3IBCA

Crystal structure of caspase-7 incomplex with acetyl-yvad-cho
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
140
structure length
140
Chain Sequence
TYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational similarity in the activation of caspase-3 and -7 revealed by the unliganded and inhibited structures of caspase-7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase, apoptosis
molecule keywords Caspase-7
total genus 52
structure length 140
sequence length 140
chains with identical sequence C
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2009-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ibcA00
1F1JA 2XZDA 1GFWA 1PYOA 2CNKA 4JJEA 5IBCA 5JFTA 1SC4A 3OD5A 3D6FA 4QTYA 3GJRA 3D6HA 3EDQA 2H65A 2C2MA 3QNWA 3V3KA 2CJXA 3PCXA 4ZVUA 1NMEA 4ZVQA 1PAUA 4AWBA 1RHQA 2J31A 2K7ZA 4QUIA 1RWXA 1NMSA 4AW9A 5LUAA 3H13A 1RWKA 1F9EA 1RWPA 2CNNA 1KMCA 4HVAA 3RJMA 4I1PA 1I3OA 3ITNA 1I51A 2H4WA 1SHLA 2DKOA 3R6GA 4HQ0A 4LSZA 2H48A 4N5DA 4N7JA 4QUAA 5IBPA 4DCOA 2QL7A 1SC3A 3H0EA 1RWWA 4NOJA 5LUBA 2P2CA 2XYHA 3V6LA 5IAEA 4EHLA 2CNOA 5H0IA 1K86A 3R7NA 3R5KA 1RHUA 3GJTA 5IC6A 2H5JA 4PS0A 2HBZA 3D6MA 1RWVA 2H4YA 4NBNA 4PRZA 3R6LA 4QTXA 1RHMA 4ZVRA 4EHNA 4JQZA 2H54A 1IBCA 3R7BA 2FP3A 4EHKA 1ICEA 2C2KA 4JQYA 2Y0BA 4QU8A 1JXQA 2CNLA 4QUGA 4ZVPA 3PD0A 4ZVOA 5IC4A 4EHDA 5IAGA 4NOLA 4EHAA 5IANA 4NOKA 3E4CA 3R5JA 3P45A 4N6OA 2XYPA 4EHHA 1RWOA 2QL5A 4D3YA 5IAJA 4FGUA 3UOAB 3V4LA 2XYGA 1NMQA 4QUEA 3V4OA 4FDLA 4I1RA 1BMQA 2WDPA 5LU9A 1GQFA 3KJQA 4NBKA 1CVRA 1I4OA 2FUNB 2H5IA 4QUBA 2NN3C 4PRYA 3DEHA 2QLFA 3EDRA 4DCJA 3K7EA 4FEAA 3NS7A 4D3XA 3NR2A 3DEKA 4ZVTA 1NW9B 2J33A 2QLBA 3NKFA 2CJYA 3PD1A 3UO8B 1QX3A 1RE1A 1SC1A 3V6MA 4QUHA 3SIRA 3H11A 4JR0A 3H1PA 4NOMA 4QUJA 1RHRA 2J30A 2FQQA 3GJQA 3KJFA 5I9BA 2HBQA 5K20A 4DCPA 4QU9A 2C2ZA 3DEJA 5LU8A 2XZTA 4JR2A 3R7SA 4EJFA 4QU5A 2QLJA 2C2OA 4IYRA 1K88A 4QU0A 2C1EA 4JJ7A 4QULA 3P4UA 3IBFA 3DEIA 4QUDA 2J32A 4D3ZA 5I9TA 2CDRA 1M72A 3IBCA 4EHFA 4HQRA 1I4EB 1CP3A 3SIPA 4PS1A 3BIJA 1QTNA 1SHJA 1RHJA 1RWNA 3H11B 1RWMA 4JR1A 5IARA 2HBYA 3GJSA 3KJNA 4N6NA 4ZVSA 1RHKA 4N7MA 3V55A 4AWAA 1QDUA 2Y1LA 2HBRA 4FXOA 2QL9A 4IEFB 3S70A 4JJ8A 2H51A 4M9RA 2AR9A 5IASA 3S8EA 5IABA 4N6GA 4NBLA 5IAKA 5IBRA 4JB8A
chains in the Genus database with same CATH superfamily
1V1RB 1M7HA 4UAUA 5FOVA 3A6DA 4P9NA 1XLWA 2VDQB 4HQKA 3K72B 3R7LA 3JALB 4Z5XA 4RTKA 4X1KA 3GLIB 4R2HA 1E4YA 1JMKC 4KAXA 3E6AA 4DIKA 3HU5A 2R1VA 4UQPA 1E9VA 3PC3A 3Q3CA 5A7FA 3RVKA 5CA0F 4M7PA 1CWUA 3DB1A 4RWZA 4EIWA 3G5AA 1Q1AA 3UYKA 2G83A 3ZDXB 4ZKDA 5BSUA 1NBAA 1T25A 3C3MA 4HEJA 4JL5A 2CFCA 4GZ5A 2XIJA 1U6KA 1Q3HA 4GUAA 1U8EA 4P4SA 4QUAA 3GVHA 5T4FA 2GEDA 4RC9A 2NUTA 1GG5A 4L6AA 1XYYA 3V8BA 4J7AA 3SIXA 3EUFA 3N8KA 3NETA 4LSGA 3ZV3A 3U16A 2X23A 4UDOA 4XM1A 3HM9A 2Q99A 3LUHA 4ZRMA 3R5KA 3W8RA 2BZ1A 3JASB 3HP7A 4S1VA 3EXIB 2YZ2A 1RWVA 3IAXA 1JDJA 1ZJ5A 5JHGB 4IXWA 1R18A 2AFHA 1EJ0A 1UJ5A 2V6GA 2D4HA 4CMEC 5JAUA 2VT6A 1VIYA 4Z4GA 1H3NA 2VYNA 4Y2RA 4KKVA 2Y0BA 5HG0A 3L05A 1FQJA 3F1KA 4LXQA 5A05A 4D8XA 1Z74A 3H5NA 2E89A 1V8ZA 2PZJA 1GHTA 3ZJTA 2H7VA 2XQKA 2I2DA 3ZTYA 2P11A 2Z2IA 4C03A 2C1ZA 2JDID 1W6UA 5AVXA 3TR5A 4PAQA 1BHSA 5J2UF 5KYNA 3NHKA 1E18A 5DCYA 4F4FA 1XPUA 3T5CA 2FPMA 4ARIA 2R86A 4HC4A 5BR4A 1FLVA 2IYRA 1CBUA 3THXB 1W5AA 5IEBA 5J2TB 1GYRA 2FZVA 2AL7A 5TRTA 3CX6A 5U1PA 1BDMA 2A8YA 3M33A 2QX7A 2ZTVA 3M1LA 4O8ZA 3T41A 1ZDMA 3OZBA 4AS2A 2WABA 3G2IA 3F3YA 2PWBA 1MH9A 1TJ3A 3LK6A 4O2AF 4QDKA 4O3FA 3RUAA 2CNWA 1E3LA 2BE9A 4MPTA 3KJXA 3SQMA 2B37A 4YQZA 3WNZA 3DNPA 1T9CA 4KR2A 2JPDA 1U0GA 4TQAA 4TVBA 2AKAB 2PRJA 3DNFA 3I3OA 1ZGAA 4JK3A 1BDHA 2YS6A 3WLQA 4IIXA 1CY6A 4HAOA 5A5VA 2EKLA 1HRDA 1TXGA 4OHKA 4CMHA 2JL1A 1RJDA 3CX4A 3WLNA 1M5RA 1VE7A 4OQFA 2RGNA 2ZAIA 1F6WA 3PQFA 4DANA 5KYGA 2XRFA 4F92B 1Y5LA 4JL8A 1GRQA 2M1ZA 1U0LA 5EKDA 1CU1A 2DT8A 2KLBA 3DA8A 1JG4A 4XR9A 5HIMA 4AZ0B 3DLCA 4YHHB 5AHRA 1U2SA 1CETA 2ZJ3A 1X1DA 3LNTA 1KJYA 1WDKA 3HDYA 4I4TF 4D4GA 3UMCA 4TKLA 4KUGA 4CCSA 3PHLA 4JVOA 3WB1A 4B7UA 3U7FB 4CFSA 3AEUB 2HTFA 1M3SA 2H4FA 2GBCA 4PPFA 1Z5GA 4UZFA 3JASA 1ZNZA 3I62A 4ITRC 1W75A 3EF0A 4L3VA 4NNPA 1RNLA 4R6XA 2EWMA 3FNHA 4UVHA 5EE5B 4B83A 2FEPA 1THGA 2PRKA 2VHJA 1CHDA 1RU3A 3DO8A 4AI6A 2NU7A 4E88A 2PH3A 2JLSA 4LOJA 5LWHA 4ND6A 4F4JA 1QGAA 1XKQA 2VP2A 4IHAA 5MFZA 3AIKA 2BM0A 2EJUA 3LXXA 1EG2A 1PD0A 4XCXA 4TV9F 2OXEA 1NF9A 2H5EA 1LJLA 2XTAA 1U3CA 3DMYA 1M8PA 2HB6A 4UVGA 3AV0B 5E95A 1GQQA 4MAMA 1OROA 1VE5A 2CLMB 2DKOA 3ETJA 3CH5A 3IOYA 3LBFA 2PFGA 3K6SB 2GLTA 5TMEA 1DLIA 3PB3A 4JLNA 2H1SA 1Y8QA 4EABA 4WKOA 5HMMA 2V3VA 2ZT8A 4X0EA 1R4AA 2C7VA 5DBIA 4CBVA 1IN1A 3VRHA 4JJFA 3OTWA 1YS2X 1H0KA 1NN3A 2BEUB 2E1PA 3UH1A 1MA3A 1BGVA 4TS4A 4ZI7F 4HUJA 1HL7A 2RGWA 2H4YA 1OA0A 3W77A 2X5OA 2A5DA 2HSDA 4QJBA 3CSDA 3Q6IA 3MAAC 2CLKB 4XQCA 2AMFA 7ADHA 1N0HA 1PV4A 1N7GA 3PDHA 1QHSA 4N40A 4C3OB 4NF2A 4OATA 2VT3A 3RSSA 3V2UA 4CEJB 3HCEA 4LDRA 5KTSA 2BN4A 2WWXA 3UMRA 4YLGA 1DWUA 3OCUA 5CVCA 4YP7A 1HORA 2I2WA 1DHRA 2A1TR 1YE3A 2RHWA 3DCNA 1U9IA 3DD1A 3H4VA 3Q9SA 3TI9A 4CKWB 5LPNA 