3IB7A

Crystal structure of full length rv0805
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
295
structure length
295
Chain Sequence
LRAAEHPRPDYVLLHISDTHLIGGDRRLYGAVDADDRLGELLEQLNQSGLRPDAIVFTGDLADKGEPAAYRKLRGLVEPFAAQLGAELVWVMGNHDDRAELRKFLLDEAPSMAPLDRVCMIDGLRIIVLDTSVPGHHHGEIRASQLGWLAEELATPAPDGTILALHHPPIPSVLDMAVTVELRDQAALGRVLRGTDVRAILAGHLHYSTNATFVGIPVSVASATCYTQDLTVAAGGTRGRDGAQGCNLVHVYPDTVVHSVIPLGGGETVGTFVSPGQARRKIAESGIFIEPSRRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Icc protein
publication title A mycobacterial cyclic AMP phosphodiesterase that moonlights as a modifier of cell wall permeability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 89
structure length 295
sequence length 295
ec nomenclature ec 3.1.4.53: 3',5'-cyclic-AMP phosphodiesterase.
pdb deposition date 2009-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3ib7A00
4J6OA 5DNYA 3C5WC 2WDDA 3KBPA 3DW8C 4H2GA 2O8AA 4UWQA 3RL4A 3H69A 2WDEA 1QHWA 3QFOA 4G9JA 1TCOA 4I5NC 3K7VC 4UT3A 2QFRA 3CK2A 1USHA 3QG5C 4O4KA 5J28A 2P6BA 2IE4C 3RQZA 1S3LA 1FJMA 3H64A 1T70A 3P71C 4IL1A 4NZVA 5B8IA 4FBKA 3H68A 2QFPA 1Z2XA 2HYOA 3ZU0A 2O8GA 3RL3A 2Z06A 5HPEA 3IVDA 4I5LC 3THOB 4DSYA 3EGHA 4ZX2A 4TUGA 1G5BA 3PSNA 3AV0A 3ICFA 5JJTA 3HVQA 5IOHA 4O24A 2Q8UA 2BCDA 1NNWA 3DSCA 3DSDA 4H1SA 2HYPA 3QFNA 2IE3C 2Z1AA 2USHA 2YVTA 4H2FA 4DT2A 4H2IA 2BDXA 3FGAC 1S3MA 4ORBA 4Q7FA 1T71A 4LU9A 5JPEA 2WDCA 1IT6A 1MF8A 2Z72A 1JK7A 4M0VA 1OIDA 4JA7A 4ORAA 3H60A 2JOGA 4WWLA 4MOVA 1HPUA 2QJCA 4TUIA 3EGGA 3E7BA 3LL8A 4JA9A 4F0ZA 2BQ8X 3TGHA 1OI8A 2ZBMA 2NYMC 3QFKA 4O43A 2DFJA 4H2BA 4O5GA 2CV9A 1U32A 4V0XA 4KKZA 4MP0A 2A22A 2AHDA 1Z2WA 4FBQA 1II7A 1UTEA 3V4YA 5C1VA 4XPNA 4MOYA 5INBA 3E7AA 5F3WA 4FCXA 4HD0A 4DHLA 1SU1A 5JPFA 1XM7A 1XZWA 3K7WC 3QFMA 3THNA 3GVEA 5GTUA 3IB8A 4ORCA 1W24A 4UT3B 1AUIA 3RL5A 2NXFA 4LACC 1WAO1 4IYPC 3T1IA 4OR9A 1UF3A 1HO5A 4FBWA 4ZVZA 3AUZA 2GJUA 3IB7A 1OIEA 3IVEA 4H1YP 5EQVA 3ZTVA 2HY1A 1S70A 4V0WA 4UT2A 1WARA 1M63A 1QFCA 4LTYA 1S8EA 2NPPC 2XMOA 3N5UA 4B2OA 3H67A 1V73A 2R17A 3H66A 3H63A 3JYFA 2IAEC 1HP1A 2NYLC 3C9FA 3H62B 4V0VA 1KBPA 4YKEA 3PSOA 1S95A 1S3NA 2KKNA 2WDFA 3H61A 4KBPA
