3IBCA

Crystal structure of caspase-7 incomplex with acetyl-yvad-cho
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
140
structure length
140
Chain Sequence
TYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-7
publication title Conformational similarity in the activation of caspase-3 and -7 revealed by the unliganded and inhibited structures of caspase-7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase, apoptosis
total genus 52
structure length 140
sequence length 140
chains with identical sequence C
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2009-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ibcA00
2H5IA 4NOMA 4QU5A 2XYPA 3SIPA 2C2KA 2WDPA 2XYGA 3DEHA 1K88A 5IANA 2CNNA 4D3ZA 3H11B 1I4OA 2AR9A 4AW9A 5LU8A 1SC3A 2QL7A 5H0IA 4EHNA 4HVAA 2QL5A 4ZVOA 1RWKA 2C1EA 5IBRA 2XYHA 1SC4A 4ZVSA 1RWPA 4EHHA 2FQQA 2J30A 5IABA 4ZVPA 2NN3C 3GJQA 3E4CA 4NBKA 4QUHA 5JFTA 3NS7A 1SHLA 1I3OA 1CVRA 2HBYA 4JJ8A 5K20A 2C2MA 3KJNA 3H0EA 3P45A 1NMQA 2QLBA 3R6LA 3UO8B 3V55A 4EJFA 1QDUA 2HBRA 5IAKA 2J33A 5IBCA 4I1PA 2CNKA 2K7ZA 4QU8A 3UOAB 3K7EA 4FDLA 2P2CA 1NMSA 2QLFA 1CP3A 4QULA 5IAGA 2H51A 4JQZA 3H1PA 3GJSA 3NKFA 2HBQA 1I4EB 2CJXA 3R5KA 1RHMA 4LSZA 4QUIA 4ZVQA 5IAEA 4PRZA 4HQ0A 1ICEA 2C2OA 4JR1A 4DCPA 4PS1A 1I51A 4FEAA 4PRYA 4QUGA 4NOKA 3GJTA 4N7JA 4JQYA 1GFWA 3PCXA 2H4WA 3R7NA 1SC1A 1RWVA 2XZDA 3V4LA 3KJQA 2HBZA 4D3XA 1NMEA 1M72A 4EHKA 4NOJA 3SIRA 3IBCA 3EDRA 4QU9A 4QUBA 2FUNB 4PS0A 4QU0A 4N5DA 4I1RA 3V6MA 1RHKA 4DCOA 2CNLA 3P4UA 3IBFA 3V4OA 1QX3A 1GQFA 4NOLA 4DCJA 3V6LA 1QTNA 3RJMA 5LUBA 4AWAA 3R6GA 2H5JA 3ITNA 3PD1A 2DKOA 1JXQA 2J32A 1RE1A 3R5JA 4FXOA 1PYOA 2CJYA 2QL9A 3KJFA 4N6OA 4N6GA 3BIJA 5IC6A 2CDRA 4ZVTA 4EHAA 4JJEA 4NBLA 4EHDA 4JB8A 4QUJA 5IAJA 3DEKA 2H4YA 3D6MA 3OD5A 4D3YA 4IYRA 1SHJA 2Y1LA 1NW9B 2FP3A 4QUAA 1IBCA 5I9BA 4HQRA 3NR2A 5LU9A 1F1JA 4M9RA 3H11A 5IBPA 2H54A 4N6NA 4QTXA 2Y0BA 3S70A 1KMCA 4ZVRA 5I9TA 4AWBA 3GJRA 3R7BA 1K86A 3D6HA 1RWMA 1RWWA 2CNOA 4IEFB 4QUEA 5IC4A 4JR2A 1F9EA 1RWOA 2QLJA 1BMQA 2C2ZA 4ZVUA 5IARA 4EHLA 5LUAA 3QNWA 3DEIA 4EHFA 5IASA 1RHRA 2XZTA 3H13A 1RWNA 3EDQA 4JJ7A 4N7MA 4JR0A 4NBNA 1RWXA 1PAUA 3S8EA 1RHQA 3PD0A 3R7SA 2H48A 3V3KA 3D6FA 3DEJA 4FGUA 2H65A 2J31A 4QTYA 1RHJA 1RHUA 4QUDA
chains in the Genus database with same CATH superfamily
2GZHA 2YNMC 4FKZA 3GLFE 1K3FA 3GELA 2XYRA 4JLJA 4UDYX 4TV8A 5L4NA 1M2HA 2X42A 3RS4A 1WAMA 2H08A 2BFDA 1NPDA 3I73A 2F3RA 1P2TA 1O4VA 4XJSA 3ZK8A 1VOTA 4EPVA 4BNWA 3DBHA 4LNHA 1RZ3A 4OV6B 4PC1A 4CCWA 3FOAA 1EK2A 2ZJ1A 1I01A 4B8YA 5LP1A 5IJAA 4M2LA 4H7JA 2BFWA 3OOJA 2FUEA 3NRCA 4X1KB 3LZCA 3RS8A 4MRVA 2A0UA 1E9RA 3KVVA 4RZHA 4TRNA 1EE1A 2J3KA 1WS6A 4RVDA 5JCOA 2ZETA 2A59A 3CRZA 2ZM6B 1ULHA 3O91A 2IYNA 2P78A 1N9ZA 1OSNA 4HLQB 4OU5A 1QE5A 4LJSA 3ED1A 3ROFA 2QOEA 4QU8A 3R6WA 3DDZX 1Z38A 2XTMA 3K7EA 2HMYB 1OX6A 4FS8A 4FQ7A 1ISMA 2Z1MA 4KXQA 4V0QA 3L6CA 1UOOA 1YVEI 3DNFA 5THKA 3PK0A 3OZGA 4GECA 4EZEA 4RDXA 4QREA 1YJXA 2IZ7A 3DAFA 3FRJA 3PX3A 4IO0A 2XB8A 4UHKA 1L4FA 4ND8B 4U02A 1JHPA 1JV2B 5DHUA 4CYMA 3FWZA 4JLNA 4FYPA 1H3EA 1ADGA 1MB2A 4C7VA 4F71A 5L4SA 3CXUA 2NMVA 3T7AA 1NSFA 1HO3A 3H1BA 5CX4A 2GMWA 1RE0A 4QXQA 5CFRA 5TPZA 1IM2A 1BQ4A 2BDEA 2Z57A 2ORYA 4F91B 2GSDA 2ZUDA 1M72A 1P7PA 4DMLA 4DR1B 2X0DA 2DFLA 5A03A 5ED0A 4FOPA 4X63A 1EUYA 4K28A 2I6XA 4Q9IA 3WLEA 2JGEA 1NT4A 4JK3A 1F9AA 3GNSA 4YJ3B 4OVKA 1C2TA 2GA9A 3E22B 3WNQA 2WSMA 2GBLA 5LIRA 1ABEA 3MVEA 1F4PA 2CVQA 3PD1A 4HX9A 4LISA 5DGXA 3TRJA 5JJLA 3IUJA 5K45A 4Z86A 3TI9A 5KYKA 1VDMA 1ZM7A 5L8VA 1DBWA 1QWSA 1ZCAA 4IIDA 3K1AA 1SOAA 1AUPA 3PL5A 1GTJ1 4KLNA 2AA3A 5F1KA 4QDUA 7YASA 3ZWBA 4M60A 1KZYC 4R8MA 3TAHA 4UHFA 1MABA 1N2BA 1HGXA 1WPQA 1PSZA 2WI8A 3H11A 1C2YA 5DIFA 2PUGA 4AMZA 4WXPA 4WY2A 1ZJ4A 3O8QA 4ARUA 4TT3D 3ANMA 1WDTA 3KVRA 4G01B 2OXRA 4ZVRA 5A7HA 4C3ZA 5C7LO 1NUUA 1BDIA 3VDRA 4F45A 2ZVDA 3O94A 2O0LA 2VF5X 2G09A 2CB0A 4L5IA 1T24A 2EGUA 2FX3A 2C42A 5GONF 3RAGA 3GLSA 2QPTA 3LBAA 4EGAA 3OMXA 5LC1A 3DD5A 4HADA 3E18A 1OILA 4JCCA 3ILYA 3W5DA 1ADJA 2IW3A 2J6CA 1YUMA 3CURA 3KAJA 3Q98A 1UWVA 1WMDA 1ID8A 2ZQZA 3F5MA 3BH7A 3DA8A 4OHRA 4LF9B 4I4TF 4HAYA 1MQAA 2C0PA 3EXEB 1BMFD 3URKA 3I9OA 3OZXA 7GPBA 2HQRA 2WM9B 3ZXSA 3KZXA 3RUIA 4AMBA 5EUMA 1ST3A 5L3QA 1P1KA 1WY5A 1A8IA 3ZEIA 1JJIA 1P19A 4LDZA 1PR6A 5BOSB 4LV8B 3D2LA 1SC4A 3RHSA 1AKNA 5KB3A 4ZC1A 3VNVA 4RZ2A 3UXEA 4EYKA 5AM0A 2ZRJA 1FU8A 1RAEA 2EF1A 5HM8A 4S0XA 3PF8A 2CK3A 1XHLA 2E37A 2R1ZA 2YC4C 1DNPA 3M70A 1EWYA 1WNTA 1JKXA 2Q29A 2VK4A 3L7AA 1I3OA 4NICA 3QXCA 3C4VA 3LV8A 4NPCA 1WZUA 5AM5A 5EIBD 1U0TA 2JGDA 3G0CA 1JAIA 3BJIC 4N48A 2D13A 4MZXA 3ER8A 2ZE5A 1P39A 4KQMA 1P4RA 4TMTA 3M9LA 3R5HA 3UMRA 3IQGX 4UDOA 3ER6A 6ADHA 4N39A 1J2EA 4DT1B 2ASEA 4ONEA 2ONZA 2AFRA 3E9EA 3PNBA 3SG0A 3SZRA 4E7PA 5BW5A 1L4BA 2E5LB 4L15A 3EW7A 3U17A 2VTEA 4B6SA 4F6CA 2ZUCA 4FCVA 1IWOA 4PC7A 3S2IA 3VTZA 1SUWA 3ZHSA 1VXOA 2J9YB 2CJXA 3Q4GA 4H0NA 1Y6JA 3V3TA 1M6VA 5A05A 2QUJA 2JVJA 3QHQA 1X1AA 4JXZA 1R3DA 3D2AA 4PINA 3TNJA 2SHKA 4E5KA 5ES4B 3EXHB 2ZRGA 3T35A 4U6SA 4MPDA 3QYJA 3VPGA 3G3EA 5FUWA 3TS1A 