3IB8A

Crystal structure of full length rv0805 in complex with 5'-amp
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
295
structure length
295
Chain Sequence
LRAAEHPRPDYVLLHISDTHLIGGDRRLYGAVDADDRLGELLEQLNQSGLRPDAIVFTGDLADKGEPAAYRKLRGLVEPFAAQLGAELVWVMGNHDDRAELRKFLLDEAPSMAPLDRVCMIDGLRIIVLDTSVPGHHHGEIRASQLGWLAEELATPAPDGTILALHHPPIPSVLDMAVTVELRDQAALGRVLRGTDVRAILAGHLHYSTNATFVGIPVSVASATCYTQDLTVAAGGTRGRDGAQGCNLVHVYPDTVVHSVIPLGGGETVGTFVSPGQARRKIAESGIFIEPSRRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A mycobacterial cyclic AMP phosphodiesterase that moonlights as a modifier of cell wall permeability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords Icc protein
total genus 90
structure length 295
sequence length 295
ec nomenclature ec 3.1.4.53: 3',5'-cyclic-AMP phosphodiesterase.
pdb deposition date 2009-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3ib8A00
3AUZA 3N5UA 3THOB 1S3NA 3LL8A 2NYLC 3H63A 1OIEA 4TUIA 4UT2A 1Z2WA 4UWQA 2USHA 3QFOA 4V0VA 2O8GA 1OIDA 1S3MA 5IOHA 2KKNA 2A22A 1XZWA 2P6BA 3DSCA 3EGHA 3E7AA 3ZTVA 2R17A 3RL4A 4KBPA 4IL1A 1JK7A 4ORCA 3CK2A 4MOYA 3GVEA 1Z2XA 3H64A 1XM7A 3IB8A 1M63A 5HPEA 4O43A 4V0WA 5C1VA 3H60A 2ZBMA 3FGAC 4H1SA 4I5LC 4M0VA 3H66A 1T71A 3E7BA 4V0XA 2GJUA 2QFRA 1U32A 2O8AA 2IE4C 4ZX2A 4Q7FA 4LU9A 2QJCA 2Z1AA 3T1IA 5JPFA 2BDXA 3C9FA 2XMOA 2BQ8X 5EQVA 4FBQA 3ZU0A 5F3WA 3AV0A 3HVQA 2JOGA 5GTUA 2YVTA 3IVDA 4O5GA 3DSDA 1WARA 4O4KA 3PSNA 3K7WC 1OI8A 2Q8UA 3TGHA 1QFCA 1KBPA 1UTEA 4HD0A 4MP0A 3EGGA 4F0ZA 2Z06A 2IE3C 4H2IA 4JA9A 3K7VC 4H2GA 4LTYA 1IT6A 4ORBA 3QFKA 5DNYA 1G5BA 3H68A 1II7A 4ZVZA 4FCXA 3P71C 2HYOA 4G9JA 2DFJA 4FBWA 4H1YP 1UF3A 5INBA 3RL3A 1TCOA 2WDFA 1HP1A 3RQZA 1NNWA 1S70A 4NZVA 2HYPA 1USHA 3IB7A 3JYFA 5J28A 1T70A 3KBPA 4H2FA 1SU1A 3ICFA 3DW8C 4J6OA 3QG5C 2WDCA 4KKZA 5JJTA 4LACC 4UT3B 1HPUA 4I5NC 2CV9A 1HO5A 3QFNA 4WWLA 1V73A 4MOVA 3THNA 4UT3A 2QFPA 3IVEA 3H61A 4XPNA 4ORAA 2AHDA 3H69A 4O24A 2WDEA 1AUIA 1S95A 3QFMA 3H67A 4IYPC 2IAEC 5B8IA 4JA7A 2Z72A 3PSOA 1S8EA 4TUGA 2HY1A 2NPPC 1S3LA 4DT2A 2BCDA 3H62B 4H2BA 4DSYA 4FBKA 2NXFA 1W24A 2NYMC 3V4YA 3RL5A 4B2OA 4DHLA 5JPEA 1FJMA 3C5WC 1QHWA 4OR9A 4YKEA 2WDDA 1MF8A 1WAO1
