3IB7A

Crystal structure of full length rv0805
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
295
structure length
295
Chain Sequence
LRAAEHPRPDYVLLHISDTHLIGGDRRLYGAVDADDRLGELLEQLNQSGLRPDAIVFTGDLADKGEPAAYRKLRGLVEPFAAQLGAELVWVMGNHDDRAELRKFLLDEAPSMAPLDRVCMIDGLRIIVLDTSVPGHHHGEIRASQLGWLAEELATPAPDGTILALHHPPIPSVLDMAVTVELRDQAALGRVLRGTDVRAILAGHLHYSTNATFVGIPVSVASATCYTQDLTVAAGGTRGRDGAQGCNLVHVYPDTVVHSVIPLGGGETVGTFVSPGQARRKIAESGIFIEPSRRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A mycobacterial cyclic AMP phosphodiesterase that moonlights as a modifier of cell wall permeability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords Icc protein
total genus 89
structure length 295
sequence length 295
ec nomenclature ec 3.1.4.53: 3',5'-cyclic-AMP phosphodiesterase.
pdb deposition date 2009-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3ib7A00
4FCXA 3E7BA 3QFMA 1OIDA 3H66A 2Z06A 3H64A 3RL5A 3THOB 2A22A 4M0VA 4V0VA 3DSDA 3H69A 4DSYA 4I5LC 3IVEA 4OR9A 1S95A 1HO5A 4V0WA 2GJUA 2QJCA 4H1SA 1V73A 1HP1A 1WARA 1QHWA 2Z72A 3EGGA 1JK7A 3E7AA 4H2BA 1II7A 3JYFA 3QG5C 1UF3A 4LU9A 4TUGA 4ORCA 2WDCA 4UT3B 4XPNA 2YVTA 1S3LA 4Q7FA 2BQ8X 1S70A 4F0ZA 4KBPA 4NZVA 2HYOA 4ZX2A 2NXFA 2WDEA 5DNYA 3RQZA 1S3NA 2CV9A 3QFNA 1Z2WA 3AV0A 3H62B 4ORAA 3ICFA 4TUIA 4JA7A 4MOYA 5C1VA 3H60A 4ORBA 2WDFA 3IB7A 1WAO1 3C9FA 1FJMA 1IT6A 4IYPC 3C5WC 3LL8A 3H67A 3V4YA 4MOVA 3IB8A 4MP0A 5INBA 2DFJA 2BDXA 1U32A 5J28A 5F3WA 1S3MA 1S8EA 3GVEA 3EGHA 3H68A 2Z1AA 1OI8A 3H63A 2HYPA 4UT2A 1M63A 4J6OA 3AUZA 4HD0A 2IE3C 3H61A 2IAEC 4DT2A 1Z2XA 2USHA 1T70A 4O5GA 2WDDA 2NYLC 1OIEA 2O8GA 4B2OA 4JA9A 1UTEA 3T1IA 3DW8C 2NYMC 4LTYA 1TCOA 1KBPA 3PSNA 4I5NC 3PSOA 4FBWA 2JOGA 4O43A 2ZBMA 4FBQA 3RL3A 3FGAC 2Q8UA 5JPFA 4UWQA 5GTUA 4WWLA 1MF8A 5EQVA 2HY1A 4KKZA 5B8IA 3IVDA 4G9JA 5JPEA 4DHLA 3THNA 3N5UA 1SU1A 1AUIA 3ZU0A 3CK2A 3ZTVA 2QFRA 5JJTA 2IE4C 3K7VC 4O4KA 5IOHA 2QFPA 4IL1A 5HPEA 1XM7A 2KKNA 3QFKA 4O24A 1XZWA 4H2IA 4YKEA 2NPPC 1W24A 3DSCA 3HVQA 4LACC 3P71C 1NNWA 3KBPA 4UT3A 2R17A 3TGHA 2BCDA 1G5BA 3K7WC 3QFOA 4H2GA 1T71A 3RL4A 1QFCA 2XMOA 1HPUA 4ZVZA 4FBKA 2AHDA 2O8AA 1USHA 4H2FA 4H1YP 2P6BA 4V0XA
chains in the Genus database with same CATH superfamily
