3IBFB

Crystal structure of unliganded caspase-7
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
KIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational similarity in the activation of caspase-3 and -7 revealed by the unliganded and inhibited structures of caspase-7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Caspase-7
total genus 18
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2009-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3ibfB00
2CJXB 3GJSB 2CNKB 2H51B 4DCJB 2QLJB 2XYPB 3R6GB 2C2KB 1RWWB 5K20B 2H48B 2QL9B 3D6MB 4LSZB 2H4WB 2QL5B 4ZVUB 4ZVRB 2FQQB 1SC1B 3R7BB 3EDQB 3P45B 4DCPB 3IBFB 1SC3B 1BMQB 2HBYB 3R7SB 2HBRB 2C1EB 1ICEB 2XYHB 1RWVB 1IBCB 2QLBB 2HBZB 2C2MB 3D6FB 2QLFB 2XYGB 4ZVSB 3EDRB 1RWXB 1QDUB 1RWKB 3R7NB 3KJFB 1PYOB 2C2OB 2CDRB 1RHMB 1RWMB 2CNLB 1F9EB 3IBCB 3R5JB 2H5JB 4ZVQB 1I3OB 5IC4B 3GJQB 3RJMB 2H65B 2C2ZB 1RHJB 4ZVPB 1RHKB 2HBQB 1PAUB 3NS7B 2H4YB 2CNNB 5IC6B 1RWPB 3SIPB 3KJNB 1RHQB 2XZDB 1RWNB 2XZTB 2DKOB 1I51B 1RE1B 2H54B 3D6HB 3KJQB 1RHUB 1NMEB 2H5IB 1SC4B 4ZVOB 2Y0BB 1RWOB 2QL7B 1RHRB 3GJTB 4ZVTB 1GFWB 2P2CB 4DCOB 2CJYB 3R6LB 1QTNB 3P4UB 2CNOB 2Y1LB 3QNWB 4JB8B 3GJRB
chains in the Genus database with same CATH superfamily
2B9XA 4C6AA 2KJWA 3NNCA 4DX7A 1XN9A 3ISND 1QM9A 1FEEA 3C6TB 2GJFA 3AT1B 3MD3A 3W8PA 1ZM9A 1PYTA 2WSEC 3DOMA 2JFKA 4KIAA 4LIRA 3OLAA 1KOOA 2D3ZA 1JNRB 3BREA 4QQBA 1X4DA 4IRKA 3BQ2A 2AW0A 2R2TA 2XMUA 2H48B 3NNHA 3SSQA 1H73A 2HHPA 1CQNA 4ZP6A 3ZZRA 3H7HB 3KDOA 3UN5A 5HMWA 1X0FA 4M95A 1CC8A 2A1BA 4IH5A 4I0WA 2BJ8A 2CG8A 3QWUA 2XMJA 3JSMB 3CTRA 2POKA 2GVZB 3KHHA 3H5XA 2ZITA 2GO9A 3I82A 3OR1B 2VPZB 4MTPA 4CLLA 4NLUA 5KFMA 2G0CA 1KEKA 4IO1A 2JC0A 3WBZA 1W7WA 3HT3A 4ZDNA 1M5OC 5HL7Q 4AL5A 2I1RA 1IKYA 2IDLA 1RWVB 2MY8A 3Q8QB 2WONA 2AT1B 2CWKA 1WG5A 1FXDA 1KWMA 4QIWD 1QY7A 4ECZA 2HGMA 4UY8T 1U6FA 2V50A 3AB4B 2Y8YA 3CNQP 1RWKB 3EE3A 3MM7B 5BR8F 3CJ4A 5A8WA 5M2PA 2PI5A 2UVRA 4EI2A 1S0NA 3B6BA 1YIJS 3FK4A 2QSFA 1PYOB 3A13A 4CTAA 1HMVB 3MM6B 2W9CB 3KHGA 1HR0J 2AEMA 5D8HB 2ZBQA 2NYIA 3BEGB 4RLEA 2Z30B 3T9NA 2FHJD 1BXNA 1D09B 1TKXA 1TL5A 2CQ0A 3PFOA 1N32J 1Y5IB 2ADCA 1HL6A 4FKXA 1GMUA 4N41A 2K1RB 4Y28C 2D41A 2DNGA 2H3EB 3CD5A 2OEMA 3GJQB 5IC4B 3MCNA 1IVZA 1L3KA 2ZC4A 3MOJB 1MN9A 1S49A 4IG3A 4A8FA 3I5AA 2ZBPA 1RHJB 2G9OA 2V9KA 3C2PA 3LGHA 3QAEA 2HVIA 3OJUA 2W4CA 3I0RA 1YQHA 3B4DA 4CYUB 3CJ0A 3K5LA 2GAGC 3L7OA 3HM9A 1UPPA 4TY8B 1JLCA 1ZA1B 2QYCA 1YHQS 3CCJS 3BR9A 3POTA 4RR5A 1SKSA 5D0HA 3PX6A 1S1TB 3QPIA 1VR6A 5KG1A 5IT0A 4NCBA 3HJFA 3GB0A 1C0UB 2W8KA 1AZSB 3G71S 2VU5A 1AW0A 2G13A 4LMZA 4X2BA 4GRSA 2RB7A 3HKZD 4U6PA 2IVYA 4LJMA 1JXEA 1RT4A 1TZ0A 2N82B 2BZ2A 4NZ6A 2LDIA 4PWWA 2B4OA 1FDBA 1NNDA 2W7AA 3CMAS 4IR9A 4YB1P 3LOUA 6FDRA 3H5SA 4Q8FA 3DLLQ 1QAXA 2FY8A 1EAYC 2ZWPA 4L73A 2E9ZA 4PWDA 4NYPA 4LF8J 1AYEA 1O6XA 5K8NA 4YHHF 2Y1JA 2AGOA 1YJWS 5HAOA 5IM0B 2HZCA 2L3MA 3ZTQA 2DGSA 5J1EB 5A2QY 4RBUA 3GIKA 1X9MA 3SQOP 1F1BB 1YJUA 3I6PA 2V69A 1UP1A 4Y3CA 3UI3A 2WTFA 2C2DA 2M7SA 1NZ8A 4ZS6A 4AFFA 1BD6A 3MCOA 4ZP7A 4GC7A 5D4NA 2JH3A 5CD4H 2F63A 4DR1F 1P1LA 4UQTA 2Q79A 4DLEA 8RUCA 3HI9A 3BPDA 4RKUC 2E5IA 3N79A 1S48A 1M5SA 2DEIA 1LWCB 2FVQA 5E41A 3B78A 2CJAA 1TV6B 4M5IA 1NDKA 3I9ZA 4NYOA 2V8DA 1WNEA 2GIRA 4FXDA 3SSRA 1N56A 3R8YA 2W24A 4KGXB 1XNRJ 4OI3A 1LOUA 1F9HA 3PDNA 1Y3KA 4KY3A 1DHMA 1DBDA 3NBPA 5E33A 3V6JA 5I42B 2HYIB 3HF5A 3J81U 1ZS6A 1OQ6A 4WYWA 2CJBA 3TOQA 3NRBA 3PR5B 1CJVB 4WKYA 1CULB 1TUWA 2KKHA 1ZPWX 4M5MA 3R1LA 2W8LA 4F04B 5DGBA 3OD2A 1UWBA 3DRYA 2ZE2B 2K8GA 5E3AA 1RT3A 2E66A 3JQKA 2HBRB 2EC0A 2ZH3A 1NHKL 1TKXB 4DX6A 4BLGA 2BOPA 3J7A1 2HPUA 3FBBA 1KDNA 5GAGU 2IRXA 2HQDA 2J76E 3HFZB 2HK3A 4IOCQ 1U26A 1X4BA 2CPXA 2PFDA 4YR3A 2V4JB 2HVZA 4NLDA 3DLKA 3U1NA 2M2BA 3HMJG 2KB2A 2FDNA 3D3CJ 4BWJA 3ENAA 5BXIA 3VAMA 1PBUA 1KLMB 4E2FB 3OL8A 3V81B 1F9EB 1HBMA 3U1LA 5IT4A 2B0GA 5HROB 1YWXA 4K0KF 1REVA 2HGLA 3NBPB 4LT6A 3CC2S 2ZNYA 1YVFA 1H2TZ 3EGNA 4ILLA 4TXSA 4F4XA 1AZSA 3A12A 1SUQA 5K8PA 1WHYA 4C98A 2A2DA 1K47A 4WK3A 5JXSA 5CA5A 3UFCX 1FNMA 3W9IA 3ETOA 1BQMB 3RTVA 2DH7A 1RTDB 3QJPA 1OPIA 2AEFA 2F7VA 2CJKA 4F3OA 4I4BA 3NCPA 1HHTP 3HHLA 4C0OC 3MDFA 1VYAA 4L6V3 4DZ6A 2HW3A 1RTJA 1Q86T 4IR1A 1WEYA 5KG5A 4ZIWA 4JI8J 2ZZMA 2EBEA 2MXYA 1NDPA 2NR0A 3PFEA 3C14B 1KBRA 2VZ9A 2KO1A 1EETB 2CDQA 2BMBA 4RL1A 1GQEA 3KJNB 2X51A 5JMNA 1EP4A 3LAMA 4DEZA 2W01A 2QFJA 2Q43A 2KXHA 3MM9B 2L41A 3OL7A 1QAIA 3U27A 4X62J 2CPDA 1Q53A 3W62A 3LPEA 3Q8YA 2FJBB 5KFXA 2OPQA 4KBIA 3D6HB 4IOAQ 4MH8A 1DFDA 4I56A 1BGXT 3RU0A 1QE1A 2DGVA 3CB4A 3GFZA 3RW7A 2DO0A 4R8UA 3KLEA 5EWEA 1S6PA 4ECVA 1RU1A 2MSTA 3T5KA 2X3GA 5HLFB 3WZ0A 2P9GA 4I6AA 1B7FA 2VG5A 1A7GE 1WJ9A 2FGCA 1N33J 2ZH5A 1U49A 3PRBA 5IT9U 3I5CA 2MTLA 5EGYA 5GADI 2V5HG 2PT0A 1GX5A 3PEJA 2DNYA 2Y0SD 2CPIA 5IOLA 1R0BG 4DV1J 3PO5A 2RVJA 3TZWA 4AQYJ 2NSCA 3BB5A 3TJAA 1N6QA 1XMQF 3Q2SC 2UXCJ 2F5GA 3MEEA 5KFOA 2BEFA 5DGAA 3TRGA 3HDSA 2GCFA 3PJWA 5KFZA 2YNGA 2YH1A 1WHXA 1S0VA 3US5A 3QIPB 4NPOA 1N36F 2HMIA 2PE8A 4DCJB 1UVJA 4PG8A 1FJGJ 2DK2A 3MEKA 3R6GB 4X84A 3CD6S 2AJQA 2XQCA 1NJZA 2RS8A 4J9SA 4G1QB 4IRDA 2F4VF 4Y2IA 3X3UA 4KRWA 4YY3J 3DOLA 5B09A 3SCIE 3OL6A 4OZ0A 2HNDA 1OWXA 1V5VA 3BSAA 3MM6A 4DPUA 3W61A 2EPIA 2QT7A 5GMEA 5CYQA 5LMUF 2KL8A 2X1FA 2KFZA 1SC6A 3P45B 2FZGB 3IM9A 3IBFB 1ZAVA 2R7RA 4KAIA 4LBIA 4DL7A 3I9V9 2E1AA 4GO7X 2MZRA 2YQ0A 2OTLS 2IAJB 2ADBA 2WBRA 5EDWA 2O3DA 2F65A 2E1MC 1UJ6A 1NSPA 2LP4A 3DHWC 2FPHX 1RBAA 3DNCA 1VRUB 4YN3B 3UWTA 3UCUP 1VQ8S 3QRPA 4FYDA 1SIZA 3PRDA 1FK9B 3ITHA 2MKKA 3JTNA 1PIEA 2MY7A 5KFPA 4X64J 2RQMA 3M6XA 2VKRA 4OYWA 3VAIA 1S59A 4Q44A 1T7PA 5FDLA 3MR2A 5KOWA 1NPRA 4C8LA 4LQ9A 4WZQA 2AGQA 2V4QA 3CEDA 3CIZA 3QGHA 3T6BA 4AT1B 2X1BA 2JFDA 1N34J 3KUGA 4C8OA 1YZ6A 1FK9A 1VRQC 3CJ8A 3G8TA 4J9UE 1HPZB 3R5JB 2B9YA 4NLYA 4RX6A 2AZ1A 4WU3A 1XK8A 1W2IA 3FVYA 1NUEA 2DHGA 4L3KA 4ZVEA 3CUNA 1ZTWA 3LP1A 1L3VA 2RRBA 4OYIA 5FD1A 4DV1F 1TL4A 2XZWA 4I2PA 4EK2A 5LXYA 4OYZA 2VG7A 3IN5A 1R0AA 4O44B 1HNWJ 4BS2A 3MPDA 4PQAA 3WIUA 2HQGA 5CYMB 2VPXB 3M30A 4UZBA 2KHDA 2AWZA 2VBYA 4F02A 5EN1A 3M2RA 3DU5A 1BWEA 4TLRA 1IKWB 3UCZP 4ANEA 2ATCB 2HHUA 1OMSA 1LWCA 1PG5B 1DTTA 4NI2B 4OHYA 3TA1A 5IC6B 2C3OA 4YS2A 1WG4A 3IS9A 2YWEA 1R0AB 2EFNA 1WI8A 3QRQA 2ZH6A 2A18A 5SUHA 3HHKA 1RAFB 1S1WA 3W64A 2Y9HA 3ETMA 4ICLB 4XAKA 2DHSA 5B0CA 1PSDA 2AJFE 2HZVA 4JI5F 1HBUB 2LA4A 1X5OA 3W9JA 1W26A 4OIXA 1YI2S 2FZKB 4M5LA 2HAFA 2UXCF 4P2SA 1MSWD 3MWBA 4DPXA 2M4MA 1RHUB 3NP5A 4WXOA 1SVDA 4ELUA 3BGUA 4JI2J 5D4OA 3ZZZA 1T02A 3QLHB 1HQUB 3PRVA 4O3PA 2N7CA 4Q8EA 1Q7YT 2I9SA 1C1BA 5G4DA 4DS4A 1IQTA 1T3OA 2BUNA 1HD0A 2D69A 2RDDA 4W90B 2RRAA 2JEFA 2VOPA 3JSRA 3A8KA 2GNKA 2XS5A 3CCUS 4DL2A 4CLSA 4H4MB 3RBXA 2FLNA 4JYAF 1F3FA 4C0BA 4OZLA 2JVOA 2BE9B 3JSMA 3G6VA 1JXVA 4LF6J 1AROP 3RJMB 3PJXA 4TY8A 3MM9A 3HVWA 3CJ3A 1VQPS 4DXLA 2BR0A 3OUYB 1HBOB 3MMAA 3MMCB 2UV8G 2MMYA 4NRTA 1FKOB 3DRSA 4KSEB 2YKAA 2ZJQQ 1NJYA 2UUTA 1UEVA 1R8CA 4NZ0A 2F3JA 1T9UA 4OZ3A 1VRTA 2KHCA 4HH1A 3EGWB 3NGUA 3WHIA 2I5JA 2VFRA 2VQEF 1HLWA 1NDLA 1RT2B 4NE9C 1L3UA 4A48A 3HVAA 3W2VA 2GGPB 4URSA 2A3JA 4YY3F 4JV2A 1TK5A 4LF9F 4RW7A 1EQ0A 2L9DA 2YX4A 4DV0F 1HW9A 3GLJA 3WC2A 4LFCF 2GO8A 2EK1A 1GAOA 1E6YA 5ETMA 3DDIA 5HP1A 4DOZA 3MTKA 1RTDA 2FJWA 5ETNA 1KP6A 4M94A 3H5YA 3KMSA 2HIYA 3D1QA 5F8IA 2A10A 3NNAA 2OPSB 3OUYA 2VC1A 4RW9B 4DDFA 4JI5J 3R2CJ 2I6WA 3CMQA 1LQ9A 2Z2LA 2HHXA 2NXUA 3M7VA 2L9NA 4NEZA 4XDDA 2CVIA 1T9TA 3DRPB 2OIHA 2HS0A 4DL4A 2C2OB 2CDRB 1RT5B 5CH7B 4F4WA 4B3SF 1RHMB 1SB6A 3KK2A 1G2EA 2QLXA 1UEKA 3N01A 4KO0B 5KFHA 5GAGI 5ETPA 2GVZA 1WUUA 2ZHOA 2XLIA 2D3O1 3IRXA 2E29A 2XSJA 4DG1B 2C28A 2AHOB 1C0TB 4F0KA 2OJ3A 4QWBA 1IM4A 2QSWA 3SFGA 1GMWD 2YX1A 3FRZA 3IWLA 3PYEA 5J2QA 1HNXF 1LW2A 3CCRS 3SV4A 1OO0B 5EWGA 3CJ5A 2WBMA 3CDUA 4R25A 3OHAA 4A8SA 1RAEB 4ZJQA 3Q83A 3FZBA 4HI2A 4MK9A 4CO2A 5E3PA 2FVSA 1KOHA 1VIXA 2RNEA 1R43A 4FN5A 3RAQA 3I87A 3UQSA 4RNNA 1FE0A 4EFAC 1JXLA 3HVTA 2RUSA 1ELOA 3FMWA 1N5YA 4DV2F 4ECSA 1PILA 1K8AT 3T5JA 5KG4A 3GYGA 3G82A 3NAHA 4X4SA 2IFXA 4FPRA 5HVFA 1IN0A 2HQ3A 1RHQB 1U4BA 1N8RT 3KNGA 2DGOA 4ES1A 2B7CB 3M2RB 1XMBA 1FI4A 4KPYA 4MKBA 4CZCA 3DM2B 3EJMA 5CYMA 3DDKA 2E1PA 5KFFA 1U1KA 2CJQA 5KFSA 3RG6A 4DF4A 1KC8T 4NMLA 3UN3A 1GXTA 1TFYA 2XMMA 4X4VA 4ED6A 3TP2A 4DV4F 4PUOA 3QT7A 4URGA 2DCLA 1RTZA 3O3LA 3HZGA 1FRIA 2D9PA 3EZ5A 1NJXA 4YOEA 2OTJS 5CHCB 3HSGA 4OZ5A 3JYTA 2QA1A 2RE1A 2BQRA 4LF8F 3M32A 3H4DA 5K5MA 3PKMA 4OX9F 3V4IB 1VJQA 3M2UB 3MCSA 4U7UD 3BO2A 1PYSB 3VQTA 3PW2A 3P4UB 3KJVB 1T8EA 5HJXA 1S5ZA 3UCGA 2Y1LB 2ZH9A 3FEZA 5IWAJ 1YG0A 3IMQJ 2AQ4A 1V6HA 2OD6A 2CJXB 2XBPA 3HFVA 4QIVA 2R2SA 2C22A 4Q2MA 2ZOFA 2IYIA 1PJ7A 3IG1B 2IA6A 