chains in the Genus database with same CATH superfamily
3AUZA 3N5UA 3THOB 1S3NA 3LL8A 2NYLC 3H63A 1OIEA 4TUIA 4UT2A 1Z2WA 4UWQA 2USHA 3QFOA 2DXLA 2YEQA 4V0VA 2O8GA 1OIDA 1S3MA 5IOHA 2KKNA 2A22A 1XZWA 2P6BA 3DSCA 3EGHA 3E7AA 3ZTVA 2R17A 3RL4A 4KBPA 4IL1A 1JK7A 4ORCA 3CK2A 4MOYA 3GVEA 1Z2XA 3H64A 1XM7A 3IB8A 1M63A 5HPEA 4O43A 4V0WA 5C1VA 3H60A 2ZBMA 3FGAC 4H1SA 4I5LC 4M0VA 3H66A 3FLOA 1T71A 3E7BA 4V0XA 2GJUA 2QFRA 1U32A 2O8AA 2IE4C 4ZX2A 4Q7FA 4LU9A 2QJCA 2Z1AA 3T1IA 5JPFA 2BDXA 3C9FA 2XMOA 2BQ8X 5EQVA 4FBQA 3ZU0A 2DXNA 5F3WA 3AV0A 3HVQA 2JOGA 5GTUA 2YVTA 3IVDA 4O5GA 3DSDA 1WARA 4O4KA 3PSNA 3K7WC 1OI8A 2Q8UA 3TGHA 1QFCA 1KBPA 1UTEA 4HD0A 4MP0A 3EGGA 4F0ZA 2Z06A 2IE3C 4H2IA 4JA9A 3K7VC 4H2GA 4LTYA 1IT6A 4ORBA 3QFKA 5DNYA 1G5BA 3E0JA 1II7A 3H68A 4ZVZA 4FCXA 3P71C 2HYOA 4G9JA 2DFJA 4FBWA 4H1YP 1UF3A 5INBA 3RL3A 1TCOA 2WDFA 1HP1A 3RQZA 1NNWA 1S70A 4NZVA 2HYPA 1USHA 3IB7A 3JYFA 5J28A 1T70A 3KBPA 4H2FA 1SU1A 2ZOAA 3DW8C 3ICFA 4J6OA 3QG5C 2WDCA 4KKZA 5JJTA 4LACC 4UT3B 1HPUA 4I5NC 2CV9A 1HO5A 3QFNA 4WWLA 1V73A 4MOVA 3THNA 4UT3A 3D03A 2QFPA 3IVEA 3H61A 4XPNA 4ORAA 2AHDA 3H69A 2ZO9B 4O24A 2WDEA 1AUIA 1S95A 3QFMA 3H67A 4IYPC 2IAEC 5B8IA 4JA7A 2Z72A 3PSOA 1S8EA 4TUGA 2HY1A 2NPPC 1S3LA 4DT2A 2BCDA 3H62B 4H2BA 4DSYA 4FBKA 2NXFA 1W24A 2NYMC 3V4YA 3RL5A 4B2OA 4DHLA 5JPEA 1FJMA 3C5WC 1QHWA 4OR9A 4YKEA 2WDDA 1MF8A 1WAO1
chains in the Genus database with same CATH topology
3AUZA 3N5UA 3THOB 1S3NA 3LL8A 2NYLC 3H63A 1OIEA 4TUIA 4UT2A 1Z2WA 4UWQA 2USHA 3QFOA 2DXLA 2YEQA 4V0VA 2O8GA 1OIDA 1S3MA 5IOHA 2KKNA 2A22A 1XZWA 2P6BA 3DSCA 3EGHA 3E7AA 3ZTVA 2R17A 3RL4A 4KBPA 4IL1A 1JK7A 4ORCA 3CK2A 4MOYA 3GVEA 1Z2XA 3H64A 1XM7A 3IB8A 1M63A 5HPEA 4O43A 4V0WA 5C1VA 3H60A 2ZBMA 3FGAC 4H1SA 4I5LC 4M0VA 3H66A 3FLOA 1T71A 3E7BA 4V0XA 2GJUA 2QFRA 1U32A 2O8AA 2IE4C 4ZX2A 4Q7FA 4LU9A 2QJCA 2Z1AA 3T1IA 5JPFA 2BDXA 3C9FA 2XMOA 2BQ8X 5EQVA 4FBQA 3ZU0A 2DXNA 5F3WA 3AV0A 3HVQA 2JOGA 5GTUA 2YVTA 3IVDA 4O5GA 3DSDA 1WARA 4O4KA 3PSNA 3K7WC 1OI8A 2Q8UA 3TGHA 1QFCA 1KBPA 1UTEA 4HD0A 4MP0A 3EGGA 4F0ZA 2Z06A 2IE3C 4H2IA 4JA9A 3K7VC 4H2GA 4LTYA 1IT6A 4ORBA 3QFKA 5DNYA 1G5BA 3E0JA 1II7A 3H68A 4ZVZA 4FCXA 3P71C 2HYOA 4G9JA 2DFJA 4FBWA 4H1YP 1UF3A 