3BYZA 3EVAA 4D5GA 3HNPA 3KSDO 3LLVA 3V1KA 2FWBA 2JASA 2OFOA 1DX9A 2P0YA 3KFVA 3QVGB 1F4LA 3GUVA 3DTVA 1MOQA 3OFSA 4A23A 4WIAA 1RFLA 3W4JA 3PFWO 1ESNA 4KJXA 3IBCA 1UWCA 5I6DA 1QO0A 2ZR0A 1PG0A 3SJCA 1KEEB 2Z56A 2WB2A 1FU7A 1H8HA 1KIFA 5A1JA 2HTFA 4QTZA 4EUKA 3HXQA 4H59A 2WJZB 2IHTA 3VHQA 5EGSA 5AK5A 3LG2A 4C5BA 4MUGA 2NP6A 3GBVA 2VUUA 2J46A 2QUKA 5E4YA 2NUPA 4LZZA 2H5JA 4FXOA 5EZYB 3WDSA 4DNFA 5HRCA 2QXTA 4QQFA 1X7YB 2QTGA 4UU7A 5AW5A 1CUUA 4GR5A 4QQKA 2BCJQ 1FZTA 3T99A 1GCIA 5FBVB 5HBRA 1UDRA 4KE8A 1VA5A 3VR4A 4AO6A 4PRKA 3RIMA 2C7BA 3RRNA 2W6MA 4FHDA 2WM8A 2WWVD 3TKYA 1SO8A 3KLMX 1Z2EA 2A0WA 4ICIA 1OFUX 5A5EA 1NJ1A 1GTSA 4Q4CA 2ZT7A 2XDQA 1JHYA 3FVRA 1K86A 3RQIA 4IEFB 1C0KA 1J2RA 1UKAA 3OZBA 4NL4H 4URUR 4P3PA 4LQLA 2DQYA 1QO9A 3GA7A 4KPUA 2UXDB 1CY1A 2HH9A 4F38A 3WMXA 4ZCIA 5I47A 1B23P 3PE6A 4EUHA 3D1JA 1NJ8A 1H4SA 3K70D 4WOPA 3T7JA 1H2YA 1U8ZA 5IKMA 4BRWA 4P4TA 4TZKA 1HE2A 4X6YA 1XYYA 3KHUA 4DC1A 2PSHA 4CKZA 1T4MA 1U90A 3PXDA 1M8GA 3EK2A 2F55A 2FSVA 3IUEA 1N5MA 3PUKA 4TRMA 1TMYA 2GPBA 2ZBPA 3NVDA 1RXSA 3FY4A 4LYGA 3GQVA 4KWTA 4MPJA 1ZGGA 5FAKA 4MUJA 2G36A 1WCIB 1ARZA 3QJ5A 3PIIA 1NVGA 2X6RA 3QYAA 5AR1A 5GVSA 1UBTS 5DBFA 4M6WB 2BRUA 2HSDA 3HEAA 5KYNA 3DWFA 2VL7A 3GG2A 4XXHA 3TTTA 4CMIA 5KNCA 1Z45A 2HK9A 2KX7A 1ZEMA 3B2EA 4R2KA 5DHSA 821PA 4DWWA 3KVNA 3B3GA 3OG9A 4F7WA 1ORRA 1V6AA 4P0PB 1V3UA 2O5EA 4FTWA 1JPVA 3IIJA 2ZZKA 3DYBA 3BE6A 4XQCA 1YZUA 3UOAB 3ZY3A 3R8FA 4UBNA 1REQA 3IJPA 2Y76A 3M6VA 5CXXA 3EAGA 5BWBA 4KR3A 1K4KA 2YC2C 3B2QA 4DREA 3USES 4QM7A 1TZMA 1J22A 1WDWB 2LIPA 2NAFA 3GRZA 4P5PA 1FDVA 4ARZA 3P9RA 4G09A 4KEAA 4K6MA 1E3WB 1P3DA 3LS2A 3MN1A 4LFCB 3WIVA 1JR3A 1E1QD 3F49S 1NQOA 3VZPA 4DV7B 2WTXA 4IDHA 2XWSA 4UOQA 3O3CA 5FTNA 2QVBA 2O0HA 1JFRA 1BW9B 2GBIA 3LUJA 3WYFA 1T13A 3BMOB 2O52A 4GC9A 3REQA 4D9IA 2P11A 2QD1A 1ZMOA 3AYZB 1RXUA 3JY6A 4B5KA 3KJQA 4UUAA 4JFAA 3TSZA 4BAUA 1D1TA 3ZE8A 1SBTA 1YAHA 1JQ5A 4S2UA 2HJVA 4UUQA 3KSAC 5AK4A 1OLXB 3M5WA 4TM7A 2F3PA 3UK1A 4Q4JB 3HP4A 1NW3A 4UDXX 6REQA 5SZKB 1K5GA 2AW5A 1CU1A 3HBAA 3GLIE 1HE5A 2RHHA 2XZPA 5T4EA 4F3YA 1XPRA 4MMYB 1MC4A 2W37A 5AOBA 3IKJA 5CFZA 4D1YA 2QR2A 4HR7A 2GRJA 3VYTB 3ZBPA 5C2JB 4II3A 2AKYA 1P2VA 4ZYYA 3WI7A 4C05A 3D6MA 1VI6A 4IG9A 1UXJA 5GM2A 4UW9A 1V11A 2P1ZA 5IUKC 5BYKA 3K09A 5E7JA 4KPGA 2RB4A 3DGEC 3MCZA 1G20E 1OLOA 4MUAA 3VFDA 3QUAA 2OHVA 1X1CA 2PU5A 4XYGA 1P6QA 2PH7A 2ZIFA 4LX0A 5CIWA 3IULA 4CUKA 2CNOA 1UMCB 1CLUA 3TFWA 1TW3A 1B00A 1I2CA 4RK5A 4ZGWA 1CIVA 3SNKA 3F98A 3N0RA 4IZ6A 1K97A 3F6BX 1NLYA 1PJCA 2IY8A 1DAKA 1T2AA 1J9ZA 2QLMA 4K9SA 4LE1A 4BNKA 3IILA 2IBSA 1NI4A 4J0IA 1XP8A 4ZT4A 4YCCA 4C4XA 1OD6A 2BSAA 2E6UX 3DJFA 3MMSA 3QX3A 5JS1A 1H6AA 1PEDA 5F9FA 3F9CA 1NL3A 2Y8EA 1E9DA 3PSAA 3D0OA 2B36A 1GV1A 1LJLA 2ZIZA 4JA0A 5BQPA 3USCS 4PN3A 2BTEA 5IYZB 2D0OB 1Z7WA 3WL6A 1IY9A 2VEDA 221PA 1QIKA 5MFPA 3A1SA 1LBEA 3O93A 2C4NA 1P61B 1JG3A 3GOQA 4BECA 4NYIQ 2H16A 3W7VA 121PA 4JKYA 2W6JD 2VJLA 4YWJA 4M8IA 3EG9A 3ZJYA 4BKMA 4ENUA 5LD2B 4BWFB 4AY2A 1E3QA 5A4FS 2IYXA 2ZDQA 4RTPA 2F4VB 2Q5LA 3NS7A 4OFWA 4JEIA 3RC3A 3EGDB 3GAZA 5IAOA 3EXIA 2FDCA 1TEVA 2P0AA 3SAJA 2NTEA 2I2WA 5T6MA 2PWPA 3O82A 1DFGA 5GP1A 4F5DA 1CTQA 1MTZA 3NBYC 4LRQA 3AY6A 3CVWA 1AS2A 3HXMA 4KPYA 4TZ0A 1NAIA 1W59A 3ESXA 3GLQA 2QLNA 3RUCA 1T5BA 4CQLA 3FJ1A 3ZGVA 4CG3A 4D74A 5EP1A 1J97A 1S5PA 3AUTA 2CFCA 3IIKA 1BG6A 1MHTA 1PJ2A 2HCFA 2QQEA 3FCAA 3USZA 4IEEA 4DEVA 1UOEA 3I39X 3IDZA 4X62B 3F8TA 2HRRA 2PK3A 1CUDA 1VIDA 4BOYA 1Y34E 2OR3A 3A6HA 3CJQA 3D8BA 3FFBA 2YIVX 3Q3CA 2JAHA 1D2RA 1OLUA 3GCGA 4FMCB 3EGVA 2FXVA 1C3VA 3EDOA 4IDPA 1SVOA 5ENVA 1IXZA 4D2IA 5EIXA 2O3JA 3F9RA 3SIRA 1PK9A 3V7UA 3K9LA 4JEMA 4OKIA 4X94A 4BO4A 1Y7LA 4MUFA 4DIKA 1XZEA 1RU3A 4PLHA 1CY6A 4HLUA 2XIJA 4HFJA 4AQ7A 5LOVB 4R41A 5A9SB 4WA8A 4DRXA 1C4WA 1NV9A 1D4OA 2I6QA 2Z3ZA 2GD0A 3ICVA 3PTLA 3P2JA 4UTNA 3CLSC 3HXLA 4ZOLF 1KR2A 2EJCA 3A06A 4B0OA 1I24A 2OLEA 1MQ8B 4AJLA 1SKYB 4HGQA 2YWBA 2OCKA 2P40A 3EVEA 1DDOA 1PFYA 4MEAA 4LJLA 3Q6MA 4IH4A 1J0AA 2ZAMA 4F3TA 2WEKA 4ZYLA 4Q1BA 3VZCA 4PHHA 4XWAA 3R9IA 2SCUB 4A26A 1UDXA 1UKCA 2QGFA 3RTDA 1H0RA 4NCHA 1VIMA 3I30X 1LLFA 1M2VA 3IP9A 4K9NA 4F97A 1J00A 2EX0A 2I1QA 4RZQA 4WZAB 4FINA 4JV5B 1EFCA 1EFVB 1N2SA 3SSAA 4MVWA 5HRUA 2J3LA 1VHDA 1WB4A 5JNSA 3HACA 3AF6A 1KDRA 2R1TB 2GOYA 4TRJA 4ALIA 1W9MA 4ZKDA 2VBCA 1GRVA 1C7RA 1V7ZA 3OE5A 2FE1A 4MINA 3BSWA 2H8KA 1WD5A 2NZJA 4J2OA 5HUJA 1DO2A 2I99A 2A30A 2P35A 3TZKA 2WF9A 4J8PA 1DIHA 1IY1A 3ZVLA 1XQXA 3JSXA 3UWSA 2GXAA 4D9CA 3IALA 5U1PA 1ZGJA 3AKDA 2WSBA 4QT0A 3S27A 1U28C 2XUIA 3RVBA 3UG6A 5FOQA 5JFGA 4NEHB 1SCJA 4KQIA 2I6TA 1X19A 4BZXA 3GPDG 2X4DA 4B6PA 1G9XA 4F46A 1ORWA 4N5MA 1S2OA 2DJIA 3GQBB 2JANA 5PGMA 2G07A 1XIVA 2KWIA 2PEZA 4CR6A 3N0VA 5D3MA 4YR9A 2BBTA 5TPWA 4KOAA 1R3UA 3AH8A 2BOVA 2GKSA 1RWKA 2Q3CA 1ZXXA 1KH2A 3EJ6A 3L8HA 5CVVA 2HK6A 1FYXA 2JKVA 1JG7A 2IEBA 2ZJAA 1FK8A 1X94A 3BB1A 1J9EA 5AJWA 3ZDQA 1JNYA 4IV5A 4RNDB 3DZ8A 1O0BA 1Q16A 4BNZA 3KVYA 1ZUIA 1E9CA 3RFUA 3U9SA 1ZD3A 3V55A 4I50B 3ETJA 1YRBA 2AD5A 1O89A 1WETA 1VE9A 3E9QA 3SC6A 2WV7A 2VF4X 1OFGA 4P08A 1XVTA 1PE0A 