4I7EA 2EGGA 4LAFA 3R7WA 3C4JA 4JVMA 5IZCC 3ANTA 4WCVA 1XDSA 3GT7A 1AB5A 1RI1A 1JKFA 4MYCA 2HU5A 3RHSA 4GZLA 1ND6A 3RROA 1BE1A 2BGNA 1DDIA 3K92A 4HLQB 2DQSA 2DT5A 3SICE 4ML3A 1UODA 1NXWA 1U2DA 2QX6A 4YXWA 2XQFA 5F1PA 5CPBA 4AZ0A 2BD0A 1U98A 3C8ZA 2WP0A 4IJKA 4LEIA 5EJ5A 1MT3A 2IEAA 1UZLA 4EPWA 2WIGA 4A0SA 4NK4A 2ZSBA 1IRIA 1GEGA 3BILA 1NVAA 3N2YA 2V74B 3GYBA 5DNDA 4O5OA 3NTXA 3TQTA 1JGTA 1KRHA 1T0HB 3ILXA 4DKXA 1MC8A 3DS8A 3SQOA 1U5BB 3L6CA 3OPMA 1XEXA 5ECWA 2Y9PB 3BJMA 3LGAA 2IY8A 4ALNA 2VKTA 4R2JA 3R0JA 1VM6A 5BQOA 4UTVA 3I53A 3HN6A 3R7WB 3VTFA 2HF7A 1E61A 3GLHB 3D7MA 4EBBA 3FR7A 1X1TA 1E1NA 1WCWA 3RUHA 2P4UA 4LOHA 4AUNA 4BJ1A 3KL2A 1SAYA 2HWYA 2H17A 3PNOA 4XLLA 4XUDA 5LXTB 4NMWA 5ALDA 2J87A 2VEDA 3HP4A 3OC6A 4L0DA 2VJOA 5GTDA 4CYMA 2DHQA 3GRUA 4MKGA 3U19A 2Q2NA 3ORYA 1JR2A 1W48A 2QUIA 1JHQA 2G7MC 1Y8RB 4YAEA 5KWIA 2FRXA 5FR2A 3TZQA 2JKYA 3NVMB 3ZWWA 2EBWA 4U2CA 5DX0A 4D45A 3WWEA 3SGLA 1OKKD 3OUTA 5EUMA 4A8PA 1UM9A 3PR1A 4MH0R 2QE7A 1C7QA 1QZUA 5JTUA 3GLHA 2ZTLA 4R1TA 3L4EA 3KIPA 4L5IA 4EMTA 1HNNA 1A8SA 3CR3C 2PX2A 4JLSA 3TZEA 3W5BA 2ZYHA 3OM0A 1NPTO 1T5OA 3HKEB 5EPEA 3P71T 4LSZA 5GONA 3MRXA 1C8KA 1JFVA 1HFEL 1IUKA 1P5RA 1S7CA 1U7HA 3RWBA 4CM9A 5CEJA 3KLNA 3BZWA 3V1LA 2WUGA 3H99A 4AMVA 1Z4OA 2ZXFA 1QOQB 3PS9A 2I1LA 2Q8QA 3HEAA 4ES6A 5L95A 4G0MA 1I36A 4TTTS 1U7XA 1Z0KA 5KTMA 4MW0A 2HOQA 4ZHQF 3R6LA 1Z3IX 1LK0A 4R9VA 1NT4A 3QP9A 2WFAA 5EQTA 1RRGA 2A0YA 4I9UA 2GERA 4IOJA 5CFMA 1AMOA 3F49S 4H7EA 4DWJA 1E8DA 2ODBA 3BB3A 1VJTA 1L8QA 3OQPA 1Y4AE 3ZVRA 3LNCA 3IBGA 3ZIAD 2GN4A 3B5EA 3PX2A 4LNUA 5EKTA 5JZBA 1CR6A 4IILA 2ESRA 4KJZA 3X44A 1X19A 1YGPA 4WNAB 1CUHA 1P3Y1 4IDGA 3TLCA 2XYPA 4B6PA 5IWCA 8MHTA 2Y1OA 2VPYA 2ZBUA 2CHEA 2FWBA 2W58A 1UC4B 2HT1A 2UKDA 2HYIC 3IURA 1WSWA 4JB0A 3ZDRA 3OUUA 3M4NA 3FVQA 3GDHA 1SKYB 3NYIA 4MKIA 5BNFA 2H9IA 4LHXA 1ZJWA 4D9BA 3K9CA 3KKQA 4DF3A 2OFOA 2PUJA 1ULHA 1XAGA 1KZYC 4I55A 1E98A 2G1KA 2GAOA 1AJEA 4NARA 3RFFA 1VYTA 3TQIA 4BNYA 1KJNA 3EGIA 1ZL2A 4BCDA 1KYZA 1WBJB 2QD2A 1L7EA 4KOAA 1T9GS 2F43A 3WK5A 5C80A 1FW6A 1K4MA 7REQA 1ZH4A 3T38A 2FR1A 2MJLA 3ROTA 3RC9A 3INRA 4P32A 2IDZA 2PZMA 3LZCA 4BLUA 1XQYA 4NFLA 2WNSA 1HYBA 1PKXA 3VR6H 1NXTA 2YFYA 3C3KA 5EQDA 4DYDA 1JAZA 4V0QA 2CLSA 1ML3A 4EUEA 2BH2A 1H1LB 3ESBA 1LK5A 4MJ7A 5AVVA 2JCBA 4J1TA 3SR0A 3ZV4A 5T4EA 2P6NA 2RH4A 2QGFA 4HAVA 5KNLA 1Z0ZA 2HWUA 2EP5A 3LPDA 4N5NA 1M73E 4B45A 5FUMA 4KH0A 1Z9BA 1UBEA 2HPZA 4IV5A 4J29A 5ICFA 1OXBB 2P7HA 2Z2ZA 2ZS9A 4J49A 3LDAA 1JU9A 1H2FA 4OPMA 4OQZA 4RM2A 3H9UA 3MCWA 3IUSA 2QNRA 5JS1A 4WOCA 4QRIA 1O94D 4TTQA 4NG4A 4OIMA 3A1NA 4XYGA 1Q15A 2Q5EA 3CT6A 3SY8A 4F06A 2H85A 1DG3A 3AG5A 1RPAA 2B1JA 3AYXB 4PZ9A 4PZPA 1P80A 4XYMA 2O3SA 4G5OA 3CZPA 4D0SA 3HDGA 3ZTWA 4BVLA 1Q0TA 2AD5A 2J67A 2A6PA 2A0FA 5IKMA 4XIGS 4A10A 1NR7A 5MN5A 1GTSA 3GELA 4O25A 5MGBA 3PQ7A 5IYZB 3Q7TA 2DLDA 2PUCA 4RK7A 3SYMA 3WQRA 3DDCA 2HDOA 2EC5A 2JA1A 2VJAA 1UK9A 1JHOA 3B38A 1OLSB 4JODA 3FCCA 1JLKA 1W76A 3CEHA 3WLOA 4WZAA 4P7KA 3FROA 5CVJA 2RGUA 4QO7A 1BCSB 2IITA 5A4IS 1JHPA 2X19A 3BHJA 1B6GA 1P6UA 2J3MA 1FC0A 2W6JA 3IT3A 3KOMA 4UUBA 1OT3A 5F7XA 1T4DA 4B84A 1J21A 1KH2A 2J3HA 5JYCA 4WKPA 3ADOA 3OH8A 1N8TA 4TMXA 3ZR4B 3GL9A 4OQNA 3ZI0A 2NTVA 3AKDA 4M83A 3VOAA 5KSWB 3BAFA 5LMZA 2JRLA 2J3EA 3MPUA 4Z9XA 4DUYB 3RABA 4ZVPA 3OWHA 4YAOA 3T61A 5E8JA 1OA1A 3X1ZA 3O7MA 3FTNA 2WV9A 3FNQA 3KSBC 3J7AC 4JLOA 1MJGA 1NNI1 1JHAA 1P0FA 4WAUA 3WGIA 5J2TF 1XSEA 2PS0A 1RDFA 3HCNA 5EQJB 3ZDBA 1N36B 3E70C 4CIBA 3QK7A 3AQIA 1P7ZA 3HY4A 4CLOB 2QL5A 5CP8A 2CYAA 3E84A 4PGFA 2QMHA 3ZJ4A 2IOQA 5AM2A 5C7OO 2H16A 2NU8B 2AOTA 4HV4A 4WV3A 3I45A 1I3MA 2GPAA 3I73A 3ER8A 1YVRA 3HNRA 1JL3A 2I99A 1PWYE 1VIDA 1XMIA 2IE8A 5K8LA 1WX1A 3MSCA 4HZIA 1E3SA 3F71A 4RUKA 3EXIA 4XGNA 1Q1NA 3E81A 3HABA 3K96A 4JI0B 1P45A 3LS2A 3BZUA 1K6JA 1AZLA 1R4ZA 1CS0B 2P5YA 1RJ9B 2Z4SA 3FBGA 3G2MA 3NZEA 3TSZA 5HQJA 2PZFA 5KS2A 5IVIA 1J7KA 2HC9A 2CFRA 1LTQA 2YWCA 1PEDA 3HCAA 1XA4A 4XI9A 4AXBA 1SCIA 2QMQA 4UMFA 4Z9YA 3AU8A 1A76A 1B3RA 3KR2A 1C3OB 3O38A 3Q98A 4UU1A 3TBFA 3MINA 3BFXA 5A6SB 1TO2E 2PX6A 1E3DA 1FMFA 1H5UA 2C2OA 1K88A 4UARA 4XIYA 1TKAA 1KEWA 1WDLA 2QTHA 2OA0A 4OBXA 3KB8A 1WKCA 5E6UA 2FY8A 3GDGA 4M87A 4B4OA 4CTMA 5J4KA 1SKBA 2IHJA 2PKYX 4XARA 2O4UX 1U9YA 1S8OA 3PC4A 3UJHA 2I4NA 4ER0A 1T4CB 3LCJA 4AJLA 3CKKA 4I1OA 1ODKA 1Z82A 2H5LA 3ZHUA 1U28C 1KTVA 2HSEA 4EKDA 1HPLA 3W8FA 3VYVA 4HNAB 3T1OA 4B7XA 1Q0RA 2HAEA 2OLJA 1B76A 5L45A 2Z1NA 4X8HA 4MRRA 5JOQA 3LY5A 5CCDA 1QCDA 3EZ6A 5IRCD 1D0VA 1ZI6A 3PRHA 5BSVA 2E4YA 2HM7A 4QBTA 3A6HA 1ZCZA 4P3KA 2XMSA 3JQ9C 1ULTA 3FYUA 4KO1S 4NDNE 5JD3A 3W05A 3OT4A 1RXUA 2DBQA 2DUNA 1DFIA 3RS5A 5ENVA 4RWEA 4KQGA 2I03A 2QP3A 2VSFA 2YV2A 4HB4A 5HIAA 3FDFA 2FWPA 1H8HD 5JAQA 2MINA 3MGAA 4D02A 4AY6A 4BU0A 4TS1A 2AF3C 5JAPA 3ACBA 3CPSA 3VJLA 1YMUA 4ZRNA 3TRFA 3NM6B 3ICWA 5LQMA 4W5QA 5EP3A 4L15A 2ZRBA 1QIIA 4P33A 1L7MA 1WCYA 1UK8A 3DWGA 3H9GA 2ATIA 4GXNA 3MMPA 4JNKA 3TZHA 1EK0A 1IUOA 3E3MA 3GBPA 3RS8A 2JFFA 4M1QA 1J5PA 1QUFA 5HDQA 1KJIA 4NZ9A 2QAIA 4A4DA 2IVFA 3L8HA 2Y1XA 3RQIA 4YJ3F 2GPTA 2Y1CA 2I6GA 3IP1A 1JTFA 2JGAA 