5INBA 3RL3A 1TCOA 2WDFA 1HP1A 3RQZA 1NNWA 1S70A 4NZVA 2HYPA 1USHA 3IB7A 3JYFA 5J28A 1T70A 3KBPA 4H2FA 1SU1A 2ZOAA 3DW8C 3ICFA 4J6OA 3QG5C 2WDCA 4KKZA 5JJTA 4LACC 4UT3B 1HPUA 4I5NC 2CV9A 1HO5A 3QFNA 4WWLA 1V73A 4MOVA 3THNA 4UT3A 3D03A 2QFPA 3IVEA 3H61A 4XPNA 4ORAA 2AHDA 3H69A 2ZO9B 4O24A 2WDEA 1AUIA 1S95A 3QFMA 3H67A 4IYPC 2IAEC 5B8IA 4JA7A 2Z72A 3PSOA 1S8EA 4TUGA 2HY1A 2NPPC 1S3LA 4DT2A 2BCDA 3H62B 4H2BA 4DSYA 4FBKA 2NXFA 1W24A 2NYMC 3V4YA 3RL5A 4B2OA 4DHLA 5JPEA 1FJMA 3C5WC 1QHWA 4OR9A 4YKEA 2WDDA 1MF8A 1WAO1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AUZ A;  3N5U A;  3THO B;  1S3N A;  3LL8 A;  2NYL C;  3H63 A;  1OIE A;  4TUI A;  4UT2 A;  1Z2W A;  4UWQ A;  2USH A;  3QFO A;  4V0V A;  2O8G A;  1OID A;  1S3M A;  5IOH A;  2KKN A;  2A22 A;  1XZW A;  2P6B A;  3DSC A;  3EGH A;  3E7A A;  3ZTV A;  2R17 A;  3RL4 A;  4KBP A;  4IL1 A;  1JK7 A;  4ORC A;  3CK2 A;  4MOY A;  3GVE A;  1Z2X A;  3H64 A;  1XM7 A;  3IB8 A;  1M63 A;  5HPE A;  4O43 A;  4V0W A;  5C1V A;  3H60 A;  2ZBM A;  3FGA C;  4H1S A;  4I5L C;  4M0V A;  3H66 A;  1T71 A;  3E7B A;  4V0X A;  2GJU A;  2QFR A;  1U32 A;  2O8A A;  2IE4 C;  4ZX2 A;  4Q7F A;  4LU9 A;  2QJC A;  2Z1A A;  3T1I A;  5JPF A;  2BDX A;  3C9F A;  2XMO A;  2BQ8 X;  5EQV A;  4FBQ A;  3ZU0 A;  5F3W A;  3AV0 A;  3HVQ A;  2JOG A;  5GTU A;  2YVT A;  3IVD A;  4O5G A;  3DSD A;  1WAR A;  4O4K A;  3PSN A;  3K7W C;  1OI8 A;  2Q8U A;  3TGH A;  1QFC A;  1KBP A;  1UTE A;  4HD0 A;  4MP0 A;  3EGG A;  4F0Z A;  2Z06 A;  2IE3 C;  4H2I A;  4JA9 A;  3K7V C;  4H2G A;  4LTY A;  1IT6 A;  4ORB A;  3QFK A;  5DNY A;  1G5B A;  3H68 A;  1II7 A;  4ZVZ A;  4FCX A;  3P71 C;  2HYO A;  4G9J A;  2DFJ A;  4FBW A;  4H1Y P;  1UF3 A;  5INB A;  3RL3 A;  1TCO A;  2WDF A;  1HP1 A;  3RQZ A;  1NNW A;  1S70 A;  4NZV A;  2HYP A;  1USH A;  3IB7 A;  3JYF A;  5J28 A;  1T70 A;  3KBP A;  4H2F A;  1SU1 A;  3ICF A;  3DW8 C;  4J6O A;  3QG5 C;  2WDC A;  4KKZ A;  5JJT A;  4LAC C;  4UT3 B;  1HPU A;  4I5N C;  2CV9 A;  1HO5 A;  3QFN A;  4WWL A;  1V73 A;  4MOV A;  3THN A;  4UT3 A;  2QFP A;  3IVE A;  3H61 A;  4XPN A;  4ORA A;  2AHD A;  3H69 A;  4O24 A;  2WDE A;  1AUI A;  1S95 A;  3QFM A;  3H67 A;  4IYP C;  2IAE C;  5B8I A;  4JA7 A;  2Z72 A;  3PSO A;  1S8E A;  4TUG A;  2HY1 A;  2NPP C;  1S3L A;  4DT2 A;  2BCD A;  3H62 B;  4H2B A;  4DSY A;  4FBK A;  2NXF A;  1W24 A;  2NYM C;  3V4Y A;  3RL5 A;  4B2O A;  4DHL A;  5JPE A;  1FJM A;  3C5W C;  1QHW A;  4OR9 A;  4YKE A;  2WDD A;  1MF8 A;  1WAO 1; 