4FCXA 3E7BA 3QFMA 1OIDA 3H66A 2Z06A 3H64A 3RL5A 3THOB 2A22A 4M0VA 4V0VA 3DSDA 3H69A 4DSYA 4I5LC 3IVEA 4OR9A 2ZO9B 1S95A 1HO5A 4V0WA 2GJUA 2QJCA 4H1SA 1V73A 1HP1A 1WARA 1QHWA 2Z72A 3EGGA 1JK7A 3E7AA 4H2BA 1II7A 3JYFA 3QG5C 1UF3A 4LU9A 4TUGA 4ORCA 2WDCA 4UT3B 4XPNA 2YVTA 1S3LA 4Q7FA 2BQ8X 1S70A 4F0ZA 4KBPA 2DXLA 4NZVA 2HYOA 4ZX2A 2NXFA 2WDEA 5DNYA 3RQZA 1S3NA 2CV9A 3QFNA 1Z2WA 3AV0A 3H62B 4ORAA 3ICFA 4TUIA 4JA7A 4MOYA 5C1VA 3H60A 4ORBA 2WDFA 3IB7A 1WAO1 1FJMA 1IT6A 2YEQA 3C9FA 3C5WC 4IYPC 3LL8A 3H67A 3V4YA 4MOVA 3IB8A 4MP0A 5INBA 2DFJA 2BDXA 1U32A 5J28A 5F3WA 1S3MA 1S8EA 3GVEA 3EGHA 2ZOAA 3H68A 2Z1AA 1OI8A 3H63A 2HYPA 4UT2A 1M63A 4J6OA 3AUZA 4HD0A 2IE3C 3H61A 2IAEC 4DT2A 1Z2XA 2USHA 1T70A 4O5GA 2WDDA 2NYLC 1OIEA 2O8GA 4B2OA 4JA9A 1UTEA 3T1IA 3D03A 3DW8C 2NYMC 4LTYA 1TCOA 1KBPA 3E0JA 3PSNA 4I5NC 3PSOA 4FBWA 2JOGA 4O43A 2ZBMA 4FBQA 3RL3A 3FGAC 2Q8UA 5JPFA 4UWQA 5GTUA 4WWLA 1MF8A 5EQVA 2HY1A 4KKZA 5B8IA 3IVDA 4G9JA 5JPEA 4DHLA 3THNA 3N5UA 1SU1A 1AUIA 3ZU0A 3CK2A 3ZTVA 2DXNA 2QFRA 5JJTA 2IE4C 3K7VC 4O4KA 5IOHA 2QFPA 4IL1A 5HPEA 1XM7A 2KKNA 3QFKA 3FLOA 1XZWA 4H2IA 4O24A 4YKEA 2NPPC 1W24A 3DSCA 3HVQA 4LACC 3P71C 1NNWA 3KBPA 4UT3A 2R17A 3TGHA 2BCDA 1G5BA 3K7WC 3QFOA 4H2GA 1T71A 3RL4A 1QFCA 2XMOA 1HPUA 4ZVZA 4FBKA 2AHDA 2O8AA 1USHA 4H2FA 4H1YP 2P6BA 4V0XA
chains in the Genus database with same CATH topology
4FCXA 3E7BA 3QFMA 1OIDA 3H66A 2Z06A 3H64A 3RL5A 3THOB 2A22A 4M0VA 4V0VA 3DSDA 3H69A 4DSYA 4I5LC 3IVEA 4OR9A 2ZO9B 1S95A 1HO5A 4V0WA 2GJUA 2QJCA 4H1SA 1V73A 1HP1A 1WARA 1QHWA 2Z72A 3EGGA 1JK7A 3E7AA 4H2BA 1II7A 3JYFA 3QG5C 1UF3A 4LU9A 4TUGA 4ORCA 2WDCA 4UT3B 4XPNA 2YVTA 1S3LA 4Q7FA 2BQ8X 1S70A 4F0ZA 4KBPA 2DXLA 4NZVA 2HYOA 4ZX2A 2NXFA 2WDEA 5DNYA 3RQZA 1S3NA 2CV9A 3QFNA 1Z2WA 3AV0A 3H62B 4ORAA 3ICFA 4TUIA 4JA7A 4MOYA 5C1VA 3H60A 4ORBA 2WDFA 3IB7A 1WAO1 1FJMA 1IT6A 2YEQA 3C9FA 3C5WC 4IYPC 3LL8A 3H67A 3V4YA 4MOVA 3IB8A 4MP0A 5INBA 2DFJA 2BDXA 1U32A 5J28A 5F3WA 1S3MA 1S8EA 3GVEA 3EGHA 2ZOAA 3H68A 2Z1AA 1OI8A 3H63A 2HYPA 4UT2A 1M63A 4J6OA 3AUZA 4HD0A 2IE3C 3H61A 2IAEC 4DT2A 1Z2XA 2USHA 1T70A 4O5GA 2WDDA 2NYLC 1OIEA 2O8GA 4B2OA 4JA9A 1UTEA 3T1IA 3D03A 3DW8C 2NYMC 