5AT1A 1RSZA 5I5EA 1OXTA 1Z8HA 2IYWA 5J43A 1YIDA 3PX7A 2OO3A 2MOKA 4R81A 3HCWA 4YJDA 1PQUA 1QO7A 1VYUA 3GZTB 3QE2A 3AVQA 4FSXA 1SD1A 3SLRA 2QRKA 1PJSA 1HSZA 1BS1A 1MEOA 1N75A 1XZEA 3ET4A 4HAIA 4XVQA 4YP5A 2BTQB 3WLHA 2PE5A 5B1YA 3ZEIA 3DFFA 5LLTA 2NXJA 3PDUA 2QTNA 1D7OA 2PGXA 4XA8A 1TZKA 4RKEA 2DX7A 3KYCB 4W5OA 3CVJA 1NVKA 2IEBA 5JQGF 3S2YA 2X4LA 3EGEA 1YS6A 1MN6A 3L5KA 3QYPA 1IN5A 4DA9A 3OZRA 3MD9A 1W29A 3RBAA 3UHAA 4RZSA 4ZEMA 1VRCA 2PAAA 5JXGA 4EKIA 1NNEA 3DW3X 1UK7A 1NT2A 3GP5A 4AJEA 3TIFA 5IEJA 1J1IA 4RPGA 1HE3A 1I4OA 1DRKA 1EHIA 1QP0A 1QH9A 3ZLVA 3OTIA 1J4AA 4CRWB 1E6LA 4V38A 3CW8X 4G0XA 2OFFA 5E1OA 3ZGYA 3K35A 4FZ5A 3SK0A 4ZZIA 1XR3A 2IU3A 4RFSB 4BLTA 1THMA 1ONBA 4O8CA 1W25A 3THWA 3B1KA 5AIAA 1KOFA 3SJZA 5IXYA 5M04A 4MYUA 3L06A 2PMBA 3BE8A 2Z3VA 2WAYA 4IIHA 3B8HA 4JC0A 4TLMB 1D1QA 1IC6A 1QWSA 1H9BA 2GHRA 4GM0A 1TA0A 2JGLA 5FPPA 5TQVA 3G8CA 3WTBA 3FYUC 2HU2A 4OM8A 1H1TA 1XJ0A 2P3LA 3SE0A 2ZUVA 3RRYA 5JO0A 4IYRA 2VK4A 2FPXA 3OF2A 3L0OA 1GTMA 1ZVQA 3P9RA 3K2QA 1W85B 4NPHA 3PHBE 5DZSA 5I8PA 1J5XA 1LLFA 3NBUA 1EUQA 3MUFA 2FE1A 5EGNA 3QLEA 2Z1DA 1SVMA 1YJAA 3SKVA 1HZZC 1FLDA 2WVHA 4HADA 3R0XA 2JFGA 1ITZA 4IRUB 4PZYA 2O2ZA 5LC1A 5BUSA 4PW0A 5CA0A 2XB6A 3D5QA 1FSZA 1X38A 2A58A 1E6MA 2FWNA 2OBMA 2VEOA 1K75A 4YWHA 5IARA 1Q21A 1VCHA 2I7TA 2W2XA 2KJQA 4HL6A 4QODA 3TFWA 4BWGA 1OFVA 1NOKA 2HQRA 4PPQA 1T13A 1TT7A 1Z07A 1ISHA 2XA2A 5EYPB 2Q5QA 3HKEA 3UBMA 4RNDB 5CW1A 4B17A 4Q4JB 1A71A 5EJ2A 4LXIA 8GPBA 1AQUA 1ZUHA 1XZKA 3A4LA 3BGVA 1GTG1 3DR5A 1L5NA 1UXIA 1V39A 1CQJB 2EFDB 2ZR9A 1BWSA 1VIVA 4O4IF 2XVZA 4YPOA 2RKOA 4QX6A 2W2TA 5A9TA 1BEZA 3JD2A 4YP9A 3V97A 1H4TA 4AJKA 2ANCA 3LX6A 1RHQA 5HOQA 1ZU5A 2H31A 2Q27A 4K3UA 1RWXA 1B0UA 1ODFA 3I3SR 3MWDB 5E7JA 1YU9A 2FLVA 1J00A 4FHCA 2PQ2A 3ZJ5A 1DCTA 3N70A 3W0LB 3N2ZB 1F6DA 1BMFD 1VBKA 2QRVA 4RPHA 2BRUA 1W36C 3E9ZA 1R3UA 2RJ3A 3UMSA 2GXAA 1QIGA 2VNIA 3SOZA 4XQ0A 4A8HA 3OCZA 5CFOA 2FV8A 3SG0A 3CRQA 1AGXA 4UBOA 3T9DA 3AEQB 3ZZNA 3LQRA 3WGLA 4AO8A 3QVGA 4BE9A 1RYFA 4MUEA 1E1CB 2J0UA 4FMDB 4KN5A 1XKLA 5GY7A 1AX9A 1V3UA 2F1JA 2KI5A 3QLUA 5PGMA 3ZNOA 2IODA 5AXAA 5DLEA 2NYAA 4CM7A 1II8A 2H07A 1U8ZA 3C16C 4UOEA 4UZSA 5IYZA 1Z88A 4QU8A 1G5TA 4YS6A 4HGYA 5JD5A 1ES9A 4IKOA 2D8AA 4PHFA 1DAPA 3S2SA 4IDAA 3ZWVA 3DDNA 5CT4A 1IY0A 3IEPA 4A3SA 2Q45A 3CUVA 2QM7A 4CDMA 2ZIUB 4BN4A 2YJNA 3DO5A 2I9KA 4LF9B 3CNNA 5G0WA 4KQHA 3S29A 5HKAA 2GBIA 3PFIA 4EHHA 2CXXA 2WHEA 4NCBA 4TT8A 5AXBA 1XT6A 4OGWA 1AT1A 2EJVA 3BSYA 1GZ5A 5F2EA 1GDDA 1CQZA 4FHGA 3ZH9B 1K7CA 1YT5A 1VJCA 2GSWA 2YWXA 1V1JA 4YRNA 5EEHA 5HTKA 3RE1A 1Z06A 4JVSB 1T36A 5KPDA 4KVGA 4N0QA 2UUPA 1Z56C 2WILA 4I2NA 2AFRA 3FMVA 3UENA 4ZYYA 1JHRA 2R6HA 3RREA 1NAIA 2NPOA 3P7MA 1QH8B 2BMEA 1T9DA 3TQSA 4A2QA 3QX3A 1BEUB 1GDHA 4ZZ3A 3K1JA 3G9ZA 2AD1A 1VMIA 1VE6A 1KERA 2JFNA 3IAHA 3JQ7A 2MR6A 2KM1A 4BYMA 3ZW8A 3QLVA 1MNQA 2OM6A 2PWYA 4PIPA 2EG5A 1O0CA 3SIWA 1NJ2A 5JAIA 2A0UA 3K4PA 5LLSA 4EHBA 2Q1WA 4PGHA 4IIEA 4DLZA 2JAPA 4AFNA 3KQKA 3UVEA 5K3AA 4TKMA 1LB1B 1DOZA 1FMTA 2VDLB 2I2CA 4R16A 5JQGB 1FU7A 1I10A 4MRMB 5ALRA 1DXHA 1F8XA 1TM4E 1WMSA 2UZ1A 1QB8A 2WJYA 2EZUA 3F8WA 3FVRA 4GMGA 5C8VA 2VPQA 1T5IA 2QMYA 2JVJA 2FX2A 4YJFB 5I4KA 1T3GA 3WMFA 2ZRDA 3HY3A 4IGEA 1OE0A 2G4VA 4LYGA 3VKVA 2WV7A 1F2UB 3PZBA 4IFEA 4U9IS 3TTTA 2GPYA 2HEGA 4Z8XA 3H17A 4U4AA 1VLQA 3ETCA 2XWJI 1MPTA 3QBVA 3UK7A 3WK9A 4PQFA 4RVSA 2FX3A 1LJUA 2ZIWB 3L82B 2FFBA 3ANNA 2F3PA 3BRCA 3Q7SA 2KQUA 4TV8F 5LZ8A 1PKEA 1Y6FA 3OMWA 1UAAA 5JTTA 3QVXA 3EXHA 3GAZA 4RF2A 4DXAA 1JPNA 4TYWA 3BMNA 2MIIA 2R1TB 4BJ6A 1XRPA 4YUAA 1D03A 4G0PA 3PPXA 4AY4A 4YMLA 4OSEA 3FWHA 1G3IA 3NTRA 3P5SA 1IJBA 3DTVB 4FGSA 4O4IB 4NAHA 3C5CA 4NENA 4TTAA 1HXHA 1GUZA 3HA5A 3IILA 4W5HA 1EFPB 1YQWA 3PXCX 3RRMA 3GVCA 5G3ZA 1IVSA 4DDUA 3G7NA 1LZLA 1UMBA 1DTWB 4PG7A 4S2UA 5A3JA 2PU5A 5DBGA 5HKBA 2Y1DA 5JH7B 1W1UA 3DXXA 4URXR 1KWGA 2FPWA 3KVRA 3OZTA 1SOMA 4WUVA 3ZH2A 1BYIA 3LP5A 4PIMA 2I3ZA 1E3QA 1E9SA 1DQRA 5ES4B 1Y82A 2WDZA 1I1QB 5YASA 2G28A 4KFRA 1MRSA 3C4VA 3LRTA 1BSVA 4PN3A 1H2BA 2H4ZA 3GMIA 4B3JA 4RVOA 3PCTA 3WNQA 1XXHB 1O03A 1YOVB 4CI9A 1H2HA 1X1RA 1NZJA 1Y6RA 1YASA 4DWVA 4PY2A 3C15C 2QRGA 2G6BA 1IZ0A 3GPIA 4OOFA 4B6FA 1E62A 4DL9A 2D3TA 5A5GA 3HYNA 5JSZA 2GKGA 4X64B 3RD5A 4ZJPA 1IJEA 2MHCA 3HJAA 1NHGA 4EG7A 1OZAA 2M6RA 3RARA 5EWJB 2V0CA 4J8PA 1IXKA 2BF7A 4FBLA 4K46A 4N49A 3V9PA 4EY5A 4PLWA 2DBVO 1RYBA 1XD2A 3MBOA 1XRJA 2YHUA 4L8GA 1J49A 1NM5A 2POCA 4C04A 5A4FS 1F1BA 1OJ7A 4D57A 2WZBA 1C1YA 1J70A 5JDCA 4E22A 2ALJA 4YR9A 1GXSA 1B4DA 2ZRKA 2AYXA 1PK8A 3NLLA 4NVRA 1SUDA 2XEXA 2XUGA 3E15A 1H9AA 2QRMA 2HF8A 3EEBA 4TXLA 1UXKA 1E2BA 4K9SA 4DS3A 4QLAA 1Q7RA 3AUKA 4AZ3B 5LZ5A 1SULA 3OQHA 2XKKA 1LNSA 2YY5A 4ID3A 2I5PO 5BOSB 5LJLA 1SXPA 2NUAA 5EXSA 2B1IA 3QVSA 4LHYA 3MD0A 5JPDA 2BFOA 4QU5A 1T15A 3NU1A 4I3FA 2RKWA 2QV7A 3L7AA 4EW6A 2J9FA 3WKCA 1U9IC 4G2TA 5JADA 2KWIA 1HA3A 3A32A 1IM5A 2C8JA 1P75A 1SUFA 3BERA 4OP2A 1HNZB 3FKJA 3GMDA 1JTEA 1QU2A 4ZQBA 4RMNA 2ZZMA 3WLLA 4AKHA 4RJIA 1EUDB 3B20A 2PAFA 2WRZA 3OBBA 5EIWA 1O58A 1WUJS 2CUTA 2OHIA 2ZKLA 4LVUA 3K0BA 2OV2A 1A9RA 1HOTA 