chains in the Genus database with same CATH superfamily
4J6OA 5DNYA 3C5WC 2WDDA 3KBPA 3DW8C 4H2GA 2O8AA 4UWQA 3RL4A 3H69A 2WDEA 1QHWA 3QFOA 4G9JA 1TCOA 4I5NC 3K7VC 4UT3A 2QFRA 3CK2A 1USHA 3QG5C 4O4KA 5J28A 3E0JA 2P6BA 2IE4C 3RQZA 1S3LA 1FJMA 3H64A 1T70A 3P71C 4IL1A 4NZVA 5B8IA 4FBKA 3H68A 2QFPA 1Z2XA 2HYOA 3ZU0A 2O8GA 3RL3A 2Z06A 5HPEA 3IVDA 4I5LC 3THOB 4DSYA 3EGHA 2ZO9B 4ZX2A 4TUGA 1G5BA 3PSNA 3AV0A 3ICFA 5JJTA 3HVQA 5IOHA 4O24A 2Q8UA 2BCDA 3FLOA 1NNWA 3DSCA 3DSDA 4H1SA 2HYPA 3QFNA 2IE3C 2Z1AA 2USHA 2YVTA 4H2FA 4DT2A 4H2IA 2BDXA 3FGAC 1S3MA 4ORBA 4Q7FA 1T71A 4LU9A 5JPEA 2WDCA 1IT6A 1MF8A 2Z72A 1JK7A 4M0VA 1OIDA 4JA7A 4ORAA 3H60A 2JOGA 4WWLA 4MOVA 1HPUA 2QJCA 4TUIA 3EGGA 3E7BA 3LL8A 4JA9A 4F0ZA 2BQ8X 3TGHA 1OI8A 2ZBMA 2NYMC 3QFKA 2ZOAA 4O43A 2DFJA 4H2BA 4O5GA 2CV9A 1U32A 4V0XA 4KKZA 4MP0A 2A22A 2AHDA 1Z2WA 4FBQA 1II7A 1UTEA 3V4YA 5C1VA 4XPNA 4MOYA 5INBA 3E7AA 5F3WA 4FCXA 4HD0A 4DHLA 1SU1A 5JPFA 1XM7A 1XZWA 3K7WC 3QFMA 3THNA 3GVEA 5GTUA 3IB8A 4ORCA 1W24A 4UT3B 1AUIA 3RL5A 2NXFA 4LACC 1WAO1 4IYPC 3T1IA 4OR9A 2DXNA 1UF3A 1HO5A 4FBWA 4ZVZA 3AUZA 2GJUA 3IB7A 1OIEA 2YEQA 3IVEA 4H1YP 5EQVA 3ZTVA 2HY1A 1S70A 4V0WA 4UT2A 2DXLA 1WARA 1M63A 1QFCA 4LTYA 1S8EA 2NPPC 2XMOA 3D03A 3N5UA 3H67A 4B2OA 1V73A 2R17A 3H66A 3H63A 3JYFA 2IAEC 1HP1A 2NYLC 3C9FA 3H62B 4V0VA 1KBPA 4YKEA 3PSOA 1S95A 1S3NA 2KKNA 2WDFA 3H61A 4KBPA
chains in the Genus database with same CATH topology
4J6OA 5DNYA 3C5WC 2WDDA 3KBPA 3DW8C 4H2GA 2O8AA 4UWQA 3RL4A 3H69A 2WDEA 1QHWA 3QFOA 4G9JA 1TCOA 4I5NC 3K7VC 4UT3A 2QFRA 3CK2A 1USHA 3QG5C 4O4KA 5J28A 3E0JA 2P6BA 2IE4C 3RQZA 1S3LA 1FJMA 3H64A 1T70A 3P71C 4IL1A 4NZVA 5B8IA 4FBKA 3H68A 2QFPA 1Z2XA 2HYOA 3ZU0A 2O8GA 3RL3A 2Z06A 5HPEA 3IVDA 4I5LC 3THOB 4DSYA 3EGHA 2ZO9B 4ZX2A 4TUGA 1G5BA 3PSNA 3AV0A 3ICFA 5JJTA 3HVQA 5IOHA 4O24A 2Q8UA 2BCDA 3FLOA 1NNWA 3DSCA 3DSDA 4H1SA 2HYPA 3QFNA 2IE3C 2Z1AA 2USHA 2YVTA 4H2FA 4DT2A 4H2IA 2BDXA 3FGAC 1S3MA 4ORBA 4Q7FA 1T71A 4LU9A 5JPEA 2WDCA 1IT6A 1MF8A 2Z72A 1JK7A 4M0VA 1OIDA 4JA7A 4ORAA 3H60A 2JOGA 4WWLA 4MOVA 1HPUA 2QJCA 4TUIA 3EGGA 3E7BA 3LL8A 4JA9A 4F0ZA 2BQ8X 3TGHA 1OI8A 2ZBMA 2NYMC 3QFKA 2ZOAA 4O43A 2DFJA 4H2BA 4O5GA 2CV9A 1U32A 4V0XA 4KKZA 4MP0A 2A22A 2AHDA 1Z2WA 