#chains in the Genus database with same CATH topology
 3AUZ A;  3N5U A;  3THO B;  1S3N A;  3LL8 A;  2NYL C;  3H63 A;  1OIE A;  4TUI A;  4UT2 A;  1Z2W A;  4UWQ A;  2USH A;  3QFO A;  2DXL A;  2YEQ A;  4V0V A;  2O8G A;  1OID A;  1S3M A;  5IOH A;  2KKN A;  2A22 A;  1XZW A;  2P6B A;  3DSC A;  3EGH A;  3E7A A;  3ZTV A;  2R17 A;  3RL4 A;  4KBP A;  4IL1 A;  1JK7 A;  4ORC A;  3CK2 A;  4MOY A;  3GVE A;  1Z2X A;  3H64 A;  1XM7 A;  3IB8 A;  1M63 A;  5HPE A;  4O43 A;  4V0W A;  5C1V A;  3H60 A;  2ZBM A;  3FGA C;  4H1S A;  4I5L C;  4M0V A;  3H66 A;  3FLO A;  1T71 A;  3E7B A;  4V0X A;  2GJU A;  2QFR A;  1U32 A;  2O8A A;  2IE4 C;  4ZX2 A;  4Q7F A;  4LU9 A;  2QJC A;  2Z1A A;  3T1I A;  5JPF A;  2BDX A;  3C9F A;  2XMO A;  2BQ8 X;  5EQV A;  4FBQ A;  3ZU0 A;  2DXN A;  5F3W A;  3AV0 A;  3HVQ A;  2JOG A;  5GTU A;  2YVT A;  3IVD A;  4O5G A;  3DSD A;  1WAR A;  4O4K A;  3PSN A;  3K7W C;  1OI8 A;  2Q8U A;  3TGH A;  1QFC A;  1KBP A;  1UTE A;  4HD0 A;  4MP0 A;  3EGG A;  4F0Z A;  2Z06 A;  2IE3 C;  4H2I A;  4JA9 A;  3K7V C;  4H2G A;  4LTY A;  1IT6 A;  4ORB A;  3QFK A;  5DNY A;  1G5B A;  3E0J A;  1II7 A;  3H68 A;  4ZVZ A;  4FCX A;  3P71 C;  2HYO A;  4G9J A;  2DFJ A;  4FBW A;  4H1Y P;  1UF3 A;  5INB A;  3RL3 A;  1TCO A;  2WDF A;  1HP1 A;  3RQZ A;  1NNW A;  1S70 A;  4NZV A;  2HYP A;  1USH A;  3IB7 A;  3JYF A;  5J28 A;  1T70 A;  3KBP A;  4H2F A;  1SU1 A;  2ZOA A;  3DW8 C;  3ICF A;  4J6O A;  3QG5 C;  2WDC A;  4KKZ A;  5JJT A;  4LAC C;  4UT3 B;  1HPU A;  4I5N C;  2CV9 A;  1HO5 A;  3QFN A;  4WWL A;  1V73 A;  4MOV A;  3THN A;  4UT3 A;  3D03 A;  2QFP A;  3IVE A;  3H61 A;  4XPN A;  4ORA A;  2AHD A;  3H69 A;  2ZO9 B;  4O24 A;  2WDE A;  1AUI A;  1S95 A;  3QFM A;  3H67 A;  4IYP C;  2IAE C;  5B8I A;  4JA7 A;  2Z72 A;  3PSO A;  1S8E A;  4TUG A;  2HY1 A;  2NPP C;  1S3L A;  4DT2 A;  2BCD A;  3H62 B;  4H2B A;  4DSY A;  4FBK A;  2NXF A;  1W24 A;  2NYM C;  3V4Y A;  3RL5 A;  4B2O A;  4DHL A;  5JPE A;  1FJM A;  3C5W C;  1QHW A;  4OR9 A;  4YKE A;  2WDD A;  1MF8 A;  1WAO 1; 