2EW8A 4GPEA 4JT4A 3BH7A 3CH4B 3JW8A 4K2AA 4KSCA 3BRWA 3WQHA 2FPGB 3KE8A 4EGFA 4J03A 2NUBA 5GONF 2HNAA 4WBNA 3JQBA 5KOJB 4GDMA 1KY5A 1QF7A 4FNAA 3SDBA 2W2KA 2VAPA 2D2EA 3NFRA 1J25A 1MVNA 5CX4A 5BP7A 1C7FA 1UT6A 3GT4A 2C2MA 3PNVA 4UHEA 1N1EA 1IU9A 5FOSA 1Z12A 1NYTA 2QNIA 3E3NA 1S3GA 1O9BA 2Z5VA 1ODSA 3VVMA 2O2GA 2PEYA 4CUKA 4HGZA 1MGPA 2PL5A 4RENA 1SKYE 2WD7A 1IE3A 3RC1A 3TSYA 5HJ5A 3ERCA 3JVDA 1R0LA 1V2HE 2Z2XA 5FPHA 4FS8A 1UJ4A 2J5QA 2G0AA 1D4FA 2BKAA 4MUBA 1U8AA 1VCIA 4MUXA 4TT3A 4W1PA 4FYKA 3V8NA 4W5RA 2C8VA 3DOEA 3AHCA 5L53A 1UBOS 2JZCA 4P92A 3O91A 3NIFB 1PV2A 2RFLA 1ESZA 3QU9A 4IIJA 1ECJA 1YL7A 2Z2JA 2RGCA 1WXEA 1E2QA 2YZKA 4JC4A 3L07A 2WJIA 4ZAGA 1JECA 3VU1A 3DF7A 5ERGB 2WEKA 4O1MA 1R27A 3O3NB 3ZDDA 1I7PA 5FCDA 4BMDA 1J9EA 3CT4A 3ZUGA 1M8KA 1C1XA 1L5ZA 1Z0DA 4MV9A 4U8GA 1F3LA 5IANA 2AN1A 1BS2A 1J99A 2QRPA 1RZ3A 2V5AA 4Z7QB 4X62B 3D8NA 4HAZA 3LCVB 5LCXA 2F1KA 1ZHFA 1Z6AA 3EZ9A 1U80A 2FPIB 1YS1X 2FSHA 3D0QA 3NXKA 2VJDA 2HMYB 1BFUA 3FGZA 4P4TA 5KSZA 4L0MA 2X8JB 1WB9A 4ZXFA 1ECBA 2XDQA 1GZ3A 3SMQA 4H2DA 4BDSA 2AI2A 2QZ4A 1PYGA 3DKRA 5AVRA 1C3VA 1LI4A 3CE6A 3OM9A 1DGQA 2GZSA 2DQZA 1CR2A 5JVDA 1J8QA 3H9BA 5EHNA 5DHFA 4P22A 1XYVA 1UL1X 2Q9UA 3VH4A 5BN5A 1G5QA 2HJRA 2Z4RA 5I51A 1B3BA 5J5AA 3UFXB 1Z0SA 1G66A 4NMXB 1YE5A 1BCRA 1C1DA 2WNHA 1QDLB 3EC2A 1TJ5A 4MZXA 4TWZA 2DP4E 2DRIA 4FOPA 1M1NA 2DPGA 3KKOA 3P1JA 3L41A 1N2CE 4GI7A 4CG2A 4LGMA 3G8AA 3VYRB 2EXXA 2C4WA 1E2UA 1DT5A 4TL9A 4Q0MA 5CPFA 1MAVA 1M1ZA 4UCWA 3R3ZA 2O8VA 5AK6A 2W22A 1UBKS 5KINB 2M98A 2AZDA 1VL2A 3L0CA 2LKCA 4GMHA 1H0HA 3BTUA 5IDYA 5IPFA 1CQJA 3GGSA 2DFLA 1TD9A 2QUJA 3KB1A 3OHPA 5JYDA 1ECCA 2ODAA 3MGGA 3PUVA 1Z4LA 5DGDA 4PN7A 3HV2A 4GI2A 5EE0A 4K9LA 1GQYA 2QVGA 3K2IA 4P38A 5TEVA 1M7BA 1YVUA 1EEXB 2WNIA 2C4HA 3C7AA 2AIRA 2BSXA 2AVDA 3CISA 1PEYA 1FMCA 1QLWA 2JCVA 2OESA 3L6RA 1KI4A 1YS4A 2B4QA 2BW0A 2HBYA 3A58B 3DYBA 3H8SA 3KKLA 3KT3A 2C5EA 2F64A 4L5YA 1JFFA 3VI3B 1TF5A 1R6DA 2R1UA 4MB2A 3AJAA 2XADA 5H16A 2J9ZB 3SM9A 4C08A 4JU8A 1IFXA 1E2GA 1N77A 3NRJA 3TQOA 4IJMA 4K8RB 2X6TA 5DMHA 3KZXA 3M3DA 1NC3A 1VA5A 1NVUQ 3GO4A 4AF6A 1PJLA 3UA3A 3RU2A 5DNUA 1LS6A 3DDWA 4RFLA 3DOFA 5K0BA 1OVMA 2H2IA 3Q8KA 3H6KA 2V1UA 2J5BA 3F73A 3HUEA 2XF2A 1C9NA 1SKAA 2G0NA 4HRAA 1O89A 2ENUA 2VRBA 2VWHA 3GCXA 2OO5C 4XM0A 4CT0A 2C4VA 2LKDA 5AIBA 1YOBA 1ZA2A 3DL0A 1L7OA 1NX9A 4I66A 3Q9UA 1W5FA 1ZZGA 2O2HA 2QD1A 2O4CA 2A7QA 4M0PA 2W6MA 5EE9A 5B3AA 1U7PA 4DBVO 1MP0A 1NXOA 4YP0A 4N65A 4EPXA 3UGJA 5KVAA 4BYGA 1YKSA 1YL5A 2Y9MB 2O3UA 2R7MA 3PNKA 4O33A 5TE9A 3VSDA 1NLZA 5A6VA 3O7WA 2BTEA 3NDIA 2O8CB 4JWTA 2D7CA 3HKBB 1JFTA 2VLBA 4O4JF 1R6BX 2PV7A 4X1YB 5H3HA 3LBYA 1U7DA 2PR2A 2XJ9A 3U56A 1HDYA 1DEHA 1V48A 2N3ZA 5HYVA 4RA9A 4ZT7A 4MO9A 2OK8A 3DAYA 4QPJC 3O4VA 1IXYA 1XQVA 5AUOB 1E3WA 2Q4TA 1LBTA 3AEKB 4A0RA 2X8AA 1R0XA 4X3OA 1XWWA 3L7KA 1CF9A 1R50A 3ITEA 2X0KA 3QUBA 5K3EA 1SHZA 1KOJA 3LLUA 4CEHA 1TCAA 2HXGA 2O3QA 2EKBA 2XDYA 3AKYA 3C7KA 3D0OA 3IPYA 4ON9A 4PC6A 4U8HA 4Z4QA 1E2JA 2Z6AA 3NTQA 1PT6A 3IAM1 3PXEA 4FLMA 1QGOA 2R1VB 2GTPA 1Z25A 5IT9A 5K2MA 2P2LA 1ACLA 1FXWA 1BH2A 1D2MA 1J2TA 2YY6A 4ZO4A 2XGSA 2VRCA 3BFJA 3E8SA 4Z0PA 4WINA 1GM5A 3GCDA 2QRUA 4DSZA 3BXPA 4H7JA 1S89A 3T8YA 1V8BA 2Z8YM 1UP4A 3E53A 1NR5A 3QPAA 4I1RA 1ADGA 1H65A 2I71A 1QH1A 3HDQA 2QNBA 1MW8X 5CYOA 2FG5A 4RW0A 1WCIA 4MKRA 5EHGA 5FPSA 4N47A 4L5JA 1JDSA 3WFJA 5C53B 1EUDA 1Q1GA 3DMFA 5B12A 4GYJA 2O2IA 2VA8A 4G5HA 2WTNA 4HGOA 5CD1A 5HW0A 4N82A 3UFBA 1F8FA 2C7BA 1AKVA 1XLUA 3PI7A 2OG1A 1S2MA 1BN6A 2DLNA 3UJDA 1OXVA 1O5IA 1LPNA 2O2YA 2ZI6A 4MMXB 5EJIA 3BXZA 1KVRA 4JSYA 4LZNA 3BJZA 4YECA 2WJGA 4FI3F 3UANA 3LLMA 1JR3E 2B4AA 4Q9AA 4BIMA 3EXAA 4G8CA 1B93A 2UAGA 3HY6A 4JITA 4DBZA 2CLCX 4JT8A 3EX7C 3CS3A 1I7SB 4PO8A 1M1YA 1U2ZA 1UJCA 1FW8A 2XNHA 5JHHB 3A3OA 4UHCA 4XGIA 4QIHA 3TL3A 1F7UA 2X7JA 5ISMA 3F46A 4ZCPA 4LY6A 4GEGA 1H66A 3MNFA 4MRSA 2CVHA 3QPVA 2DFVA 1GVNB 1EVJA 4JJ8A 2WINI 1D2EA 1SXJB 2FU5C 3IHWA 4ALIA 1U6IA 1YZKA 3B3JA 1KHHA 3F4BA 3D4NA 4MAFA 1DNPA 1WXWA 1YBMA 2I2BA 1C1HA 1NF3A 2J85A 2QSZA 3FKSA 4MRPA 4BDTA 4PXSA 4RVDA 1Z39A 2UZ0A 4FDUA 1P60A 1VL6A 2COUA 2IUFA 3LLSA 1CSEE 1NLUA 4QTTB 1JR4A 2FWIA 3DOCA 3DT8A 5JSUA 4M1WA 3OZCA 3QLJA 1BVUA 1JIIA 1N7IA 2CXHA 1QK3A 4EA7A 3II6X 4DMFA 4PX9A 1U3GA 3ZYZA 4FX2A 2Q6KA 2R8EA 3PJEA 4E12A 1BWQA 2ZAOA 2VBCA 2B21A 1NUAA 3IR5A 4RIEA 1QHXA 2OORA 2QXTA 2SBTA 4FNMA 1J2JA 4II7A 1GQRA 2HV8A 2VTVA 4C0HA 4YP6A 1WSAA 1E2LA 3PUWA 4HQ0A 1LEHA 3SFZA 3WGKA 3AUAA 1WLSA 3MBKA 3VBCA 3PUKA 4EUFA 1EWVA 3FN4A 3PUXA 3UJ6A 3W3AD 4IFTA 3G02A 3KD2A 5ESWA 2RG7A 2P2CA 3PE3A 5KKAA 3SBXA 5A9SB 1U3FA 2RAFA 1V2GA 3TJZA 1R4MA 2CNOA 2Q1TA 2H7XA 5AXDA 3WR5A 1A9PA 4D9CA 4EB6B 2OLEA 4ZZ0A 4RYDA 5E1DA 3FZNA 5CFRA 2B3DA 3D6MA 3JPYA 2HX1A 2DH5A 2W11A 3WQQA 4JYAB 2V3CC 3ZZMA 3U3JA 2BGUA 3H1AA 4I4TB 1C14A 3BIXA 3DZJA 3ZGVA 4EUSA 5AJZA 1GL3A 1EUYA 5LKAA 4JAVC 3ZG6A 3FW1A 2C4UA 1WMBA 5ERXA 2IIPA 1CLUA 1H8HA 3IA7A 4C30A 3N8DA 3M9LA 4IHKA 4MQ5A 2IXGA 3ZVLA 5LBTA 1KIMA 1MRNA 4NPCA 4Q7EA 1U0FA 3W6ZA 3SQXA 1AGRA 1D2RA 3KT8A 1K92A 4KBYA 2PMDA 4YT4A 3LYHA 4V39A 3JWJA 4O6VA 