9FA 4NZVA 5IOHA 3H69A 4V0WA 1USHA 5INBA 5DNYA 4UWQA 1Z2WA 2WDFA 4H2BA 3ICFA 1QFCA 1T70A 4H2IA 3H68A 3V4YA 4MP0A 3RL3A 3T1IA 4FBWA 2ZO9B 1UF3A 2YVTA 2WDEA 4B2OA 5F3WA 2Q8UA 3KBPA 3IB7A 5JPEA 2YEQA 1TCOA 4WWLA 2XMOA 4XPNA 1W24A 4O43A 4O24A 3FLOA 4V0XA 2DXNA 4JA7A 4TUIA 3E0JA 4ORBA 4O5GA 5JJTA 1MF8A 1WAO1 1S95A 1S8EA 3E7AA 4G9JA 2ZOAA 3N5UA 4Q7FA 2Z06A 3IVEA 4LU9A 2HYPA 4LACC 3QG5C 3AV0A 4I5LC 4FCXA 4ZX2A 4TUGA 1V73A 4ORAA 4KKZA 2NXFA 4DSYA 3H64A 3DSCA 1XM7A 3FGAC 3QFOA 1UTEA 2USHA 4FBKA 5EQVA 4J6OA 1WARA 3ZU0A 2HY1A 3QFMA 4JA9A 4IYPC 4H1SA 3H63A 1S3LA 4F0ZA 2QJCA 1S70A 3AUZA 3C5WC 3DW8C 3H66A 3H67A 3H62B 3ZTVA 5JPFA 3H61A 2O8AA 3GVEA 3THNA 3E7BA 4UT3A 2NPPC 3RL4A 2KKNA 2IAEC 1JK7A 1II7A 3JYFA 1S3MA
chains in the Genus database with same CATH topology
4HD0A 3LL8A 1FJMA 1OIEA 2A22A 1U32A 2BDXA 1T71A 2QFPA 3IB8A 4IL1A 4LTYA 1G5BA 4MOYA 3P71C 4ORCA 3EGHA 4ZVZA 3QFKA 1Z2XA 3TGHA 3QFNA 2O8GA 1NNWA 4H2GA 2NYLC 2Z1AA 5B8IA 1HPUA 2WDDA 4MOVA 4UT3B 2P6BA 3DSDA 4O4KA 5GTUA 1M63A 1OIDA 2NYMC 2DFJA 3EGGA 4V0VA 5C1VA 2AHDA 3K7VC 4H2FA 3K7WC 2DXLA 2IE3C 1SU1A 2ZBMA 2CV9A 2IE4C 4M0VA 3RQZA 1AUIA 4H1YP 1QHWA 3IVDA 3THOB 1S3NA 3H60A 1KBPA 2QFRA 2R17A 4UT2A 5HPEA 1HO5A 4DT2A 2JOGA 3HVQA 3PSNA 4OR9A 2Z72A 1IT6A 2WDCA 3D03A 4FBQA 4KBPA 4YKEA 3PSOA 1XZWA 2GJUA 5J28A 2BCDA 2HYOA 3RL5A 4DHLA 1OI8A 2BQ8X 3CK2A 1HP1A 4I5NC 3C9FA 4NZVA 5IOHA 3H69A 4V0WA 1USHA 5INBA 5DNYA 4UWQA 1Z2WA 2WDFA 4H2BA 3ICFA 1QFCA 1T70A 4H2IA 3H68A 3V4YA 4MP0A 3RL3A 3T1IA 4FBWA 2ZO9B 1UF3A 2YVTA 2WDEA 4B2OA 5F3WA 2Q8UA 3KBPA 3IB7A 5JPEA 2YEQA 1TCOA 4WWLA 2XMOA 4XPNA 1W24A 4O43A 4O24A 3FLOA 4V0XA 2DXNA 4JA7A 4TUIA 3E0JA 4ORBA 4O5GA 5JJTA 1MF8A 1WAO1 1S95A 1S8EA 3E7AA 4G9JA 2ZOAA 3N5UA 4Q7FA 2Z06A 3IVEA 4LU9A 2HYPA 4LACC 3QG5C 3AV0A 4I5LC 4FCXA 4ZX2A 4TUGA 1V73A 4ORAA 4KKZA 2NXFA 4DSYA 3H64A 3DSCA 1XM7A 3FGAC 3QFOA 1UTEA 2USHA 4FBKA 5EQVA 4J6OA 1WARA 3ZU0A 2HY1A 3QFMA 4JA9A 4IYPC 4H1SA 3H63A 1S3LA 4F0ZA 2QJCA 1S70A 3AUZA 3C5WC 3DW8C 3H66A 3H67A 3H62B 3ZTVA 5JPFA 3H61A 2O8AA 3GVEA 3THNA 