#chains in the Genus database with same CATH homology
 3AUZ A;  3N5U A;  3THO B;  1S3N A;  3LL8 A;  2NYL C;  3H63 A;  1OIE A;  4TUI A;  4UT2 A;  1Z2W A;  4UWQ A;  2USH A;  3QFO A;  2DXL A;  2YEQ A;  4V0V A;  2O8G A;  1OID A;  1S3M A;  5IOH A;  2KKN A;  2A22 A;  1XZW A;  2P6B A;  3DSC A;  3EGH A;  3E7A A;  3ZTV A;  2R17 A;  3RL4 A;  4KBP A;  4IL1 A;  1JK7 A;  4ORC A;  3CK2 A;  4MOY A;  3GVE A;  1Z2X A;  3H64 A;  1XM7 A;  3IB8 A;  1M63 A;  5HPE A;  4O43 A;  4V0W A;  5C1V A;  3H60 A;  2ZBM A;  3FGA C;  4H1S A;  4I5L C;  4M0V A;  3H66 A;  3FLO A;  1T71 A;  3E7B A;  4V0X A;  2GJU A;  2QFR A;  1U32 A;  2O8A A;  2IE4 C;  4ZX2 A;  4Q7F A;  4LU9 A;  2QJC A;  2Z1A A;  3T1I A;  5JPF A;  2BDX A;  3C9F A;  2XMO A;  2BQ8 X;  5EQV A;  4FBQ A;  3ZU0 A;  2DXN A;  5F3W A;  3AV0 A;  3HVQ A;  2JOG A;  5GTU A;  2YVT A;  3IVD A;  4O5G A;  3DSD A;  1WAR A;  4O4K A;  3PSN A;  3K7W C;  1OI8 A;  2Q8U A;  3TGH A;  1QFC A;  1KBP A;  1UTE A;  4HD0 A;  4MP0 A;  3EGG A;  4F0Z A;  2Z06 A;  2IE3 C;  4H2I A;  4JA9 A;  3K7V C;  4H2G A;  4LTY A;  1IT6 A;  4ORB A;  3QFK A;  5DNY A;  1G5B A;  3E0J A;  1II7 A;  3H68 A;  4ZVZ A;  4FCX A;  3P71 C;  2HYO A;  4G9J A;  2DFJ A;  4FBW A;  4H1Y P;  1UF3 A;  5INB A;  3RL3 A;  1TCO A;  2WDF A;  1HP1 A;  3RQZ A;  1NNW A;  1S70 A;  4NZV A;  2HYP A;  1USH A;  3IB7 A;  3JYF A;  5J28 A;  1T70 A;  3KBP A;  4H2F A;  1SU1 A;  2ZOA A;  3DW8 C;  3ICF A;  4J6O A;  3QG5 C;  2WDC A;  4KKZ A;  5JJT A;  4LAC C;  4UT3 B;  1HPU A;  4I5N C;  2CV9 A;  1HO5 A;  3QFN A;  4WWL A;  1V73 A;  4MOV A;  3THN A;  4UT3 A;  3D03 A;  2QFP A;  3IVE A;  3H61 A;  4XPN A;  4ORA A;  2AHD A;  3H69 A;  2ZO9 B;  4O24 A;  2WDE A;  1AUI A;  1S95 A;  3QFM A;  3H67 A;  4IYP C;  2IAE C;  5B8I A;  4JA7 A;  2Z72 A;  3PSO A;  1S8E A;  4TUG A;  2HY1 A;  2NPP C;  1S3L A;  4DT2 A;  2BCD A;  3H62 B;  4H2B A;  4DSY A;  4FBK A;  2NXF A;  1W24 A;  2NYM C;  3V4Y A;  3RL5 A;  4B2O A;  4DHL A;  5JPE A;  1FJM A;  3C5W C;  1QHW A;  4OR9 A;  4YKE A;  2WDD A;  1MF8 A;  1WAO 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...