4W8GA 2CZGA 4PQYA 1YVEI 2I4IA 2P2YA 2IWRA 5HDBB 2GMWA 4Q9LA 3SQNA 2CVZA 3TGPA 3F97A 4ZA2A 2VDUE 2OV4A 1KI9A 4QUBA 2IHNA 1X7WB 2P69A 3DG9A 2AG8A 3TB4A 4ER3A 2AJ8A 1EFUA 2PLWA 4ZZ2A 3SHQA 3TPCA 1RAAA 2QAGA 4AJIA 5I3ZA 3I1FA 5AI9A 4Y2SA 4ZAVA 5L7YA 4M1TA 2ODQA 3NJRA 4P7FA 3WHPA 4AP5A 1R0BA 1P2BA 3QLVC 1SU8A 1E3EA 1WL8A 3T0GA 1OQAA 2ZTUA 3NC0C 4YX9A 3H0CA 1Z5VA 4GQAA 1RQRA 2DG2A 4KXWA 2HMAA 3JX9A 4R2XA 3HVRA 3N2NA 3HC7A 3QMPA 3FFBA 1PT8A 1QC5B 1RPTA 2X8LA 3DVAB 5ALXA 1KE2A 5H02A 3SLKA 5H4GA 4X54A 1B26A 2XH8A 1KSHA 4Q9IA 2FZWA 3MJSA 1M0EA 1FZQA 1PCXA 1YDEA 3DEAA 4ZU6X 1MT0A 1YZFA 3FFXA 2DTDA 3VHRA 4DRZA 5A62A 3BMCB 2O6HA 4GXTA 2Y1EA 1F60A 5GOZA 5J47A 4R69A 3T0FA 1WCXA 3ZVMA 1QP8A 2JI9A 1M75A 2C5HA 2AN5A 3AILA 4L73A 3RYFA 1UJNA 4AZTA 1DE0A 4BL5A 1GADO 1O77A 3CNEA 4HBGA 4P31A 4WSOA 4N5IX 3Q1LA 1Z5ZA 4BQFA 4OAOA 2R5NA 4PYNA 4D4JA 3RLFA 4FJ1A 3W2EA 3R3HA 3TDKA 3HUDA 4I4LA 5DIFA 1RXWA 1Q5PA 1YB2A 3AUXA 5FRDA 5SYAA 1C9KA 2OR3A 2NMVA 1EH5A 1VIMA 5C0OE 1ZK4A 1A9XB 5DI3B 4E2FA 3O5AA 1JG7A 1JB9A 5KYWB 4X94A 1ORVA 4KRXA 4LRTB 3H7AA 4HAWA 5AW3A 3QBDA 4QJ5A 4G1FA 2DZDA 2F00A 5JEEA 1NLMA 3TKAA 4Z54A 1RI2A 4FFBA 1U65A 3ZJYA 2BI4A 3H5RA 3KXIA 1U0NA 4H1VA 2C84A 4PCVA 1JJAA 2VP6A 3O8OB 4D9FA 1JFFB 3GFFA 5EP1A 2CNNA 4L4YA 4B43A 4FDVA 1JZTA 4BNTA 1Q0SA 2GD2A 5B2EA 1ABBA 3SEZA 1G20B 1BRMA 1JMVA 3EDMA 3R6GA 1EJ2A 1K9VF 4B4VA 2ZYWX 2BMDA 4MMZB 4S1NA 4WN9A 1PR2A 1LSJA 2GEKA 2VJCA 4P98A 3JQFA 2Y66A 2NOAA 2B99A 3R6DA 3UTDA 1JEAA 1T1IA 1BX3A 4RJKA 3JAKA 1GUAA 1OLOA 3JD3A 4UNNA 2RSLA 2GJ4A 3MGCA 2VOEA 1WLYA 2JLRA 4QAQA 3V1KA 1W5EA 4BJ3A 5DWQA 4RHTA 1JNYA 1GU7A 1IMOA 1RVDA 2SECE 1CEXA 1DZ3A 3KKZA 3Q7EA 1KJZA 3GI1A 1PG0A 1QHIA 1X1SA 4F5DA 3P4XA 2G36A 1CVIA 4XUCA 4D98A 2ZRFA 1PJ3A 1WM1A 3FYSA 3OOSA 3GLTA 3NJ8A 4JFRA 4UDXX 2OK7A 2JDIA 4NV3A 5K8TA 2H4JA 1H3FA 1VOTA 2QJFA 4BMZA 3RIEA 3VNVA 4PRLA 1CULC 3VR3D 3L43A 4R0VA 1Z6QA 3R74A 2JS7A 5DLPA 4N18A 3H9EO 1PL7A 1X7DA 3HDJA 3MINB 1GNRA 4NEGA 4Q1FA 4B3GA 5T8KA 1Q7TA 3T4PA 1KFCB 4AL4A 1RPJA 4PM4A 3PEUA 1SURA 1C50A 1R0ZA 2ZG6A 3HDVA 5CEFA 1RW4A 2E18A 1TZ2A 1N2JA 3EH2A 2JD0A 4B75A 3OOWA 1G0NA 4RHYA 3W1VA 1ADJA 1V8DA 3RYIB 1JLMA 5M34A 4FEAA 5BV8A 1YU6A 3CNLA 4MVJM 4X20A 4ZVTA 4EHIA 4HDSA 5KQLA 1FFGA 2CK3A 2CXPA 3IIKA 5FOXA 3UAYA 1QV6A 3EGDB 5ER9A 4GLFA 3HMQA 1CUDA 3H8VA 2PO7A 4QUHA 3TIXB 1XZQA 4LNHA 5SY6A 3S2FA 4YT2A 1M1YE 3U09A 3EEIA 2NZUG 2AOTB 5ADHA 2OB1A 1P33A 1OIVA 1PX2A 2W2QA 3A1WA 3A8TA 4OH1A 4PTLA 3FNGA 2R7NA 4Y9TA 4W1RA 1UP7A 1RM5A 1DKUA 2PXXA 1E1KA 4Q7MB 3IO3A 4V0SA 3IXMA 3K9QO 1NG1A 2XZOA 3QBTA 1K08A 1E94E 4QT4A 5JFGA 2R7KA 4II3A 1YR8A 4BLVA 2BONA 4HSGA 4EFMA 3ZDCA 2EGUA 4Z2YA 1L5HB 3T4UA 2AJCA 2D2XA 2ZIAA 3DKKA 3WLPA 4QKQA 3KAJA 4ZDJA 5HQTA 1DO2A 2VNSA 2OFXA 1AMUA 5I7AA 3HRIA 4IS3A 4BLQA 1J2EA 4RX1A 5CT9A 2IPLA 5I9IA 2GD1O 4EO9A 1UJMA 4CW7A 3EG5A 4AWAA 4D44A 2P67A 3H4IA 3H5LA 2HSGA 1T91A 4FP9A 2VDWA 4IQFA 1XRQA 1L3BA 3UQYS 4ZGBA 1XVIA 5IF9A 4RK4A 4O08A 4FOTA 1SIUA 3WHIA 1C29B 4UEQA 3GFOA 4A8TA 4Q4LA 1UZMA 3GNQA 5DSTA 4OP1A 3TZKA 4KQIA 3ZBUA 4S04A 1F1JA 2ZTMA 4E2WA 3KZMA 1UFQA 3O93A 5K8JB 4FE3A 3I6ZA 4ZQFA 4HVCA 2HRCA 1ISGA 4N4AA 1E32A 2CN1A 4NYIR 1T43A 1Z7WA 2CMKA 1CYDA 2PPLA 3KSMA 3Q3GE 3JQCA 2GS9A 2NSJA 2C4NA 1K89A 1E4VA 1CRPA 5KJCA 4W7HA 3GDWA 4F1JA 4LMRA 1L2TA 5KX5A 3X2FA 1FL9A 3C4QA 4J0FA 3VR3A 4D3DA 5K0ZA 4G23A 4GM1A 3IPLA 5EKUA 2Z95A 1N8SA 2WD9A 1Z5OA 3EYAA 3HV0A 4N5DA 4ZDWA 4DV6B 4D0NA 1MB3A 2X4DA 3DP9A 4D81A 1K2VN 1XTBA 2AI1A 1MHTA 3CZ5A 4FFNA 2QN8A 3HCBA 3IP9A 4Q1VA 3VHXA 4WVLA 4ZIRB 5LVAA 5DM2A 3H1TA 5F2OA 2RCNA 2HQ1A 1OTYA 2GCNA 3H6HA 2IW3A 4J4HA 3GPBA 1NASA 1RZVA 3M83A 3H65A 5CITA 3DTVA 4G0WA 4GWGA 2CF6A 5KIAA 1HZJA 1ZISA 4FWIB 2Q3MA 2D0IA 2PQMA 2O0LA 4DSTA 5I7SA 4GGPA 4ID9A 2WVJA 2J0VA 3ANSA 1SNYA 5I7FA 2GO1A 3M5WA 1IOZA 4KXFB 1F2DA 5E1BA 1MFPA 1YSCA 4OFWA 3VYSB 1W93A 3B5JA 3V5NA 4ZJYA 4G97A 1VIAA 2Q3FA 6REQB 4HDCA 1YJQA 1XWFA 4R4JA 5EEGA 2ZB7A 3D4BA 1BMTA 4UNQA 2JIBA 3CF6R 3RIGA 1COZA 3WRWA 5IMBA 6LDHA 3PLAE 2FW8A 1FFDA 1QTRA 1TQ4A 1ZMOA 3FHCB 1P29A 4RAOA 3QUTA 5DNWA 2WVAA 1HM5A 1OBVA 1W4RA 2ONCA 4FDAA 3GC6A 5FP0A 4EPVA 2AH5A 1AQYA 1V16A 2NAFA 2FRDC 2VHQA 3PEFA 4KK3A 5JMTA 4UEJA 4DEVA 4JLKA 2D2IA 1PUIA 4JIMA 4IZ6A 4UJ3A 3VO2A 3TLBA 3FBTA 5KWSA 2WSSD 3LQYA 2HU7A 3KPWA 1M9NA 3K6JA 1D0IA 3Q3VA 1VTKA 4G89A 3DPUA 4ND5A 4CG0A 4Q1EA 3T7RA 3RM3A 1KGDA 3WYEA 1XCMA 4NABA 5CFPA 3TO5A 2PIAA 3ENNA 3SQWA 1MABB 1WVMA 1Y1RA 4F3KA 3V7UA 1UMDA 1BHQ1 3A6GA 4YJGA 1TD1A 1J39A 5A3SA 3VJMA 4CV0A 5FI5A 4GGMX 1KNXA 1E2KA 2I3GA 2V45A 3QE0A 3RU7A 4CF3A 2OAEA 1EKXA 3K73O 1YH3A 2P7IA 1CJTC 1NV9A 4OGFA 2PUEA 2AJTA 2BFAA 1WDMA 2D1TA 2QTBA 3ELWA 4IDHA 4S0XA 3CRMA 4XUGB 5CNMA 3DZCA 4KMSA 4K9NA 2Q4BA 3O2SB 4Q34A 1P5JA 1EX1A 4F5YA 2PRIA 2QE6A 3D4LA 4XVHA 1HKHA 3M2PA 1JSRA 1EFPA 1ZOSA 1ACMA 3NKVA 2C3UA 2QLMA 2ZT7A 4NI5A 5BNIA 2P6RA 3UWKA 1PVDA 4RE5A 2P9QA 4NSNA 4YMWA 5TMPA 2NZ2A 1V71A 1WB4A 4KXXA 4D8VA 2X6RA 3FNFA 3F96A 4P82A 1MB0A 5CCEA 1SUCA 5SZKB 3UMGA 3KOZA 3GHYA 3OIFA 3DBRA 1QV9A 2Y76A 3L0SA 4REQA 5E4JA 5T67A 3ZHVA 2JVIA 1GTZA 3IEUA 2QE7D 