4LZJA 1BE1A 3PGJA 3BMNB 1L5MA 2CXTA 2OBXA 4NU0A 1DG1G 4WH0A 2H1LA 2FSPA 4MVJM 1JS1X 1ZC4A 4QM6A 3L6DA 1KFBB 4BMCA 3GPBA 1JIIA 1C1HA 2EEPA 2OHXA 3ONWA 4E09A 1T8SA 4QPZA 3R5KA 4JC0A 1MB3A 1JHQA 2BE7A 1J8VA 2ZVQX 4HAVA 3CT4A 4CNQA 4YHBA 4RPGA 4OI2A 3F2IA 4HQKA 3EZNA 4U2BA 3A9TA 4ZO7A 2Q5HA 5AWFC 5FL7D 2J5QA 3EXFA 4B85A 4B7UA 1J0CA 1B8NA 2ID4A 1QTIA 2BSXA 1TE2A 2ZWAA 3HVUA 3L6UA 2QNBA 2CMGA 2NQ2C 2GF2A 3B53X 3R7NA 4EITA 1DXYA 1JEAA 2HSEA 2AG5A 1R37A 4TLEA 2VDMB 3ESZA 3W3AA 2EBUA 4EEZA 4B3BA 1U5AA 2P9CA 1HLPA 4B33A 3T5AA 3CZ4A 1CS0B 3DMFA 3FHJA 4C89A 2CFTA 2XITA 5KWEA 1WZIA 5CU7A 5C7YA 4ECAA 3GX1A 5IFKA 1TKAA 1GPJA 2K4MA 4HN9A 5A62A 1KU0A 3JQCA 3QPCA 2XVXA 4ZKEA 4DNXA 1BEUB 4MS3B 2O2JA 4BBPA 2WPDD 4KREA 1JSZA 1NLZA 3DDWA 3GH1A 4QDXA 4BE7B 2RIPA 2IYQA 3A4LA 3MS7A 4OHCA 5LQJA 4JSRA 3RNOA 1UWLA 2RBEA 5JHHB 1PFUA 3ZH9B 4KQJA 3QFSA 2R00A 1J24A 2W22A 1V26A 4L8WB 4N8SA 3KZ1E 2OCIA 3R3JA 4UOEA 1N2ZA 1XE3A 3EZYA 1K66A 3SSOA 3T3DA 4F96A 3EA0A 5EVCA 5B55A 3VA7A 2FZVA 1JKIA 2V4MA 3AMVA 4TROA 1JYEA 4U7TB 2P9FA 1J8MF 1PR1A 3FA2A 4I9GA 3FPCA 4HB3A 4JP8A 2IZ1A 3FNBA 4A5OA 5A7FA 3ES9A 4L7VA 5EMHA 1AK2A 5T57A 4ASUA 2G1KA 2H8GA 1NQWA 3LXXA 1GZ4A 1UJNA 1P5HA 2H63A 2WU0A 4AMYA 3FHTA 2H48A 1QVZA 2NZ8A 4FGUA 1OFIA 4IZOA 1TIPA 2N42A 1PP4A 5JBNA 4CEIB 2J6IA 2QAIA 1I2BA 4RTQA 3S44A 2DUUA 3L1VA 3PNLA 4CLXA 3MT0A 1XNRB 5FL3A 2JAWA 2YVAA 5TX7A 2JEOA 4Q7JB 2H7YA 4RF2A 4Y6GB 1M6EX 5KVAA 1GEGA 4ZAZA 4X71A 4XUGB 1UEXC 4U8GA 4GX5A 1AGXA 1X0XA 3GLGE 3QELA 1TZCA 3FLEA 3M8KA 1G0OA 1OKKA 3AYXB 4OI0A 4L5CA 3OPQA 4GOND 3BXXA 4DLXA 3OIFA 3T4XA 1TA9A 3P2OA 4LI3X 2BR3A 3UO8B 1SQ5A 2WWYA 3MM4A 4X00A 2HFJA 4TS1A 1ZD8A 3D3QA 4BTVA 5KQMA 3KP1A 5H16A 1CZLA 3BF8A 3GGGA 1G3UA 3ADDA 3EIOA 3QTTA 1XTQA 4CEHA 4C43A 3EZ9A 2FOLA 2IPNA 4X44A 5AVSA 1CETA 1OW3B 4KB5A 3PUZA 3O4FA 2BHNA 3UGJA 1Q7CA 3ETHA 4NC9A 2MOKA 3T5TA 3OT4A 3THXB 3QVVA 2MDTA 2ZI7A 2LR0A 5F5NA 3GXBA 3OQIA 2VFAA 1VKJA 1N25A 1EFAA 3QE4A 3DHVA 5AW4A 2OVBA 3WE7A 1QH1B 1E4VA 2VSNA 3CH6A 3NOOA 4REQB 3RJTA 3W7AA 4WXYB 4YNBA 4BS9A 3VPDA 1N2OA 1P75A 1ZX1A 3OPVA 1MT0A 4E2ZA 2HA0A 4F3RA 2AOXA 5IJ0B 1QGYA 4J49A 5IM4A 3QWIA 3LY8A 3A3OA 4NWIA 2GWHA 1GGKA 3FJYA 4WV3A 3CO5A 4HNQA 1ORDA 3G9QA 1S8AA 1QX3A 4U2KA 3MK31 3RVSA 1HTBA 1FPQA 2A1IA 1Z47A 3MSCA 5ALWA 3EMDA 3T5DA 4ITVA 4NI5A 3T3IA 4GP7A 1QRTA 3JZDA 2JFOA 2C5FA 4S1OA 5H5JA 1RE1A 1WRBA 1R6TA 3HKCA 3ME5A 3LT0A 2A92A 4FYWA 5F35A 4C1BA 1Y33E 5BWNA 3NMUF 4RM3A 3IB3A 3W5JA 5B3JA 1K0FA 1VMIA 2NUBA 2DPGA 2DWOA 4KCGA 1NVVR 5EMMA 1LJUA 1ORVA 1RYDA 4G6ZA 5JG7A 5KI6A 3IP6A 3TNYA 4GFDA 3QVWA 4G0ZA 4HUJA 4CFZA 2O2YA 3RFXA 2OBBA 5JADA 1E2KA 1ZG3A 4WCDA 3AFGA 2VZ0A 3MF4A 1QIDA 3IE1A 3HRKA 1Z68A 2HDHA 4MCJA 4AYXA 4RHTA 2G6TA 5EE5B 1CZRA 2B34A 2V4ZA 2ZBGA 3ON5A 4I8XA 9GPBA 5TLSA 1UOQA 3D4LA 3TM4A 2W2TA 2QVXX 4PYMA 1KP2A 1ZXBA 2A3RA 2NW6A 4O4IF 3IPYA 3PD7A 1D03A 1U2DA 2GSWA 2J8ZA 3H4IA 1KEVA 3I9LA 4GUAA 1CDEA 4ZVNA 3TLGB 3WL5A 1XRRA 1RRCA 1NBWB 3U6KA 1Q3HA 2C94A 4BDSA 1OH8A 3N8GA 2Q2NA 4JQCA 1I4OA 3A1TA 1RQLA 2Z2IA 2BR4A 3NBFA 4MWSA 4B79A 1BXGA 1YOVB 3L0CA 5AUPB 2B30A 2PZKA 2Z08A 2HF2A 3I9KA 1T3LA 1V4NA 4R7TA 4DHEA 3OZIA 1A2QA 1IHDA 3BMCB 3ESCA 1NY5A 2HMUA 3KV1A 3GL9A 3CKLA 4PR0A 2XNKA 3JTEA 1UC8A 4M21A 4TLLB 5C5CA 1FW6A 3W2EA 3TQIA 3C3JA 4BO9A 1E3MA 1G4HA 4W5NA 1BGXT 4HGNA 4GO1A 4MRMA 3UICA 2H6EA 4NDNE 2WIKA 4QDTA 3PEUA 4M8KA 5JXHA 3U4QA 1VLMA 3KHSA 1FTYA 4GP9A 3T12A 2SBTA 1DOAA 2OWDA 3ACCA 1P2UA 3EASA 4NZYA 3FWYA 4MGKR 1CW2B 2FPIB 4P84A 4WNIA 3QP9A 4LTNA 1Z4QA 3W2TA 5I7EA 1S96A 4RE5A 3P9SA 1NVTA 2JKYA 1R5BA 1Z8FA 3GHHA 3TQOA 3NU1A 3U44A 4HDSA 4NXNB 2XNDA 4C0XA 1F20A 1E2GA 2PY6A 3LDUA 4U2CA 2C5HA 3SGLA 2I87A 2Y67A 3C8UA 3FB4A 2BBSA 1P7CA 1CQJB 1GG5A 4Q3CA 4QDOA 3S1AB 1B3RA 3DMTC 4O02B 5BV2P 5IXYA 5K0EA 3S2EA 1G20A 2IC5A 2PUDA 3NM5A 1GVHA 2VUTA 2G7MC 1U7ZA 2ZTVA 3AV3A 3R5TA 4HBGA 3V1NA 3WGNA 3UW1A 2GLTA 3O7MA 1V1MA 4WTOA 2OCXA 3KELA 2A7QA 1NXXA 4M0EA 4X9XA 3VHXB 2XVZA 1MA0A 1S8OA 1GCUA 3BHIA 3R6DA 4PU0A 4QDKA 5G41A 1QFSA 5AKLA 4TTSA 3H9EO 2R7KA 4NV3A 3V8BA 5JQGF 2WJPA 4C4TA 3AHFA 1ZVKA 2WE8A 3QX8A 4H9GA 4JNKA 5FNVA 1CNEA 3GJ4A 3W79A 4ZODA 1H6CA 2NXCA 1CQZA 4R9NA 2O5VA 3X1YA 1U3CA 2N1BA 3KJFA 1K8RA 1NXPA 2P6NA 4AS3A 1Y9DA 1HZZA 2WB4A 2ONCA 3N1UA 4PW0A 5HZHA 3AXSA 1JFFA 5B7NA 4ZYXA 1H6BA 4MX8A 1OFUA 1SPXA 1OFVA 3PQ6A 4L78A 1M1YB 5EIBC 2I6UA 2RHTA 1G3IA 3Q41A 2ZTUA 4GPAA 4FONA 1RQPA 2WQ7A 2G8LA 4DCJA 2Q2VA 1WDMA 1OV6A 3OE7D 1QP0A 4YCSA 3GLVA 3AVYA 1OXSC 3KQPA 1XNGA 2SKDA 3FAKA 1GADO 3R3XA 5HF6A 3QUTA 3R7LA 2I4OA 2ECPA 1WF3A 2RGWA 1LX6A 1DC7A 2ERCA 4KGXA 5ECGC 4DLNA 3FM9A 3ORFA 1GPUA 1TEXA 3AW8A 2P8JA 4FPXA 1RTKA 1SKQA 2BWJA 3AR6A 2EL9A 5D51S 4MVJE 2D0DA 3U5ZB 4HAWA 2E1PA 5IWAB 3DZKA 1CUVA 2VQDA 5TIIA 1PLJA 2JGJA 1CJSA 5LDHA 2YCLA 5AOAA 3HVRA 1QRUA 4N76A 3WLLA 2H2FA 1DWQA 2BJWA 1YA8A 1E2UA 4I5GA 5CJJA 1W6UA 2ATXA 4CW7A 1WR8A 1YB7A 2NO6A 3VSBA 5TEVA 2NV2B 4O2BA 2CFSA 2Q1SA 4FGZA 4OHKA 4UVDA 5ARDA 3E9MA 4QKQA 4ZHQA 2O1SA 4Y9TA 2YJ5A 3AHEA 5JECA 2O57A 3EZGA 3FFWA 1XXHE 3LOUA 1CUBA 3UN1A 3PYMA 2XLCA 2NUAB 4D9BA 3I6QA 4JKOA 