4FBQA 1II7A 1UTEA 3V4YA 5C1VA 4XPNA 4MOYA 5INBA 3E7AA 5F3WA 4FCXA 4HD0A 4DHLA 1SU1A 5JPFA 1XM7A 1XZWA 3K7WC 3QFMA 3THNA 3GVEA 5GTUA 3IB8A 4ORCA 1W24A 4UT3B 1AUIA 3RL5A 2NXFA 4LACC 1WAO1 4IYPC 3T1IA 4OR9A 2DXNA 1UF3A 1HO5A 4FBWA 4ZVZA 3AUZA 2GJUA 3IB7A 1OIEA 2YEQA 3IVEA 4H1YP 5EQVA 3ZTVA 2HY1A 1S70A 4V0WA 4UT2A 2DXLA 1WARA 1M63A 1QFCA 4LTYA 1S8EA 2NPPC 2XMOA 3D03A 3N5UA 3H67A 4B2OA 1V73A 2R17A 3H66A 3H63A 3JYFA 2IAEC 1HP1A 2NYLC 3C9FA 3H62B 4V0VA 1KBPA 4YKEA 3PSOA 1S95A 1S3NA 2KKNA 2WDFA 3H61A 4KBPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J6O A;  5DNY A;  3C5W C;  2WDD A;  3KBP A;  3DW8 C;  4H2G A;  2O8A A;  4UWQ A;  3RL4 A;  3H69 A;  2WDE A;  1QHW A;  3QFO A;  4G9J A;  1TCO A;  4I5N C;  3K7V C;  4UT3 A;  2QFR A;  3CK2 A;  1USH A;  3QG5 C;  4O4K A;  5J28 A;  2P6B A;  2IE4 C;  3RQZ A;  1S3L A;  1FJM A;  3H64 A;  1T70 A;  3P71 C;  4IL1 A;  4NZV A;  5B8I A;  4FBK A;  3H68 A;  2QFP A;  1Z2X A;  2HYO A;  3ZU0 A;  2O8G A;  3RL3 A;  2Z06 A;  5HPE A;  3IVD A;  4I5L C;  3THO B;  4DSY A;  3EGH A;  4ZX2 A;  4TUG A;  1G5B A;  3PSN A;  3AV0 A;  3ICF A;  5JJT A;  3HVQ A;  5IOH A;  4O24 A;  2Q8U A;  2BCD A;  1NNW A;  3DSC A;  3DSD A;  4H1S A;  2HYP A;  3QFN A;  2IE3 C;  2Z1A A;  2USH A;  2YVT A;  4H2F A;  4DT2 A;  4H2I A;  2BDX A;  3FGA C;  1S3M A;  4ORB A;  4Q7F A;  1T71 A;  4LU9 A;  5JPE A;  2WDC A;  1IT6 A;  1MF8 A;  2Z72 A;  1JK7 A;  4M0V A;  1OID A;  4JA7 A;  4ORA A;  3H60 A;  2JOG A;  4WWL A;  4MOV A;  1HPU A;  2QJC A;  4TUI A;  3EGG A;  3E7B A;  3LL8 A;  4JA9 A;  4F0Z A;  2BQ8 X;  3TGH A;  1OI8 A;  2ZBM A;  2NYM C;  3QFK A;  4O43 A;  2DFJ A;  4H2B A;  4O5G A;  2CV9 A;  1U32 A;  4V0X A;  4KKZ A;  4MP0 A;  2A22 A;  2AHD A;  1Z2W A;  4FBQ A;  1II7 A;  1UTE A;  3V4Y A;  5C1V A;  4XPN A;  4MOY A;  5INB A;  3E7A A;  5F3W A;  4FCX A;  4HD0 A;  4DHL A;  1SU1 A;  5JPF A;  1XM7 A;  1XZW A;  3K7W C;  3QFM A;  3THN A;  3GVE A;  5GTU A;  3IB8 A;  4ORC A;  1W24 A;  4UT3 B;  1AUI A;  3RL5 A;  2NXF A;  4LAC C;  1WAO 1;  4IYP C;  3T1I A;  4OR9 A;  1UF3 A;  1HO5 A;  4FBW A;  4ZVZ A;  3AUZ A;  2GJU A;  3IB7 A;  1OIE A;  3IVE A;  4H1Y P;  5EQV A;  3ZTV A;  2HY1 A;  1S70 A;  4V0W A;  4UT2 A;  1WAR A;  1M63 A;  1QFC A;  4LTY A;  1S8E A;  2NPP C;  2XMO A;  3N5U A;  4B2O A;  3H67 A;  1V73 A;  2R17 A;  3H66 A;  3H63 A;  3JYF A;  2IAE C;  1HP1 A;  2NYL C;  3C9F A;  3H62 B;  4V0V A;  1KBP A;  4YKE A;  3PSO A;  1S95 A;  1S3N A;  2KKN A;  2WDF A;  3H61 A;  4KBP A; 