4LTYA 1TCOA 1KBPA 3E0JA 3PSNA 4I5NC 3PSOA 4FBWA 2JOGA 4O43A 2ZBMA 4FBQA 3RL3A 3FGAC 2Q8UA 5JPFA 4UWQA 5GTUA 4WWLA 1MF8A 5EQVA 2HY1A 4KKZA 5B8IA 3IVDA 4G9JA 5JPEA 4DHLA 3THNA 3N5UA 1SU1A 1AUIA 3ZU0A 3CK2A 3ZTVA 2DXNA 2QFRA 5JJTA 2IE4C 3K7VC 4O4KA 5IOHA 2QFPA 4IL1A 5HPEA 1XM7A 2KKNA 3QFKA 3FLOA 1XZWA 4H2IA 4O24A 4YKEA 2NPPC 1W24A 3DSCA 3HVQA 4LACC 3P71C 1NNWA 3KBPA 4UT3A 2R17A 3TGHA 2BCDA 1G5BA 3K7WC 3QFOA 4H2GA 1T71A 3RL4A 1QFCA 2XMOA 1HPUA 4ZVZA 4FBKA 2AHDA 2O8AA 1USHA 4H2FA 4H1YP 2P6BA 4V0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FCX A;  3E7B A;  3QFM A;  1OID A;  3H66 A;  2Z06 A;  3H64 A;  3RL5 A;  3THO B;  2A22 A;  4M0V A;  4V0V A;  3DSD A;  3H69 A;  4DSY A;  4I5L C;  3IVE A;  4OR9 A;  1S95 A;  1HO5 A;  4V0W A;  2GJU A;  2QJC A;  4H1S A;  1V73 A;  1HP1 A;  1WAR A;  1QHW A;  2Z72 A;  3EGG A;  1JK7 A;  3E7A A;  4H2B A;  1II7 A;  3JYF A;  3QG5 C;  1UF3 A;  4LU9 A;  4TUG A;  4ORC A;  2WDC A;  4UT3 B;  4XPN A;  2YVT A;  1S3L A;  4Q7F A;  2BQ8 X;  1S70 A;  4F0Z A;  4KBP A;  4NZV A;  2HYO A;  4ZX2 A;  2NXF A;  2WDE A;  5DNY A;  3RQZ A;  1S3N A;  2CV9 A;  3QFN A;  1Z2W A;  3AV0 A;  3H62 B;  4ORA A;  3ICF A;  4TUI A;  4JA7 A;  4MOY A;  5C1V A;  3H60 A;  4ORB A;  2WDF A;  3IB7 A;  1WAO 1;  3C9F A;  1FJM A;  1IT6 A;  4IYP C;  3C5W C;  3LL8 A;  3H67 A;  3V4Y A;  4MOV A;  3IB8 A;  4MP0 A;  5INB A;  2DFJ A;  2BDX A;  1U32 A;  5J28 A;  5F3W A;  1S3M A;  1S8E A;  3GVE A;  3EGH A;  3H68 A;  2Z1A A;  1OI8 A;  3H63 A;  2HYP A;  4UT2 A;  1M63 A;  4J6O A;  3AUZ A;  4HD0 A;  2IE3 C;  3H61 A;  2IAE C;  4DT2 A;  1Z2X A;  2USH A;  1T70 A;  4O5G A;  2WDD A;  2NYL C;  1OIE A;  2O8G A;  4B2O A;  4JA9 A;  1UTE A;  3T1I A;  3DW8 C;  2NYM C;  4LTY A;  1TCO A;  1KBP A;  3PSN A;  4I5N C;  3PSO A;  4FBW A;  2JOG A;  4O43 A;  2ZBM A;  4FBQ A;  3RL3 A;  3FGA C;  2Q8U A;  5JPF A;  4UWQ A;  5GTU A;  4WWL A;  1MF8 A;  5EQV A;  2HY1 A;  4KKZ A;  5B8I A;  3IVD A;  4G9J A;  5JPE A;  4DHL A;  3THN A;  3N5U A;  1SU1 A;  1AUI A;  3ZU0 A;  3CK2 A;  3ZTV A;  2QFR A;  5JJT A;  2IE4 C;  3K7V C;  4O4K A;  5IOH A;  2QFP A;  4IL1 A;  5HPE A;  1XM7 A;  2KKN A;  3QFK A;  4O24 A;  1XZW A;  4H2I A;  4YKE A;  2NPP C;  1W24 A;  3DSC A;  3HVQ A;  4LAC C;  3P71 C;  1NNW A;  3KBP A;  4UT3 A;  2R17 A;  3TGH A;  2BCD A;  1G5B A;  3K7W C;  3QFO A;  4H2G A;  1T71 A;  3RL4 A;  1QFC A;  2XMO A;  1HPU A;  4ZVZ A;  4FBK A;  2AHD A;  2O8A A;  1USH A;  4H2F A;  4H1Y P;  2P6B A;  4V0X A; 