1N9KA 2FWMX 1WSWA 4GPD1 4LYJA 4N5IX 1BCSA 1FS5A 3MPOA 4KVFA 1K3UB 1AQLA 4TZTA 1JIUA 5E38A 1UAGA 4HCJA 2B7CA 1J25A 3MINA 4KR7A 3LUPA 3IOYA 1GZ6A 2IQ5A 2XMBA 3ZV4A 4JI4B 2ZSIA 1NNI1 3AESB 2WJGA 4UCQA 2QM8A 5FBHA 2BI7A 4IUDS 3A3NA 4LNAA 2IV3A 3TLJA 4CLDA 1VPDA 2VRNA 4LRXA 3ZCRA 1B93A 2GPAA 3HJHA 3MTDA 3RU3A 5KTSA 1E79D 1HE4A 5KMGB 3HE3A 1W76A 2QN8A 3LWBA 3RUEA 5HWSA 3SCZA 4MCAA 5HVNA 3JASA 2LE0A 4UQPA 1VBKA 2WJ6A 4V0RA 1ISJA 2JI6A 3KKEA 4TXJA 1V41E 1NR7A 2B3TA 1D1SA 2Y0DA 1QFJA 2O6HA 3R5SA 3DFKA 2WT8A 1N34B 3A6ZA 2UUBB 2PXXA 3KYJB 4ZQIA 4FFWA 1JFLA 1IQPA 3BN3A 5AM3A 2C9DA 2G67A 2EQ5A 4W1SA 4F56A 4FDUA 1N7JA 2BJHA 2FZKA 2JGNA 1E7QA 1MJ5A 3CKMA 5K6AC 3K70C 4NX2A 4BQOA 2WRZA 4D4KA 2AEFA 4HGRA 4RF3A 5K3DA 5HBGA 5G02A 3GGCA 2AQIA 4OK5A 3D43A 1YKFA 3AB3A 1L4YA 1XCPA 4E1BA 4IDAA 7AT1A 1ZM3A 1PFWA 3UHAA 3PJEA 1MC1A 2WSSA 3I2FA 4BWVA 1GLNA 1GGHA 2DWPA 2GFHA 3QBTA 1IOZA 3TLMA 1X74A 4ZICA 1WCXA 5CBPB 3K35A 1WZNA 3JWGA 3ABRB 4RHXA 2PLWA 1PDOA 2O07A 3HJFA 1CJUC 1KXJA 2F1JA 4NY1A 2IH5A 3BERA 2L42A 2QRVA 3VU9A 1N33B 3RS7A 3AUUA 1SU6A 4BWYA 3GT3A 5JY1A 2DKOA 2DPXA 2TSYB 4YCAA 5CURA 4HNVA 5BPFA 3GFFA 4N6OA 1ECJA 1TVEA 2IZ0A 3IX7A 4FFMA 4ER6A 3UGQA 5HNKA 2JGLA 1VRCA 2V7EA 3GEGA 1Z4PX 3D1LA 3EGXA 2XY4A 1Q0PA 3OUUA 2VJDA 4JP5A 2GEUA 4OI4A 4P98A 4BJHB 1QKKA 2PKCA 5A4KA 2VTBA 2JLSA 721PA 5AKIA 1DAIA 1C50A 1VG0B 3M4YA 3FHCB 4QATA 4RQAA 5CT5A 1Z8NA 3A0RB 4ESOA 2R1VA 1FW8A 2WU3A 2ZB2A 1EDBA 3GAMA 3PQFA 4GM0A 3JV7A 3UMSA 2V5AA 1I80A 3LH5A 1Y1KE 5L3ZA 3UB3A 2H07A 2QROA 1Y1LA 1HYQA 2QE7A 5F23A 2OV4A 3VKWA 4PSCA 2P75A 2JFQA 3DEIA 1KEKA 2CN1A 4MYRA 4ZO9A 4QYIA 3SE0A 2PX8A 4YJFA 3DMRA 4IIUA 2UU9B 1C8LA 2ETVA 3DO6A 1ISHA 1GRRA 3DBLB 3PI6A 1PD0A 2Q0SA 3WB2A 4BB5A 1L5HA 4EDHA 4YMGA 4BEJA 3OQPA 3KPUA 1M9NA 5AK3A 5DRTA 5IJXA 1PEKE 2B4KA 4DLYA 2UZ1A 1UKYA 2FPPA 4H27A 3FIJA 4NARA 1EE2A 1K7XB 1LSSA 5KNDD 4Q9KA 4AKHA 3QH4A 4P7KA 1HXHA 2O0KA 3NWOA 2C2GA 4DNPA 2J7KA 4B47A 2BFPA 4C5AA 3IPAA 2GTIA 3KDAA 1Z2DA 1F6BA 2BTQB 1NPYA 1QHXA 2X8WA 3PITA 2B99A 1RJEA 1I8TA 2QU7A 3FCCA 4YAGA 4S24A 3TLAA 4J03A 5AVQA 1CVRA 2HRDA 4ZQHA 5E4JA 3VU1A 3JQFA 1GZ5A 5GVRA 4MV1A 4BQQA 3UXHA 1B42A 1QZUA 3L6RA 2O50A 1WNFA 4OM8A 2L17A 4NZZA 3Q5EA 3W3ZB 2EFEB 2P6MA 4FFRA 2ZRLA 2X22A 4MWEA 3H19A 2CFOA 4C6SA 4EI9A 1QIIA 4TWBA 4I08A 1X9GA 5JZBA 3EEOA 3KK0A 1P3JA 1QPBA 2P30A 7ABPA 3IUBA 3PX2A 1AS0A 1HM5A 2H51A 2HUNA 4MYHA 3OI7A 2YR0A 4MS4B 1VL5A 1XZFA 4XWYA 1G5PA 3BC1A 2VCYA 2QJTA 1KAGA 2EQAA 4Q9DA 1U4NA 2RGNC 4OTZA 2N47A 4GAEA 2PR2A 1JLHA 3CW9A 5BQFA 2ZBEA 4W8HA 4TUYF 4MW0A 3U7EB 4JY7A 3RS5A 1RACA 3N8NA 3QBJA 5A9TA 4CKWA 2GAFA 1MIOB 3WL8A 5FA5A 4B46A 2A1TR 3ZHXA 4CKBA 1SEPA 1YFJA 3DS8A 2G9QA 2D7JA 3NB0A 2X3YA 4IVPA 5I5GA 4B6FA 2AXNA 4CDGA 1QFMA 5KWSA 1RPJA 3FCXA 4X8LA 1YWGO 2CL7X 3M3DA 3V6MA 4WBNA 5BT8A 2GXSA 3LA6A 3AKZA 1OZGA 2XBMA 4BCDA 2YV1A 4YB8A 2AFHB 5CLHA 1AS3A 1YGYA 2DFDA 5BNZA 3IP7A 4PYOA 5E2AA 4A91A 3A6LA 3T7DA 2GUWA 4RF5A 5KVVA 3PFIA 4J0DA 5TPZD 2DECA 3SF0A 4ZDJA 2UVPA 5JVDB 4ZHSA 1EFRA 5K2MA 1MO5A 4HBZA 1ACJA 2CLEB 2REOA 2WWXA 2XOXA 2ZPTX 3IHKA 3IT2A 5FWYB 4YP9A 3QKTA 5SY9A 4D6XA 2OHIA 3ILVA 2O54A 1OE0A 2XMDA 4LMPA 3HCDA 4NMLA 4DM3A 3QEJA 3I9FA 2ZJ5A 4IJKA 4R8KA 3HL0A 4D56A 2ZWVA 3B78A 2OQ2A 2PKQP 3RUDA 1YV9A 1G5IA 3K0KA 1N4AA 3T1QA 3AETA 5KSWB 1UC9A 5B53A 2I6FA 4Y7DA 4BMVA 2EKZA 4JELA 1A72A 3HR7A 3QFRA 2IBMA 1QANA 4M76B 4Y2GA 2WQ6A 4YH1A 3K16A 2DBQA 4GQBA 5CLQA 5LUAA 1EEXB 5FR1A 1MXHA 1UEJA 4QEDA 4QLOA 4PLGA 3VH4A 5K8UA 3WHKA 4EG5A 2H2WA 1BFKA 2AX3A 4KE9A 2RHOA 4KQEA 4QDZA 3LX4A 1VHQA 2VHZA 4BP1A 1DOHA 5C0OE 5CCXA 3R7WA 3KOOA 1Y9JA 3W1VA 2WNIA 3PQ5A 4UKDA 3ZU5A 2APJA 2HPHA 2V0CA 1UFQA 3TZEA 2XKKA 2AJ8A 3VR6A 3WRXC 3HHEA 4D3ZA 4Z7OB 5I7OA 3L6BA 3KTOA 4LDAA 4UUOA 1R9GA 2ZB4A 2Q0QA 3AOEA 3ZG6A 1A69A 4NJOA 4QO7A 1E5QA 1DZIA 2O8FB 3SX0A 1HG0A 4NBTA 2FDRA 3KQWA 5ARBA 4OBXA 1S2IA 5IABA 4XPZA 1XX6A 3GJQA 3ZDCA 1HE3A 4S35A 3L7JA 3LO5A 2DR0A 4HS4A 1Z0FA 3DZFA 3A25A 2EBFX 4RPJA 4IFTA 4RSHA 1EVQA 2VDUE 1SHLA 2YQ4A 4HRAA 1O95A 2BKAA 2AMJA 2O1EA 2OUKA 4HY3A 3LRXA 4QTUB 4RL6A 4KBGA 4BMSA 3GLHE 4DIFA 4YCLA 2CWDA 2JAOA 5JH7F 3CEMA 4K9KA 1R0BA 1UK8A 3HA5A 4L5AA 4AP9A 2HREA 5DNEA 1CEXA 1L2TA 1CB0A 2WWIA 3DLPX 1R8JA 3KX2A 1JEOA 1TVKB 1KIMA 3RC8A 4X64B 4R8LA 3IA7A 4KNWA 2RGXA 1OWLA 3HO6A 3MOIA 4HLCA 2QXUA 4D92A 1P7WA 1JKJA 5D3ZA 2JIZA 1XF9A 2CK3D 2IU3A 4B6OA 3FCOA 3LPCA 1P1BA 2EKPA 1NZFA 2GHTA 1OV4A 4HDKA 4JC5A 1GPKA 4OQMA 5K51A 2O7NA 4MJLA 4EKDA 1VJ5A 4B31A 1PNQA 3NHPA 4GBJA 3BDIA 2J3MA 4CKCA 3SMVA 4FYHA 3N2KB 5BVHB 2GGSA 1IJKA 2TRSB 1VHWA 1XVLA 3HQ4O 5LBTA 2XUAA 1F2TA 5C3MA 1Q5PA 1DJPA 1DI0A 2Y4OA 1HR0B 5DN9A 1NP3A 1R0XA 2Q3HA 1I32A 1VRWA 2X8AA 4XZ3A 4GLOA 3PUHA 4PSKA 5HEKA 2X13A 2UVDA 2BEKA 4OQFA 4EQZA 2GX6A 1GCGA 1A0OA 1XRMA 1A4IA 4N0QA 5CX1B 1KMNA 5TARA 4I1RA 2QTMA 3QHPA 1ISFA 3EIXA 1H4VB 3FWPA 4IJWA 4E08A 3IAAA 3MYYA 3N8DA 3ABIA 3KL4A 2BW0A 4NLLA 5ESDA 1CDOA 1T4BA 1KI9A 4IIYA 4D98A 2FMKA 4M7OA 2C92A 2YVKA 3IUSA 4XIGS 2V96A 5EJGA 1JHOA 5CDUA 3LY7A 5JEEA 4HPXB 1LF5A 3V1MA 1AO3A 1GGJA 2E4YA 1SMKA 1A27A 3G89A 3DTVD 3MGCA 