#chains in the Genus database with same CATH topology
 4J6O A;  5DNY A;  3C5W C;  2WDD A;  3KBP A;  3DW8 C;  4H2G A;  2O8A A;  4UWQ A;  3RL4 A;  3H69 A;  2WDE A;  1QHW A;  3QFO A;  4G9J A;  1TCO A;  4I5N C;  3K7V C;  4UT3 A;  2QFR A;  3CK2 A;  1USH A;  3QG5 C;  4O4K A;  5J28 A;  3E0J A;  2P6B A;  2IE4 C;  3RQZ A;  1S3L A;  1FJM A;  3H64 A;  1T70 A;  3P71 C;  4IL1 A;  4NZV A;  5B8I A;  4FBK A;  3H68 A;  2QFP A;  1Z2X A;  2HYO A;  3ZU0 A;  2O8G A;  3RL3 A;  2Z06 A;  5HPE A;  3IVD A;  4I5L C;  3THO B;  4DSY A;  3EGH A;  2ZO9 B;  4ZX2 A;  4TUG A;  1G5B A;  3PSN A;  3AV0 A;  3ICF A;  5JJT A;  3HVQ A;  5IOH A;  4O24 A;  2Q8U A;  2BCD A;  3FLO A;  1NNW A;  3DSC A;  3DSD A;  4H1S A;  2HYP A;  3QFN A;  2IE3 C;  2Z1A A;  2USH A;  2YVT A;  4H2F A;  4DT2 A;  4H2I A;  2BDX A;  3FGA C;  1S3M A;  4ORB A;  4Q7F A;  1T71 A;  4LU9 A;  5JPE A;  2WDC A;  1IT6 A;  1MF8 A;  2Z72 A;  1JK7 A;  4M0V A;  1OID A;  4JA7 A;  4ORA A;  3H60 A;  2JOG A;  4WWL A;  4MOV A;  1HPU A;  2QJC A;  4TUI A;  3EGG A;  3E7B A;  3LL8 A;  4JA9 A;  4F0Z A;  2BQ8 X;  3TGH A;  1OI8 A;  2ZBM A;  2NYM C;  3QFK A;  2ZOA A;  4O43 A;  2DFJ A;  4H2B A;  4O5G A;  2CV9 A;  1U32 A;  4V0X A;  4KKZ A;  4MP0 A;  2A22 A;  2AHD A;  1Z2W A;  4FBQ A;  1II7 A;  1UTE A;  3V4Y A;  5C1V A;  4XPN A;  4MOY A;  5INB A;  3E7A A;  5F3W A;  4FCX A;  4HD0 A;  4DHL A;  1SU1 A;  5JPF A;  1XM7 A;  1XZW A;  3K7W C;  3QFM A;  3THN A;  3GVE A;  5GTU A;  3IB8 A;  4ORC A;  1W24 A;  4UT3 B;  1AUI A;  3RL5 A;  2NXF A;  4LAC C;  1WAO 1;  4IYP C;  3T1I A;  4OR9 A;  2DXN A;  1UF3 A;  1HO5 A;  4FBW A;  4ZVZ A;  3AUZ A;  2GJU A;  3IB7 A;  1OIE A;  2YEQ A;  3IVE A;  4H1Y P;  5EQV A;  3ZTV A;  2HY1 A;  1S70 A;  4V0W A;  4UT2 A;  2DXL A;  1WAR A;  1M63 A;  1QFC A;  4LTY A;  1S8E A;  2NPP C;  2XMO A;  3D03 A;  3N5U A;  3H67 A;  4B2O A;  1V73 A;  2R17 A;  3H66 A;  3H63 A;  3JYF A;  2IAE C;  1HP1 A;  2NYL C;  3C9F A;  3H62 B;  4V0V A;  1KBP A;  4YKE A;  3PSO A;  1S95 A;  1S3N A;  2KKN A;  2WDF A;  3H61 A;  4KBP A; 