4TU8A 1EKRA 2VIHA 2GJ2A 2XHCA 1A0OB 4NLSA 4RZRA 5A6PA 4ZVFA 4FVMA 2C2KB 1UKUA 2P9EA 4OJHA 3JSBA 3BBFA 4P2FA 4RW9A 1LNQA 4DSLA 1CEZA 4ECWA 2V2QA 2PA3A 3IWXA 3DMJA 4KYZA 4U67Q 3EX7B 2ALYB 1KFSA 4HHHA 4O3NA 5B0BA 2FLPA 2VONA 4FF1A 4GKJJ 1VBZA 4DR7F 3GIMA 3I32A 3MPWA 2JLGA 2QA4G 2LECA 4I7FA 1Z2ZA 4HACA 3EDQB 4KGZB 4KGMA 1WKLA 5HQMA 3FEYB 4A8KA 4DFPA 1IBKF 4CWBA 3TZXA 3EPGA 2F9JA 1IKWA 2DJWA 3J80Y 1N36J 2VFSA 2HBYB 5E7OB 3W60A 4QPTA 2QV6A 1Y00A 4NLVA 3A8JA 3TJ9A 4MKYA 3GFYA 1P9YA 4M5DA 2C1EB 1J5EF 1F5AA 1ICEB 1TKTB 1SUQB 1O5JA 1YZ7A 2XWXA 4HR2A 1FNOA 4K59A 1WOPA 2IJRA 2LQ5A 2ZEJA 4YFUA 1NRKA 2R7WA 4RBVA 4HTJA 3T6JA 1TKZA 4KKOA 1RAOA 1U48A 2BJDA 3BGOP 4ZVSB 4O4RA 1FKOA 2N4DA 3DRSB 1R6VA 3AY0A 1FDDA 3MEEB 2ZFHA 1RYSA 1F9FA 1UFLA 3H59A 5M2RA 4P6QA 2PMZD 4C3KA 1RYRA 5BR8J 4FBUA 2MEWA 2YX7A 5LSOA 4DR6J 4C7QA 5HMZA 4JI4F 1VBYA 3NXZA 1QAYA 1U2CA 5T7LA 2EKNA 2BRKA 1TKDA 1DTQB 4B3SJ 4FP9A 4NA2A 3NWGA 4H4OA 4P72A 4R0JA 1CS4A 1WC1A 2AX0A 3IAM9 4TNOA 3BKFA 4I2QA 4YR2A 1FRHA 4OLOA 2ILZA 1AFIA 4PRFA 2CQ1A 5AXNA 4LF4F 1JLQA 4OI2A 1V5IB 2MPUA 3MPVA 1ZETA 1DLOA 1VC5A 2HHTA 2H65B 1RGVA 1EHWA 1NO8A 1I1GA 1UETA 1YJRA 4MAKA 4ES3A 4ZLPA 3UNGC 3JSYA 5A76A 3L95X 4CP5A 3V5RA 1U1PA 1HQUA 4F26A 4FF3A 1NLKL 3M8QB 2OPQB 2G2YA 1HBNA 2R7TA 2R8IA 3A3OB 4JI1J 3VV2B 5LSLA 2DR7A 4FYWB 1HFEL 2V63A 4RO0A 2X3DA 4W92B 4OHXA 1RKJA 2UUAF 3OVBA 1RWPB 4PCQA 5A0YB 3NMRA 2M9KA 3HSDA 3J7AN 2ZJPQ 4X4UA 4QBUA 3FNNA 5T14A 4B9TA 2ZD1B 3D0HE 1I51B 4F25A 5LOQA 4LREA 5IFMA 5DQIA 1SXLA 3GZ7A 4O3OA 4HYKA 2YNFB 1N5VA 2AIRB 1I6JA 1MWQA 1T95A 2DY1A 4ECRA 2HMIB 3HT0A 1WC4A 3DHXA 2YNGB 2FHKA 2ZM6J 4GO5X 3KLGA 2LDYA 3HSZA 2WVFA 4LF1A 1CSJA 1SQEA 2FHOB 1JLQB 1N5TA 1VLYA 3BZQA 3GU0A 3OTEA 1RWOB 4MIBA 3OPKA 4PXDA 2IJNA 2ZH7A 2QZ8A 1DJ0A 2Y3YA 4JI3F 4NLQA 2IBOA 1QUPA 4PABA 4U95A 2U2FA 5DM6Q 1VHFA 1YRXA 3CDAA 1R6YA 5ETVA 2LEBA 3BSNA 4KFBA 2J5AA 2FLOA 3V6DA 4PXCA 2RSQA 1XNQJ 5F9LA 4ZP9A 1AUDA 1G1XA 1HNIB 3EXYA 3K17A 3Q23A 3TUPA 4G1IA 4Q0BB 3P96A 1FERA 2M8HA 2MZQA 2NSBA 3QZ7A 2XGQA 2IM2A 3MECB 3H20A 2VASA 3K0JA 1VHIA 4ZPCA 2H51B 1RBLA 4I1TA 2DRBA 1D9DA 3HHEA 2KFYA 3P49B 4DPWA 3D7SB 2KVQE 2OHDA 2WRMA 3GYNA 1U1MA 1TKTA 3LPYA 2XI3A 3GG0A 2KXNB 3W3SA 2MYFA 2PIIA 3MAAA 3R97A 1C0UA 1J5EJ 1HWUA 4ILRA 4NLPA 3ITHB 4Y65A 3JYTB 3PW0A 2PFFB 2CZ9A 2ZE2A 2HNYA 2B5JA 3OTOF 2HRTA 3V2UC 1IM6A 1N5QA 4X4PA 2V4RA 4K4VA 1K9MT 1CJTA 3AD7C 1U0SA 5I3PA 1IBMF 3T1AA 2GQQA 1BC6A 3X1LB 4DV3J 1JQGA 2HVDA 4RUHA 4MKAA 1BQNB 5F0WA 5KFAA 2UUCJ 4USUA 1HW8A 2J9DE 4J9VA 5HN0A 4FYXB 3TR5A 1UVMA 3RAXA 1NJWA 2BKNA 4IYQA 1R0CB 4QWDA 4UOGA 1HIYA 1V3ZA 5I3UB 4FPIA 1UA1A 3J7Z5 1UVNA 4P10A 2XWYA 2MJUA 1S4EA 1RT7B 3HZEA 1ZAWA 4FS2A 1JLGA 5AJ3F 3D67A 4U7CA 1VOMA 3Q24A 3LF0A 2PO4A 1IQZA 3DXBA 5AJ3J 4B3OB 1KQGB 1RTHA 3BN4A 2PMHA 1F6TA 2CIMA 4XDCA 4DSIA 3OVSA 2RIJA 4DJBA 2GIQA 1NCLA 3QBCA 4YDDB 2B8QA 2W1BA 4IG0B 2CQBA 1FE4A 1FVSA 2CQDA 3T1YF 4L74A 3R1HA 4DQIA 3PV8A 3MZIA 4CM2A 2C3YA 3W63A 3KLFB 3CC7S 4QW8A 1UMJA 1HWLA 2C3PA 3OW2R 4B9LA 1HQ2A 3A3NB 3LTOA 4B3RJ 1FRXA 4Y00A 3SSSA 2DO4A 1X5SA 1AXQA 1S6PB 3G6YA 3EWGA 5KFRA 1RT4B 2EW9A 3C15B 1ZYQA 2AF6A 2CADA 2GQ2A 2QA4S 2NXJA 4DR1J 5ETRA 3RBDA 3CJSA 3SI8A 4B9MA 3GYXB 3QJLA 1NKBA 5B0AA 2HHSA 1WSRA 3D2WA 2HFVA 4OJGA 3Q8SB 2HK2A 3ILJA 4ED3A 2BKOA 2HFSA 3NGTA 4J9OA 1N33F 1YJNS 2OPSA 5E3QA 2BBEA 1JLEA 1SV5A 3KK3B 2EG2A 2V94A 2EBGA 2KU7A 2XZDB 5ETKA 1M90T 4W98A 5A8RB 3ZTPA 1REGX 3CWJA 3CCMS 2ZZNA 4JI4J 2Z57B 5K14B 1VCTA 3IG1A 4ECYA 2MHNA 4IFYB 3KHLA 2XMKA 3BN7A 1SQGA 3DDNA 1HBNB 3NWRA 4LRBA 4LSNA 5GAHI 2XY6A 3HLUA 5HJYA 4ZVOB 3HVRA 2KG0A 1UL3A 2ASDA 1LW2B 1HR0F 2E9TA 2DNOA 1S10A 5FIIA 3PW4A 4LF5J 4N76A 1T9WA 1Y9OA 2VG6B 4NLWA 2B51A 3ISNC 1NPKA 1O8BA 2J7UA 2RKIB 5D0RA 4F3QA 4DL6A 2C2RA 2FVPA 2EC2A 2P2CB 4KHMA 4U7UK 2BACA 3RR8A 4GKKJ 1WD6A 1S1XA 4K4UA 2KT5A 3D3BJ 1PBAA 3MEDA 3QT5A 2V0NA 1JKHA 4M8LA 4NLOA 2FC8A 2GX8A 3KLEB 4EBEA 2N3OA 3R5BA 3RR7A 3IO1A 3QT6A 3IM8A 1R89A 3QNWB 1VQOS 1AFJA 3C16A 4JB8B 5HBMB 2D3UA 3TW0A 4DWIA 4ERDA 2ZBRA 4P75A 5D3GB 4C8KA 4IH7A 1N5SA 2JRSA 3QYYA 3T3FA 3OFGA 3M8PB 3TI0A 2HZAA 1TKZB 4KKOB 4PG5A 1N52B 1FWPA 1OYEA 3FQKA 3G2XA 4ZVHA 4CIOA 4K0KJ 4C3MA 4K2JA 3IR6B 2CZ4A 2QL9B 4BCAA 4B17A 3KHRA 3MD1A 2FHJA 1U1RA 4J9RA 1DAXA 1WC3A 1S4FA 1XIQA 2RHSB 5A8KA 1U45A 5KFYA 1RSCA 4XPCA 1FKAF 4LF9J 4CLTA 4UZCA 3CD7A 1C2PA 1ZA2B 2GJIA 3K7RA 1RTIB 4O23A 4DPTA 5KT7A 3BYRA 1N0VC 1XERA 5B0FA 1WSVA 2DY9A 1VRTB 1WHWA 4YR0A 2UU9F 2GQCA 4K4XA 3MMBB 3AHPA 3KDNA 4OX6A 3NS6A 4NLRA 4OLPA 5E2QA 2E1CA 3TUJC 2CPHA 2J9CA 2QMXA 4ID5B 2FC9A 5J2QB 3MMAB 1FKPB 4PR6A 3ZTOA 2Y1IA 5LJ5Y 1YTYA 1WDTA 4KGVB 2XY7A 1K0TA 2WVCA 5HBMA 3KJFB 3M9MB 5IT9Y 1YBTA 1X4EA 1T05B 1IJEB 2Z2ZA 3MUVP 2RU9A 4O4GA 4X4TA 4BWMA 3PIPQ 2HLUA 1FX2A 3C15A 2F4FA 1HQEA 1S9EB 3N6MA 3CVKA 3KK1A 1FT8A 4ER8A 1HA1A 2YBVA 2DT9A 2HS4A 4LSLB 2FVRA 1KHWA 3J7YI 4I64A 3LO3A 2Z0GA 4Q5VA 4OYAA 3RBEA 2XMTA 2PGCA 3A1YG 2B3TB 4QIFA 2YXLA 2AYMA 4DV3F 4O3QA 2VV5A 4A8QA 3TA0A 1M1HA 4K8RA 2BE2B 3VALA 4DFJA 2XY5A 2D3OR 2OPPB 2BQUA 1SPBP 1VBKA 1TFWA 3FUYA 3M05A 2NUUG 2E7WA 5MAOA 4UOCA 2MQQA 4J37A 2ZH2A 4J91A 2AJ0A 2E7VA 5A2QU 4ELTA 4KHPF 2WVEA 1OQ3A 4ED5A 4YB5A 1ZM4A 3QSIA 2CNNB 2C2NA 3LP0B 1KTVA 4CQ1A 3LWLA 1VQ9S 1JLGB 2VDHA 5E3CA 2Z8QA 1N32F 3CJKA 4YMEA 2G2OA 3OTDA 1FA0A 3CDBA 4IFVB 3ZNJ1 1HYSB 4M63A 4EO8A 5HVHA 2VODA 1PC5A 2OFGX 4DV6J 1FRKA 3TA2A 4MT1A 1S1VB 4QWEA 4X66F 2UVUA 1NDCA 4PQUA 2PMWA 1TMMA 3KKFA 1Q5YA 1XR6A 4Y6IA 4Q45A 2YKNA 3T1HJ 2FIUA 1G4CA 2FJAB 3AODA 4JP8A 1FNXH 4CH1A 2FZCB 4LFAJ 4OYPA 4ZN3A 4WTOB 2O1PA 4HDGA 5JUMA 1M1KT 4DV7J 5IS2A 4JBCA 1FJ7A 2JHEA 1K1QA 1CJKB 4OX7A 4JI2F 4PQUB 4I2PB 2B5JB 3JXOA 3MR3A 1RHRB 4DU8A 4FXVA 5L38A 3MM5A 2LU1A 3G6ES 4FS1A 1URRA 3GJTB 4LF5F 1P27B 5JJBA 1X0PA 2JDJA 3A4TA 2CJYB 2ZDOA 3L4BC 5K9FA 4OMFG 3M8RA 1WC6A 4F8RA 1QTNB 2DRDA 3DKDA 1WG1A 4L3NA 2GVDB 4JYAJ 1FTCA 2AD9A 2KZZA 4AXJA 3PM9A 2ZWOA 4LR7A 1GNKA 4MK8A 3PO4A 4R0EA 4DCPB 2FY1A 3GJRB 2XCAA 4LFCJ 3KLIA 3RW6A 1FRJA 3ILIA 3BJYA 1NK0A 1QUVA 1D1UA 2VFVA 1MLAA 2IY5B 2EKYA 3SFUA 5H9EJ 3V6DB 1HWKA 5KFCA 2PD1A 1RWUA 1I94J 4ZJLA 1FFSB 1VRUA 1HI8A 4RBTA 4DPYA 5DM7Q 3IR5B 1Z4UA 4CNZA 5IXUA 2VJVA 3PEHA 3KNAA 1BUXA 1K0VA 4ICLA 3H40A 2XNQA 1UFKA 3NLCA 5K20B 1AB8A 1UCNA 4HVZA 3M6UA 3CULA 3PJ9A 1P6TA 3TX0A 4CLZA 1CQMA 3VAGA 4PPDA 3OXGA 1EJ7L 1R8HA 4DL0C 5IWAF 3BH6B 4JI6F 3AOCA 4TN2A 4F4AA 5DDRC 2MB0B 3KLGB 4G6VB 3PR4A 3HHDA 5F0UA 4ELVA 2R7UA 1H2VZ 1SC3B 5AXLA 3W7BA 4R5PA 2APOA 3F0NA 3C19A 3HXMA 4DV0J 1T03B 3OFFA 3C66A 4TU7A 4ZPTR 4RW6B 1SL1A 1RT2A 2J6TA 3M1VB 3VAJA 2EFOA 1SL2A 4JI8F 1R31A 1XWLA 3THVA 3BPSP 4F4YA 5EX0A 3CCLS 2YVSA 3HVTB 4RNHA 3QIPA 2R8HA 3S8SA 2HBZB 2YPZA 2C2MB 4MIWA 5HO4A 2CQGA 2N7YA 4PPZA 5KFVA 1B0VA 4E0DA 1N54B 2M3DA 4KGKA 3W5YA 4XTTA 4K2XA 2GMJA 1RBOB 3M4XA 4EWTA 2WCXA 4F36A 3CSKA 3EGVA 2YKOA 2O01C 1RT1A 3NS5A 5EHHA 4LRCA 4I6WA 2MZ1A 3ZZPA 2H5JB 4ZVQB 1RKIA 4L72B 3J81Y 3ZTSA 1LXNA 1V3SA 3P8BB 3K5OA 2G4BA 3AOAA 3ICLA 1ITPA 2G2ZA 1JK9B 2MDAA 4MFBA 1LWFB 1CJUA 3DI6B 1FCAA 4NCGA 3W2WB 5DG9A 3GFHA 2RUGA 2VBZA 3EUNA 1PCAA 2Q1LA 2QIFA 3VWSA 2Q3PA 4HH0A 4P52A 4EYHB 4XK8C 2VA2A 4DR6F 3E8OA 1ZBTA 3NS7B 2M52A 4NYZA 2QTWA 2V4JA 4JUZA 2J9DA 2BV3A 4KV8B 2WSFC 1FF2A 3M32B 4DV4J 1LWEB 4NL5A 3Q89A 4WK1A 1S99A 3MM5B 1RAGB 1NZAA 5F8GA 2QFIA 4YQWA 3SIPB 2HQIA 2LXFA 1G3OA 4USTA 5IV3A 4A46A 4ID8A 1ULRA 2BANA 4PEOA 5F3TA 2MKSA 3VGVA 4G1QA 2EFPA 4F0HA 3DLBA 2DIUA 3MMJA 3TYTA 2HRYA 4OQJA 1Y4ZB 1HNVB 3RZAA 2MZJA 1MROB 3QGPA 1SQFA 2WVBA 5KG2A 4J7CA 2IM0A 5ETQA 1BQMA 3T1HF 1QTMA 2E5LF 1VLOA 1ZM2A 2I5JB 2W2OP 2XMVA 3GFXA 3G87A 1KLNA 5EX3A 1TELA 2NQPA 4ZMMA 3D1OA 1HYSA 2ASJA 3WX8A 4P73A 4G65A 1MU2A 1IBLJ 4OI1A 3EGZA 4AUKA 3ZFVA 4DR5F 2VPWB 3P3DA 4CT8A 3H5UA 1YRTA 3RB3A 1IBLF 1B7YB 3TAMB 1SIWB 2QX0A 3MR6A 1U1QA 2VC0A 1TAQA 4W4MA 3KUHA 1LKZA 3I5BA 1GTEA 2LQBA 4LF7J 4WF9Q 2NZ4A 2PEHA 1WACA 2HQCA 4XIUA 3CCWA 3LQVA 3SCLE 4EMDA 4RNFA 2QLJB 3M2UA 3UDCA 1BWVA 5L46A 4DR4J 4CO3A 3MGJA 2SXLA 3I31A 1Q7LB 3NOGA 4X4RA 1KN6A 3B4MA 1C1BB 2F4VJ 5FLXU 5L8RC 5IM0A 2JEIA 1B4SA 1HQEB 1S9EA 4LBHA 1IWGA 2DPJA 2MHEA 5EUHA 4WJBA 3H42A 3OBIA 5HQ8A 1URNA 3MF5A 4LR9A 4C11B 4WFAQ 1T05A 5KT2A 4ZVUB 3UR3C 3OVAA 2HHHJ 2FB0A 4KT0C 2KFNA 3DRPA 2YNHB 2CKWA 3DRRB 3QGIA 4I69A 5ADZA 3L3CA 3AA9A 4F4ZA 1JWWA 1RTHB 2CQCA 4NA3A 1E6VA 3Q86A 2FJDB 1Q79A 3JQMA 1HHSA 3TQEA 1HI1A 1UFWA 2YKMA 1BMQB 4KC5A 1S1UA 4K4YA 1B0TA 3P5TL 4DUYF 3E51A 3Q22A 2BW2A 1MU2B 2EI5A 4KR0B 1PO6A 3QJJA 2JL9A 4NXMF 2CRLA 2GC8A 3H98A 2J6SA 4GC6A 3D5MA 4TY9A 2CG4A 3M2VA 1S76D 1VQNS 2AMCB 3DU6A 1IBCB 1O0PA 2W7OA 3M6VA 4H4KA 1T94A 2BX6A 2GMHA 3D6FB 2R2UA 1UA0A 3Q8PB 4N56A 3O5TB 1RWXB 5A6WA 