5K0TA 1NU6A 1U65A 3QUSA 3UC5A 5J2UA 4YALA 1QO0D 3R0QA 4R1PA 2FX5A 4Q7MB 5DHRA 2G5GX 3NIDB 3KM0A 3AY0A 4TL6A 1RS0A 5F52A 1GITA 1F8UA 3UTCA 1QCYA 4KFCA 2QX6A 1K8QA 1FQOA 4X8MA 3KPJA 4RH0A 1C29B 3GARA 3P9XA 1MQSA 1RMYA 3BXZA 4I5IA 4LYDA 1CRPA 1JKFA 4QUKA 2D1QA 3VNAA 4P9NA 1XTTA 1TT5B 2Q9CA 2PCJA 1MLDA 3FVVA 2IH4A 1HQDA 1J8DA 2PR7A 3RRZA 1JWAB 3R41A 1Z75A 5CP8A 3ITEA 3HG7A 4XAQA 1NVMB 5H3CA 1AKWA 2R8RA 4LXHA 2XX3A 3NNSA 5JYDA 4OU4A 4DF3A 4DQ0A 5KTNA 4YR7A 2RARA 2YMQA 1NRIA 1NN1A 3E6AA 1PDWA 4FMBB 4RK0A 2HJWA 1NFFA 1TM7E 2WFLA 4FSDA 3VR4D 5H4GA 2XE7A 1KI4A 3CTPA 3NGMA 4NG4A 3CKKA 4LYAA 4G0VA 3KC2A 1MPXA 3VO8A 1MT3A 5C4GB 1MG0A 3MJFA 1X14A 3SIPA 2OFPA 1HX7A 3M3HA 1VYTA 4OAOA 5ERGB 3DFZA 1SUAA 3RCBA 4BYMA 5BV1A 5DX1A 4EO4A 3D0QA 3JATA 2I9KA 1H5NA 1SN7A 1E1LA 2VKTA 3ISVA 4QPPA 2ECQA 3OEED 5ICFA 4LFAB 2EATA 1WF6A 1Q0QA 3GXOA 3PNYA 5CH8A 4D8TA 3PUXA 2ZRHA 1Q7RA 2A94A 3MILA 4A6DA 2WTUA 4OKSA 4BZZA 4EUSA 5LDDC 4FNMA 1DRUA 2A5GA 1YONA 3A27A 4JJ8A 2J3EA 4TGLA 2KQUA 1O8CA 3BH6A 1HF3A 5HFAA 5CAEA 5JD5A 5E3HA 3GFPA 1PZGA 5TS3A 1JI0A 3TQQA 2P8SA 4LVNA 3KU4A 1IZ0A 4L8YA 2P9EA 5CA1F 1HT1E 3VKHA 2PYZA 3GZJA 5K9ZA 5JNVA 1W4LA 3HCPA 3O8OA 4WNAB 2QBYB 1FDWA 5J5AA 3VNBA 4ZIRA 4XFKA 2HWUA 4Y0VA 1NBAA 4GF5A 1F4VA 5IS2A 4YCBA 3SM9A 4XIIA 4PFKA 3PIDA 2GM5A 5FI0B 5AXDA 5KNCD 4BKPA 3GFRA 3U3JA 4R1SA 1RI1A 1NUQA 2C5LA 3FVQA 1GR1A 3ZY5A 4LBWA 2G5TA 3J81A 2EGHA 2HWXA 1KY5A 4F5YA 2QRZA 4NV1A 5DH9A 1ZNQO 1V7QA 2CHQA 4UAVA 3K53A 4M9SA 4F9TA 2G76A 1E66A 3RVDA 4NYJQ 3M4JA 4JIGA 3O26A 3H4MA 3QLJA 2V65A 1EXWA 3KR2A 1RRMA 4MVJA 3TJRA 1HNZB 1YB4A 1YNSA 3MJHA 4DLAA 2WWGA 4W4TA 4FT4A 1JR3D 4KUGA 4ZJYA 1IPEA 1F06A 3GFBA 2OBFA 5BW4A 4JLMA 2LDBA 4QLAA 3TTYA 1RLMA 1ZK3A 2OYSA 2PUFA 2ZWPA 1JZQA 3M1YA 3ELWA 2PH1A 4C7OB 2H0QA 2R25B 4ODIA 3MEQA 3IERA 4YBZA 4Z4GA 1FBTA 1MP0A 1V95A 4I9UA 1G7TA 4MKXA 1MO3A 3HWWA 4KIUA 4LNUB 3UA3A 1W47A 2WOJA 2UYHA 2RD2A 1IY2A 2B2XA 1T5OA 2DQ4A 2XTJA 4PZPA 2ZZMA 1UINA 3SHVA 3QE9Y 4DTCA 1L6IA 2XAUA 5DMXA 1PR3A 5KVCA 3OOSA 1OJ7A 2BELA 1KP9A 1L7QA 1YK0A 3L1IA 1G41A 2Q4TA 5D3KA 1KSGA 2CJPA 3LP6A 4FE4A 2W8ZA 4Y6RA 2ONKA 4OB7A 1TEZA 3PFKA 1VE6A 1JKMA 2NYAA 4EPTA 1R0WA 3MWKA 4UHDA 5FOWA 4F21A 4XWOA 1D2AA 5LQKA 4MRPA 4ZTUB 3WWCA 1NM5C 4AJKA 3H13A 1N2CB 1PJ4A 2OT3B 4RHUA 3S4YA 1OAOA 4LG1A 1Z29A 5AJUA 2R6DA 2R6ZA 3PD0A 4JC8A 1TO1E 3IVAA 3CNNA 3S29A 6PFKA 3GBSA 4J7UA 4M83A 4RD3A 2C59A 3PENA 1EM6A 3ONFA 3LUHA 3DB1A 3FUWA 4HFNA 1J33A 2Q50A 4RV9A 5A6SB 4GKAA 3LUDA 4FMDB 1MAUA 3KB2A 2PZ8A 3TB6A 3VKFA 3HHPA 4PZEA 3K8QA 4E21A 1XMPA 2ZAIA 4YRCA 4LCBA 1RYEA 3E1GA 1BN6A 2PFGA 2VDKB 4J90A 3WLFA 4HNHA 2OM2A 2P9QA 2X1LA 2QLLA 3BWDD 3V7YA 4HB2A 4Z4CA 1XVIA 1R15A 5AK6A 2GHRA 3QPBA 1BWQA 3FJOA 2ATIA 1OU0A 4NQRA 2E89A 1UADA 2VJMB 5L40A 2EL7A 1LBQA 1YR6A 4X6UA 2RAUA 3AL3A 5C5IA 1HEYA 1SBIA 3UJAA 1MGOA 4W63A 5JNRA 4TYWA 1NSTA 4ZZ1A 5CRIA 5ITWA 1T0BA 1GZ7A 3ECAA 3WMGA 1I7NA 4L5YA 4KGZA 2CHEA 1DEHA 2YV2A 1WKVA 4ARCA 1C3OB 3DTYA 4UNIA 1GPH1 4U00A 1G2OA 2Z6AA 4M0DA 2QAGC 5C8YB 2HBQA 4RMJA 5LXTF 1U0RA 3LX8A 3V1YA 4X7MA 3EOZA 2A78A 3IE0A 1TO2E 2PGXA 1TRKA 3IMGA 5E95A 1YZKA 1W44A 5EQFA 1XSEA 2C7GA 2FSSA 1JE0A 3NALA 1X1EA 3OZAA 4K86A 4PNPA 4Q9JA 1I51A 2ZYWX 3C3BA 4G8CA 2Y1FA 5DTRA 3I6ZA 3H2YA 3DP7A 3HVKA 4DDHA 1G3QA 3BEDA 3ITDA 4WLUA 2QZJA 1UJ5A 3IELA 1VPLA 1ZM4A 1Z6PA 2R5FA 1UM9B 3PCXA 3O4RA 3AO0B 4OXNA 4YMSA 2DERA 2BI8A 3K96A 3WP1B 5HGXA 3EIQA 4MQFB 1E6MA 3G0HA 1M73E 3G0BA 3C4QA 5JSFA 3NHJA 1NVKA 1OGIA 3COPA 3A1DA 3I0NA 1C9JA 4LXUA 1NY6A 1VBNA 1N7GA 3C6YA 4GZ5A 4DWVA 1RKXA 5TB5A 3T7EA 5JS7A 4GVXA 4ABTA 2V0NA 2BFOA 3T9DA 5ECWA 4MW2A 4DQXA 1YSCA 4BV2A 2QX4A 1C14A 4PGMA 2D06A 3I1FA 1Y1RA 1DRJA 3N7AA 3P71T 1COZA 1ZK0A 4K40A 4R3UC 5D7NA 2HDNB 3TW0A 1M8FA 1P72A 3A37A 3FPSA 1N3BA 4W99A 1PS9A 2Z1DA 4F4FA 1W4BA 3JSAA 4LYEA 5DGDA 1Q3TA 2GHQA 3L0IB 4CPDA 1Z7EA 4ND7A 1EVJA 4PCUA 4X8HA 3EZ6A 1AH2A 5G2OA 3TNDA 5BXQC 3X1ZA 4D4IA 4BATA 2YV5A 4QOHA 2HXSA 5G4KA 4CI9A 3HDVA 3X1DA 1ZJ5A 2DC1A 5LQNA 2VT6A 1O1YA 3OTIA 5EESA 2ANCA 2P6UA 2JI4A 3B7GA 3E9CA 4J0JA 1QZTA 4PZYA 2OCYC 2NU6B 3VDMA 3PNMA 1G21A 1GT6A 1L7MA 1L7RA 3FIUA 5BRAA 1HTWA 1P2DA 1YZNA 3PFCA 1BFDA 4JENA 1TNDA 3FCSB 5BR7A 5A4MS 4GRIA 4L51A 2C20A 1U1GA 1GTL1 1W46A 3LBFA 4HWTA 1L5GB 3EQZA 1KJNA 4AB1A 5DBOA 3B3QA 4QOIA 3TKLA 5JDIA 1WY7A 3WZ2A 6CHYA 3WGUA 1ZONA 1X7WA 4NMXB 3V4RA 4JBGA 4DQVA 4GXRA 1J42A 2C29D 3L8ZA 1K88A 1GM5A 3QE3A 4L9AA 4Y2SA 3V32A 4BB0A 5KQSA 1FXSA 3FYDA 3NTXA 2UXBB 2GK4A 4CQMB 1NN5A 1YBHA 4MI9A 2AFIA 3PG5A 2JVIA 4NK5A 2OAQ1 3KKPA 4FGKA 2OC9A 4Q37A 3A1WA 3DBVO 1UFRA 2HLHA 2BONA 3AJEA 1KQGA 3GNQA 1PGOA 2G5PA 2WBLC 2VDJA 2VOEA 1PW5A 3WRWA 4KG7A 2Y68A 3JQ9C 5BN3A 4DCCA 1OPXA 3EMVA 1X2BA 2V3CC 1JZTA 1P2SA 2YUIA 4DIUA 2D6FA 4NNJA 2AG1A 3FZYA 3IHLA 5ALKA 3PVZA 5I4BA 1Z33A 1R9MA 4UJ5A 1M67A 2I8AA 3QFFA 1P29A 1ENOA 5JHGB 3GJYA 2PGLA 2Q8PA 1O96B 4IXDA 4ML3A 4WXRA 1V4BA 2B25A 5LA6A 3U3MA 5J2TF 1NW5A 2Y27A 3C98A 3FDXA 3HBLA 2VNJA 3NKFA 3RSSA 1HDCA 2G0TA 3RM3A 3T8YA 3WQSB 3VJRA 2RH9B 3HYCA 4I55A 4HWOA 5REQB 3X2SA 1DBRA 3EFOB 2Z4RA 3EOAI 3KLPX 1HL7A 3P0FA 1KDZA 