3HSKA 3NYWA 1Q3TA 2ES4A 5IXSA 4AY2A 4K0RA 1SHKA 3LGXA 5CXXA 1X92A 3VFDA 3H75A 2JIDA 2YV4A 2H65A 2C94A 3KR1A 1C3LA 1Q0PA 1ZA1A 4M36A 2F8TA 4PLGA 2GHTA 4IIVA 1R6TA 5T5QA 1LSOA 1QIMA 4GG1A 4X65B 1NE7A 4UEWA 4YCCA 4YRGA 4HDNA 4LZAA 1KP9A 4EAAA 2MU1A 1VHTA 3PWZA 5E7IA 4LYEA 3GN1A 1V3VA 4KO2S 4Y7DA 3R76A 3RNLA 2IPNA 3RVOA 5JNVA 1L7DA 1ESDA 3KCNA 1E2NA 3TW0A 1HE2A 2W42A 4X3CA 4OQ4A 3N8NA 2JIRA 1P4GA 2YTZA 4HAYA 5FWYA 2FG7C 1XD2B 1R8SA 2NZ8A 4JELA 4GMFA 1DWQA 4WBSA 4EHNA 3WSVA 1YRBA 3LX8A 3HL4A 2BDTA 3U9TA 1XEWY 1J2UA 3N0VA 4KIUA 1NRIA 1JXQA 1G98A 1ORDA 1UJ6A 2NNLD 3CA8A 2WJ4A 1A4IA 1UBSB 1QF6A 3EXEA 4YROA 1X9IA 4CIDA 2GVZC 5HFNA 2MYPA 1B73A 3G3EA 5B1IA 4ZJUA 1Y37A 3TPZA 5JRDS 2BCGY 4URHA 3KFXA 3M7IA 4I9FA 4M0MA 1VSTA 4D8YA 1E9RA 3ONFA 1BDJA 5U9CA 3GRYA 4IRMA 1ZGBA 2GVNA 3N0XA 4EY7A 1A1SA 1UFOA 3DE0X 2BGGA 1RQLA 5COBA 1YDGA 2NVWA 2VYCA 4KQMA 1E1RD 2B34A 3CX3A 4MEBA 5KNDA 1ZO8A 4OHXA 1GL9B 1ZI9A 1FDRA 5CUQA 4F38A 3O1LA 3WA6A 4H7HA 4FC6A 1A9SA 2V7GA 4Y2QA 4EKEA 5CB4F 5ADVA 3H3FA 4BVEA 2WFZA 4C0WA 4QLBA 3I6MA 3QXSA 4O2BF 3ND7A 1TFUA 4ZHQA 3K1AB 2XUZA 2FUEA 3F6RA 4D4HA 5HM8A 1U2QA 4R1PA 1DFHA 2WUFA 1XZIA 1II8B 2Z3ZA 4XX0B 3JZIA 1U8XX 3DOJA 1XQWA 1IPHA 1TAGA 3OOHA 5EHXA 1DB3A 5I9MA 4G86A 1EUZA 3LBNA 1GGJA 1R5NA 2AK3A 2GZRA 3NTOA 3TKLA 4Q7JB 4J0CA 2W43A 2RAVA 4WIAA 4R68A 3OP4A 5JAHA 4JU9A 1IRXA 2QF7A 2O8FA 2ZB8A 3FPSA 2P8SA 1OAOA 1OMOA 1EYZA 4U2EA 4BXOB 3HO6A 1L5WA 2CYBA 2XMRA 4L75A 1EQ2A 3ZNPA 2N46A 4O2AA 2KB0A 2ZBQA 3UAWA 1TCVA 2R2GA 2RHBA 2XUAA 4LZWA 5EXPA 5BVGA 4NCKA 1EM8A 1MNAA 2H2WA 4ZI2A 4RF5A 1OBCA 4N3BA 4Z53A 4Y2VA 5HK8A 4YWJA 1BC5A 1ZMXA 4KKXB 2JBAA 3ZWXA 5FDFA 4JHXA 1XZPA 1EA7A 3C8DA 1AB6A 3E22A 3QFHA 5IMSA 3JCZA 4I5EA 4DSOA 2ZRQA 1NJ5A 3A9UA 4GMXA 1GZ6A 1Y5NA 3JYNA 4DLKA 2V58A 4EX6A 4CLDA 2ZS7A 2CXTA 3T6KA 3R3VA 3L7JA 4L4ZA 3Q4GA 4WI1A 3TI7A 3RVQA 3DE5X 1XZLA 1R8QA 1YR7A 2PKXA 3DH0A 3MTAA 4Z9FA 5DYGA 1E6UA 1BWPA 2FSFA 2Y2VA 1WHTA 2C9OA 4IXMA 1ZICA 4QEZA 1LI5A 2PVSA 1JAXA 3CVXA 2G8LA 3EWIA 2OCXA 4BTLA 1ZVJA 3SNHA 1KI3A 5L3VA 2QT1A 3T52A 4EJSA 2WKQA 4RLQA 3TJRA 4RJJA 1XU7A 2C4MA 2Q9BA 1TM3E 1OJLA 1EFLA 2JH3A 3EXG2 1BE6A 5IP5A 4LQ4A 3L1JA 7MDHA 4HCJA 3BG5A 5JBQA 1K7YA 1E60A 3GT3A 4LMBA 3BL8A 5H8WA 2CVQA 3H4TA 4G3XA 4LK3A 1L4LA 3B1VA 1TM7E 3C3AA 1JS1X 1L5LA 1TYEB 5AJYA 5G0SA 1G5HA 2KMLA 4CMGA 2QD4A 1WKBA 2YNMC 3ABSB 3N0WA 5IC4A 4JI2B 4N1AA 2Q2OA 1U90A 2WYUA 1L3IA 4MR8A 3EGDA 5CLQA 1VKHA 2G9RA 4BFUA 3IULA 4AX8A 2R11A 4A23A 1H0RA 5BUZA 3E82A 1HEUA 1OZHA 3QQPA 2IU4A 3LFHA 2QMUA 4ME6A 4XYLA 1VXOA 1FLAA 3OE7A 1SVUA 3OQBA 3MEQA 1EK6A 1X70A 3TQRA 1QO0D 2ROQA 2VP0A 3G68A 1AV6A 3U80A 1UKBA 1XTKA 3BF8A 1JG3A 3LX5A 5LQJA 4KK4A 5CBPA 4K2HA 4TQ9A 1ZCFA 4KXMA 2P62A 3E61A 3HH8A 3N7TA 1J1ZA 1USGA 4EARA 1RE1A 2JFBA 4EGQA 1CUGA 2JB9A 2B8NA 3JD4A 1CRQA 4D43A 4EF5A 1C2TA 4LK2A 3WLEA 4G36A 2YY7A 1GLNA 2Q5LA 2BHTA 1WMEA 4B73A 5KQPA 3BC1A 1NVMB 2W8ZA 2FPKA 1HQKA 3HZRA 1DO0A 3F1LA 4JR2A 3WGOA 3U7IA 4CKXA 3R24A 3RS9A 1XCJA 1Y5MA 3MJCA 1XNRB 1E2DA 1EA5A 3UMFA 4LHVA 1AGPA 3AFGA 3HVKA 4H77A 5H3CA 3JAMA 3LT5A 2FNAA 3IS3A 4YLYA 1CJKC 3CR8A 3IC5A 4MWBA 3Q87B 3C3CA 2JGKA 1HMPA 3M89A 1XDGA 5MN4A 3TRJA 2AE1A 2AMJA 2AJBA 3A3KA 5JZMA 3AGPA 4KYIB 2VQ6A 3NG1A 4MINA 3JQGB 1FYDA 3EOZA 1I5EA 2JGDA 2BFCA 2OXIA 1RHKA 5JWHA 4IMJB 5K03A 2QX9A 4D92A 5HKKA 1PQPA 2I80A 4OP3A 3MC1A 5C8ZA 1F0YA 3EVEA 2BJWA 1M2KA 3UC5A 1NWCA 2E5WA 4S12A 2UXDB 3GVPA 4CQJA 4ZI5A 4X24A 1N2OA 2Z9DA 3WMEA 1IQPA 1PR5A 1FVOA 2PBFA 4MVJP 4B1FA 4K6MA 1U3DA 2YCBA 2G72A 3ICVA 4W6QA 3AHHA 4YXFA 4GPAA 1IHYA 3EGOA 1ZINA 4MPRA 3QVLA 4FM9A 2IF0A 3NGLA 4LW8A 4ZVUA 1LUAA 4QL3A 2JAOA 5FQOA 4Y1RA 3JAWB 4EFKA 1RXEA 3HYTA 4INZA 5DHAA 4G5QA 3FJ1A 1JLHA 4KWCA 2X2OA 2E4ZA 3CZAA 3IQWA 3IAM6 4PO3X 3JQ8B 3NUQA 4G6ZA 4WXPA 3EHEA 2WFLA 4IZOA 4CL8A 4KQKA 1B6TA 1TUGA 3AJRA 5AYVA 1CLEA 2JCGA 2IHBA 1VA4A 4PFQA 4NXMB 2CCKA 2PA3A 4D8UA 1UBFA 2G80A 3EPKA 4KGVA 5LDGA 2Q5JA 4DQ0A 2ATVA 3HUTA 4QBIA 4CTOA 3Q7RA 3C24A 1KORA 2VZ8A 4LN1A 1QAQA 2XCQA 3RSCA 3TX2A 1A77A 1TVEA 1PNOA 3N74A 4FDMA 1TI7A 4OJMX 2OZVA 2D1SA 4KQCA 1N4AA 1Q6ZA 4W5WA 3WDKA 4MKZA 1EWQA 4C05A 1PJRA 2ZR7A 1E7WA 3DZIA 4ZEWA 1I01A 3RG2A 3X1DA 4QHTA 4B44A 4UQLA 4OKIA 3ZIUA 2HT6A 2NXEA 3A10A 4ASUA 3RASA 1HT3A 5C46F 3NHWA 5F1YA 2A59A 1IVNA 1T5TA 3Q9LA 4GLJA 4C4RA 10MHA 1FBTA 1UT5A 1WD5A 2WHXA 2J09A 4JH0A 2Z5GA 5CBPB 4GBGA 5KO2A 1T0BA 4DIUA 1PYDA 3V4SA 1PNRA 3IVCA 4BO6A 3EE6A 3DDSA 4EM6A 1TT5A 3HB0A 1O6GA 4X00A 3Q3JB 4BNZA 1G3QA 1O5OA 2IDKA 5TB5A 3ZE2B 1WF3A 3A1TA 1L7AA 2HLDA 2PS3A 4GX2A 2EYUA 2PSFA 3CHYA 4PG4A 3ZU5A 4C7XA 1APBA 1MXFA 1ZM9A 1H2ZA 3EZLA 5HKKD 2YICA 2VK2A 5KTNA 3ZJUA 4FFRA 4P3OA 3W6UA 1O6CA 2AB0A 1E59A 3GJ4A 5KWVA 1PUJA 4PZLA 4H4CA 1Q74A 3N39C 4KFSA 4DG8A 5WRFA 2EQBA 5DK6A 1JDZA 3HBLA 1EZ1A 4B47A 3ZEAA 1A2OA 1Q83A 1WCV1 4B9AA 3EC7A 4NKRA 1U6JA 4DNPA 3F4KA 5EE1A 1U94A 3WGYA 9GPBA 3NC4A 1M72A 4Q3OA 4TZKA 2BEVB 1IN7A 3OJLA 3VNUA 1G6OA 1NP7A 4C7MA 1TLTA 2PGLA 3BIJA 2LIVA 3R9IA 1NN0A 3OT5A 3L8DA 3ADPA 4C0XA 2CXUA 2GNAA 4UM8B 5TPWB 5BW5A 3PQCA 5B30A 1P0CA 3EVDA 3FB4A 2GF2A 3LGSA 3DOHA 4M53A 