1RQ0A 4CT9A 1YITS 3FKBA 5LMNF 2BOAA 1Q8IA 3E01B 3LA0A 2LYVA 1OY9A 2JWNA 3HX9A 4DV5J 2AV5A 2CNLB 2VG7B 2WZ1A 3W5XA 3TUZC 1MNEA 1XC9A 2XM3A 1X9WA 1NHVA 1X5TA 2OUGA 1G6BA 4ZVGA 1I3OB 4EGLA 2EFQA 3OHBA 3BQ1A 4DHVA 1I94F 2XULA 2ZH8A 3SQGA 4CM0A 4CLPA 3DLGB 4NASA 3V4MA 5KG0A 4EUVA 1PGZA 2VOOA 4B3RF 4N5SA 2VF3A 4TYBA 2X1AA 1IKXB 1TUVA 2Z2YB 3M8SA 5C5JA 4ZPVR 1AT1B 4HEA9 2R2RA 3BSOA 3ZZYA 4F50A 1JJCB 1CVJA 3M6WA 1S72S 1JLFA 2ABYA 5HATA 1IUJA 4QIEA 2CXEA 4MMOA 4X4OA 4R8UB 3NMAA 1J5OA 1WOSA 3IFEA 4OHVA 4ZLJA 1KNZA 3DM2A 3MM7A 1RT7A 4OJ1A 4QPXA 3RAMA 1YKWA 3HPOA 4UQGA 4DL5A 2RS2A 2NZCA 4RNMA 2EXUA 2R8GA 3PYFA 4QR0A 2J8SA 1JLAA 2KN4A 2YWHA 3P5BP 3R5CA 2NPFA 4B08A 2ILYA 3BF4A 2HSEB 3KG4A 4U8YA 2RU3A 4B3TJ 2OFHX 2R7XA 2OELA 2D1CA 2UP1A 1OIAA 3GCWP 4A4JA 2BKPA 3QLHA 4WU2A 1YBUA 2BW7A 1FO1A 1CJKA 3GIRA 2XS2A 3G8QA 2XZTB 3MM8A 1RAAB 2CPYA 3N28A 1Q95G 5DDOC 1SKWA 5J1NA 5LSRA 3GPAA 4OV1A 4WFNQ 2DISA 3C6UB 5AXKA 4DBQA 3ENVA 4IG3B 1SJQA 1S9GA 2WOMA 4M5HA 1CJTB 5BYQA 3ZTRA 4EYIB 1Q82T 3FFIB 1YK9A 3DFEA 2LEAA 4DUZJ 4J9PA 3OT9A 1S1VA 1JLEB 2LQ8A 1Y0HA 3LALA 4ANCA 4CH0S 1TTHB 3KLFA 4GKKF 3PCOB 3UDVA 3CW2C 2ZKTA 1FRLA 1WTBA 3FSXA 2NPIA 1FXLA 3CJKB 3AJDA 3OXFA 3NCRA 2YPYA 4DN9A 3OTOJ 4QYZJ 3CCTA 2AZ3A 3MMCA 5C2CA 3BDPA 1Y11A 2B56A 3AD9C 2AX1A 2Q6CA 2VFUA 2JLEA 3LP2A 1YRUA 1P1TA 4JOUA 1T3NA 5F41A 4IOBA 4WZMA 4EZ9A 1MMLA 3OSPA 3H2UB 5C25B 1RCXB 3R5DA 3R5GA 3GV7B 1YJTA 1SBRA 3AD8C 1NXIA 3QWPA 2FD2A 3AXKA 4YUDA 3OR2A 4YDXA 3HD1A 3L09A 5B0EA 4A47A 5KT6A 3LW5C 2V8VA 1IKYB 4IH6A 4DX8H 3UR0A 5JVHQ 3CPWR 1K73T 4B3MJ 3I96A 4QCLA 5THWA 2M0GB 4USHA 4PYDA 4DV2J 1T0TV 2DR8A 3GTYX 4WXWA 3OXLA 2YTCA 1Y3JA 2XO7A 2OAUA 3PACA 4ZJOA 2MKIA 2H4WB 3UD3P 2V2ZA 1APSA 2QL5B 4PKDB 4DFKA 4TQRA 1VQLS 2QRRA 2RILA 3ZZTA 3FSYA 4OZ1A 2BM0A 1M0SA 3TZYA 5F8JA 1KS2A 1KFDA 1MWYA 3MCMA 2UUBJ 1R3NA 4KE5A 4S0MA 4CDIA 2V2KA 1NSQA 1TK8A 3SQGB 4Y2AA 4DV7F 2J7KA 3QAUA 4DMZA 4QYRA 5DS7A 2OMLA 5G0RA 2ASLA 2NUHA 2QMUB 3DOMB 3ILOA 2CAJA 3CMES 2ZBIA 4TYAA 5HI7A 2D9OA 1IR2A 5IQ6A 2QO3A 5F8NA 2BDPA 2H5EA 4ED1A 1NU4A 2QLFB 2XYGB 3BSCA 3C6TA 4GVBA 2VPYB 4V1Ak 3W65A 1GH8A 1U2RA 3IS9B 6FD1A 1KVKA 2RT3A 3LAKA 3M8QA 4RW6A 2RJZA 1IXKA 5KFTA 4TQSA 4B9SA 3RB0A 3MFIA 1Y5LB 4C8YA 4DS5A 1KVIA 2IM3A 2O67A 3M30B 1N0UA 1U7LA 4L76A 4ZPBA 4I7FB 1KQFB 4AYBD 4C97A 1S6OA 3TO8A 5GAEI 2UVWA 3IRWP 3FDSA 2QJ3A 3M2VB 1U47A 3FMBA 2ZM6F 1YSJA 1HKAA 3MAAB 3EVMA 5LM7E 3UD5A 4UY85 1YDLA 4DPOA 4QYZK 2XCPA 4IQXA 1BLUA 5BJRA 4ALZA 4ZHRB 1B3TA 4CLFA 2WONB 2CPFA 2D7SA 2PC6A 4FZVA 3V81A 4RU2A 4AL7A 1F2GA 3DGPB 1XEZA 3DXSX 4RJVA 3TEHB 4A8XA 3K58A 2VQFF 3O44A 4PWDB 1WEZA 4ZVPB 5B0GA 2DNZA 3H90A 5KFGA 8AT1B 3D9BA 4WIIA 4O0IA 4QJVA 3N4WA 3Q8VA 4WPAA 5KAKA 1JJ4A 2BE7D 2E1RA 3MPYA 3PHEA 4USJC 3T9ZA 2DR9A 3MEGA 1WI6A 2KT2A 3C8YA 1T9YA 2O66A 1RAJA 2GIFA 2WAQD 3UDLA 2CQ3A 4B3OA 2OLWA 2G1HA 2Z56B 1BQXA 5CXTA 2LQ9A 2J0QD 3Q2TC 2R42A 2BYCA 5HLFA 2HEKA 3DGVA 2M5YA 2IMWP 4C8NA 2E44A 1C4AA 4OI0A 2KZMA 4LFBJ 5KG6A 2UXDF 3FJ2A 1RUSA 2R7VA 2FUG9 3ZZUA 2K7JA 3AH6A 1LW0B 4LF6F 1RK8A 2GA7A 4N8NA 3TAQA 5LMNJ 3QATA 3IWNC 4M5KA 5HANA 4OYBA 4O44A 5LXRA 3K59A 5I42A 2RQ4A 1SKUB 2JJ4D 2Y0BB 5CYJA 4ATNA 4EBCA 2DB1A 1UVKA 3EZOA 2UUCF 4ZK7M 3QO9B 4WWSA 2DNHA 3W66A 4DV6F 4E98A 1JLAB 1TAUA 4HT5A 1GMVA 2DNKA 3E2EA 4OX8A 4PXEA 1VK3A 3CDEA 3MUMP 3GQCA 3VZHA 1GEHA 1HWIA 1WF1A 2VL1A 3R9LA 3RYLA 4DR3J 4IFVA 1J2VA 4KH1B 4JI0F 2O5DA 2LEPA 4PZVA 2OH2A 1WHVA 5DG8A 4CI0B 4NLTA 3THTA 2OSQA 4IUFA 2CNKB 3CJ2A 1XR7A 3D4JA 4P2MA 2DBBA 3VAKA 1N34F 2XLKA 2XYPB 4RUCA 5J1EA 1LK5A 3AQOA 3OTBA 4CLKA 4RUAA 2OI2A 1H0HB 1RWWB 2IC3A 3K57A 3EM1A 2VG5B 4LSZB 4RU9A 1U6ZA 4KTQA 1NSKL 4CCHA 2VQFJ 1HD1A 4LSLA 2EVZA 1QSLA 5B7WA 1UVLA 3Q8RB 5ETLA 2FQQB 4CLWA 1M5PC 2ZHAA 2RD5C 2NYHA 1QE1B 3CT9A 2VICA 4Q0BA 4TLQA 2B8PA 2BABA 3R27A 3U02A 2IA0A 3M9OB 1JKHB 4KHRA 1J5OB 3PX0A 2HHVA 1H2UX 1N48A 4JI3J 2XSFA 2HVHA 5KFWA 3DOLB 1RB0A 5D78A 4B3TF 5J2MA 3PG9A 2E5HA 1XR5A 3MXHP 4QWAA 1UTAA 4N77A 2OP5A 3NEKA 3QQCD 4P9SA 5CZVA 3UVJA 3G8SA 3TARA 3WIVA 3POTB 3BS9A 5KOXA 5L1JA 3SDEA 5SZTA 3ZZ0A 4CO4A 1FEHA 4UW2A 1H7XA 4UTGA 1FDAA 1GT8A 3EDRB 4OFZA 2W2MP 5KFNA 3KG0A 5M2UA 1JIHA 1DQAA 2P8IA 2ZDPA 1S0OA 1VQKS 4PAAA 6AT1B 2CPZA 2X1GA 5K8OA 1FJGF 3QIDA 2M88A 3TANA 1WC0A 3R5AA 4M5NA 1Q78A 4UUWA 2YWGA 3G86A 4AD6A 3GP9A 1RJJA 3KK3A 2MQPA 4WCEQ 2F1FA 3AJ2A 1VMBA 2DGUA 3BH7B 4HI1A 2R3VA 4P7VA 1FVQA 3MI7X 4U96A 5AE1A 4PG6A 4R5PB 3UDEA 3D54A 4DSJA 4F7VA 2WB4A 2LLZA 5CAAA 3TQ1A 1M5VC 2COLA 2QA2A 3GE9A 5HMYA 2HHQA 2OSRA 2ZH1A 4OV6A 5HMXA 1D0EA 3FBEA 3I4PA 3UPFA 2HHHF 1NM2A 2DCUB 3PXGa 1HBMB 2MSSA 1XNQF 2DD8S 4KH0B 4U8VA 1P9QC 1OY6A 1R8AA 3I56S 3G6XA 4TKTA 2YKQA 2ATLA 5E5NA 3V4IA 5L9XA 2YH0A 3RRHA 1DQ9A 5C25A 4FF2A 3MEDB 2Z2MA 3MOZA 4DI6A 1X4AA 4MYTA 3NG8A 2G0IA 1S12A 1ZAXA 1R8BA 5AT1B 3ULHA 2XO6A 2GMLA 2C2EA 2VG6A 2DGTA 4G1PA 4OHWA 5L1LA 1SH3A 4NRUA 5KT5A 1L3TA 4M5GA 2H54B 1JJHA 1UJ5A 4LIWA 4QR1A 5CQGA 5B08A 5DZ6A 2OMOA 3ENWA 2P6TA 1VFJA 2ZUAA 2H5IB 3KFWX 5LMUJ 2L08A 1SC4B 2LCWA 1CULA 4Z37A 3SV3A 3KOAA 4ZKAA 3S01A 3TAPA 2L9WA 4GMKA 1NJIT 4F67A 5DETA 3RBZA 1QD1A 2V67A 2CYYA 2I38A 4OYOA 5E3RA 2EFVA 4CO1A 2DIVA 3O1LA 4ZVTB 4ZN1A 3NGKA 2MGZA 4QOTA 4F3MA 2F8HA 3U7JA 1Z2LA 2DR5A 3M1VA 2QG9B 2F8EX 2KM8C 4NXNJ 3OL9A 1LW0A 1S0MA 3BYPA 4QU6A 4DR7J 3IC1A 1DTTB 1HNWF 3NOCA 1MWZA 4X64F 1UVIA 3P6YC 3PHTA 4FYYB 4DR2F 1QSSA 4A8MP 2ROGA 4BC9A 4F2RA 2MKCA 2ZZTA 1OSDA 1F2HA 4NEYA 2KH9A 2J9EA 2RHQB 4RW4A 1W2BR 3QZ8A 1H7WA 5AE2A 5D4LA 1SL0A 5C24B 1FXRA 1U1LA 3N5FA 1FFGB 1EIYB 3GCXP 5KFUA 3DLHA 4Q7AA 2HS3A 3OQ2A 1TL1B 1T9VA 2W9CA 3T1YJ 2FGOA 2HWIA 3OFHA 3QFWA 3LWMA 3G4SS 2E7XA 3JTPA 3TUIC 5GMDA 4DQPA 2WW8A 2VJUA 3CGIA 2ASYA 1WORA 2ROPA 5DDPC 1RDRA 4L75A 1A9NB 2BRLA 3O8WA 4ZOSA 4ED2A 4NXMJ 2VFTA 2DNNA 3E01A 2MQOA 1QVFR 5EWFA 1Q8KA 2BM1A 2GZOA 3O2IA 3D1HA 1CJUB 1LWFA 2HWTA 4IDKA 3PZPA 2ERRA 7FDRA 4X4QA 2B9WA 1OSCA 2QE5A 3PYDA 5D77A 2LU2A 5ETOA 3EPIA 2C3UA 1FWKA 2B6AB 2MZSA 4A8OA 2VB6A 3EXCX 4B02A 3HP6A 4ECTA 3N5BA 1QDUB 1TV6A 2YQ1A 3VCDA 4CH7A 2CFXA 3HK2A 1VQ6S 2GFFA 4HACB 3SBMA 4ETXA 3T5HA 2UXBJ 2GV1A 1U2FA 5D4PA 2IVFB 4QW9A 2R8JA 1BE4A 2ZD1A 2XS7A 3IBCB 4QR2A 2BANB 5HVGA 1B70B 2JZ5A 2YNHA 4C0HA 2N3LA 2KJVA 2XHWA 3NAIA 2HFZA 2K3KA 2QGFB 2HFUA 2CVEA 3HO1A 4HT7A 2B9EA 4PG7A 1GXUA 1OS5A 5G0RB 2J6UA 4YB7A 3L7PA 4WP9A 2EG1A 1U0HA 3ILLA 3RB4A 2IBKA 4LRFA 4M5JA 2AU0A 4DQRA 5GAHU 4YEAA 2XNRA 2UZAA 2EK6A 1FX4A 3GG1A 1UAWA 1NKCA 3W9HA 4DV5F 1JMTA 1PAUB 3H2VE 3SCJE 1HMVA 2QYGA 4DUTA 4ECXA 3FEXB 5H1SV 3EYZA 4MFBB 3BV8A 4DR4F 3PIOQ 1YJ9S 2K7KA 3T5LA 3TZZA 1FWLA 3Q8UA 3M8PA 1EQMA 2RQCA 4F4KA 2WK4A 1Z1ZA 4MKVA 2MGZB 1UWAA 3CCES 5AE3A 2DRAA 4H4KC 4KJIA 1UZDA 4PUOB 4CNYA 3CF5Q 1YX2A 3N0VA 2W2QP 4K7QA 2UUWA 3CE8A 3UN2A 5KFJA 4LUBA 2MKYA 2IHR1 4Y0FA 3FCWA 3KK1B 4ZPDA 4RUBA 2HURA 4JV1A 3KJQB 3TNVA 5CABA 5FLXY 4V19X 5CYQB 4K50A 1FFWB 1H72C 1VS3A 5KT4A 2KVIA 3IP0A 2C3MA 2HNDB 3B8HA 3SYZA 4K5RA 4ENOA 2IVMA 2E9RX 3LGMA 1ZZNA 1HNXJ 3I0SA 1DURA 3H2LA 2QL7B 2YWKA 1AUSL 2B43A 3A8IA 3EZUA 1KR4A 2NXNA 4WE1B 2IIHA 4M5DB 2J0XA 2AGPA 2VA3A 3BR8A 4ZIVA 2EWHA 2X7IA 2PDAA 1BY9A 3KLHB 4NI2A 1B64A 3HHNB 1F5CA 3C14A 1FD8A 4IQMA 4XO0A 5GAEU 3IA0A 3LANA 3SCKE 4J9NA 2CNOB 2WOMB 4HTIA 1S57A 2OKQA 2RQKA 1LWEA 4EU0A 1UPMB 2JNJA 1RADB 1X31C 3HKWA 4KV8A 3MURP 1ZPVA 1WELA 3K2YA 4NZ7A 5DRKA 2ZH4A 2OGUA 3MM8B 1SV5B 5D0GA 5IV4A 5DJBA 4TU9A 2I8EA 4OHZA 4WBFA 5RUBA 2ZHBA 3BBBA 4UT4A 2EFGA 1TVRA 1F5BA 3DOKB 3EICA 3K5PA 3ZZOA 4X62F 1P8GA 2LFVA 1HPZA 3DN9A 2EEYA 4CO0A 3BGLA 2JLFA 4KB7A 3V6KA 2DGQA 1F0XA 5D15A 4OZ2A 2UVVA 2JX2A 2WVDA 1VGYA 3FC9A 3O6QA 1RT5A 4LF2A 4P71A 5J1PA 4C8ZA 1WC5A 1CBKA 1KLMA 1KQSR 2RH3A 4F0MA 1DTQA 1RT1B 2BJ1A 1IR0A 2GVDA 1VBXA 1Q81T 1R8PA 2NXCA 4EEYA 4OZJA 4PG4A 3L7UA 2WSCC 3DLGA 4DSFA 3K89A 4I67A 2DEJA 5K8MA 3FCVA 2UUAJ 1NPPA 2WHOA 4LBPA 4IO9Q 5MLCV 2WW4A 2HG4A 3TX8A 2KDOA 3BGRB 2A0FB 1H74A 4WIQA 5F9NA 4AQYF 2M8DB 1N4LA 2QC3A 1S1WB 3SZ2A 1RT6A 2CZVC 4K4SA 3BO3A 3FBCA 1MN7A 2FLLA 1S97A 1Q8LA 2IJFA 4CLYA 2AEJA 4AL6A 1PAEX 1TMJA 2NXEA 3B54A 4Z2XA 2OEKA 4RNOA 4NLXA 1UWBB 2XG8A 2H1YA 2YKNB 4RW7B 1KKHA 7AT1B 5F8MA 2E5LJ 1FJCA 1EX8A 5A8KB 2W2NP 4A8YA 1FESA 1DRZA 1NH7A 1HARA 1VDHA 1JX4A 4V19J 1FKPA 4HLBA 1NK8A 5I3QA 4HHUA 5AXMA 2XGPA 2K06A 4D3GA 4D3HA 4DL3A 1W25A 1UEUA 5F8LA 1L5UA 1BQNA 1IBMJ 1M5KC 1TL7A 2C42A 2KYXA 2FTRA 2GHPA 4ED0A 1SKRA 3PYGA 1E6VB 2F8MA 5B0DA 4DSEA 2DNPA 2OD4A 3K8VA 2CQ4A 3JQJA 3DRRA 2W9BA 2AJ1A 3OV7A 1RAHB 2W2PP 4K4TA 1RHKB 1V3RA 3UNYA 5HSPA 5DG7A 3CCQS 1XMOF 1GK8A 1NK5A 1DARA 2DR6A 1TL3B 2DNRA 3ET6A 4DX5A 3VAHA 2K3IA 3KLIB 3ZO7A 4ZLLA 4HKQA 1U1OA 1X7VA 2YKPA 2GW8A 5DO2A 1LEOA 2W4DA 1RT6B 2Q6BA 1S6UA 