4BUZA 3MW8A 2C2OA 3IKLA 5I7FA 1PZMA 4YN3A 1GYQA 2R48A 4YMIA 3E1SA 4K5QA 4F86A 2AC2A 4ZCTA 2BY4A 3KLBA 2FFQA 3L0PA 3DQQA 1DLIA 4YJHA 3U61B 1GPYA 1FJHA 4PX5A 4YRFA 1T3GA 4Y9RA 4GDMA 4DZZA 4GMHA 1O6FA 4R2IA 1S3SA 4DAOA 4BGUA 1PVVA 5K3OA 3QE0A 3C5EA 3HKDA 3UT5B 5ILQA 3QY0A 3P20A 4TYQA 1JAXA 5AHOA 1YI8A 5F9MA 3ROKA 2CXXA 4OSOA 3EJWA 2JD2A 4XB2A 2HWWA 2GF9A 3ETCA 3IBFA 4OHZA 1HZJA 5EXTA 4A15A 1CUCA 3SXUB 1J0EA 2PCLA 3NETA 4HLNA 3UWMA 4BMNA 2BFFA 3KQNA 1T5LA 2QRQA 4BX3A 1TGYA 3OX2A 1AKMA 1FP2A 3B5EA 1AKTA 4HB0A 2GZ1A 1I13A 1F17A 4LPKA 4TKMA 3I8XA 3RBAA 3F78A 2JH9A 1QGUB 4TKUB 3ZS9A 5A1TA 3R9WA 5A7GA 1Z34A 3INNA 3P96A 5AJTA 1B3BA 2CZCA 5HKAA 2YY5A 7ADHA 3OCYA 3G68A 4DDWA 2BKXA 4C22A 3LBYA 4RJ2A 3RSCA 1J6UA 4KYIB 3W3AD 4MS1B 4RD4A 5I9BA 2PLNA 5H3HA 4NFHA 1Q6ZA 4V2UA 1JIQA 2WTEA 4TSRA 4JUDX 1J5EB 4IDDA 1XLTC 2MYPA 3OZVA 4HF7A 1H23A 1P7VA 1JAHA 1ZD4A 3JQ8B 3P4XA 3ELBA 4GLJA 5BUZA 4FGWA 3HLTA 4RFSB 3IKTA 1AHNA 3ZCVA 1F2UA 3G2MA 3R7BA 3ZWWA 3KQQA 1RWWA 4CIVA 2H2HA 5U9CA 3W5BA 2O48X 1FXWF 4P93A 2P77A 5IARA 4HDRB 3M3PA 2WPNA 3QUCA 3WYEA 2GM3A 1KAOA 4PLFA 2OCBA 3G5TA 3GN2A 1B8VA 2JK1A 2ZTLA 4YQEA 3AVTA 2P90A 3FNHA 3AEQB 2W93A 1ONBA 4LSMA 1BHQ1 1EZ1A 3SF8A 1BRTA 2CEKA 4RTRA 2YFYA 3IA2A 2JIDA 1DXHA 2AVDA 2ISSD 2BM8A 2OV6A 3FDFA 4PZCA 4AJEA 4EBFA 1F8XA 1PR2A 3I83A 4CMHA 1SHZA 1TUBA 4RF4A 1C30A 3ZD8A 4WT7A 5EJ6A 3GDWA 4IHJF 4D45A 2IYZA 3H1FA 1KDVA 1STOA 4YJDA 5KTRA 3FPBA 4JASB 5B4VA 3FI0A 4Z3OA 1PT9A 2AYXA 3FZEA 5I9MA 1AKUA 3AFNA 4HDMA 1CR0A 3L7CA 1IDN1 3BGIA 4ASUD 1BIFA 5T8KA 1ABFA 1D1QA 1RRVA 1WU7A 2DLDA 3VV2A 2I4TA 4RMNA 4YGXB 2QI9F 4LJYA 3OSUA 4TTJA 5FI3A 4I9HA 5A04A 4EELA 4WJLA 4TYYA 1FJ2A 5BNWA 5KVQA 3QG5A 2JGKA 3AQIA 1WPGA 2BGJA 2ZI5A 1BVUA 2Q21A 2VNKA 1FJGB 1KR5A 3LUGA 4P1ZA 2OCAA 4F12A 4LOLA 1BA2A 1C9YA 2IXGA 2JH3A 3DCIA 3EN0A 3PLNA 3ZZTA 4AG6A 4BP8A 1GZSA 1K5HA 1ZRSA 3JQ6A 3OJFA 3PQ7A 4KXMA 3IVRA 1X9IA 4RCYA 3ZDEA 2FG5A 1GFIA 4QQRA 4YAFA 4XGIA 1DAMA 2WAOA 1OKKD 2QD4A 1QBGA 3WWEA 5A0FA 5AKXA 1R12A 4YJ2F 4EPYA 2QI9C 2QRMA 4JL6A 2PWBA 4E70A 3T0FA 4IJ5A 3C3CA 3TQHA 4CKXA 3VC7A 2DRIA 1WZCA 2XVAA 4KAJA 2IZZA 5BT9A 3ZWCA 4K87A 3ZHYA 5B64A 3PUWA 5IEBA 4GWLA 4IMIB 5C4IA 1JEEA 2NTJA 3EH2A 4DDMA 3SQOA 3FB1A 3BGVA 4J91A 1J0BA 2Y66A 3FUCA 8AT1A 1DBQA 1QC5B 1ZLYA 2M9MA 4QGFA 3RTGA 4JJ4A 2FZ5A 3VTAA 2FPUA 5ABPA 4C14A 1CHDA 2A5JA 4TV8F 4E7OA 1AKRA 1LNSA 1TQ8A 1NQAO 2G1UA 4XQ9A 2FMXA 2ZIAA 3TL2A 2WG1A 3MIZA 4NH0A 521PA 4LJ9A 2DQZA 4NEQA 4W6QA 5JSZA 3H5OA 1H9CA 3GDOA 4DSZA 4JOCA 3DT8A 4S04A 1YS9A 1J39A 5BYAA 1HT2E 4WXMA 1KQFA 2IV2X 1VIYA 1J07A 4UHEA 2Z43A 4M53A 4GVLA 4V0KA 4MV6A 2CDRA 2OB1A 4NBLA 1UC5B 3BX1A 3N2EA 3PE3A 4IIVA 1GZHB 3VR1A 1W4CA 4RCVA 3O31A 1Z6YA 1FLNA 1MJGA 2RH5A 421PA 4C2AA 4JYCA 1RKQA 3WZLA 1Y9AA 4KWHA 4XARA 4EBBA 5IVPA 4RTLA 2PIAA 4QPJC 1KJIA 2O3UA 3KZVA 4EQ6B 3WL3A 4J07A 1IBSA 5LMUB 2RBKA 5CUQA 2YXEA 2OV1A 3GRUA 3DV2A 2WYVA 2P5TB 1W87A 3UMVA 2AMFA 4YUAA 2Q99A 1YTLA 1WKBA 3OCCA 4Y2YA 5TY0A 1Y5LA 2XUHA 1RWOA 1BMQA 1HYBA 3L5OA 2QE6A 4Q05A 4AJ9A 1J90A 3AUAA 5J4LA 2PSFA 1W5TA 2DT8A 3DAYA 3DONA 3VJKA 2BGKA 2WD7B 3EVDA 5IDQA 4IHQA 1MTOA 4QSMA 3V4PB 5D5HA 1L5ZA 1T9GR 4K0RA 2DUMA 3LX5A 2B6HA 2XTAA 5K6TA 2R1UA 4OPMA 4A16A 1P1RA 5IANA 3FYUB 3LQFA 4ISBA 2OY0A 2RC6A 5IHXA 2F43B 3I12A 3VOTA 4ZV7A 3VZQA 3KWMA 2ZBUA 1I2MA 2J41A 4CG1A 3U3OA 5GONA 4MGHA 4Y2RA 4WK2B 3RG2A 3HVHA 1WB5A 3C1TA 3GB9A 2E82A 4JP3A 1Z25A 4IL5A 2WP0A 3QU5A 4JBHA 3IAEA 3ZHOA 5K3FB 4BRZA 2HWYA 3DEFA 1CF9A 3QLUA 1K6JA 3QVOA 1P44A 2DKFA 4Y1GA 5AKEA 5JFTA 1J56A 3EGOA 4D42A 2ZE7A 5K20A 2DR2A 4IIJB 3OPYA 2A5LA 4I4TA 3U3RA 3WSVA 3V8NA 2I2FA 5L95A 1JDBC 3RYHB 2X2FA 5AHXA 1FSGA 1RBYA 1H3FA 1I33A 1E7MA 4M0LA 4UVEA 2AFVA 2DR3A 3CF0A 1FOEB 1DX6A 3BG5A 4C0QC 2IHZA 4EJ2A 5ICSA 1XRLA 2ENWA 3ILXA 2HCJB 1F1BA 2C9CA 2EFHB 2IX3A 2Z3VA 3O3MB 1KI6A 5DEOA 4O4LB 2VATA 5I7HA 1H2XA 3IXLA 3K9WA 4DLTA 4EX7A 1GA1A 2C1XA 1SVIA 2GBLC 3G8AA 3TFQA 2AXQA 4P4LA 1RMQA 1WQ3A 4E32A 2GN0A 4L7QA 2GN1A 4L4SA 3H99A 1Y63A 3DR3A 5IEJA 3ZV6A 5I9NA 2B0CA 1QCDA 2XRFA 2HC9A 4N7JA 5T3UA 1NZDA 3VZDA 2D2XA 3O8CA 3B9QA 3G5UA 1T5DX 2C2YA 1WVGA 2OK8A 3NX4A 3JQGB 4LBYA 2I55A 4LHZA 3V4LA 4B44A 3GZNB 4EMTA 1NMEA 3R5FA 5LQAA 3RHFA 3G13A 2OHFA 2M6KA 2A9PA 2JGAA 3DZBA 3RFVA 2Y0CA 4YCNA 1QHYA 1SOWA 1TOAA 2FQWA 3MYRA 2XNDD 4QFDA 3KIPA 1HKHA 4CIWA 2E21A 1APBA 4WGGA 5DK6A 1Y8RB 2R7NA 1D07A 2HPAA 2JF0A 4BBZA 4EJMA 4JVNA 3QTLA 3ZTWA 4ZOQI 1L5QA 1Z0KA 1Q1NA 2IYUA 3ORHA 2ZDHA 3KQMA 2FUCA 2Q4BA 4H08A 4JT4A 3ROEA 5AVUA 3EDYA 1E58A 3LHIA 2VXBA 3RYCA 1OVGA 4RIIA 4O4IB 4C4OA 5K0GA 4JB8A 1Y82A 3A11A 3LC2O 2D0IA 1GN8A 4L75A 1RYFA 4OHYA 2PS0A 1QP8A 5LZ9A 4H2DA 1N8NA 3IMEA 4ZO4A 4M9RA 3FSEA 1TJ4A 5A4AA 5CLFA 3VOAA 3E5HA 2NQ8A 2WIJA 1CE8A 4XSHA 3OTHA 1GKUB 4YAWA 1YH3A 2C1ZA 2AOVA 4G8DA 4HZUB 4QGSA 4RA9A 4IS2A 5L3VA 4ZI7A 2AK3A 1KJ8A 4XUDA 3QKWA 1WMSA 2BGNA 3KAQA 2A14A 3PGA1 1XO1A 2W2VA 1NJ2A 4QXMA 3C7CB 5FX2A 2VA8A 1Z39A 2AHRA 4KR0A 4MR7B 3C3PA 3ZHUA 1Z5UA 4NBNA 4DVGA 3FR7A 2C9MA 5H4HA 3G2NA 3NNNA 5HCUA 4UNRA 3JS5A 4JI1B 4UBOA 3TBHA 5ALRA 2XPCA 1RHUA 2PUVA 1LWOA 2W90A 