3RJTA 5SZIA 3LE8A 4WOKA 5FTWA 1KRXA 3LQQA 4CF7A 4B74A 1G41A 3CX7A 3PGXA 1OFTA 1K0UA 3QKWA 3LXMA 1DKLA 5A2QA 821PA 5IABA 4DUZB 2HIGA 5J63A 4K1LA 1HDXA 3V1YA 2OHOA 4M37A 1WTAA 5EKSA 2XNCA 2FQ1A 2ZW9A 2WWWA 5AW0A 2Q62A 2WW8A 3DHEA 2QU8A 4ASUD 4AW9A 3AZQA 1WXQA 1PW5A 1YCHA 3OO1A 3I61A 4H6WA 4I19A 4YI5A 1BQEA 4UREA 2CT8A 5H1YA 2WWTA 4YRPA 1MO5A 4LTMA 1OC4A 3FLAA 1J9ZA 2QKYA 1KS2A 2LNDA 4GOLD 4JNCA 4K9RA 4ROSA 1P2VA 2OECA 3A3PA 3QBJA 4AJ2A 1XU9A 2PLFA 1T5LA 2PUAA 3IOMA 2R4QA 4HGQA 5GJVC 2VDVE 1RI3A 3BWDD 3OIUA 1BKYA 1G2QA 2CXRA 1HE8B 4AQ7A 2ZRCA 4OHCA 3ZHTA 1P1BA 3DOUA 1PEKE 4H16A 4MI6A 1G3UA 3HO8A 2HLDD 4Y1EA 5J5CA 1FRZA 2EX0A 5AKLA 4ZKEA 2J3IA 3Q88A 3U62A 3WY9A 4TMZA 5G2OA 5G41A 5JS8A 1U11A 3DMRA 4K9OA 3TW6A 1TTPB 1KR5A 2R96A 1P77A 3BBLA 3VDMA 4O4IA 5CA1A 4RKWA 2I55A 3HDTA 3I4FA 4YCAA 1EVZA 3T0IA 4INOA 5EXXA 3KCQA 3D7RA 4L9RA 4WEOA 4XSGA 1MC5A 1HO3A 5KZMB 3D0RA 4FD3A 3RU9A 4M8KA 2IZ5A 3QX9A 2YJ5A 4ZHQB 2W6PA 5FAXA 2HO5A 3KWJA 4DDHA 5BSHA 3KSAC 2QL6A 2G25A 3OBIA 1SN7A 2ZOSA 5EXDA 2ACKA 4KVAA 1PR9A 4OSOA 2BFFB 4FSDA 4O2BB 3DZFA 1NATA 1TB4A 2DPXA 3N28A 3I6BA 1PWXA 2ATCA 1Q0HA 3V4LA 5TIIA 2QHXA 4ND8B 4YDHB 3IMGA 1RAEA 2EDAA 1T8RA 2XAUA 5AVZA 1ZN2A 4NLLA 5AHOA 4IO0A 1XMSA 2CWWA 3ABQB 4RH3A 1NXSA 2WWIA 5CX1B 1LLDA 1QC5A 4U0KA 3IQIX 3QF4B 1UKAA 4WECA 1P4AA 1P31A 2OAGA 1RLTA 2LTAA 1LRJA 2W2KB 3F5QA 4Z9BA 1S5PA 2ZSUA 4LI3X 1PO7A 4GEKA 4IZHA 1G16A 2C9YA 3WDMA 1P6QA 2YHBA 2J5RA 1R0YA 1T2FA 3NONA 5FTNA 1YDMA 2XWQA 2YJGA 1FFWA 2FW9A 1PTJC 2GJAA 2XE6A 4QT0A 3W1EA 3U7JA 4BUZA 5TV2A 4IH9A 3I9NA 4QHSA 4PYOA 3ZDFA 1DTEA 4LV6A 1CUXA 5BVHB 4US2R 4MYSA 4F45A 1CS4C 1JQEA 3FHLA 2GF9A 2ZROA 3RBXA 4Y0NA 3GFGA 3NFYA 3E3AA 1P4JA 5EWLB 3ZCVA 4D5EA 2HNBA 4R9RA 5BW4A 3ORSA 1JXAA 3A2LA 4RMGA 3ID6C 1NF2A 4GX5A 2W6QA 2FR8A 2POQX 3CRVA 4XJXA 4A8JA 3OJWA 2IX9A 3BE6A 4J0IA 4TPKA 1J8VA 3FUCA 2XD9A 4V02A 4LRWA 2BP7A 2O19A 4HNGA 5DBFA 1MJNA 4G4IA 1N6RA 2JGMA 3BSWA 3E9NA 3UMMA 4MV0A 2GDZA 4UXJA 1QBGA 1QIHA 5DYIA 5BOSA 1PIWA 3ICEA 1N5IA 3MJ4A 3NC1C 4QYMA 3UPTA 3L1IA 1E5QA 2D2VA 5BV2P 4TV9A 3RHFA 4XJVA 3WAKA 1DQSA 3FPHA 3GRKA 4G5YA 4CKCB 1JH9A 1LDNA 2FMIA 2WU0A 3QEJA 4QBGB 2D59A 4U02A 4UM9B 4NS4A 4BO2A 1VQ1A 3EQZA 2N1MA 2P2NA 3IQEA 4LWOA 3CU5A 2O1EA 3BORA 4OOEA 3V3KA 4N9WA 3MQ4A 2IOHA 3QKTA 5I7EA 3FZEA 2R6JA 1ZFNA 1A9OA 2M1XA 3TTYA 4BNVA 4G4SO 3W7AA 3N2KB 2WMDA 3AEYA 3WFZA 4DA0A 3FSJX 2LUOA 4FR5A 5BN3A 1TF2A 4HFNA 3IUQA 3OJCA 5JE8A 1NDQA 2F3RA 2CFSA 2MSLA 2UDPA 5LMCA 2RE8A 3RIMA 1T1SA 2ADOA 2HK6A 1NGSA 2OCDA 3NHRA 4GX1A 2NQ2C 4HNAA 3T5PA 1JQ3A 4XWWA 2DMRA 1SC3A 2ADFA 1Q7EA 4I1SA 2VP5A 3B52X 3NIDB 5CVTA 5LN1A 1B74A 1W6RA 1SG0A 2IPMA 4FOSA 2NGRA 1P2FA 1UDRA 1EK2A 5LP6B 2JF0A 5JG7A 4DOMA 5IC6A 4KXLA 3OZIA 4ENVA 3F9IA 1TMOA 5DCUA 2C98A 3UB4A 1ZX1A 4L07A 1Q7GA 1LU9A 2YFKA 4X91A 4ZO7A 2VUSA 4QPPA 2UUCB 3ZXSA 1U0TA 5A6SA 3QYFA 3TIVA 4BPRA 1H4SA 1EQAA 1H4VB 3CYFA 3I8XA 3KLPX 5D8DA 3QFRA 1GNPA 1P2DA 3ESQA 1EUCB 4D74A 3WLAA 3TW8B 1DBWA 5B6IA 1WUIS 3C5WP 3PKZA 4X44A 5LA6B 4DLRA 3H2GA 5JROA 3HU2A 3K0FA 4HNSA 3KOWA 1KIAA 3WJ1A 1K0FA 2LE0A 2XMBA 5FJJA 3RYTC 3LT2A 4RQAA 1WNFA 2GKSA 3ESZA 3N7UA 5DH9A 2FK7A 4C06A 4NBKA 4HZGA 2FUNB 2OLKA 4NE9A 4CCYB 3UIEA 4B3TB 3W5VA 4EGSA 2QENA 1H5QA 3NR2A 3BFPA 4JB2A 4C21A 4YRBA 3NKFA 4BLPA 5C7YA 4K6CA 4F8JA 1NVDA 2HUNA 3SEAA 4AO6A 4GXQA 4OGLA 1SWVA 4RV5A 1FQKA 2XR1A 3IERA 3WOVA 4RZQA 4WKCA 2E4VA 5HUHA 1IN8A 1CQPA 3DTVD 4XTCS 1Y4ZA 3FOBA 1R4NA 1W8IA 2QROA 3KPVA 5FTKA 4EB0A 2D5CA 3CINA 3ROEA 4YUWA 1RYZA 4DE5A 1NBWB 5K0FA 3QU2A 2DWUA 4PG5A 1L4HA 3P9KA 1KO8A 1AKYA 1OCEA 4MMYB 1R1DA 4F56A 3OFKA 3NT4A 4NC9A 2YUIA 3Q5GA 5CDHA 3R0QA 1W0JA 3ER9A 1A7AA 1HDZA 1NV8A 2AFIE 1JJIA 2WSYB 2PPVA 2X5XA 4C4OA 2BHRA 5ES3A 1JYFA 2IYVA 3B82A 3K6SA 4GNRA 4ESEA 5I7RA 3ORFA 2KYRA 2REQB 4LJYA 5T4BA 4A82A 4MUNA 4BCBA 2IEGA 4OQYA 3RS7A 2IXEA 5HFJA 4H7IA 5FBVB 1GILA 2FVYA 1ZAYA 1V43A 3HHPA 2YXPX 3ECSA 3HRKA 4O0MA 1DT3A 3IUPA 4M9RA 2C5BA 4R3WA 1NI5A 2WSSA 2ZCVA 1QS0A 3LF1A 4OV6B 4X6UA 1AQNA 1MJFA 2W6ZA 2ASEA 3T3IA 5A06A 1I9GA 5LP6A 4Y2UA 3M6FA 1XMVA 2J5KA 4GXRA 2QSYA 2YJ3A 3RCBA 2D74A 2PZ8A 4R1MA 5TPZD 1O0BA 2HHCA 4HI0E 1P0MA 3BVPA 1J0BA 2PYZA 1QPBA 2FSVA 2HO4A 2YIDA 3VX3A 3NDBB 2DEUA 3DXZA 1Z35A 1CC1S 4QICA 4BVFA 3TCNA 1RMQA 2H1LA 1QFXA 1VJ0A 1ORWA 2XMZA 3D2AA 5D3QA 5FOWA 4QGGA 1RWKA 3MFQA 3V8RA 1DC3A 3FTDA 2HJWA 5LB2A 3E58A 4X8MA 5CU7A 4CKYA 3PQ5A 5F3WB 4F4IA 2HMTA 2X3YA 3G5MA 2A9VA 3PPWA 5REQA 1UDBA 3OX3A 1GIAA 3GOHA 2VNAA 1KK2A 1JMYA 1X87A 1H1LA 5AICA 2PR7A 3ROXA 2WYHA 2ZJ4A 5JCZA 4JXXA 1BVHA 1ORHA 3KL4A 4YAKA 4BLRA 4P34A 1FNNA 1V47A 1MQAA 2DHRA 2YC2C 1EP2B 1GLGA 1H1DA 1Q77A 2A14A 3QXJA 3COYA 4KIFA 2PUBA 3DFUA 4PFJA 2C3YA 3E0XA 5KKNB 2PFKA 4G5FA 5AO9A 2BIFA 3L46A 5KHLB 3JWGA 4J0GA 3H84A 4NU5A 2R97A 3ADDA 1UFVA 2NV6A 2VT2A 1ADFA 2E21A 1KBQA 4TWBA 2EAUA 3KALA 1N33B 4IMPA 2C9DA 1PS8A 4BNUA 2NP6A 1JDVA 1O7JA 3KPUA 1UC9A 2CVFA 3B3QA 1VP3A 3VR0A 2WJPA 3A1UA 1VB3A 1SZDA 4IH4A 2ARKA 1M6YA 1U1EA 4G0OA 1BRTA 1PGJA 3BXGA 1FX1A 2NO0A 2WTEA 3AVOA 2Z1MA 3EN0A 2PU7A 4Y9RA 4YJGB 4RM3A 4DBLE 4NTZA 1U28A 1PHRA 