2RAQA 4N8OA 1VC6A 5H9EK 3DRXA 1OPZA 2AJ4A 2RKIA 3BGRA 1C0TA 3FRYA 5H9FK 5C24A 1Y7PA 3JB9k 2XMAA 1T9XA 1DZ5A 2ZKUA 4BDPA 3PW7A 2UV8A 1M5HA 1RWNB 2Y1RI 1DY3A 2DKOB 1S6QA 3FCHA 1WKJA 3A8EA 1X4GA 3KUEA 2JC1A 4PYAA 3F56A 1X60A 1WDDA 4UUXA 3VTIA 1H38A 4FNHA 4Y34A 4GKJF 3TAMA 5L39A 1WF2A 2RDJA 4CRJA 2JVRA 2OPRB 4KFBB 3S1TA 2H9ZA 2ZC3A 2BQ3A 2YWWA 4JI6J 3ONQA 1TU0B 3N6NA 4NOHA 5DLGA 2VBXA 3M8YA 5CZXA 4NLGA 2HFNA 3IXQA 1RACB 1KSPA 2HAIA 4DN0A 2R8KA 4O3RA 1ZZFA 2LVWA 3ADAC 3G96A 1GFWB 1MW7A 2E5GA 2MQNA 5I3UA 4NA1A 4ED4A 3R6LB 4HHJA 3KG1A 3BKUA 2A2CA 2VQEJ 3AA8A 4RW8B 1U02A 1U1NA 2W25A 5IQQA 4KPCA 1HNVA 3FBFA 2HLTA 1RISA 3CDWA 2CPEA 2YKMB 1K1SA 3RGIA 2VBWA 1TUGB 4JV0A 2FVCA 1NEEA 1TR0A 1ZOTA 4GVBB 3LP0A 4IFYA 5JVGQ 1SJ4P 1JJ2R 4RWWA 1T11A 4C4WA 3JAMU 1WEXA 2ZOGA 3ISZA 3AOBA 4USIA 4YP3A 2R7SA 2DPIA 3GR1A 5A0YA 2XEXA 1IKVA 3M8ZA 1WWHA 3KLHA 1S6QB 3UD4P 3D66A 3CD0A 2KRBA 3D0IE 4C8MA 3CJRA 4ZITA 3OLBA 3H0PA 4ANDA 1LFWA 1IJFB 3BQ0A 3T41A 3J7YU 3CJQA 1FTRA 4DR3F 1VJWA 3C16B 1IBKJ 1SC1B 4KO0A 1Q4RA 4F2SA 4X65F 3EVOA 4HL9A 4JI7F 4NCGB 5KG3A 4J90A 3KMQA 2V8GA 1S1XB 1LXJA 4JI7J 1OYDA 2DXDA 4ZCMA 2QN6B 5D0EA 1D9FA 4I2QB 3AB2B 2V6AA 4QIGA 3BM7A 5FJ4A 4QZVB 2VH7A 4J5OA 1OY8A 2DNLA 1TK0A 2AJ2A 4EO6A 1TL7B 2J0SD 1TVRB 1U8WA 1Y5NB 4LVNP 2ACYA 2U1AA 1HNZJ 4Z7YA 2JEGA 4B9NA 1RA6A 4ZLNA 3KYLA 3KWMA 3VHQA 2DXEA 3I0RB 4CYUA 3PX4A 2XTJP 3VF0B 1HWJA 3DLEB 3QMQA 4ED7A 2DTJA 3SEOA 1RTIA 1RI7A 1VQYA 4DR2J 2D74B 2ROEA 5ITHA 2J7WA 4AE5A 2YQ3A 1UZHA 3F73A 1D9AA 2G0JA 1VISA 2RF2B 4GVLA 5KFLA 4K4ZA 2YWFA 2V68A 3PTWA 1XTZA 4U9RA 2HNYB 3GWCA 4E8UA 1YLXA 4A8WA 4LRAA 4WE1A 2K2PA 3ENQA 3CO9A 1T03A 4J9LA 2CQPA 2GS8A 3I0SB 3IGVA 2P9CA 3WC0A 5KFEA 2RMLA 1IR1A 2CPJA 5BYSA 2F40A 1FD2A 2MKJA 3AAWB 1G7CB 1RP5A 1Q5VA 3C6UA 3IGNA 1REVB 4CTAB 2MKHA 3NGRA 2W9AA 3MHYA 4JI1F 3FGVA 4DUYJ 1NK6A 3QGGA 2OPRA 2HNZB 3CO0P 3W1YC 2KRRA 4USVA 2JEJA 3HFKA 3NCQA 4WP3A 4KHPJ 1DQ8A 2IM1A 1NAQA 1TQLA 1V9OA 4HDHA 4ZP8A 4O0NA 2B6AA 1RLCL 5L9NA 1SCJB 2IDEA 2J8AA 1DLOB 5U47A 3TEGA 4G3IA 1FDNA 5LL6d 2DNQA 4WYLA 3W8GA 4LF4J 1LFPA 2VD3A 3PY8A 2AP6A 4I6YA 1MMDA 2PN6A 4ILMA 2MQMA 4I68A 4B9VA 3WQPA 4TVAB 3N6LA 2E5JA 4H54A 3T19A 3BKTA 3TJ8A 1JLFB 1GXLA 3M8WA 4LQ3A 3OR2B 2UXDJ 1GMWA 2PI4A 1NMEB 1U0HB 5H9FJ 5L1IA 1MG7A 1HNIA 3OFEA 1RLDA 5J2PB 2NREA 2KTQA 1FRMA 4RPFA 7FD1A 1YGYA 3KXDA 3A3PB 2MQ8A 1NHUA 3H8YA 4ITSA 8ATCB 2W9BB 1CJVA 2VDIA 3NGSA 3Q0AA 2Z4PA 1JNZB 4Y2MA 4B9UA 4NCAA 4K5SA 2NCKL 1JB0C 5HQLA 1HBUA 2CWXA 3MAQA 5KFBA 2IAJA 4OI6A 1JLCB 4C3LA 1KTQA 1KHVA 1Q1KA 1U6BA 2N4CA 3M9NB 5DZ7A 3H25A 4J9KA 1RTJB 4K4WA 2GHVC 3I4HX 4FYVB 2AYGA 3HHLB 3GV8B 3PW5A 4NXNF 4X65J 2PA8D 1N88A 2LMIA 2HFOA 3HULA 3CCVS 3GJSB 1MMNA 2J0WA 1S9GB 1RABB 2KI2A 1YBAA 2VUGA 3OTCA 4BHQA 4ZPAA 4ETZA 1S77D 2XLJA 5KTQA 2HVEA 1VQSA 2RRNA 2CQ2A 4M1KA 5DQHA 2GHWA 5KT3A 1CG2A 1WOOA 2IYGA 1U25A 1VIOA 2BJ9A 1NH8A 2Z58B 4ZCKA 1LV5A 3LP1B 4IDKB 1S1UB 3B82A 3LGNA 4DR5J 4Q2LA 3NKYA 2ALZA 3AJ1A 1J27A 5KFDA 3RB6A 2KT3A 3GONA 3TVKA 1R27B 2P5VA 3LH2S 1XMOJ 3DLEA 2MLXA 3R7BB 1PKUA 4ZCIA 2G1DA 2FHMA 2DITA 2NS1B 3S7RA 5KFQA 1SJ3P 1PJ5A 4WFZA 4USWA 3UO0A 3F41A 3IBWA 9RUBA 1KD1T 5GMKa 2A6OA 3HHLC 5FDLB 1ROFA 4XPEA 3V6HA 4FXWA 4JV5F 3R7SB 1WKKA 4B3MF 3MAHA 4DSKA 2DH9A 3IRXB 4OYMA 1CPZA 3D0GE 2AYEA 1D8ZA 2XYHB 4RW4B 3K5NA 4NX9A 3ELHA 2KM8B 3H4BA 3D28A 2HIQA 2LKZA 2CJ9A 3BDEA 4P74A 3OR1A 3MTJA 3LUYA 4ZCLA 2HQFA 4H4OB 3CCSS 1SJFA 3R2DJ 2BA9A 4QWCA 4RWXA 3MUTP 3BO4A 2Y8WA 3D68A 4ZA1A 4WFYA 3R7NB 4DZDA 2YNFA 3KLVA 1H6KX 1WTFA 2DHAA 1RWMB 1C4CA 4DQQA 1KONA 1NB7A 3EMTA 2FJXA 2MJNA 2QLWA 4ID5A 1SJ1A 5IZHA 4YHHJ 3DMJB 1K44A 3SMZA 4ECQA 2UU9J 1NK9A 1IWAA 1PC4A 2RDIA 2W7PA 4DUZF 1VQ7S 1CLFA 3VGTA 1D3WA 1E6YB 3MPUB 5HP1B 1VQ5S 1X4FA 3NY0A 2C2ZB 1Q0NA 2LQJA 4MJKA 4X4NA 3EVWA 3HCXA 5KFKA 2IRYA 1KRPA 5J2PA 1HHQA 2A6MA 1EZZB 4OI4A 2V9WA 2YNIB 2R4FA 2RF2A 3JTOA 2DHXA 3GIJA 3GR0A 3PNIA 2B7BB 1RZMA 2PSZA 2ACMA 1SH2A 1CC7A 2R7OA 1X8DA 3TWZA 3VGUA 5C2GA 1KVJA 4LVOP 2KG1A 3SDEB 4ES2A 5ETSA 3DYAB 3VAFA 1N6QB 3C3LA 1SJRA 4QU7A 4YB6A 5C7PA 4OZNA 2CQIA 1H98A 1UJ4A 3IAS9 1XBWA 5GADU 2QEXS 1Q8BA 2Q66A 2KYZA 3VGSA 2V34A 2XSJB 4DG1A 1NB2A 1RE1B 2HWHA 2W4PA 1I5OB 3FSIA 3MFHA 1RAIB 1RXOB 3AQPA 3L9ZA 3U1MA 5F3ZA 5F8HA 2DHHA 2V2VA 1S9FA 3KTQA 4O4GB 3QRRA 2FJVA 3DI6A 1EARA 2BJ7A 2CA9A 3LP2B 2ZUGA 4BBYA 3C46A 5CCLA 1C1CA 1NBEB 4EZ6A 2UUBF 2QMWA 1GX6A 2VKZG 4LR8A 3ZC4A 3GIIA 3DOKA 1A6LA 3GILA 1Q16B 2MQLA 3PVXA 1HNZF 4Z7CA 1N5YB 3J81j 3VVTA 1JLBB 1EETA 4DCOB 1BHNA 1EP4B 1H3DA 1YJVA 3DYAA 1OJ4A 3FFIA 1IKVB 1XJWB 2BXJA 1X4CA 2FYXA 4LSNB 3JAMY 2ZOMA 2GAHC 4N7TA 1ZTTA 1X4HA 5K14A 4Y2CA 5GVQA 4AXIA 3QT8A 3WX4A 3AFGA 1B0PA 1KQKA 4FVCA 2LXUA 2R9LA 3CC4S 3CJTA 4FDFA 2BJEA 2ZNZA 4ZPWR 5A8RA 5DDQC 3K5MA 2GGPA 4EBDA 4JV5J 1QAJA 1MROA 3I55S 1QSYA 4RW8A 1ZH5A 3G9CA 2MZTA 5BYRA 3UVJB 4X66J 3GV5B 5C42A 2PEBA 3RUBL 4NWBA 4O3SA 1C1CB 1M1GA 2YY3A 2OEJA 5J2NA 2CQHA 3D6MB 4DU7A 1AA1B 1UW4A 3N9UC 1F3VA 3DC2A 3ZXWA 1VI7A 9ATCB 3CXCR 2DGXA 2HHWA 4ZVRB 3KK2B 1HBOA 2ZBCA 1S7IA 4WFXA 2IMOA 1CS4B 1B99A 5I4MA 4FBTA 2MLZA 4JI0J 5HROA 5ETTA 1VC0A 5T7LB 3VZIA 3KJVA 4KQZA 1Y10A 5A8WB 1UW9A 2B4VA 2M70A 3UE2A 5CD4A 3MR5A 4FKYA 1NKEA 3E3XA 3WDOA 2ZJRQ 4LFAF 1NSAA 1IKXA 4FNIA 2BE2A 3D6TB 3JS9A 3DLKB 2KXFA 3SXLA 2VHGA 4FF4A 3PKYA 2MLYA 3NL0A 2IC3B 3J80U 4Q43A 1NK4A 2NLWA 5DQGA 1U8SA 1ZM3A 3GSDA 1U24A 4IKAA 2QLBB 2AYBA 5L1KA 1F60B 4N47A 1WF0A 1L3SA 4LF7F 1X5PA 3VQSA 3BBCA 1RT3B 3QFHA 2XC9A 2IRUA 1TL3A 3ET6B 2YNIA 1R7IA 1XQIA 4P2XA 5E0OA 4CLUA 3HD2A 3CIMA 4LFBF 4WP8A 5KFIA 1FJEB 4USKA 4USMA 2B4UA 3J7ZT 2OO4A 4OYXA 2P6SA 2HKEA 3GSIA 3DGPA 1YJ7A 5KG7A 2V8PA 3RRGA 4WKRA 2LA6A 4ED8A 3G82B 1VQ4S 4IRCA 3ZNUA 2WB1D 1RU2A 2IPOB 3QO9A 3MMBA 2JSXA 1XNRF 1U09A 3K8WA 3OSNA 2I0XA 2XMWA 3S6EA 5CCMA 4OJ3A 3GMGA 5J2MB 4DF8A 2DVIA 2FJEB 4OX9J 5DLFA 4CO5A 4MIAA 4UOHA 3W5ZA 4WTYA 1LK7A 2HBQB 1EKSA 2DYAA 3BGFA 3AXMA 3DLJA 4C9DA 5LT5A 1S7HA 2H4YB 3IR7B 1RCOB 1JLBA 3TVYA 4Y2KA 5T41A 1NK7A 5D6GA 4H4MA 1HI0P 1SI9A 4DFMA 4NMXA 1GTHA 2DNMA 2K1RA 2ZVSA 4PWUA 4DLGA 1LWXA 3HJVA 2B4PA 4ECUA 1EB0A 2BVZA 2F9DA 2XI2A 3HHLD 3R3TA 3MECA 1X9SA 1SH0A 4IG0A 1TP7A 3VR1A 2CUYA 4P7TA 1VQMS 3DCAA 3MEGB 3NGDA 2UXBF 3CCZA 2L48A 5D3GA 1ACMB 2DGWA 4UF4A 3RRKA 2R7QA 1FHTA 2OPPA 2LXIA 3OJSA 5HK4A 2V8HA 4WFBQ 2DXFA 3QSYB 1TL1A 3FZ2A 4C48A 1PJ6A 4ZHRA 2AKWB 2I2YA 3FQLA 3MR7A 4UOFA 3W2WA 2ZVIA 4C11A 1S79A 2JOQA 4LRDA 3TVZA 2DH8A 1QLNA 3F44A 5J2NB 3VVUA 1QJHA 1VK8A 4C2MA 4URQU 2BJ3A 1QVGR 5C42B 5LJ3Y 4J9QA 4J9MA 3HSJA 1RA7A 1D8YA 3UW1A 1S1TA 4MK7A 1O51A 2XB2D 2HGNA 1XMQJ 4MYUA 4PXBA 4OL8A 2HRUA 3THPA 2HNZA 4BC7A 3W2VB 4DQSA
chains in the Genus database with same CATH topology
2CJXB 3GJSB 2CNKB 2H51B 4DCJB 2QLJB 2XYPB 3R6GB 2C2KB 1RWWB 5K20B 2H48B 2QL9B 3D6MB 4LSZB 2H4WB 2QL5B 4ZVUB 4ZVRB 2FQQB 1SC1B 3R7BB 3EDQB 3P45B 4DCPB 3IBFB 1SC3B 1BMQB 2HBYB 3R7SB 2HBRB 2C1EB 1ICEB 2XYHB 1RWVB 1IBCB 2QLBB 2HBZB 2C2MB 3D6FB 2QLFB 2XYGB 4ZVSB 3EDRB 1RWXB 1QDUB 1RWKB 3R7NB 3KJFB 1PYOB 2C2OB 2CDRB 1RHMB 1RWMB 2CNLB 1F9EB 3IBCB 3R5JB 2H5JB 4ZVQB 1I3OB 5IC4B 3GJQB 3RJMB 2H65B 2C2ZB 1RHJB 4ZVPB 1RHKB 2HBQB 1PAUB 3NS7B 2H4YB 2CNNB 5IC6B 1RWPB 3SIPB 3KJNB 1RHQB 2XZDB 1RWNB 2XZTB 2DKOB 1I51B 1RE1B 2H54B 3D6HB 3KJQB 1RHUB 1NMEB 2H5IB 1SC4B 4ZVOB 2Y0BB 1RWOB 2QL7B 1RHRB 3GJTB 4ZVTB 1GFWB 2P2CB 4DCOB 2CJYB 3R6LB 1QTNB 3P4UB 2CNOB 2Y1LB 3QNWB 4JB8B 3GJRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CJX B;  3GJS B;  2CNK B;  2H51 B;  4DCJ B;  2QLJ B;  2XYP B;  3R6G B;  2C2K B;  1RWW B;  5K20 B;  2H48 B;  2QL9 B;  3D6M B;  4LSZ B;  2H4W B;  2QL5 B;  4ZVU B;  4ZVR B;  2FQQ B;  1SC1 B;  3R7B B;  3EDQ B;  3P45 B;  4DCP B;  3IBF B;  1SC3 B;  1BMQ B;  2HBY B;  3R7S B;  2HBR B;  2C1E B;  1ICE B;  2XYH B;  1RWV B;  1IBC B;  2QLB B;  2HBZ B;  2C2M B;  3D6F B;  2QLF B;  2XYG B;  4ZVS B;  3EDR B;  1RWX B;  1QDU B;  1RWK B;  3R7N B;  3KJF B;  1PYO B;  2C2O B;  2CDR B;  1RHM B;  1RWM B;  2CNL B;  1F9E B;  3IBC B;  3R5J B;  2H5J B;  4ZVQ B;  1I3O B;  5IC4 B;  3GJQ B;  3RJM B;  2H65 B;  2C2Z B;  1RHJ B;  4ZVP B;  1RHK B;  2HBQ B;  1PAU B;  3NS7 B;  2H4Y B;  2CNN B;  5IC6 B;  1RWP B;  3SIP B;  3KJN B;  1RHQ B;  2XZD B;  1RWN B;  2XZT B;  2DKO B;  1I51 B;  1RE1 B;  2H54 B;  3D6H B;  3KJQ B;  1RHU B;  1NME B;  2H5I B;  1SC4 B;  4ZVO B;  2Y0B B;  1RWO B;  2QL7 B;  1RHR B;  3GJT B;  4ZVT B;  1GFW B;  2P2C B;  4DCO B;  2CJY B;  3R6L B;  1QTN B;  3P4U B;  2CNO B;  2Y1L B;  3QNW B;  4JB8 B;  3GJR B; 
#chains in the Genus database with same CATH topology