3COJA 4BFUA 3CN9A 5CK4A 1RM4A 2B20A 4X65B 1UBJS 4TV9B 5T3YA 1FS4A 1FTWA 4U9UA 1UCFA 2IYEA 4LMAA 2QENA 1W8IA 3TSYA 3V33A 2CF5A 2OFXA 4W1PA 3VJLA 5CYGA 1R4AA 4K9MA 3OLWA 1CPYA 5G0TA 3DAHA 3TOCA 3WK9A 3B5IA 5LYJB 4HKTA 2R3SA 4DFDA 1W5EA 1U0EA 2PQ0A 3OT5A 4ZAXA 5BUSA 1R64A 4G1MB 1PQYA 1T8PA 4NPAA 4WZAE 3WRVA 3A6DA 3C74A 5LIPA 1PJSA 3AEUB 4M9ZA 4BU0A 1SC6A 1SKBA 4CKEA 1H65A 1EUDA 2WYWA 1SPBS 1GQ2A 1RIFA 3LHDA 5JC1A 1W4AA 1U2ZA 4ZT7A 1IATA 4PZUA 1VG1A 4B6QA 4F6RA 3NPMA 4ETIA 1DOZA 2XCTB 5SYMA 5CD9A 1T2UA 3A1VA 3JAKA 5FPPA 3IBGA 4R1QA 4CNBA 3EW9A 1ZI6A 3BRWD 2GETA 4D9HA 5GIPE 3K5IA 5FB3A 3KQUA 4NCNA 1CUYA 1E7YA 4Q1DA 3SU8A 3O8BA 2OD9A 2B1RA 4FLEA 4G5GA 4XGRA 4XFJA 2WR8A 4BJ3A 2IKSA 4CL3A 3R9XB 2YJZA 4R98A 4RGYA 4XH9B 3MWGA 4L57A 4UCFA 5A5VA 4UFNA 2F1HA 1XZHA 1Y3CE 4DR7B 2MINA 3LC0A 2DPYA 1Q50A 2C3YA 2HGSA 1W9HA 1EVKA 2W2PA 3LZ6A 3HCRA 5EE9A 1M3SA 4DGSA 1OWOA 1V25A 1KQ3A 3L46A 4FMPA 1NLMA 5HR5A 1DX4A 1ZLXA 2HHHB 4TSFA 4NENB 3RTAA 2AN5A 1I5OA 1O5OA 2GLXA 1EQAA 4OJNA 3T9EA 3WLTA 3MC1A 1B0PA 4ER0A 2VP9A 5B2EA 1EGAA 3LYHA 3CUVA 3NHBA 1LK0A 3D6TB 3S81A 3KQHA 3GYGA 3HEMA 2HNBA 2YYYA 3AUXA 1U8FO 3BA6A 4PYRA 3UAGA 2GPSA 5ISMA 1QIFA 1EEHA 3V4OA 1QHHB 1NWHA 2VP3A 4ACAA 1AB5A 4ZN6A 2OGZA 3PC3A 2E55A 5JNWA 2EZ8A 3UCEA 2XB9A 5CNJA 2V97A 3OESA 1H66A 5CA0F 3F6EX 2JLQA 2I6GA 1RAHA 1RQXA 1QQ6A 4TOIA 1T4CB 1RI2A 3RSOA 3CW2A 1ZBQA 1KEWA 4N9QA 5JLAA 2D59A 2DWCA 3AGPA 2V5UA 4MV0A 1L3IA 5DHTA 3ZDYB 4FM9A 5CIYA 1NVBA 2FW0A 2WSSD 2FSVC 1N3YA 621PA 3ASUA 3TGPA 2X9QA 3N2IA 2V55B 1U4SA 2J9FA 3OX1A 2NXEA 3DW3X 2JA2A 3WNZA 1NMYA 3H1TA 4HPWA 3ZHCA 3ZHVA 1QH8B 4GI2A 1V16B 3QPWA 2A0XA 2HX1A 1O9HA 4PC3A 2VSFA 2AE1A 3V8RA 2NPIA 4EVQA 3TX6A 2JHCA 3PT5A 1A97A 3DOJA 4KWCA 5IP5A 4IX1A 1CIPA 2A9OA 2R6JA 3NHLA 4HMOA 5SY4A 4A9AA 4EHFA 4F9EA 5J58A 4GYJA 2IXFA 4PZAA 1YZFA 1MUUA 4ZCSA 1ZVMA 4KVAA 5GGYA 3RVMA 4F4IA 3RRFA 3K70B 2Z9DA 1TQ4A 5ALYA 2C2WA 1ZAKA 1N57A 2W4MA 3DMGA 4IOKA 4PAOA 5GWXA 4WZBB 1AM4D 3DO8A 1G2QA 1H1TA 2H3HA 1H69A 4HEHA 4X1IB 1ZU4A 5DHFA 1WD7A 3TW6A 4BNIA 1XZPA 5JMTA 3QKUA 1JGTA 3FMOB 2X2OA 4G63A 5KNDH 4DCTA 3ZK7A 3V9AA 3OX3A 2QE7D 4OGFA 1P3Y1 4A8TA 1XEXB 2EAUA 2K6GA 4GMKA 1SXQA 1WHSA 2CY0A 4YC7A 3VUFA 1T6ZA 2F17A 2IHNA 5E8RA 4AZ3A 3X1MA 1YBMA 3D6VA 1TAUA 4DUYB 4KDFA 1DT5A 5IUJC 1X70A 3AR4A 5KQRA 4N5NA 3ICQB 5BURA 3OKCA 1CBUA 1BX0A 4HAUA 4KX3A 1JDSA 1A7AA 1MDBA 1R66A 4G5SA 3ZU4A 3WLIA 1JH8A 4WW0A 4LJ5A 3P9ZA 3G17A 4KIFA 1OBCA 3EEYA 3HLKA 4QOEA 2ZPUA 2JJ2A 3BB4A 4JITA 2AXEA 1KVSA 4RXUA 4E22A 1Y6FA 4BLQA 3R9KA 1R4ZA 1E2DA 4Y2VA 4AZ0B 3HKBB 2W0SA 1RXVA 4OQQA 3A3KA 5L51A 2C7VA 4I1OA 3NCTA 4XRRA 5AT1A 3RVQA 1H2RS 3PNQA 1V45E 4O3FA 3VDXA 4UOZA 3WOVA 4F2GA 2HHJA 4B32A 1OWMA 1CRZA 4UTRA 1D7OA 1KHTA 4MVYA 1PGNA 5CJ2A 3RVKA 2D54A 3ZZ1A 3DBOB 3KLNA 5IK2A 3MLAA 1PG2A 2J0UB 3G7SA 4NE7A 3RVLA 4AJPA 5BMVF 3E5RA 1CD5A 5BWCA 2X4GA 3ORRA 3IV7A 4CM3A 3H8WA 4JB0A 4NS1A 4TLBA 5EWLA 1GKLA 4IHAA 5TEWA 5HDQA 1S4QA 3AERA 2GVDC 3K09C 4GKKB 3RKSA 4GGPA 4D3XA 3L7LA 3UWKA 3GA5A 2QZ4A 2X8JB 3ETGA 2QNRA 3JU3A 4YRSA 1FRQA 1YZVA 2DVMA 2FP4B 4B7ZA 5BSFA 5C8VA 1P8JA 4KMMA 1KOFA 4MW4A 3VPCA 2UZIR 2HSWA 2EYQA 2O2XA 2ZBQA 2BFEA 4YCJA 5E9JA 5FR2A 5FWDA 4DA8A 3C7AA 2ODPA 1UJ6A 1BO6A 3AJAA 4NJMB 4M0KA 4DWOA 2JLVA 2WVHA 5JSKA 4G0YA 2PIDA 2LXNA 4C6RA 2CCGA 4IF6A 4LW8A 1J70A 4M99A 4RENA 4XJXA 4YUYA 2Z2ZA 2PX6A 1EB8A 2GBFA 1WUTA 3C6MA 4RGVA 3O75A 5HUHA 2FZGA 4RD6A 3UV6A 2FN3A 1RRKA 1LNQA 4G37A 3QIVA 4EFLA 4EF5A 1RPZA 4RSMA 2FX2A 5FOTA 3T7CA 1CCWA 3IDSA 5DM0A 3O83A 2YZKA 1S01A 3C45A 2EWMA 4OQYA 1E61A 4DV2B 5DI9A 4D57A 1I5RA 4BRSA 1XL0A 2Z1NA 1L1EA 3BMQB 1R8SA 1QJ4A 1XEFA 3AJDA 4HGPA 4L2IB 5FO1A 4DCSA 2BM9A 3HCCA 4XFDA 3NHSA 4ZOLA 3B7PA 3FPJA 3B6EA 1PS8A 3DE1X 1TJNA 2FWAA 2GDZA 5F5XA 5LMNB 1JEYB 2INGX 4GU5A 4KQKA 1DIBA 4PGAA 4EI2A 1ZESA 1BVYF 1A95A 2MHCA 3N07A 4R81A 4O33A 1T5IA 3ACDA 3EGEA 4TQAA 1EFRD 1RWXA 3S8EA 2CHGA 1HURA 1LBSA 1G6HA 5B4UA 3JARB 2CXPA 3NV7A 3Q12A 4MDHA 4U2EA 4BNFA 3TCXB 4QXOA 1GKKA 2XXAB 2QN2A 4YQYA 4DJTA 4H1WA 4R1NA 2FLVA 5MN4A 2ZIXA 3NGLA 1JHVA 3HZHA 3TZBA 3WQQA 2TMYA 4MIEA 5EJFA 4AX4A 3R74A 2PRZA 3NM4A 3V42A 4AJIA 4EMBA 2ZWOA 4L9WA 3MCTA 4IIBA 2CVZA 1PNTA 2IS4A 4S1WA 2J30A 4J4BA 3O4VA 1TCBA 1CVLA 3EA4A 4YMWA 1NAHA 5BOVA 2AZDA 2M98A 1PZNA 4B17A 4MW6A 3H2KA 1JEQB 3NIFB 4YRBA 4TUYB 4DB4A 4Z4FA 2IIVA 3ESQA 4C21A 4UMFA 5DISB 1R6UA 1BSVA 2O7SA 1R9NA 3LFUA 4UEQA 4PBSA 4CM6A 1TGVA 3OE1A 4X1YA 5KSOA 1Y5MA 5EWMB 2PS9A 3KALA 4MKRA 1WEKA 2VAPA 3SHWA 1S7GA 4RE6A 1C7IA 1YR1A 4PTLA 3ZWAA 5IBCA 5K0BA 3VR6D 3V1TC 3H1EA 3DKRA 3P52A 1P2GA 2GN8A 2HSZA 2QD2A 2ZIUB 3AJRA 5DCYA 3ZZMA 4B1FA 3X3HA 1Q0TA 5L9AA 3OQHA 1M1XB 1Z6AA 1CP3A 3A9VA 3VZSA 2P9GA 3BKWA 1E6LA 4H3VA 3ZWKA 4JOSA 5DF1A 3ABZA 2PZLA 2XADA 3L9XA 1RHMA 4LSZA 1EX9A 4DCUA 4F0JA 1O95D 2VYQA 3RFFA 4EYQA 2JFZA 2JJ8A 3KTAA 1XFDA 2UYCA 1QIGA 1T6NA 2WICA 3B3AA 3LIIA 3QLTA 4K3UA 1NBME 4BLUA 3RADC 4A1OA 1MOSA 1NW6A 1PX2A 1VGVA 4BE9A 2VAMA 2ZYUX 4FBMA 2OA0A 4D99A 2WQZA 5A3JA 1PR4A 3ROTA 1ODSA 2HD4A 1VMEA 1H1LB 5IFLA 5ALLA 3TGLA 3HV0A 4RSRA 3EDRA 1NIPA 1EFKA 1C1XB 4PS0A 4WA7A 