#chains in the Genus database with same CATH topology
 4FCX A;  3E7B A;  3QFM A;  1OID A;  3H66 A;  2Z06 A;  3H64 A;  3RL5 A;  3THO B;  2A22 A;  4M0V A;  4V0V A;  3DSD A;  3H69 A;  4DSY A;  4I5L C;  3IVE A;  4OR9 A;  2ZO9 B;  1S95 A;  1HO5 A;  4V0W A;  2GJU A;  2QJC A;  4H1S A;  1V73 A;  1HP1 A;  1WAR A;  1QHW A;  2Z72 A;  3EGG A;  1JK7 A;  3E7A A;  4H2B A;  1II7 A;  3JYF A;  3QG5 C;  1UF3 A;  4LU9 A;  4TUG A;  4ORC A;  2WDC A;  4UT3 B;  4XPN A;  2YVT A;  1S3L A;  4Q7F A;  2BQ8 X;  1S70 A;  4F0Z A;  4KBP A;  2DXL A;  4NZV A;  2HYO A;  4ZX2 A;  2NXF A;  2WDE A;  5DNY A;  3RQZ A;  1S3N A;  2CV9 A;  3QFN A;  1Z2W A;  3AV0 A;  3H62 B;  4ORA A;  3ICF A;  4TUI A;  4JA7 A;  4MOY A;  5C1V A;  3H60 A;  4ORB A;  2WDF A;  3IB7 A;  1WAO 1;  1FJM A;  1IT6 A;  2YEQ A;  3C9F A;  3C5W C;  4IYP C;  3LL8 A;  3H67 A;  3V4Y A;  4MOV A;  3IB8 A;  4MP0 A;  5INB A;  2DFJ A;  2BDX A;  1U32 A;  5J28 A;  5F3W A;  1S3M A;  1S8E A;  3GVE A;  3EGH A;  2ZOA A;  3H68 A;  2Z1A A;  1OI8 A;  3H63 A;  2HYP A;  4UT2 A;  1M63 A;  4J6O A;  3AUZ A;  4HD0 A;  2IE3 C;  3H61 A;  2IAE C;  4DT2 A;  1Z2X A;  2USH A;  1T70 A;  4O5G A;  2WDD A;  2NYL C;  1OIE A;  2O8G A;  4B2O A;  4JA9 A;  1UTE A;  3T1I A;  3D03 A;  3DW8 C;  2NYM C;  4LTY A;  1TCO A;  1KBP A;  3E0J A;  3PSN A;  4I5N C;  3PSO A;  4FBW A;  2JOG A;  4O43 A;  2ZBM A;  4FBQ A;  3RL3 A;  3FGA C;  2Q8U A;  5JPF A;  4UWQ A;  5GTU A;  4WWL A;  1MF8 A;  5EQV A;  2HY1 A;  4KKZ A;  5B8I A;  3IVD A;  4G9J A;  5JPE A;  4DHL A;  3THN A;  3N5U A;  1SU1 A;  1AUI A;  3ZU0 A;  3CK2 A;  3ZTV A;  2DXN A;  2QFR A;  5JJT A;  2IE4 C;  3K7V C;  4O4K A;  5IOH A;  2QFP A;  4IL1 A;  5HPE A;  1XM7 A;  2KKN A;  3QFK A;  3FLO A;  1XZW A;  4H2I A;  4O24 A;  4YKE A;  2NPP C;  1W24 A;  3DSC A;  3HVQ A;  4LAC C;  3P71 C;  1NNW A;  3KBP A;  4UT3 A;  2R17 A;  3TGH A;  2BCD A;  1G5B A;  3K7W C;  3QFO A;  4H2G A;  1T71 A;  3RL4 A;  1QFC A;  2XMO A;  1HPU A;  4ZVZ A;  4FBK A;  2AHD A;  2O8A A;  1USH A;  4H2F A;  4H1Y P;  2P6B A;  4V0X A; 