 2B9X A;  4C6A A;  2KJW A;  3NNC A;  4DX7 A;  1XN9 A;  3ISN D;  1QM9 A;  1FEE A;  3C6T B;  2GJF A;  3AT1 B;  3MD3 A;  3W8P A;  1ZM9 A;  1PYT A;  2WSE C;  3DOM A;  2JFK A;  4KIA A;  4LIR A;  3OLA A;  1KOO A;  2D3Z A;  1JNR B;  3BRE A;  4QQB A;  1X4D A;  4IRK A;  3BQ2 A;  2AW0 A;  2R2T A;  2XMU A;  2H48 B;  3NNH A;  3SSQ A;  1H73 A;  2HHP A;  1CQN A;  4ZP6 A;  3ZZR A;  3H7H B;  3KDO A;  3UN5 A;  5HMW A;  1X0F A;  4M95 A;  1CC8 A;  2A1B A;  4IH5 A;  4I0W A;  2BJ8 A;  2CG8 A;  3QWU A;  2XMJ A;  3JSM B;  3CTR A;  2POK A;  2GVZ B;  3KHH A;  3H5X A;  2ZIT A;  2GO9 A;  3I82 A;  3OR1 B;  2VPZ B;  4MTP A;  4CLL A;  4NLU A;  5KFM A;  2G0C A;  1KEK A;  4IO1 A;  2JC0 A;  3WBZ A;  1W7W A;  3HT3 A;  4ZDN A;  1M5O C;  5HL7 Q;  4AL5 A;  2I1R A;  1IKY A;  2IDL A;  1RWV B;  2MY8 A;  3Q8Q B;  2WON A;  2AT1 B;  2CWK A;  1WG5 A;  1FXD A;  1KWM A;  4QIW D;  1QY7 A;  4ECZ A;  2HGM A;  4UY8 T;  1U6F A;  2V50 A;  3AB4 B;  2Y8Y A;  3CNQ P;  1RWK B;  3EE3 A;  3MM7 B;  5BR8 F;  3CJ4 A;  5A8W A;  5M2P A;  2PI5 A;  2UVR A;  4EI2 A;  1S0N A;  3B6B A;  1YIJ S;  3FK4 A;  2QSF A;  1PYO B;  3A13 A;  4CTA A;  1HMV B;  3MM6 B;  2W9C B;  3KHG A;  1HR0 J;  2AEM A;  5D8H B;  2ZBQ A;  2NYI A;  3BEG B;  4RLE A;  2Z30 B;  3T9N A;  2FHJ D;  1BXN A;  1D09 B;  1TKX A;  1TL5 A;  2CQ0 A;  3PFO A;  1N32 J;  1Y5I B;  2ADC A;  1HL6 A;  4FKX A;  1GMU A;  4N41 A;  2K1R B;  4Y28 C;  2D41 A;  2DNG A;  2H3E B;  3CD5 A;  2OEM A;  3GJQ B;  5IC4 B;  3MCN A;  1IVZ A;  1L3K A;  2ZC4 A;  3MOJ B;  1MN9 A;  1S49 A;  4IG3 A;  4A8F A;  3I5A A;  2ZBP A;  1RHJ B;  2G9O A;  2V9K A;  3C2P A;  3LGH A;  3QAE A;  2HVI A;  3OJU A;  2W4C A;  3I0R A;  1YQH A;  3B4D A;  4CYU B;  3CJ0 A;  3K5L A;  2GAG C;  3L7O A;  3HM9 A;  1UPP A;  4TY8 B;  1JLC A;  1ZA1 B;  2QYC A;  1YHQ S;  3CCJ S;  3BR9 A;  3POT A;  4RR5 A;  1SKS A;  5D0H A;  3PX6 A;  1S1T B;  3QPI A;  1VR6 A;  5KG1 A;  5IT0 A;  4NCB A;  3HJF A;  3GB0 A;  1C0U B;  2W8K A;  1AZS B;  3G71 S;  2VU5 A;  1AW0 A;  2G13 A;  4LMZ A;  4X2B A;  4GRS A;  2RB7 A;  3HKZ D;  4U6P A;  2IVY A;  4LJM A;  1JXE A;  1RT4 A;  1TZ0 A;  2N82 B;  2BZ2 A;  4NZ6 A;  2LDI A;  4PWW A;  2B4O A;  1FDB A;  1NND A;  2W7A A;  3CMA S;  4IR9 A;  4YB1 P;  3LOU A;  6FDR A;  3H5S A;  4Q8F A;  3DLL Q;  1QAX A;  2FY8 A;  1EAY C;  2ZWP A;  4L73 A;  2E9Z A;  4PWD A;  4NYP A;  4LF8 J;  1AYE A;  1O6X A;  5K8N A;  4YHH F;  2Y1J A;  2AGO A;  1YJW S;  5HAO A;  5IM0 B;  2HZC A;  2L3M A;  3ZTQ A;  2DGS A;  5J1E B;  5A2Q Y;  4RBU A;  3GIK A;  1X9M A;  3SQO P;  1F1B B;  1YJU A;  3I6P A;  2V69 A;  1UP1 A;  4Y3C A;  3UI3 A;  2WTF A;  2C2D A;  2M7S A;  1NZ8 A;  4ZS6 A;  4AFF A;  1BD6 A;  3MCO A;  4ZP7 A;  4GC7 A;  5D4N A;  2JH3 A;  5CD4 H;  2F63 A;  4DR1 F;  1P1L A;  4UQT A;  2Q79 A;  4DLE A;  8RUC A;  3HI9 A;  3BPD A;  4RKU C;  2E5I A;  3N79 A;  1S48 A;  1M5S A;  2DEI A;  1LWC B;  2FVQ A;  5E41 A;  3B78 A;  2CJA A;  1TV6 B;  4M5I A;  1NDK A;  3I9Z A;  4NYO A;  2V8D A;  1WNE A;  2GIR A;  4FXD A;  3SSR A;  1N56 A;  3R8Y A;  2W24 A;  4KGX B;  1XNR J;  4OI3 A;  1LOU A;  1F9H A;  3PDN A;  1Y3K A;  4KY3 A;  1DHM A;  1DBD A;  3NBP A;  5E33 A;  3V6J A;  5I42 B;  2HYI B;  3HF5 A;  3J81 U;  1ZS6 A;  1OQ6 A;  4WYW A;  2CJB A;  3TOQ A;  3NRB A;  3PR5 B;  1CJV B;  4WKY A;  1CUL B;  1TUW A;  2KKH A;  1ZPW X;  4M5M A;  3R1L A;  2W8L A;  4F04 B;  5DGB A;  3OD2 A;  1UWB A;  3DRY A;  2ZE2 B;  2K8G A;  5E3A A;  1RT3 A;  2E66 A;  3JQK A;  2HBR B;  2EC0 A;  2ZH3 A;  1NHK L;  1TKX B;  4DX6 A;  4BLG A;  2BOP A;  3J7A 1;  2HPU A;  3FBB A;  1KDN A;  5GAG U;  2IRX A;  2HQD A;  2J76 E;  3HFZ B;  2HK3 A;  4IOC Q;  1U26 A;  1X4B A;  2CPX A;  2PFD A;  4YR3 A;  2V4J B;  2HVZ A;  4NLD A;  3DLK A;  3U1N A;  2M2B A;  3HMJ G;  2KB2 A;  2FDN A;  3D3C J;  4BWJ A;  3ENA A;  5BXI A;  3VAM A;  1PBU A;  1KLM B;  4E2F B;  3OL8 A;  3V81 B;  1F9E B;  1HBM A;  3U1L A;  5IT4 A;  2B0G A;  5HRO B;  1YWX A;  4K0K F;  1REV A;  2HGL A;  3NBP B;  4LT6 A;  3CC2 S;  2ZNY A;  1YVF A;  1H2T Z;  3EGN A;  4ILL A;  4TXS A;  4F4X A;  1AZS A;  3A12 A;  1SUQ A;  5K8P A;  1WHY A;  4C98 A;  2A2D A;  1K47 A;  4WK3 A;  5JXS A;  5CA5 A;  3UFC X;  1FNM A;  3W9I A;  3ETO A;  1BQM B;  3RTV A;  2DH7 A;  1RTD B;  3QJP A;  1OPI A;  2AEF A;  2F7V A;  2CJK A;  4F3O A;  4I4B A;  3NCP A;  1HHT P;  3HHL A;  4C0O C;  3MDF A;  1VYA A;  4L6V 3;  4DZ6 A;  2HW3 A;  1RTJ A;  1Q86 T;  4IR1 A;  1WEY A;  5KG5 A;  4ZIW A;  4JI8 J;  2ZZM A;  2EBE A;  2MXY A;  1NDP A;  2NR0 A;  3PFE A;  3C14 B;  1KBR A;  2VZ9 A;  2KO1 A;  1EET B;  2CDQ A;  2BMB A;  4RL1 A;  1GQE A;  3KJN B;  2X51 A;  5JMN A;  1EP4 A;  3LAM A;  4DEZ A;  2W01 A;  2QFJ A;  2Q43 A;  2KXH A;  3MM9 B;  2L41 A;  3OL7 A;  1QAI A;  3U27 A;  4X62 J;  2CPD A;  1Q53 A;  3W62 A;  3LPE A;  3Q8Y A;  2FJB B;  5KFX A;  2OPQ A;  4KBI A;  3D6H B;  4IOA Q;  4MH8 A;  1DFD A;  4I56 A;  1BGX T;  3RU0 A;  1QE1 A;  2DGV A;  3CB4 A;  3GFZ A;  3RW7 A;  2DO0 A;  4R8U A;  3KLE A;  5EWE A;  1S6P A;  4ECV A;  1RU1 A;  2MST A;  3T5K A;  2X3G A;  5HLF B;  3WZ0 A;  2P9G A;  4I6A A;  1B7F A;  2VG5 A;  1A7G E;  1WJ9 A;  2FGC A;  1N33 J;  2ZH5 A;  1U49 A;  3PRB A;  5IT9 U;  3I5C A;  2MTL A;  5EGY A;  5GAD I;  2V5H G;  2PT0 A;  1GX5 A;  3PEJ A;  2DNY A;  2Y0S D;  2CPI A;  5IOL A;  1R0B G;  4DV1 J;  3PO5 A;  2RVJ A;  3TZW A;  4AQY J;  2NSC A;  3BB5 A;  3TJA A;  1N6Q A;  1XMQ F;  3Q2S C;  2UXC J;  2F5G A;  3MEE A;  5KFO A;  2BEF A;  5DGA A;  3TRG A;  3HDS A;  2GCF A;  3PJW A;  5KFZ A;  2YNG A;  2YH1 A;  1WHX A;  1S0V A;  3US5 A;  3QIP B;  4NPO A;  1N36 F;  2HMI A;  2PE8 A;  4DCJ B;  1UVJ A;  4PG8 A;  1FJG J;  2DK2 A;  3MEK A;  3R6G B;  4X84 A;  3CD6 S;  2AJQ A;  2XQC A;  1NJZ A;  2RS8 A;  4J9S A;  4G1Q B;  4IRD A;  2F4V F;  4Y2I A;  3X3U A;  4KRW A;  4YY3 J;  3DOL A;  5B09 A;  3SCI E;  3OL6 A;  4OZ0 A;  2HND A;  1OWX A;  1V5V A;  3BSA A;  3MM6 A;  4DPU A;  3W61 A;  2EPI A;  2QT7 A;  5GME A;  5CYQ A;  5LMU F;  2KL8 A;  2X1F A;  2KFZ A;  1SC6 A;  3P45 B;  2FZG B;  3IM9 A;  3IBF B;  1ZAV A;  2R7R A;  4KAI A;  4LBI A;  4DL7 A;  3I9V 9;  2E1A A;  4GO7 X;  2MZR A;  2YQ0 A;  2OTL S;  2IAJ B;  2ADB A;  2WBR A;  5EDW A;  2O3D A;  2F65 A;  2E1M C;  1UJ6 A;  1NSP A;  2LP4 A;  3DHW C;  2FPH X;  1RBA A;  3DNC A;  1VRU B;  4YN3 B;  3UWT A;  3UCU P;  1VQ8 S;  3QRP A;  4FYD A;  1SIZ A;  3PRD A;  1FK9 B;  3ITH A;  2MKK A;  3JTN A;  1PIE A;  2MY7 A;  5KFP A;  4X64 J;  2RQM A;  3M6X A;  2VKR A;  4OYW A;  3VAI A;  1S59 A;  4Q44 A;  1T7P A;  5FDL A;  3MR2 A;  5KOW A;  1NPR A;  4C8L A;  4LQ9 A;  4WZQ A;  2AGQ A;  2V4Q A;  3CED A;  3CIZ A;  3QGH A;  3T6B A;  4AT1 B;  2X1B A;  2JFD A;  1N34 J;  3KUG A;  4C8O A;  1YZ6 A;  1FK9 A;  1VRQ C;  3CJ8 A;  3G8T A;  4J9U E;  1HPZ B;  3R5J B;  2B9Y A;  4NLY A;  4RX6 A;  2AZ1 A;  4WU3 A;  1XK8 A;  1W2I A;  3FVY A;  1NUE A;  2DHG A;  4L3K A;  4ZVE A;  3CUN A;  1ZTW A;  3LP1 A;  1L3V A;  2RRB A;  4OYI A;  5FD1 A;  4DV1 F;  1TL4 A;  2XZW A;  4I2P A;  4EK2 A;  5LXY A;  4OYZ A;  2VG7 A;  3IN5 A;  1R0A A;  4O44 B;  1HNW J;  4BS2 A;  3MPD A;  4PQA A;  3WIU A;  2HQG A;  5CYM B;  2VPX B;  3M30 A;  4UZB A;  2KHD A;  2AWZ A;  2VBY A;  4F02 A;  5EN1 A;  3M2R A;  3DU5 A;  1BWE A;  4TLR A;  1IKW B;  3UCZ P;  4ANE A;  2ATC B;  2HHU A;  1OMS A;  1LWC A;  1PG5 B;  1DTT A;  4NI2 B;  4OHY A;  3TA1 A;  5IC6 B;  2C3O A;  4YS2 A;  1WG4 A;  3IS9 A;  2YWE A;  1R0A B;  2EFN A;  1WI8 A;  3QRQ A;  2ZH6 A;  2A18 A;  5SUH A;  3HHK A;  1RAF B;  1S1W A;  3W64 A;  2Y9H A;  3ETM A;  4ICL B;  4XAK A;  2DHS A;  5B0C A;  1PSD A;  2AJF E;  2HZV A;  4JI5 F;  1HBU B;  2LA4 A;  1X5O A;  3W9J A;  1W26 A;  4OIX A;  1YI2 S;  2FZK B;  4M5L A;  2HAF A;  2UXC F;  4P2S A;  1MSW D;  3MWB A;  4DPX A;  2M4M A;  1RHU B;  3NP5 A;  4WXO A;  1SVD A;  4ELU A;  3BGU A;  4JI2 J;  5D4O A;  3ZZZ A;  1T02 A;  3QLH B;  1HQU B;  3PRV A;  4O3P A;  2N7C A;  4Q8E A;  1Q7Y T;  2I9S A;  1C1B A;  5G4D A;  4DS4 A;  1IQT A;  1T3O A;  2BUN A;  1HD0 A;  2D69 A;  2RDD A;  4W90 B;  2RRA A;  2JEF A;  2VOP A;  3JSR A;  3A8K A;  2GNK A;  2XS5 A;  3CCU S;  4DL2 A;  4CLS A;  4H4M B;  3RBX A;  2FLN A;  4JYA F;  1F3F A;  4C0B A;  4OZL A;  2JVO A;  2BE9 B;  3JSM A;  3G6V A;  1JXV A;  4LF6 J;  1ARO P;  3RJM B;  3PJX A;  4TY8 A;  3MM9 A;  3HVW A;  3CJ3 A;  1VQP S;  4DXL A;  2BR0 A;  3OUY B;  1HBO B;  3MMA A;  3MMC B;  2UV8 G;  2MMY A;  4NRT A;  1FKO B;  3DRS A;  4KSE B;  2YKA A;  2ZJQ Q;  1NJY A;  2UUT A;  1UEV A;  1R8C A;  4NZ0 A;  2F3J A;  1T9U A;  4OZ3 A;  1VRT A;  2KHC A;  4HH1 A;  3EGW B;  3NGU A;  3WHI A;  2I5J A;  2VFR A;  2VQE F;  1HLW A;  1NDL A;  1RT2 B;  4NE9 C;  1L3U A;  4A48 A;  3HVA A;  3W2V A;  2GGP B;  4URS A;  2A3J A;  4YY3 F;  4JV2 