4ARAA 5HJEA 2C9BA 2BVNA 2JIZD 4FNOA 3DMPA 5HE9A 4AD8A 1UQRA 4DCOA 4DMHA 3J7AC 3LPDA 5CHEA 1Z8HA 1EGHA 1CERA 1HG1A 1AD2A 4ND4A 2C57A 4IUYA 3K4QA 4WCFA 4D9KA 1VBMA 4IILA 2FOXA 3ADOA 3Q11A 4EYEA 3DEYX 4II2A 4YLYA 3NAZA 3HUUA 3DOUA 3A6FA 3GH3A 4G0XA 5IVHA 2OCDA 1GL9B 1I2ZA 2YJ3A 3H2GA 3WFJA 3AOGA 3KD3A 1VE7A 4EFMA 1ZJYA 1L5VA 4AJNA 4JC4A 1YT5A 1UT5A 1V9SA 1W5FA 4K6HA 3WB9A 1D3AA 1ZRNA 3QX7A 4AUMA 1E3SA 3G1UA 3L49A 1OTHA 3P2YA 4HYQA 1SB9A 3CE6A 3VTFA 4A6XA 4IGAA 3SEAA 3I23A 1RYMA 4UJ3A 4YP0A 3PC2A 3DQPA 4WFIA 4PG5A 1N6NA 4XTCS 4JU8A 1AK9A 4RM2A 5F51A 4O3MA 4EG3A 3W0LB 1CY2A 1KDYA 4B0PA 3FSJX 1AUVA 1TF7A 4K3VA 5GPBA 2NUTA 2KYRA 4C4RA 3MTGA 4DARA 4DUGA 3MRTA 5GINE 3NUGA 5F7ZA 3GROA 1Y98A 1X3SA 3SVZA 2O2DA 4UUNA 5JH7B 4C0WA 1TADA 1Y80A 4LY9A 1ZO8A 2ZAYA 4GW3A 3QGMA 5LJIA 3GJ6A 1OOEA 1ZH6A 1IMJA 2KBEA 2XUDA 4MYUA 5AVJA 4HDNA 4RADA 1P31A 3CTMA 5HS4A 3C8MA 4XLZA 2MYTA 2W2LA 2Q4OA 3OQMA 1QB8A 2QUBA 2MT9A 1RZRA 3OQBA 2QIOA 3MJ4A 4ZYUA 3BMXA 5J43A 3OWHA 1LZLA 2ZSDA 1OR8A 4N5HX 5UKDA 5BN4A 5LZ4A 3N74A 3SPXA 1QYXA 2ZS8A 5JDCA 1M1YE 1GP2A 2YBDA 3OY7A 3S7TA 3SHQA 1C9NA 1TUIA 4OB6A 3DF7A 5FTMA 3WLSA 4O1IA 4DGQA 3BE8A 3U7FB 4DBLC 4PIMA 1B4DA 1XKXA 1F7UA 4MWZA 3RB8A 3TINA 5AJHA 4INPA 1EGMB 2OQRA 2HBRA 4GOXA 2GM9A 3EFEA 4E15A 1M0TA 1ZCJA 4H3KB 4XGKA 4BJ5A 3BL6A 4W9MC 2WWRA 1LPNA 3QMMA 3SZOA 3TIVA 4C04A 5AKHA 3A0UA 3ZE7A 5H02A 2X0FA 5DCWA 1I7LA 5F1YA 4B7CA 2BFAA 2BC9A 2COEA 4PTZA 5KYUA 4DPMA 3NKLA 5DI3A 1LQTA 2CUKA 4A0QA 4JJKA 1ZKMA 2EIHA 2XGOA 1BVRA 5KWIA 1AGNA 2FSUA 5LZ8A 3WYNA 1SBCA 2QVLA 2VH1A 3HB0A 2FRXA 1N8TA 4DQUA 4QBKA 4RTOA 2IS1A 2YH2A 4HUQA 4D25A 1ZWLA 2QV7A 5ER6A 2WY2D 2NQTA 3GFTA 1EBUA 3HSSA 1XYGA 3N0XA 1U6IA 3NOQA 4I6EA 5KNCH 2RGBA 5HZKA 3F8SA 4HEA1 4HQFA 2H4JA 3CR3C 2BP7A 3BSYA 3NO4A 4O2AF 2Z8YM 4JHLA 1V8PA 1QIMA 5D5QA 3WBFA 2REQB 3CVOA 1LB1B 3VKVA 3WMFA 2F62A 3ZCQA 4QFCA 3SHTA 4CLRB 5TGTA 3C3MA 2WTNA 4GNKA 5FULA 3DE2X 4F84A 1A9XB 2R00C 3FXAA 5AVXA 5IJZA 2F1IA 3JVIA 5D01A 3B6MA 1O6CA 2JFNA 3N3AC 3PA6A 4IFBA 2I33A 3GJ3A 3U80A 5C81A 5A9RA 2QUIA 1XJCA 4I4CA 1ZD5A 1X1BA 3KLOA 4DCMA 2B78A 3BCHA 3OJOA 4QFBA 5JO0A 4KYTA 1MW9X 1JSXA 4US1R 4F1KA 3AWIA 3GVIA 3RTBA 2QG4A 3ANXA 1UOPA 2WAMA 13PKA 5TJ9A 4DV0B 3PEWA 1NX9A 2Q6TA 3DEKA 4N7BA 1I2DA 2VZLA 4CCSA 1OIWA 1UIRA 1ZOOA 4MVJD 2I78A 2C4TA 2WAAA 5GOTA 2VPYA 5AVOA 1GZ3A 2WHPA 5DSXA 5E2BA 3F67A 3IUYA 3C8HA 3LAWA 3ZX5A 2CDBA 2W11A 2GLUA 2KLHA 3D3WB 4AWBA 5FUMA 3HY4A 3MQFA 2I5PO 1XR3A 3QF4A 3DBRA 4UEJA 1WWKA 5G0VA 1KS2A 2BFBB 1KS9A 4GR4A 4A3SA 2GAJA 2J08A 1JA1A 3T4UA 1W85A 4M1YA 1XHEA 1EAMA 4G3XA 3NCHA 2ZSEA 4ZU3A 1K2WA 4D97A 3OZDA 2CV2A 2HWKA 1FYEA 1JN0A 2ZLBA 5AVZA 3AFHA 1LDYA 5IRCD 5F7JA 5ALZA 1SUCA 4Y2QA 1HRDA 4KN8A 2BEWA 2HU8A 1NJGA 3S2GA 5CA1B 2LNDA 4JOBA 2ID8A 3KAKA 3L06A 2AJLI 3FNEA 1L7DA 3ND9A 5EE1A 3ZKWB 3WK7A 2XB2A 2XYPA 1XQWA 3VVLA 2RFLA 2MTBA 3VHLB 5L6MB 2BDTA 1OCEA 4UZFA 4K9PA 3WA7A 1A2KC 1M8JA 2OAP1 3QSYA 3NBUA 1KBZA 2HLPA 4QECA 4U7WA 4HDCA 1T2DA 3VR2A 1NVXQ 1RIIA 2A6PA 3CEPB 3O1LA 5BN5A 2VK8A 3LQQA 1I1QB 5E6UB 2DZDA 3F5SA 3G0GA 3TOVA 2HRCA 4XUEA 4Z4IA 2PVSA 1XAIA 1WXWA 1GO2A 3IDQA 2WFAA 5FUQA 1MD9A 2PBFA 3OEHA 4CJXA 2PYIA 3MAAC 4QHSA 1KO8A 1JIVA 4CZ2A 2A0FA 1HMPA 2Q9BA 2ZG6A 3C14C 3CM0A 1GDDA 4GOMD 5FA6A 3MCVA 3T54A 5K8LA 2Y6VA 5JS8A 4L8VA 1Y8QB 2FEOA 3TPFA 1Z26A 3UMCA 4XGNA 5IBQA 3RE1A 2R6GA 2OCLA 2J3HA 3VOBA 5K0ZA 2WWTA 3TD6A 3DDSA 2G08A 4C9BA 4B4WA 5KBYA 4E94A 1Y6RA 3LLMA 5BSWA 3FTNA 4OX9Y 2FW1A 4I4IA 3SQXA 1XP5A 1P6XA 1U2SA 2PG3A 4WGFA 2J5RA 4IR7A 2QTVB 4OBEA 1M0EA 1JLMA 2REXB 2OXFA 2Y9MB 3I72A 1MJFA 1SCUA 2QYOA 3IV9A 2R65A 3CF2A 3FNIA 4AZTA 5B3JC 1TLLA 2J09A 3IS3A 3W77A 2D7CA 4QXPA 5HRAA 5KNBA 3W9SA 2O05A 4GBED 1JRLA 1YBAA 4BDTA 4Z49A 5ESXA 1NVWQ 2H2IA 3OM0A 1K7CA 4KO3S 2PUAA 1SCNE 1UK9A 3KJXA 3TRFA 3ESYA 4KDCA 1Y0BA 3H86A 3HWX1 4MV3A 5D87A 1XHFA 3TDMA 3DJYA 3K6SA 1BOFA 2G3YA 3H2IA 4TTVA 2XE4A 4YT2A 4S05A 4LF6B 3RANA 2GPWA 4DZTA 3EUFA 5LZ2A 4R6XA 1HDRA 5BSHA 4QNMA 3ESAA 5CHYA 3ONNA 4HGYA 2PD3A 2UDPA 4JJFA 1BS9A 1U4OA 2YWDA 4JVLA 3BRSA 4O5OA 4B6JA 3EA5A 4QRIA 4MUBA 1VHTA 1R00A 2CJWB 2IP1A 2PJDA 4BP3A 4WFKA 1UPUA 3MHTA 2JNWA 1IQUA 4COKA 1AHPA 4O5AA 4EI8A 3PWZA 1S8FA 2C95A 4G9BA 4N6NA 5JC8A 1GUBA 1FX1A 2GO7A 4ISCA 3S70A 3HB4X 1DC3A 3EARA 4L1KA 4PX3A 5CJPA 3FH0A 5IUNC 5JQGA 5DULA 1SQ0A 2QAGB 2MSDB 1MQ9A 1NKTA 4QBTA 1KI3A 3LQ1A 4NHEA 5DRYA 4DM7A 4UARA 4XEHA 1EG7A 1HNWB 4V1CB 3CCFA 2H17A 2WA2A 1F2DA 4BXOB 1V0JA 5CVDA 2QMUA 2VH2A 5CCEA 3NIWA 4EY5A 1PYDA 4ZEOA 1K6XA 5KOJA 1VI5A 2LCIA 3NG1A 4CE6A 2Y1OA 2I66A 1M66A 4QBHA 3NXKA 4YVFA 3HR4A 1YNOA 2JAQA 3WLRA 3STXA 3NEPX 1TCVA 5HE8A 4DA9A 3VXKA 2I7CA 4PY2A 4YUVA 4ZK2A 2ATCA 4AQYB 4V03A 2B5WA 4F3KA 4MGYR 4RORA 2C5BA 4MR8A 1QE3A 4RKQA 4F72A 1DTWA 2N1MA 3LK7A 4ZCQA 3VH3A 5BP7A 1LH0A 4R3WA 5ALHA 2DSNA 2MJLA 2SICE 4GXNA 2BGGA 1YFZA 4EHBA 2GEDA 1UAYA 4EGFA 3FYCA 2OV2A 3UFXB 4WESA 1Z9BA 5KQGA 1P62B 5DLEA 2FZ4A 4YJGA 2QTBA 3EOBI 3P9IA 3Q2IA 7REQA 3DZCA 5HFNA 3EULA 1WQ4A 2AWOA 2C9OA 2WF6A 2WYOA 4R84A 4WK0B 4A10A 1O6BA 1AQIA 4DLUA 1RC0A 1Z0JA 2E4AA 3CFYA 3M83A 3WRYC <