3E7BA 4UT3A 2NPPC 3RL4A 2KKNA 2IAEC 1JK7A 1II7A 3JYFA 1S3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HD0 A;  3LL8 A;  1FJM A;  1OIE A;  2A22 A;  1U32 A;  2BDX A;  1T71 A;  2QFP A;  3IB8 A;  4IL1 A;  4LTY A;  1G5B A;  4MOY A;  3P71 C;  4ORC A;  3EGH A;  4ZVZ A;  3QFK A;  1Z2X A;  3TGH A;  3QFN A;  2O8G A;  1NNW A;  4H2G A;  2NYL C;  2Z1A A;  5B8I A;  1HPU A;  2WDD A;  4MOV A;  4UT3 B;  2P6B A;  3DSD A;  4O4K A;  5GTU A;  1M63 A;  1OID A;  2NYM C;  2DFJ A;  3EGG A;  4V0V A;  5C1V A;  2AHD A;  3K7V C;  4H2F A;  3K7W C;  2IE3 C;  1SU1 A;  2ZBM A;  2CV9 A;  2IE4 C;  4M0V A;  3RQZ A;  1AUI A;  4H1Y P;  1QHW A;  3IVD A;  3THO B;  1S3N A;  3H60 A;  1KBP A;  2QFR A;  2R17 A;  4UT2 A;  5HPE A;  1HO5 A;  4DT2 A;  2JOG A;  3HVQ A;  3PSN A;  4OR9 A;  2Z72 A;  1IT6 A;  2WDC A;  4FBQ A;  4KBP A;  4YKE A;  3PSO A;  1XZW A;  2GJU A;  5J28 A;  2BCD A;  2HYO A;  3RL5 A;  4DHL A;  1OI8 A;  2BQ8 X;  3CK2 A;  1HP1 A;  4I5N C;  3C9F A;  4NZV A;  5IOH A;  3H69 A;  4V0W A;  1USH A;  5INB A;  5DNY A;  4UWQ A;  1Z2W A;  2WDF A;  4H2B A;  3ICF A;  1QFC A;  1T70 A;  4H2I A;  3H68 A;  3V4Y A;  4MP0 A;  3RL3 A;  3T1I A;  4FBW A;  1UF3 A;  2YVT A;  2WDE A;  4B2O A;  5F3W A;  2Q8U A;  3KBP A;  3IB7 A;  5JPE A;  1TCO A;  4WWL A;  2XMO A;  4XPN A;  1W24 A;  4O43 A;  4O24 A;  4V0X A;  4JA7 A;  4TUI A;  4ORB A;  4O5G A;  5JJT A;  1MF8 A;  1WAO 1;  1S95 A;  1S8E A;  3E7A A;  4G9J A;  3N5U A;  4Q7F A;  2Z06 A;  3IVE A;  4LU9 A;  2HYP A;  4LAC C;  3QG5 C;  3AV0 A;  4I5L C;  4FCX A;  4ZX2 A;  4TUG A;  1V73 A;  4ORA A;  4KKZ A;  2NXF A;  4DSY A;  3H64 A;  3DSC A;  1XM7 A;  3FGA C;  3QFO A;  1UTE A;  2USH A;  4FBK A;  5EQV A;  4J6O A;  1WAR A;  3ZU0 A;  2HY1 A;  3QFM A;  4JA9 A;  4IYP C;  4H1S A;  3H63 A;  1S3L A;  4F0Z A;  2QJC A;  1S70 A;  3AUZ A;  3C5W C;  3DW8 C;  3H66 A;  3H67 A;  3H62 B;  3ZTV A;  5JPF A;  3H61 A;  2O8A A;  3GVE A;  3THN A;  3E7B A;  4UT3 A;  2NPP C;  3RL4 A;  2KKN A;  2IAE C;  1JK7 A;  1II7 A;  3JYF A;  1S3M A; 
#chains in the Genus database with same CATH topology