#chains in the Genus database with same CATH homology
 4J6O A;  5DNY A;  3C5W C;  2WDD A;  3KBP A;  3DW8 C;  4H2G A;  2O8A A;  4UWQ A;  3RL4 A;  3H69 A;  2WDE A;  1QHW A;  3QFO A;  4G9J A;  1TCO A;  4I5N C;  3K7V C;  4UT3 A;  2QFR A;  3CK2 A;  1USH A;  3QG5 C;  4O4K A;  5J28 A;  3E0J A;  2P6B A;  2IE4 C;  3RQZ A;  1S3L A;  1FJM A;  3H64 A;  1T70 A;  3P71 C;  4IL1 A;  4NZV A;  5B8I A;  4FBK A;  3H68 A;  2QFP A;  1Z2X A;  2HYO A;  3ZU0 A;  2O8G A;  3RL3 A;  2Z06 A;  5HPE A;  3IVD A;  4I5L C;  3THO B;  4DSY A;  3EGH A;  2ZO9 B;  4ZX2 A;  4TUG A;  1G5B A;  3PSN A;  3AV0 A;  3ICF A;  5JJT A;  3HVQ A;  5IOH A;  4O24 A;  2Q8U A;  2BCD A;  3FLO A;  1NNW A;  3DSC A;  3DSD A;  4H1S A;  2HYP A;  3QFN A;  2IE3 C;  2Z1A A;  2USH A;  2YVT A;  4H2F A;  4DT2 A;  4H2I A;  2BDX A;  3FGA C;  1S3M A;  4ORB A;  4Q7F A;  1T71 A;  4LU9 A;  5JPE A;  2WDC A;  1IT6 A;  1MF8 A;  2Z72 A;  1JK7 A;  4M0V A;  1OID A;  4JA7 A;  4ORA A;  3H60 A;  2JOG A;  4WWL A;  4MOV A;  1HPU A;  2QJC A;  4TUI A;  3EGG A;  3E7B A;  3LL8 A;  4JA9 A;  4F0Z A;  2BQ8 X;  3TGH A;  1OI8 A;  2ZBM A;  2NYM C;  3QFK A;  2ZOA A;  4O43 A;  2DFJ A;  4H2B A;  4O5G A;  2CV9 A;  1U32 A;  4V0X A;  4KKZ A;  4MP0 A;  2A22 A;  2AHD A;  1Z2W A;  4FBQ A;  1II7 A;  1UTE A;  3V4Y A;  5C1V A;  4XPN A;  4MOY A;  5INB A;  3E7A A;  5F3W A;  4FCX A;  4HD0 A;  4DHL A;  1SU1 A;  5JPF A;  1XM7 A;  1XZW A;  3K7W C;  3QFM A;  3THN A;  3GVE A;  5GTU A;  3IB8 A;  4ORC A;  1W24 A;  4UT3 B;  1AUI A;  3RL5 A;  2NXF A;  4LAC C;  1WAO 1;  4IYP C;  3T1I A;  4OR9 A;  2DXN A;  1UF3 A;  1HO5 A;  4FBW A;  4ZVZ A;  3AUZ A;  2GJU A;  3IB7 A;  1OIE A;  2YEQ A;  3IVE A;  4H1Y P;  5EQV A;  3ZTV A;  2HY1 A;  1S70 A;  4V0W A;  4UT2 A;  2DXL A;  1WAR A;  1M63 A;  1QFC A;  4LTY A;  1S8E A;  2NPP C;  2XMO A;  3D03 A;  3N5U A;  3H67 A;  4B2O A;  1V73 A;  2R17 A;  3H66 A;  3H63 A;  3JYF A;  2IAE C;  1HP1 A;  2NYL C;  3C9F A;  3H62 B;  4V0V A;  1KBP A;  4YKE A;  3PSO A;  1S95 A;  1S3N A;  2KKN A;  2WDF A;  3H61 A;  4KBP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...