4AY5A 2VDNB 4B71A 3MUEA 5CDYA 4N5HX 3MTEA 4RZ3A 3KYCA 2RH9B 3AUJB 2I0FA 4PXYA 3HYSA 3EPLA 2AYYA 2YV3A 1YIAA 1P1RA 1YOVA 4BO1A 1QNLA 3GJQA 1IN4A 4N0EA 2HBQA 4Q6BA 3ELUA 5BV7A 3KZVA 1YBAA 5EA2A 4BU1A 3HJRA 4NBSA 4M1YA 1CHNA 1MG0A 4GHWA 2VQSA 3RADC 3ZVNA 5TPZA 1TLFA 3UAXA 5KOHB 1SPXA 3AONB 5BRAA 3PXAA 3WYFA 1H2RS 2G76A 4JJ7A 1ETHA 1KZ1A 3ZGXA 4CTJA 3ROPA 5L51A 4WY2A 5IT4A 1HYQA 2JLUA 5G1PA 2J32A 1XDZA 3TXAA 1KI6A 4EG1A 3KSUA 4YNBA 1T26A 4QOFA 4ZAXA 2BZ0A 1RRKA 3V80A 3CLRC 1Y4UA 4HMPA 4GLLA 1M2NA 1Q50A 3L7YA 1Z13A 1ZKDA 1KO4A 4XQ9A 3S2ZA 1DJPA 4C6HA 2YHSA 3BX1A 4FXOA 3COJA 3RRBA 4C0LA 1T6XA 1XUOA 5CIWA 3KQLA 4LG1A 4DAOA 2ZVDA 3OCWA 2J48A 4GR5A 3OOEA 1YRYE 1E58A 1K1EA 4C3ZA 4G9EA 1CZNA 1QNFA 2W71A 4R8RA 5FBKA 1I5OA 3PC8A 2MWMA 5JISA 2NLOA 2QZZA 2WLTA 4W6ZA 3AQ4A 1GU0A 3AF1A 3PHGA 1G5FA 3S2UA 2I76A 4ZC8A 4BP9A 4PYKA 2VJBA 3KSRA 4G07A 2TECE 3BPSA 4UUNA 1DCMA 1GAJA 3DJFA 5A3RA 1L7NA 2XGGA 3AF4A 4PVCA 4F71A 1YVDA 3I1IA 1L9KA 1KMCA 1B1AA 3GAMA 1T2AA 3IOEA 4RIIA 3IBYA 5DHTA 4DLYA 2PGNA 3VVBA 5JECA 3OHSX 3C87A 3R4CA 3O26A 1XD8A 1PZXA 1JXMA 4B79A 3HFRA 3P9NA 5CA1F 2ID9A 1MJ5A 3LIIA 1AH2A 3KQWA 4CQLB 4QYWA 1KH3A 1C2YA 1VKOA 1YCFA 1AGNA 4RKQA 4BNGA 5J2TA 3RB8A 1WUHS 3QWAA 4YMSA 4CKBA 4HVTA 3I6IA 3MWDA 3L79A 3HA2A 5EESA 5E4YA 1HNXB 1DDGA 4MX8A 2MTBA 3SD7A 1DRVA 1Q91A 1VZ2A 2YQ5A 4OHYA 1M6VA 1E4EB 3N86A 4ACBA 1CR4A 4OX9Y 1R2QA 1Q1QA 2HZ7A 2C58A 4YRLA 5DBEX 1Y42X 2FETA 2HXYA 2C95A 1ZJ6A 3PRKE 1U81A 4HB2A 1G4AE 2W4MA 1UXOA 1ZUD1 2IIBA 2ZFUA 3ONNA 3QOWA 5HA5A 1CB0A 1TU4A 2UYCA 2WU1A 5GJWC 3V8VA 4L8LA 3F0TA 4A0HA 4R54A 1PL8A 3AKCA 5ICMA 2ZE6A 1GPUA 2FZ4A 3BEDA 1U7WA 1V7CA 2FZ5A 4UU8A 5FUVA 4AG5A 5C37A 3MWYW 5LB4A 4F2DA 2JATA 1TC1A 4YDQA 2JLCA 3OIVA 1AMNA 5B36A 3ZGNA 3QG1A 5DE3A 1DIHA 3DEZA 3AMVA 4Q05A 1G21E 4UE6A 1XQ9A 1GPYA 2PYDA 5GIPE 2YR0A 2XGJA 5ITZB 1Q11A 4C3VA 3FCEA 3KR0A 1NPYA 4LXXA 3UNXA 4OLBA 1Z45A 2B4RO 1JJFA 2YYAA 3IVGA 4DWOA 3DWEX 2OCYC 2PBLA 3MWGA 4N0MA 4UFOA 1SHUX 3PX3A 4IGKA 4JJGA 1L7RA 1D2AA 2GYWA 3DUFB 4MP8A 2X15A 4G5SA 4LMAA 3R5FA 4DKJA 1MDFA 3MT8A 3HUUA 1O95C 5CGZA 4DJ5X 4B7CA 4UTNA 5KYUB 5LQKA 1QSGA 2XMPA 1PI3A 1GD1O 4MVJF 4EG4A 1QFMA 3F98A 3IP6A 2RHDA 4OLFA 5ICCA 1EEHA 2AT1A 4FONA 2NVUA 4UTRA 2LR0A 4UUOA 1QDEA 3EOBI 3HSSA 4XSHA 5IUKC 2JKVA 4FKZA 2CHFA 2Q41A 3WWPA 5MDHA 1SCAA 4I55B 2QDXA 3LBIA 4Y8VA 1NBME 3EUAA 4RS3A 1MOQA 3V55A 1ZGCA 3O31A 1U04A 2MSWA 4Z9AA 2P5UA 1BGWA 1SQ5A 2PNFA 3P2IA 1YVPA 4ALJA 4J2TA 1DCFA 1VI6A 1WV0A 2HJ9A 5AKHA 4PPGA 5FULA 4F4DA 5KSOA 5MGNA 1KL7A 1MABA 1TGVA 2XNSA 1PZGA 3ENZA 3LRXA 4IIFA 2FW7A 1K6MA 3HGTA 1YWGO 2G1UA 5LSAA 1CY2A 1QV7A 5FWYB 4IDEA 2REQA 2OORC 3ED5A 4PTZA 1L8OA 1BXRB 2AR0A 4QOJA 1NBMA 4IJ6A 2JD2A 2C4TA 1I33A 5J23A 3CONA 2PMFA 1UWLA 3OEED 2OHXA 4IPTA 1R66A 1ZGGA 4DHEA 4IGAA 3EGCA 4EK9A 4JYZA 4NMMA 1LPAB 3HVHA 5IBQA 1T2VA 5AW7A 2TMGA 1M5UA 3PHJA 5K2OA 4KN8A 4ZT6A 2YN4A 4KR9A 4P58A 3V48A 4P80A 1GPJA 1KQFA 2HQSA 3OI7A 4ITUA 3U2QA 3FF4A 4S0ZA 3EXHB 1ZGJA 2ZBRA 3ISVA 1UKZA 1W581 4B7ZA 5TC4A 1AF4A 4QE3A 4ZMBA 5KYWA 4GDFA 1AG9A 3DZKA 4GPD1 2GZ1A 2EYQA 2ZI5A 4RF3A 3LCCA 4IFIA 1N0UA 2B92A 5T41A 3ENWA 3BD9A 2WQ7A 1JI0A 3CV3A 5CT8A 3OEHA 2WIAA 3QITA 5M2QA 1U5CA 1XL0A 3PT5A 1D6NA 4U5QA 4ZCMA 3I04A 5L8VA 1QR2A 5CIQA 1B0AA 4ZOBA 3EAFA 3THWB 2UVQA 3E4CA 3EWSA 3U49A 2H9AA 3VDXA 4KI7A 1H3EA 1GCAA 2Q5FA 1EU1A 1SMKA 5HF5A 5IM5A 2VPXA 4JOQA 4WH0A 1O97D 1GNQA 3GYGA 1FF9A 1XE3A 4I1YA 4LKRA 3Q7IA 4HYTA 4ZJZA 5I7VA 1A7UA 3U39A 4DM7A 3CXUA 4EZBA 3S28A 3U7HB 3EARA 4IP0A 3CEJA 4G24A 1JEEA 2BFNA 1T4MA 4BUCA 1I3LA 1AK1A 4R2IA 3VC7A 2QTTA 5CJPA 2V6FA 4V1CA 4FR2A 4PYRA 3TS1A 3WL8A 4AU1A 4UCQA 4JI1B 1UEJA 3E9CA 4FHZA 4E5SA 1L4GA 1WQ3A 1OWOA 1CUEA 1NW4A 1X77A 1S8NA 1S2GA 1CY7A 2VPZA 4LYFA 2IKSA 5CM9C 3ZS9A 4E1AA 3QVVA 4HN4B 2Y92A 1H6AA 1Z68A 3GB9A 1PLKA 4UE3S 4FW8A 5H70A 1P91A 3ZYCA 5MFPA 2HWKA 3ME5A 3PXXA 2BMAA 5KJFA 5A5EA 4OTZA 2ZDHA 1N9GB 4BKQA 3GRCA 3DCIA 4QXMA 2NO4A 3R3YA 2NV2B 2IYXA 3IP5A 1U99A 4KE6A 4O4LA 3LC1O 2VBIA 4NS1A 1VL0A 8ABPA 2XLCA 1FXUA 5TLSA 1KYTA 1NI4A 4MV4A 1A5AB 4CM4B 1XB2A 1WWKA 3BK1A 1E79D 4HQFA 2UZAA 2WMNB 4ALMA 1FY2A 2W00A 5SY9A 4KQJA 4CN9A 5CURA 1WJGA 4M99A 5IJAA 2ISCA 4ND7A 4E1BA 4EKYA 4GQBA 2CXQA 2XT9A 1GITA 8ATCA 1DTWA 2K6GA 4K40A 2JI8A 3FSGD 1X1CA 4J1SA 4JEHA 3SHTA 1N9KA 2G5GX 3D4PA 4G0QA 2BF4A 1HDRA 3KLBA 3ANXA 3DYIA 1SVSA 2Y6VA 2ENWA 1EE9A 4IIJB 2P1DA 3AHGA 3D7KA 3KYIB 5EPUA 3RJ9A 1YZQA 3U4GA 2GPNA 3UF0A 2RGRA 3WB0A 2C7OA 3AEZA 2Y1WA 2ZYRA 1SCQA 3PFCA 2NSHA 4DVGA 1CUYA 5IBCA 2YYSA 4WKGA 2E55A 1MR3F 2HNKA 2DUJA 1DKOA 2BGJA 3KFLA 4X7PA 2J7KA 4E5YA 1B2LA 2ANBA 2BKLA 3A70A 4GX0A 1P1CA 2QZSA 3VR4H 5FO0A 2EHDA 2P5TB 4LSMA 2HR1A 4AN0A 2HRBA 1DRWA 1FFEA 4MQBA 2H4WA 4YAUA 4DV5B 1BFDA 1CVLA 3PGMA 3NX4A 5JYEA 2MSKA 4JVLA 5IYZF 2QG4A 3S8YA 1RKBA 5FV7A 1AD2A 3V6LA 3WYNA 1W36B 4XB1A 1IY2A 4C4AA 3T06B 1RXIA 1XO1A 4OKNA 4OVKA 1LQTA 3LHDA 3ABRB 1Y9JA 1CQWA 2YQ4A 5JS7A 4D0LB 1ZRHA 2CF5A 5LP1A 3MM4A 3AC0A 1YB4A 3B1WA 3R7BA 2KBEA 2HFJA 5CG1A 4ND8A 2CNLA 2OQVA 2I8CA 3I32A 2D00A 3PD0A 1BKDR 1DPGA 4PXAA 2AW3A 3CLKA 4RS4A 1JR3D 3H86A