 4HD0 A;  3LL8 A;  1FJM A;  1OIE A;  2A22 A;  1U32 A;  2BDX A;  1T71 A;  2QFP A;  3IB8 A;  4IL1 A;  4LTY A;  1G5B A;  4MOY A;  3P71 C;  4ORC A;  3EGH A;  4ZVZ A;  3QFK A;  1Z2X A;  3TGH A;  3QFN A;  2O8G A;  1NNW A;  4H2G A;  2NYL C;  2Z1A A;  5B8I A;  1HPU A;  2WDD A;  4MOV A;  4UT3 B;  2P6B A;  3DSD A;  4O4K A;  5GTU A;  1M63 A;  1OID A;  2NYM C;  2DFJ A;  3EGG A;  4V0V A;  5C1V A;  2AHD A;  3K7V C;  4H2F A;  3K7W C;  2DXL A;  2IE3 C;  1SU1 A;  2ZBM A;  2CV9 A;  2IE4 C;  4M0V A;  3RQZ A;  1AUI A;  4H1Y P;  1QHW A;  3IVD A;  3THO B;  1S3N A;  3H60 A;  1KBP A;  2QFR A;  2R17 A;  4UT2 A;  5HPE A;  1HO5 A;  4DT2 A;  2JOG A;  3HVQ A;  3PSN A;  4OR9 A;  2Z72 A;  1IT6 A;  2WDC A;  3D03 A;  4FBQ A;  4KBP A;  4YKE A;  3PSO A;  1XZW A;  2GJU A;  5J28 A;  2BCD A;  2HYO A;  3RL5 A;  4DHL A;  1OI8 A;  2BQ8 X;  3CK2 A;  1HP1 A;  4I5N C;  3C9F A;  4NZV A;  5IOH A;  3H69 A;  4V0W A;  1USH A;  5INB A;  5DNY A;  4UWQ A;  1Z2W A;  2WDF A;  4H2B A;  3ICF A;  1QFC A;  1T70 A;  4H2I A;  3H68 A;  3V4Y A;  4MP0 A;  3RL3 A;  3T1I A;  4FBW A;  2ZO9 B;  1UF3 A;  2YVT A;  2WDE A;  4B2O A;  5F3W A;  2Q8U A;  3KBP A;  3IB7 A;  5JPE A;  2YEQ A;  1TCO A;  4WWL A;  2XMO A;  4XPN A;  1W24 A;  4O43 A;  4O24 A;  3FLO A;  4V0X A;  2DXN A;  4JA7 A;  4TUI A;  3E0J A;  4ORB A;  4O5G A;  5JJT A;  1MF8 A;  1WAO 1;  1S95 A;  1S8E A;  3E7A A;  4G9J A;  2ZOA A;  3N5U A;  4Q7F A;  2Z06 A;  3IVE A;  4LU9 A;  2HYP A;  4LAC C;  3QG5 C;  3AV0 A;  4I5L C;  4FCX A;  4ZX2 A;  4TUG A;  1V73 A;  4ORA A;  4KKZ A;  2NXF A;  4DSY A;  3H64 A;  3DSC A;  1XM7 A;  3FGA C;  3QFO A;  1UTE A;  2USH A;  4FBK A;  5EQV A;  4J6O A;  1WAR A;  3ZU0 A;  2HY1 A;  3QFM A;  4JA9 A;  4IYP C;  4H1S A;  3H63 A;  1S3L A;  4F0Z A;  2QJC A;  1S70 A;  3AUZ A;  3C5W C;  3DW8 C;  3H66 A;  3H67 A;  3H62 B;  3ZTV A;  5JPF A;  3H61 A;  2O8A A;  3GVE A;  3THN A;  3E7B A;  4UT3 A;  2NPP C;  3RL4 A;  2KKN A;  2IAE C;  1JK7 A;  1II7 A;  3JYF A;  1S3M A; 
#chains in the Genus database with same CATH homology