#chains in the Genus database with same CATH homology
 4FCX A;  3E7B A;  3QFM A;  1OID A;  3H66 A;  2Z06 A;  3H64 A;  3RL5 A;  3THO B;  2A22 A;  4M0V A;  4V0V A;  3DSD A;  3H69 A;  4DSY A;  4I5L C;  3IVE A;  4OR9 A;  2ZO9 B;  1S95 A;  1HO5 A;  4V0W A;  2GJU A;  2QJC A;  4H1S A;  1V73 A;  1HP1 A;  1WAR A;  1QHW A;  2Z72 A;  3EGG A;  1JK7 A;  3E7A A;  4H2B A;  1II7 A;  3JYF A;  3QG5 C;  1UF3 A;  4LU9 A;  4TUG A;  4ORC A;  2WDC A;  4UT3 B;  4XPN A;  2YVT A;  1S3L A;  4Q7F A;  2BQ8 X;  1S70 A;  4F0Z A;  4KBP A;  2DXL A;  4NZV A;  2HYO A;  4ZX2 A;  2NXF A;  2WDE A;  5DNY A;  3RQZ A;  1S3N A;  2CV9 A;  3QFN A;  1Z2W A;  3AV0 A;  3H62 B;  4ORA A;  3ICF A;  4TUI A;  4JA7 A;  4MOY A;  5C1V A;  3H60 A;  4ORB A;  2WDF A;  3IB7 A;  1WAO 1;  1FJM A;  1IT6 A;  2YEQ A;  3C9F A;  3C5W C;  4IYP C;  3LL8 A;  3H67 A;  3V4Y A;  4MOV A;  3IB8 A;  4MP0 A;  5INB A;  2DFJ A;  2BDX A;  1U32 A;  5J28 A;  5F3W A;  1S3M A;  1S8E A;  3GVE A;  3EGH A;  2ZOA A;  3H68 A;  2Z1A A;  1OI8 A;  3H63 A;  2HYP A;  4UT2 A;  1M63 A;  4J6O A;  3AUZ A;  4HD0 A;  2IE3 C;  3H61 A;  2IAE C;  4DT2 A;  1Z2X A;  2USH A;  1T70 A;  4O5G A;  2WDD A;  2NYL C;  1OIE A;  2O8G A;  4B2O A;  4JA9 A;  1UTE A;  3T1I A;  3D03 A;  3DW8 C;  2NYM C;  4LTY A;  1TCO A;  1KBP A;  3E0J A;  3PSN A;  4I5N C;  3PSO A;  4FBW A;  2JOG A;  4O43 A;  2ZBM A;  4FBQ A;  3RL3 A;  3FGA C;  2Q8U A;  5JPF A;  4UWQ A;  5GTU A;  4WWL A;  1MF8 A;  5EQV A;  2HY1 A;  4KKZ A;  5B8I A;  3IVD A;  4G9J A;  5JPE A;  4DHL A;  3THN A;  3N5U A;  1SU1 A;  1AUI A;  3ZU0 A;  3CK2 A;  3ZTV A;  2DXN A;  2QFR A;  5JJT A;  2IE4 C;  3K7V C;  4O4K A;  5IOH A;  2QFP A;  4IL1 A;  5HPE A;  1XM7 A;  2KKN A;  3QFK A;  3FLO A;  1XZW A;  4H2I A;  4O24 A;  4YKE A;  2NPP C;  1W24 A;  3DSC A;  3HVQ A;  4LAC C;  3P71 C;  1NNW A;  3KBP A;  4UT3 A;  2R17 A;  3TGH A;  2BCD A;  1G5B A;  3K7W C;  3QFO A;  4H2G A;  1T71 A;  3RL4 A;  1QFC A;  2XMO A;  1HPU A;  4ZVZ A;  4FBK A;  2AHD A;  2O8A A;  1USH A;  4H2F A;  4H1Y P;  2P6B A;  4V0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...