A;  1TK5 A;  4LF9 F;  4RW7 A;  1EQ0 A;  2L9D A;  2YX4 A;  4DV0 F;  1HW9 A;  3GLJ A;  3WC2 A;  4LFC F;  2GO8 A;  2EK1 A;  1GAO A;  1E6Y A;  5ETM A;  3DDI A;  5HP1 A;  4DOZ A;  3MTK A;  1RTD A;  2FJW A;  5ETN A;  1KP6 A;  4M94 A;  3H5Y A;  3KMS A;  2HIY A;  3D1Q A;  5F8I A;  2A10 A;  3NNA A;  2OPS B;  3OUY A;  2VC1 A;  4RW9 B;  4DDF A;  4JI5 J;  3R2C J;  2I6W A;  3CMQ A;  1LQ9 A;  2Z2L A;  2HHX A;  2NXU A;  3M7V A;  2L9N A;  4NEZ A;  4XDD A;  2CVI A;  1T9T A;  3DRP B;  2OIH A;  2HS0 A;  4DL4 A;  2C2O B;  2CDR B;  1RT5 B;  5CH7 B;  4F4W A;  4B3S F;  1RHM B;  1SB6 A;  3KK2 A;  1G2E A;  2QLX A;  1UEK A;  3N01 A;  4KO0 B;  5KFH A;  5GAG I;  5ETP A;  2GVZ A;  1WUU A;  2ZHO A;  2XLI A;  2D3O 1;  3IRX A;  2E29 A;  2XSJ A;  4DG1 B;  2C28 A;  2AHO B;  1C0T B;  4F0K A;  2OJ3 A;  4QWB A;  1IM4 A;  2QSW A;  3SFG A;  1GMW D;  2YX1 A;  3FRZ A;  3IWL A;  3PYE A;  5J2Q A;  1HNX F;  1LW2 A;  3CCR S;  3SV4 A;  1OO0 B;  5EWG A;  3CJ5 A;  2WBM A;  3CDU A;  4R25 A;  3OHA A;  4A8S A;  1RAE B;  4ZJQ A;  3Q83 A;  3FZB A;  4HI2 A;  4MK9 A;  4CO2 A;  5E3P A;  2FVS A;  1KOH A;  1VIX A;  2RNE A;  1R43 A;  4FN5 A;  3RAQ A;  3I87 A;  3UQS A;  4RNN A;  1FE0 A;  4EFA C;  1JXL A;  3HVT A;  2RUS A;  1ELO A;  3FMW A;  1N5Y A;  4DV2 F;  4ECS A;  1PIL A;  1K8A T;  3T5J A;  5KG4 A;  3GYG A;  3G82 A;  3NAH A;  4X4S A;  2IFX A;  4FPR A;  5HVF A;  1IN0 A;  2HQ3 A;  1RHQ B;  1U4B A;  1N8R T;  3KNG A;  2DGO A;  4ES1 A;  2B7C B;  3M2R B;  1XMB A;  1FI4 A;  4KPY A;  4MKB A;  4CZC A;  3DM2 B;  3EJM A;  5CYM A;  3DDK A;  2E1P A;  5KFF A;  1U1K A;  2CJQ A;  5KFS A;  3RG6 A;  4DF4 A;  1KC8 T;  4NML A;  3UN3 A;  1GXT A;  1TFY A;  2XMM A;  4X4V A;  4ED6 A;  3TP2 A;  4DV4 F;  4PUO A;  3QT7 A;  4URG A;  2DCL A;  1RTZ A;  3O3L A;  3HZG A;  1FRI A;  2D9P A;  3EZ5 A;  1NJX A;  4YOE A;  2OTJ S;  5CHC B;  3HSG A;  4OZ5 A;  3JYT A;  2QA1 A;  2RE1 A;  2BQR A;  4LF8 F;  3M32 A;  3H4D A;  5K5M A;  3PKM A;  4OX9 F;  3V4I B;  1VJQ A;  3M2U B;  3MCS A;  4U7U D;  3BO2 A;  1PYS B;  3VQT A;  3PW2 A;  3P4U B;  3KJV B;  1T8E A;  5HJX A;  1S5Z A;  3UCG A;  2Y1L B;  2ZH9 A;  3FEZ A;  5IWA J;  1YG0 A;  3IMQ J;  2AQ4 A;  1V6H A;  2OD6 A;  2CJX B;  2XBP A;  3HFV A;  4QIV A;  2R2S A;  2C22 A;  4Q2M A;  2ZOF A;  2IYI A;  1PJ7 A;  3IG1 B;  2IA6 A;  4TU8 A;  1EKR A;  2VIH A;  2GJ2 A;  2XHC A;  1A0O B;  4NLS A;  4RZR A;  5A6P A;  4ZVF A;  4FVM A;  2C2K B;  1UKU A;  2P9E A;  4OJH A;  3JSB A;  3BBF A;  4P2F A;  4RW9 A;  1LNQ A;  4DSL A;  1CEZ A;  4ECW A;  2V2Q A;  2PA3 A;  3IWX A;  3DMJ A;  4KYZ A;  4U67 Q;  3EX7 B;  2ALY B;  1KFS A;  4HHH A;  4O3N A;  5B0B A;  2FLP A;  2VON A;  4FF1 A;  4GKJ J;  1VBZ A;  4DR7 F;  3GIM A;  3I32 A;  3MPW A;  2JLG A;  2QA4 G;  2LEC A;  4I7F A;  1Z2Z A;  4HAC A;  3EDQ B;  4KGZ B;  4KGM A;  1WKL A;  5HQM A;  3FEY B;  4A8K A;  4DFP A;  1IBK F;  4CWB A;  3TZX A;  3EPG A;  2F9J A;  1IKW A;  2DJW A;  3J80 Y;  1N36 J;  2VFS A;  2HBY B;  5E7O B;  3W60 A;  4QPT A;  2QV6 A;  1Y00 A;  4NLV A;  3A8J A;  3TJ9 A;  4MKY A;  3GFY A;  1P9Y A;  4M5D A;  2C1E B;  1J5E F;  1F5A A;  1ICE B;  1TKT B;  1SUQ B;  1O5J A;  1YZ7 A;  2XWX A;  4HR2 A;  1FNO A;  4K59 A;  1WOP A;  2IJR A;  2LQ5 A;  2ZEJ A;  4YFU A;  1NRK A;  2R7W A;  4RBV A;  4HTJ A;  3T6J A;  1TKZ A;  4KKO A;  1RAO A;  1U48 A;  2BJD A;  3BGO P;  4ZVS B;  4O4R A;  1FKO A;  2N4D A;  3DRS B;  1R6V A;  3AY0 A;  1FDD A;  3MEE B;  2ZFH A;  1RYS A;  1F9F A;  1UFL A;  3H59 A;  5M2R A;  4P6Q A;  2PMZ D;  4C3K A;  1RYR A;  5BR8 J;  4FBU A;  2MEW A;  2YX7 A;  5LSO A;  4DR6 J;  4C7Q A;  5HMZ A;  4JI4 F;  1VBY A;  3NXZ A;  1QAY A;  1U2C A;  5T7L A;  2EKN A;  2BRK A;  1TKD A;  1DTQ B;  4B3S J;  4FP9 A;  4NA2 A;  3NWG A;  4H4O A;  4P72 A;  4R0J A;  1CS4 A;  1WC1 A;  2AX0 A;  3IAM 9;  4TNO A;  3BKF A;  4I2Q A;  4YR2 A;  1FRH A;  4OLO A;  2ILZ A;  1AFI A;  4PRF A;  2CQ1 A;  5AXN A;  4LF4 F;  1JLQ A;  4OI2 A;  1V5I B;  2MPU A;  3MPV A;  1ZET A;  1DLO A;  1VC5 A;  2HHT A;  2H65 B;  1RGV A;  1EHW A;  1NO8 A;  1I1G A;  1UET A;  1YJR A;  4MAK A;  4ES3 A;  4ZLP A;  3UNG C;  3JSY A;  5A76 A;  3L95 X;  4CP5 A;  3V5R A;  1U1P A;  1HQU A;  4F26 A;  4FF3 A;  1NLK L;  3M8Q B;  2OPQ B;  2G2Y A;  1HBN A;  2R7T A;  2R8I A;  3A3O B;  4JI1 J;  3VV2 B;  5LSL A;  2DR7 A;  4FYW B;  1HFE L;  2V63 A;  4RO0 A;  2X3D A;  4W92 B;  4OHX A;  1RKJ A;  2UUA F;  3OVB A;  1RWP B;  4PCQ A;  5A0Y B;  3NMR A;  2M9K A;  3HSD A;  3J7A N;  2ZJP Q;  4X4U A;  4QBU A;  3FNN A;  5T14 A;  4B9T A;  2ZD1 B;  3D0H E;  1I51 B;  4F25 A;  5LOQ A;  4LRE A;  5IFM A;  5DQI A;  1SXL A;  3GZ7 A;  4O3O A;  4HYK A;  2YNF B;  1N5V A;  2AIR B;  1I6J A;  1MWQ A;  1T95 A;  2DY1 A;  4ECR A;  2HMI B;  3HT0 A;  1WC4 A;  3DHX A;  2YNG B;  2FHK A;  2ZM6 J;  4GO5 X;  3KLG A;  2LDY A;  3HSZ A;  2WVF A;  4LF1 A;  1CSJ A;  1SQE A;  2FHO B;  1JLQ B;  1N5T A;  1VLY A;  3BZQ A;  3GU0 A;  3OTE A;  1RWO B;  4MIB A;  3OPK A;  4PXD A;  2IJN A;  2ZH7 A;  2QZ8 A;  1DJ0 A;  2Y3Y A;  4JI3 F;  4NLQ A;  2IBO A;  1QUP A;  4PAB A;  4U95 A;  2U2F A;  5DM6 Q;  1VHF A;  1YRX A;  3CDA A;  1R6Y A;  5ETV A;  2LEB A;  3BSN A;  4KFB A;  2J5A A;  2FLO A;  3V6D A;  4PXC A;  2RSQ A;  1XNQ J;  5F9L A;  4ZP9 A;  1AUD A;  1G1X A;  1HNI B;  3EXY A;  3K17 A;  3Q23 A;  3TUP A;  4G1I A;  4Q0B B;  3P96 A;  1FER A;  2M8H A;  2MZQ A;  2NSB A;  3QZ7 A;  2XGQ A;  2IM2 A;  3MEC B;  3H20 A;  2VAS A;  3K0J A;  1VHI A;  4ZPC A;  2H51 B;  1RBL A;  4I1T A;  2DRB A;  1D9D A;  3HHE A;  2KFY A;  3P49 B;  4DPW A;  3D7S B;  2KVQ E;  2OHD A;  2WRM A;  3GYN A;  1U1M A;  1TKT A;  3LPY A;  2XI3 A;  3GG0 A;  2KXN B;  3W3S A;  2MYF A;  2PII A;  3MAA A;  3R97 A;  1C0U A;  1J5E J;  1HWU A;  4ILR A;  4NLP A;  3ITH B;  4Y65 A;  3JYT B;  3PW0 A;  2PFF B;  2CZ9 A;  2ZE2 A;  2HNY A;  2B5J A;  3OTO F;  2HRT A;  3V2U C;  1IM6 A;  1N5Q A;  4X4P A;  2V4R A;  4K4V A;  1K9M T;  1CJT A;  3AD7 C;  1U0S A;  5I3P A;  1IBM F;  3T1A A;  2GQQ A;  1BC6 A;  3X1L B;  4DV3 J;  1JQG A;  2HVD A;  4RUH A;  4MKA A;  1BQN B;  5F0W A;  5KFA A;  2UUC J;  4USU A;  1HW8 A;  2J9D E;  4J9V A;  5HN0 A;  4FYX B;  3TR5 A;  1UVM A;  3RAX A;  1NJW A;  2BKN A;  4IYQ A;  1R0C B;  4QWD A;  4UOG A;  1HIY A;  1V3Z A;  5I3U B;  4FPI A;  1UA1 A;  3J7Z 5;  1UVN A;  4P10 A;  2XWY A;  2MJU A;  1S4E A;  1RT7 B;  3HZE A;  1ZAW A;  4FS2 A;  1JLG A;  5AJ3 F;  3D67 A;  4U7C A;  1VOM A;  3Q24 A;  3LF0 A;  2PO4 A;  1IQZ A;  3DXB A;  5AJ3 J;  4B3O B;  1KQG B;  1RTH A;  3BN4 A;  2PMH A;  1F6T A;  2CIM A;  4XDC A;  4DSI A;  3OVS A;  2RIJ A;  4DJB A;  2GIQ A;  1NCL A;  3QBC A;  4YDD B;  2B8Q A;  2W1B A;  4IG0 B;  2CQB A;  1FE4 A;  1FVS A;  2CQD A;  3T1Y F;  4L74 A;  3R1H A;  4DQI A;  3PV8 A;  3MZI A;  4CM2 A;  2C3Y A;  3W63 A;  3KLF B;  3CC7 S;  4QW8 A;  1UMJ A;  1HWL A;  2C3P A;  3OW2 R;  4B9L A;  1HQ2 A;  3A3N B;  3LTO A;  4B3R J;  1FRX A;  4Y00 A;  3SSS A;  2DO4 A;  1X5S A;  1AXQ A;  1S6P B;  3G6Y A;  3EWG A;  5KFR A;  1RT4 B;  2EW9 A;  3C15 B;  1ZYQ A;  2AF6 A;  2CAD A;  2GQ2 A;  2QA4 S;  2NXJ A;  4DR1 J;  5ETR A;  3RBD A;  3CJS A;  3SI8 A;  4B9M A;  3GYX B;  3QJL A;  1NKB A;  5B0A A;  2HHS A;  1WSR A;  3D2W A;  2HFV A;  4OJG A;  3Q8S B;  2HK2 A;  3ILJ A;  4ED3 A;  2BKO A;  2HFS A;  3NGT A;  4J9O A;  1N33 F;  1YJN S;  2OPS A;  5E3Q A;  2BBE A;  1JLE A;  1SV5 A;  3KK3 B;  2EG2 A;  2V94 A;  2EBG A;  2KU7 A;  2XZD B;  5ETK A;  1M90 T;  4W98 A;  5A8R B;  3ZTP A;  1REG X;  3CWJ A;  3CCM S;  2ZZN A;  4JI4 J;  2Z57 B;  5K14 B;  1VCT A;  3IG1 A;  4ECY A;  2MHN A;  4IFY B;  3KHL A;  2XMK A;  3BN7 A;  1SQG A;  3DDN A;  1HBN B;  3NWR A;  4LRB A;  4LSN A;  5GAH I;  2XY6 A;  3HLU A;  5HJY A;  4ZVO B;  3HVR A;  2KG0 A;  1UL3 A;  2ASD A;  1LW2 B;  1HR0 F;  2E9T A;  2DNO A;  1S10 A;  5FII A;  3PW4 A;  4LF5 J;  4N76 A;  1T9W A;  1Y9O A;  2VG6 B;  4NLW A;  2B51 A;  3ISN C;  1NPK A;  1O8B A;  2J7U A;  2RKI B;  5D0R A;  4F3Q A;  4DL6 A;  2C2R A;  2FVP A;  2EC2 A;  2P2C B;  4KHM A;  4U7U K;  2BAC A;  3RR8 A;  4GKK J;  1WD6 A;  1S1X A;  4K4U A;  2KT5 A;  3D3B J;  1PBA A;  3MED A;  3QT5 A;  2V0N A;  1JKH A;  4M8L A;  4NLO A;  2FC8 A;  2GX8 A;  3KLE B;  4EBE A;  2N3O A;  3R5B A;  3RR7 A;  3IO1 A;  3QT6 A;  3IM8 A;  1R89 A;  3QNW B;  1VQO S;  1AFJ A;  3C16 A;  4JB8 B;  5HBM B;  2D3U A;  3TW0 A;  4DWI A;  4ERD A;  2ZBR A;  4P75 A;  5D3G B;  4C8K A;  4IH7 A;  1N5S A;  2JRS A;  3QYY A;  3T3F A;  3OFG A;  3M8P B;  3TI0 A;  2HZA A;  1TKZ B;  4KKO B;  4PG5 A;  1N52 B;  1FWP A;  1OYE A;  3FQK A;  3G2X A;  4ZVH A;  4CIO A;  4K0K J;  4C3M A;  4K2J A;  3IR6 B;  2CZ4 A;  2QL9 B;  4BCA A;  