 4HD0 A;  3LL8 A;  1FJM A;  1OIE A;  2A22 A;  1U32 A;  2BDX A;  1T71 A;  2QFP A;  3IB8 A;  4IL1 A;  4LTY A;  1G5B A;  4MOY A;  3P71 C;  4ORC A;  3EGH A;  4ZVZ A;  3QFK A;  1Z2X A;  3TGH A;  3QFN A;  2O8G A;  1NNW A;  4H2G A;  2NYL C;  2Z1A A;  5B8I A;  1HPU A;  2WDD A;  4MOV A;  4UT3 B;  2P6B A;  3DSD A;  4O4K A;  5GTU A;  1M63 A;  1OID A;  2NYM C;  2DFJ A;  3EGG A;  4V0V A;  5C1V A;  2AHD A;  3K7V C;  4H2F A;  3K7W C;  2DXL A;  2IE3 C;  1SU1 A;  2ZBM A;  2CV9 A;  2IE4 C;  4M0V A;  3RQZ A;  1AUI A;  4H1Y P;  1QHW A;  3IVD A;  3THO B;  1S3N A;  3H60 A;  1KBP A;  2QFR A;  2R17 A;  4UT2 A;  5HPE A;  1HO5 A;  4DT2 A;  2JOG A;  3HVQ A;  3PSN A;  4OR9 A;  2Z72 A;  1IT6 A;  2WDC A;  3D03 A;  4FBQ A;  4KBP A;  4YKE A;  3PSO A;  1XZW A;  2GJU A;  5J28 A;  2BCD A;  2HYO A;  3RL5 A;  4DHL A;  1OI8 A;  2BQ8 X;  3CK2 A;  1HP1 A;  4I5N C;  3C9F A;  4NZV A;  5IOH A;  3H69 A;  4V0W A;  1USH A;  5INB A;  5DNY A;  4UWQ A;  1Z2W A;  2WDF A;  4H2B A;  3ICF A;  1QFC A;  1T70 A;  4H2I A;  3H68 A;  3V4Y A;  4MP0 A;  3RL3 A;  3T1I A;  4FBW A;  2ZO9 B;  1UF3 A;  2YVT A;  2WDE A;  4B2O A;  5F3W A;  2Q8U A;  3KBP A;  3IB7 A;  5JPE A;  2YEQ A;  1TCO A;  4WWL A;  2XMO A;  4XPN A;  1W24 A;  4O43 A;  4O24 A;  3FLO A;  4V0X A;  2DXN A;  4JA7 A;  4TUI A;  3E0J A;  4ORB A;  4O5G A;  5JJT A;  1MF8 A;  1WAO 1;  1S95 A;  1S8E A;  3E7A A;  4G9J A;  2ZOA A;  3N5U A;  4Q7F A;  2Z06 A;  3IVE A;  4LU9 A;  2HYP A;  4LAC C;  3QG5 C;  3AV0 A;  4I5L C;  4FCX A;  4ZX2 A;  4TUG A;  1V73 A;  4ORA A;  4KKZ A;  2NXF A;  4DSY A;  3H64 A;  3DSC A;  1XM7 A;  3FGA C;  3QFO A;  1UTE A;  2USH A;  4FBK A;  5EQV A;  4J6O A;  1WAR A;  3ZU0 A;  2HY1 A;  3QFM A;  4JA9 A;  4IYP C;  4H1S A;  3H63 A;  1S3L A;  4F0Z A;  2QJC A;  1S70 A;  3AUZ A;  3C5W C;  3DW8 C;  3H66 A;  3H67 A;  3H62 B;  3ZTV A;  5JPF A;  3H61 A;  2O8A A;  3GVE A;  3THN A;  3E7B A;  4UT3 A;  2NPP C;  3RL4 A;  2KKN A;  2IAE C;  1JK7 A;  1II7 A;  3JYF A;  1S3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...