4B17 A;  3KHR A;  3MD1 A;  2FHJ A;  1U1R A;  4J9R A;  1DAX A;  1WC3 A;  1S4F A;  1XIQ A;  2RHS B;  5A8K A;  1U45 A;  5KFY A;  1RSC A;  4XPC A;  1FKA F;  4LF9 J;  4CLT A;  4UZC A;  3CD7 A;  1C2P A;  1ZA2 B;  2GJI A;  3K7R A;  1RTI B;  4O23 A;  4DPT A;  5KT7 A;  3BYR A;  1N0V C;  1XER A;  5B0F A;  1WSV A;  2DY9 A;  1VRT B;  1WHW A;  4YR0 A;  2UU9 F;  2GQC A;  4K4X A;  3MMB B;  3AHP A;  3KDN A;  4OX6 A;  3NS6 A;  4NLR A;  4OLP A;  5E2Q A;  2E1C A;  3TUJ C;  2CPH A;  2J9C A;  2QMX A;  4ID5 B;  2FC9 A;  5J2Q B;  3MMA B;  1FKP B;  4PR6 A;  3ZTO A;  2Y1I A;  5LJ5 Y;  1YTY A;  1WDT A;  4KGV B;  2XY7 A;  1K0T A;  2WVC A;  5HBM A;  3KJF B;  3M9M B;  5IT9 Y;  1YBT A;  1X4E A;  1T05 B;  1IJE B;  2Z2Z A;  3MUV P;  2RU9 A;  4O4G A;  4X4T A;  4BWM A;  3PIP Q;  2HLU A;  1FX2 A;  3C15 A;  2F4F A;  1HQE A;  1S9E B;  3N6M A;  3CVK A;  3KK1 A;  1FT8 A;  4ER8 A;  1HA1 A;  2YBV A;  2DT9 A;  2HS4 A;  4LSL B;  2FVR A;  1KHW A;  3J7Y I;  4I64 A;  3LO3 A;  2Z0G A;  4Q5V A;  4OYA A;  3RBE A;  2XMT A;  2PGC A;  3A1Y G;  2B3T B;  4QIF A;  2YXL A;  2AYM A;  4DV3 F;  4O3Q A;  2VV5 A;  4A8Q A;  3TA0 A;  1M1H A;  4K8R A;  2BE2 B;  3VAL A;  4DFJ A;  2XY5 A;  2D3O R;  2OPP B;  2BQU A;  1SPB P;  1VBK A;  1TFW A;  3FUY A;  3M05 A;  2NUU G;  2E7W A;  5MAO A;  4UOC A;  2MQQ A;  4J37 A;  2ZH2 A;  4J91 A;  2AJ0 A;  2E7V A;  5A2Q U;  4ELT A;  4KHP F;  2WVE A;  1OQ3 A;  4ED5 A;  4YB5 A;  1ZM4 A;  3QSI A;  2CNN B;  2C2N A;  3LP0 B;  1KTV A;  4CQ1 A;  3LWL A;  1VQ9 S;  1JLG B;  2VDH A;  5E3C A;  2Z8Q A;  1N32 F;  3CJK A;  4YME A;  2G2O A;  3OTD A;  1FA0 A;  3CDB A;  4IFV B;  3ZNJ 1;  1HYS B;  4M63 A;  4EO8 A;  5HVH A;  2VOD A;  1PC5 A;  2OFG X;  4DV6 J;  1FRK A;  3TA2 A;  4MT1 A;  1S1V B;  4QWE A;  4X66 F;  2UVU A;  1NDC A;  4PQU A;  2PMW A;  1TMM A;  3KKF A;  1Q5Y A;  1XR6 A;  4Y6I A;  4Q45 A;  2YKN A;  3T1H J;  2FIU A;  1G4C A;  2FJA B;  3AOD A;  4JP8 A;  1FNX H;  4CH1 A;  2FZC B;  4LFA J;  4OYP A;  4ZN3 A;  4WTO B;  2O1P A;  4HDG A;  5JUM A;  1M1K T;  4DV7 J;  5IS2 A;  4JBC A;  1FJ7 A;  2JHE A;  1K1Q A;  1CJK B;  4OX7 A;  4JI2 F;  4PQU B;  4I2P B;  2B5J B;  3JXO A;  3MR3 A;  1RHR B;  4DU8 A;  4FXV A;  5L38 A;  3MM5 A;  2LU1 A;  3G6E S;  4FS1 A;  1URR A;  3GJT B;  4LF5 F;  1P27 B;  5JJB A;  1X0P A;  2JDJ A;  3A4T A;  2CJY B;  2ZDO A;  3L4B C;  5K9F A;  4OMF G;  3M8R A;  1WC6 A;  4F8R A;  1QTN B;  2DRD A;  3DKD A;  1WG1 A;  4L3N A;  2GVD B;  4JYA J;  1FTC A;  2AD9 A;  2KZZ A;  4AXJ A;  3PM9 A;  2ZWO A;  4LR7 A;  1GNK A;  4MK8 A;  3PO4 A;  4R0E A;  4DCP B;  2FY1 A;  3GJR B;  2XCA A;  4LFC J;  3KLI A;  3RW6 A;  1FRJ A;  3ILI A;  3BJY A;  1NK0 A;  1QUV A;  1D1U A;  2VFV A;  1MLA A;  2IY5 B;  2EKY A;  3SFU A;  5H9E J;  3V6D B;  1HWK A;  5KFC A;  2PD1 A;  1RWU A;  1I94 J;  4ZJL A;  1FFS B;  1VRU A;  1HI8 A;  4RBT A;  4DPY A;  5DM7 Q;  3IR5 B;  1Z4U A;  4CNZ A;  5IXU A;  2VJV A;  3PEH A;  3KNA A;  1BUX A;  1K0V A;  4ICL A;  3H40 A;  2XNQ A;  1UFK A;  3NLC A;  5K20 B;  1AB8 A;  1UCN A;  4HVZ A;  3M6U A;  3CUL A;  3PJ9 A;  1P6T A;  3TX0 A;  4CLZ A;  1CQM A;  3VAG A;  4PPD A;  3OXG A;  1EJ7 L;  1R8H A;  4DL0 C;  5IWA F;  3BH6 B;  4JI6 F;  3AOC A;  4TN2 A;  4F4A A;  5DDR C;  2MB0 B;  3KLG B;  4G6V B;  3PR4 A;  3HHD A;  5F0U A;  4ELV A;  2R7U A;  1H2V Z;  1SC3 B;  5AXL A;  3W7B A;  4R5P A;  2APO A;  3F0N A;  3C19 A;  3HXM A;  4DV0 J;  1T03 B;  3OFF A;  3C66 A;  4TU7 A;  4ZPT R;  4RW6 B;  1SL1 A;  1RT2 A;  2J6T A;  3M1V B;  3VAJ A;  2EFO A;  1SL2 A;  4JI8 F;  1R31 A;  1XWL A;  3THV A;  3BPS P;  4F4Y A;  5EX0 A;  3CCL S;  2YVS A;  3HVT B;  4RNH A;  3QIP A;  2R8H A;  3S8S A;  2HBZ B;  2YPZ A;  2C2M B;  4MIW A;  5HO4 A;  2CQG A;  2N7Y A;  4PPZ A;  5KFV A;  1B0V A;  4E0D A;  1N54 B;  2M3D A;  4KGK A;  3W5Y A;  4XTT A;  4K2X A;  2GMJ A;  1RBO B;  3M4X A;  4EWT A;  2WCX A;  4F36 A;  3CSK A;  3EGV A;  2YKO A;  2O01 C;  1RT1 A;  3NS5 A;  5EHH A;  4LRC A;  4I6W A;  2MZ1 A;  3ZZP A;  2H5J B;  4ZVQ B;  1RKI A;  4L72 B;  3J81 Y;  3ZTS A;  1LXN A;  1V3S A;  3P8B B;  3K5O A;  2G4B A;  3AOA A;  3ICL A;  1ITP A;  2G2Z A;  1JK9 B;  2MDA A;  4MFB A;  1LWF B;  1CJU A;  3DI6 B;  1FCA A;  4NCG A;  3W2W B;  5DG9 A;  3GFH A;  2RUG A;  2VBZ A;  3EUN A;  1PCA A;  2Q1L A;  2QIF A;  3VWS A;  2Q3P A;  4HH0 A;  4P52 A;  4EYH B;  4XK8 C;  2VA2 A;  4DR6 F;  3E8O A;  1ZBT A;  3NS7 B;  2M52 A;  4NYZ A;  2QTW A;  2V4J A;  4JUZ A;  2J9D A;  2BV3 A;  4KV8 B;  2WSF C;  1FF2 A;  3M32 B;  4DV4 J;  1LWE B;  4NL5 A;  3Q89 A;  4WK1 A;  1S99 A;  3MM5 B;  1RAG B;  1NZA A;  5F8G A;  2QFI A;  4YQW A;  3SIP B;  2HQI A;  2LXF A;  1G3O A;  4UST A;  5IV3 A;  4A46 A;  4ID8 A;  1ULR A;  2BAN A;  4PEO A;  5F3T A;  2MKS A;  3VGV A;  4G1Q A;  2EFP A;  4F0H A;  3DLB A;  2DIU A;  3MMJ A;  3TYT A;  2HRY A;  4OQJ A;  1Y4Z B;  1HNV B;  3RZA A;  2MZJ A;  1MRO B;  3QGP A;  1SQF A;  2WVB A;  5KG2 A;  4J7C A;  2IM0 A;  5ETQ A;  1BQM A;  3T1H F;  1QTM A;  2E5L F;  1VLO A;  1ZM2 A;  2I5J B;  2W2O P;  2XMV A;  3GFX A;  3G87 A;  1KLN A;  5EX3 A;  1TEL A;  2NQP A;  4ZMM A;  3D1O A;  1HYS A;  2ASJ A;  3WX8 A;  4P73 A;  4G65 A;  1MU2 A;  1IBL J;  4OI1 A;  3EGZ A;  4AUK A;  3ZFV A;  4DR5 F;  2VPW B;  3P3D A;  4CT8 A;  3H5U A;  1YRT A;  3RB3 A;  1IBL F;  1B7Y B;  3TAM B;  1SIW B;  2QX0 A;  3MR6 A;  1U1Q A;  2VC0 A;  1TAQ A;  4W4M A;  3KUH A;  1LKZ A;  3I5B A;  1GTE A;  2LQB A;  4LF7 J;  4WF9 Q;  2NZ4 A;  2PEH A;  1WAC A;  2HQC A;  4XIU A;  3CCW A;  3LQV A;  3SCL E;  4EMD A;  4RNF A;  2QLJ B;  3M2U A;  3UDC A;  1BWV A;  5L46 A;  4DR4 J;  4CO3 A;  3MGJ A;  2SXL A;  3I31 A;  1Q7L B;  3NOG A;  4X4R A;  1KN6 A;  3B4M A;  1C1B B;  2F4V J;  5FLX U;  5L8R C;  5IM0 A;  2JEI A;  1B4S A;  1HQE B;  1S9E A;  4LBH A;  1IWG A;  2DPJ A;  2MHE A;  5EUH A;  4WJB A;  3H42 A;  3OBI A;  5HQ8 A;  1URN A;  3MF5 A;  4LR9 A;  4C11 B;  4WFA Q;  1T05 A;  5KT2 A;  4ZVU B;  3UR3 C;  3OVA A;  2HHH J;  2FB0 A;  4KT0 C;  2KFN A;  3DRP A;  2YNH B;  2CKW A;  3DRR B;  3QGI A;  4I69 A;  5ADZ A;  3L3C A;  3AA9 A;  4F4Z A;  1JWW A;  1RTH B;  2CQC A;  4NA3 A;  1E6V A;  3Q86 A;  2FJD B;  1Q79 A;  3JQM A;  1HHS A;  3TQE A;  1HI1 A;  1UFW A;  2YKM A;  1BMQ B;  4KC5 A;  1S1U A;  4K4Y A;  1B0T A;  3P5T L;  4DUY F;  3E51 A;  3Q22 A;  2BW2 A;  1MU2 B;  2EI5 A;  4KR0 B;  1PO6 A;  3QJJ A;  2JL9 A;  4NXM F;  2CRL A;  2GC8 A;  3H98 A;  2J6S A;  4GC6 A;  3D5M A;  4TY9 A;  2CG4 A;  3M2V A;  1S76 D;  1VQN S;  2AMC B;  3DU6 A;  1IBC B;  1O0P A;  2W7O A;  3M6V A;  4H4K A;  1T94 A;  2BX6 A;  2GMH A;  3D6F B;  2R2U A;  1UA0 A;  3Q8P B;  4N56 A;  3O5T B;  1RWX B;  5A6W A;  1RQ0 A;  4CT9 A;  1YIT S;  3FKB A;  5LMN F;  2BOA A;  1Q8I A;  3E01 B;  3LA0 A;  2LYV A;  1OY9 A;  2JWN A;  3HX9 A;  4DV5 J;  2AV5 A;  2CNL B;  2VG7 B;  2WZ1 A;  3W5X A;  3TUZ C;  1MNE A;  1XC9 A;  2XM3 A;  1X9W A;  1NHV A;  1X5T A;  2OUG A;  1G6B A;  4ZVG A;  1I3O B;  4EGL A;  2EFQ A;  3OHB A;  3BQ1 A;  4DHV A;  1I94 F;  2XUL A;  2ZH8 A;  3SQG A;  4CM0 A;  4CLP A;  3DLG B;  4NAS A;  3V4M A;  5KG0 A;  4EUV A;  1PGZ A;  2VOO A;  4B3R F;  4N5S A;  2VF3 A;  4TYB A;  2X1A A;  1IKX B;  1TUV A;  2Z2Y B;  3M8S A;  5C5J A;  4ZPV R;  1AT1 B;  4HEA 9;  2R2R A;  3BSO A;  3ZZY A;  4F50 A;  1JJC B;  1CVJ A;  3M6W A;  1S72 S;  1JLF A;  2ABY A;  5HAT A;  1IUJ A;  4QIE A;  2CXE A;  4MMO A;  4X4O A;  4R8U B;  3NMA A;  1J5O A;  1WOS A;  3IFE A;  4OHV A;  4ZLJ A;  1KNZ A;  3DM2 A;  3MM7 A;  1RT7 A;  4OJ1 A;  4QPX A;  3RAM A;  1YKW A;  3HPO A;  4UQG A;  4DL5 A;  2RS2 A;  2NZC A;  4RNM A;  2EXU A;  2R8G A;  3PYF A;  4QR0 A;  2J8S A;  1JLA A;  2KN4 A;  2YWH A;  3P5B P;  3R5C A;  2NPF A;  4B08 A;  2ILY A;  3BF4 A;  2HSE B;  3KG4 A;  4U8Y A;  2RU3 A;  4B3T J;  2OFH X;  2R7X A;  2OEL A;  2D1C A;  2UP1 A;  1OIA A;  3GCW P;  4A4J A;  2BKP A;  3QLH A;  4WU2 A;  1YBU A;  2BW7 A;  1FO1 A;  1CJK A;  3GIR A;  2XS2 A;  3G8Q A;  2XZT B;  3MM8 A;  1RAA B;  2CPY A;  3N28 A;  1Q95 G;  5DDO C;  1SKW A;  5J1N A;  5LSR A;  3GPA A;  4OV1 A;  4WFN Q;  2DIS A;  3C6U B;  5AXK A;  4DBQ A;  3ENV A;  4IG3 B;  1SJQ A;  1S9G A;  2WOM A;  4M5H A;  1CJT B;  5BYQ A;  3ZTR A;  4EYI B;  1Q82 T;  3FFI B;  1YK9 A;  3DFE A;  2LEA A;  4DUZ J;  4J9P A;  3OT9 A;  1S1V A;  1JLE B;  2LQ8 A;  1Y0H A;  3LAL A;  4ANC A;  4CH0 S;  1TTH B;  3KLF A;  4GKK F;  3PCO B;  3UDV A;  3CW2 C;  2ZKT A;  1FRL A;  1WTB A;  3FSX A;  2NPI A;  1FXL A;  3CJK B;  3AJD A;  3OXF A;  3NCR A;  2YPY A;  4DN9 A;  3OTO J;  4QYZ J;  3CCT A;  2AZ3 A;  3MMC A;  5C2C A;  3BDP A;  1Y11 A;  2B56 A;  3AD9 C;  2AX1 A;  2Q6C A;  2VFU A;  2JLE A;  3LP2 A;  1YRU A;  1P1T A;  4JOU A;  1T3N A;  5F41 A;  4IOB A;  4WZM A;  4EZ9 A;  1MML A;  3OSP A;  3H2U B;  5C25 B;  1RCX B;  3R5D A;  3R5G A;  3GV7 B;  1YJT A;  1SBR A;  3AD8 C;  1NXI A;  3QWP A;  2FD2 A;  3AXK A;  4YUD A;  3OR2 A;  4YDX A;  3HD1 A;  3L09 A;  5B0E A;  4A47 A;  5KT6 A;  3LW5 C;  2V8V A;  1IKY B;  4IH6 A;  4DX8 H;  3UR0 A;  5JVH Q;  3CPW R;  1K73 T;  4B3M J;  3I96 A;  4QCL A;  5THW A;  2M0G B;  4USH A;  4PYD A;  4DV2 J;  1T0T V;  2DR8 A;  3GTY X;  4WXW A;  3OXL A;  2YTC A;  1Y3J A;  2XO7 A;  2OAU A;  3PAC A;  4ZJO A;  2MKI A;  2H4W B;  3UD3 P;  2V2Z A;  1APS A;  2QL5 B;  4PKD B;  4DFK A;  4TQR A;  1VQL S;  2QRR A;  2RIL A;  3ZZT A;  3FSY A;  4OZ1 A;  2BM0 A;  1M0S A;  3TZY A;  5F8J A;  1KS2 A;  1KFD A;  1MWY A;  3MCM A;  2UUB J;  1R3N A;  4KE5 A;  4S0M A;  4CDI A;  2V2K A;  1NSQ A;  1TK8 A;  3SQG B;  4Y2A A;  4DV7 F;  2J7K A;  3QAU A;  4DMZ A;  4QYR A;  5DS7 A;  2OML A;  5G0R A;  2ASL A;  2NUH A;  2QMU B;  3DOM B;  3ILO A;  2CAJ A;  3CME S;  2ZBI A;  4TYA A;  5HI7 A;  2D9O A;  1IR2 A;  5IQ6 A;  2QO3 A;  5F8N A;  2BDP A;  2H5E A;  4ED1 A;  1NU4 A;  2QLF B;  2XYG B;  3BSC A;  3C6T A;  4GVB A;  2VPY B;  4V1A k;  3W65 A;  1GH8 A;  1U2R A;  3IS9 B;  6FD1 A;  1KVK A;  2RT3 A;  3LAK A;  3M8Q A;  4RW6 A;  2RJZ A;  1IXK A;  5KFT A;  4TQS A;  4B9S A;  3RB0 A;  3MFI A;  1Y5L B;  4C8Y A;  4DS5 A;  1KVI A;  2IM3 A;  2O67 A;  3M30 B;  1N0U A;  1U7L A;  4L76 A;  4ZPB A;  4I7F B;  1KQF B;  4AYB D;  4C97 A;  1S6O A;  3TO8 A;  5GAE I;  2UVW A;  3IRW P;  3FDS A;  2QJ3 A;  3M2V B;  1U47 A;  3FMB A;  2ZM6 F;  1YSJ A;  1HKA A;  3MAA B;  3EVM A;  5LM7 E;  3UD5 A;  4UY8 5;  1YDL A;  4DPO A;  4QYZ K;  2XCP A;  4IQX A;  1BLU A;  5BJR A;  4ALZ A;  4ZHR B;  1B3T A;  4CLF A;  2WON B;  2CPF A;  2D7S A;  2PC6 A;  4FZV A;  3V81 A;  4RU2 A;  4AL7 A;  1F2G A;  3DGP B;  1XEZ A;  3DXS X;  4RJV A;  3TEH B;  4A8X A;  3K58 A;  2VQF F;  3O44 A;  4PWD B;  1WEZ A;  4ZVP B;  5B0G A;  2DNZ A;  3H90 A;  5KFG A;  8AT1 B;  3D9B A;  4WII A;  4O0I A;  4QJV A;  3N4W A;  3Q8V A;  4WPA A;  5KAK A;  1JJ4 A;  2BE7 D;  2E1R A;  3MPY A;  3PHE A;  4USJ C;  3T9Z A;  2DR9 A;  3MEG A;  1WI6 A;  2KT2 A;  3C8Y A;  1T9Y A;  2O66 A;  1RAJ A;  2GIF A;  2WAQ D;  3UDL A;  2CQ3 A;  4B3O A;  2OLW A;  2G1H A;  2Z56 B;  1BQX A;  5CXT A;  2LQ9 A;  2J0Q D;  3Q2T C;  2R42 A;  2BYC A;  5HLF A;  2HEK A;  3DGV A;  2M5Y A;  2IMW P;  4C8N A;  2E44 A;  1C4A A;  4OI0 A;  2KZM A;  4LFB J;  5KG6 A;  2UXD F;  3FJ2 A;  1RUS A;  2R7V A;  2FUG 9;  3ZZU A;  2K7J A;  3AH6 A;  1LW0 B;  4LF6 F;  1RK8 A;  2GA7 A;  4N8N A;  3TAQ A;  5LMN J;  3QAT A;  3IWN C;  4M5K A;  5HAN A;  4OYB A;  4O44 A;  5LXR A;  3K59 A;  5I42 A;  2RQ4 A;  1SKU B;  2JJ4 D;  2Y0B B;  5CYJ A;  4ATN A;  4EBC A;  2DB1 A;  1UVK A;  3EZO A;  2UUC F;  4ZK7 M;  3QO9 B;  4WWS A;  2DNH A;  3W66 A;  4DV6 F;  4E98 A;  1JLA B;  1TAU A;  4HT5 A;  1GMV A;  2DNK A;  3E2E A;  4OX8 A;  4PXE A;  1VK3 A;  3CDE A;  3MUM P;  3GQC A;  3VZH A;  1GEH A;  1HWI A;  1WF1 A;  2VL1 A;  3R9L A;  3RYL A;  4DR3 J;  4IFV A;  1J2V A;  4KH1 B;  4JI0 F;  2O5D A;  2LEP A;  4PZV A;  2OH2 A;  1WHV A;  5DG8 A;  4CI0 B;  4NLT A;  3THT A;  2OSQ A;  4IUF A;  2CNK B;  3CJ2 A;  1XR7 A;  3D4J A;  4P2M A;  2DBB A;  3VAK A;  1N34 F;  2XLK A;  2XYP B;  4RUC A;  5J1E A;  1LK5 A;  3AQO A;  3OTB A;  4CLK A;  4RUA A;  2OI2 A;  1H0H B;  1RWW B;  2IC3 A;  3K57 A;  3EM1 A;  2VG5 B;  4LSZ B;  4RU9 A;  1U6Z A;  4KTQ A;  1NSK L;  4CCH A;  2VQF J;  1HD1 A;  4LSL A;  2EVZ A;  1QSL A;  5B7W A;  1UVL A;  3Q8R B;  5ETL A;  2FQQ B;  4CLW A;  1M5P C;  2ZHA A;  2RD5 C;  2NYH A;  1QE1 B;  3CT9 A;  2VIC A;  4Q0B A;  4TLQ A;  2B8P A;  2BAB A;  3R27 A;  3U02 A;  2IA0 A;  3M9O B;  1JKH B;  4KHR A;  1J5O B;  3PX0 A;  2HHV A;  1H2U X;  1N48 A;  4JI3 J;  2XSF A;  2HVH A;  5KFW A;  3DOL B;  1RB0 A;  5D78 A;  4B3T F;  5J2M A;  3PG9 A;  2E5H A;  1XR5 A;  3MXH P;  4QWA A;  1UTA A;  4N77 A;  2OP5 A;  3NEK A;  3QQC D;  4P9S A;  5CZV A;  3UVJ A;  3G8S A;  3TAR A;  3WIV A;  3POT B;  3BS9 A;  5KOX A;  5L1J A;  3SDE A;  5SZT A;  3ZZ0 A;  4CO4 A;  1FEH A;  4UW2 A;  1H7X A;  4UTG A;  1FDA A;  1GT8 A;  3EDR B;  4OFZ A;  2W2M P;  5KFN A;  3KG0 A;  5M2U A;  1JIH A;  1DQA A;  2P8I A;  2ZDP A;  1S0O A;  1VQK S;  4PAA A;  6AT1 B;  2CPZ A;  2X1G A;  5K8O A;  1FJG F;  3QID A;  2M88 A;  3TAN A;  1WC0 A;  3R5A A;  4M5N A;  1Q78 A;  4UUW A;  2YWG A;  3G86 A;  4AD6 A;  3GP9 A;  1RJJ A;  3KK3 A;  2MQP A;  4WCE Q;  2F1F A;  3AJ2 A;  1VMB A;  2DGU A;  3BH7 B;  4HI1 A;  2R3V A;  4P7V A;  1FVQ A;  3MI7 X;  4U96 A;  5AE1 A;  4PG6 A;  4R5P B;  3UDE A;  3D54 A;  4DSJ A;  4F7V A;  2WB4 A;  2LLZ A;  5CAA A;  3TQ1 A;  1M5V C;  2COL A;  2QA2 A;  3GE9 A;  5HMY A;  2HHQ A;  2OSR A;  2ZH1 A;  4OV6 A;  5HMX A;  1D0E A;  3FBE A;  3I4P A;  3UPF A;  2HHH F;  1NM2 A;  2DCU B;  3PXG a;  1HBM B;  2MSS A;  1XNQ F;  2DD8 S;  4KH0 B;  4U8V A;  1P9Q C;  1OY6 A;  1R8A A;  3I56 S;  3G6X A;  4TKT A;  2YKQ A;  2ATL A;  5E5N A;  3V4I A;  5L9X A;  2YH0 A;  3RRH A;  1DQ9 A;  5C25 A;  4FF2 A;  3MED B;  2Z2M A;  3MOZ A;  4DI6 A;  1X4A A;  4MYT A;  3NG8 A;  2G0I A;  1S12 A;  1ZAX A;  1R8B A;  5AT1 B;  3ULH A;  2XO6 A;  2GML A;  2C2E A;  2VG6 A;  2DGT A;  4G1P A;  4OHW A;  5L1L A;  1SH3 A;  4NRU A;  5KT5 A;  1L3T A;  4M5G A;  2H54 B;  1JJH A;  1UJ5 A;  4LIW A;  4QR1 A;  5CQG A;  5B08 A;  5DZ6 A;  2OMO A;  3ENW A;  2P6T A;  1VFJ A;  2ZUA A;  2H5I B;  3KFW X;  5LMU J;  2L08 A;  1SC4 B;  2LCW A;  1CUL A;  4Z37 A;  3SV3 A;  3KOA A;  4ZKA A;  3S01 A;  3TAP A;  2L9W A;  4GMK A;  1NJI T;  4F67 A;  5DET A;  3RBZ A;  1QD1 A;  2V67 A;  2CYY A;  2I38 A;  4OYO A;  5E3R A;  2EFV A;  4CO1 A;  2DIV A;  3O1L A;  4ZVT B;  4ZN1 A;  3NGK A;  2MGZ A;  4QOT A;  4F3M A;  2F8H A;  3U7J A;  1Z2L A;  2DR5 A;  3M1V A;  2QG9 B;  2F8E X;  2KM8 C;  4NXN J;  3OL9 A;  1LW0 A;  1S0M A;  3BYP A;  4QU6 A;  4DR7 J;  3IC1 A;  1DTT B;  1HNW F;  3NOC A;  1MWZ A;  4X64 F;  1UVI A;  3P6Y C;  3PHT A;  4FYY B;  4DR2 F;  1QSS A;  4A8M P;  2ROG A;  4BC9 A;  4F2R A;  2MKC A;  2ZZT A;  1OSD A;  1F2H A;  4NEY A;  2KH9 A;  2J9E A;  2RHQ B;  4RW4 A;  1W2B R;  3QZ8 A;  1H7W A;  5AE2 A;  5D4L A;  1SL0 A;  5C24 B;  1FXR A;  1U1L A;  3N5F A;  1FFG B;  1EIY B;  3GCX P;  5KFU A;  3DLH A;  4Q7A A;  2HS3 A;  3OQ2 A;  1TL1 B;  1T9V A;  2W9C A;  3T1Y J;  2FGO A;  2HWI A;  3OFH A;  3QFW A;  3LWM A;  3G4S S;  2E7X A;  3JTP A;  3TUI C;  5GMD A;  4DQP A;  2WW8 A;  2VJU A;  3CGI A;  2ASY A;  1WOR A;  2ROP A;  5DDP C;  1RDR A;  4L75 A;  1A9N B;  2BRL A;  3O8W A;  4ZOS A;  4ED2 A;  4NXM J;  2VFT A;  2DNN A;  3E01 A;  2MQO A;  1QVF R;  5EWF A;  1Q8K A;  2BM1 A;  2GZO A;  3O2I A;  3D1H A;  1CJU B;  1LWF A;  2HWT A;  4IDK A;  3PZP A;  2ERR A;  7FDR A;  4X4Q A;  2B9W A;  1OSC A;  2QE5 A;  3PYD A;  5D77 A;  2LU2 A;  5ETO A;  3EPI A;  2C3U A;  1FWK A;  2B6A B;  2MZS A;  4A8O A;  2VB6 A;  3EXC X;  4B02 A;  3HP6 A;  4ECT A;  3N5B A;  1QDU B;  1TV6 A;  2YQ1 A;  3VCD A;  4CH7 A;  2CFX A;  3HK2 A;  1VQ6 S;  2GFF A;  4HAC B;  3SBM A;  4ETX A;  3T5H A;  2UXB J;  2GV1 A;  1U2F A;  5D4P A;  2IVF B;  4QW9 A;  2R8J A;  1BE4 A;  2ZD1 A;  2XS7 A;  3IBC B;  4QR2 A;  2BAN B;  5HVG A;  1B70 B;  2JZ5 A;  2YNH A;  4C0H A;  2N3L A;  2KJV A;  2XHW A;  3NAI A;  2HFZ A;  2K3K A;  2QGF B;  2HFU A;  2CVE A;  3HO1 A;  4HT7 A;  2B9E A;  4PG7 A;  1GXU A;  1OS5 A;  5G0R B;  2J6U A;  4YB7 A;  3L7P A;  4WP9 A;  2EG1 A;  1U0H A;  3ILL A;  3RB4 A;  2IBK A;  4LRF A;  4M5J A;  2AU0 A;  4DQR A;  5GAH U;  4YEA A;  2XNR A;  2UZA A;  2EK6 A;  1FX4 A;  3GG1 A;  1UAW A;  1NKC A;  3W9H A;  4DV5 F;  1JMT A;  1PAU B;  3H2V E;  3SCJ E;  1HMV A;  2QYG A;  4DUT A;  4ECX A;  3FEX B;  5H1S V;  3EYZ A;  4MFB B;  3BV8 A;  4DR4 F;  3PIO Q;  1YJ9 S;  2K7K A;  3T5L A;  3TZZ A;  1FWL A;  3Q8U A;  3M8P A;  1EQM A;  2RQC A;  4F4K A;  2WK4 A;  1Z1Z A;  4MKV A;  2MGZ B;  1UWA A;  3CCE S;  5AE3 A;  2DRA A;  4H4K C;  4KJI A;  1UZD A;  4PUO B;  4CNY A;  3CF5 Q;  1YX2 A;  3N0V A;  2W2Q P;  4K7Q A;  2UUW A;  3CE8 A;  3UN2 A;  5KFJ A;  4LUB A;  2MKY A;  2IHR 1;  4Y0F A;  3FCW A;  3KK1 B;  4ZPD A;  4RUB A;  2HUR A;  4JV1 A;  3KJQ B;  3TNV A;  5CAB A;  5FLX Y;  4V19 X;  5CYQ B;  4K50 A;  1FFW B;  1H72 C;  1VS3 A;  5KT4 A;  2KVI A;  3IP0 A;  2C3M A;  2HND B;  3B8H A;  3SYZ A;  4K5R A;  4ENO A;  2IVM A;  2E9R X;  3LGM A;  1ZZN A;  1HNX J;  3I0S A;  1DUR A;  3H2L A;  2QL7 B;  2YWK A;  1AUS L;  2B43 A;  3A8I A;  3EZU A;  1KR4 A;  2NXN A;  4WE1 B;  2IIH A;  4M5D B;  2J0X A;  2AGP A;  2VA3 A;  3BR8 A;  4ZIV A;  2EWH A;  2X7I A;  2PDA A;  1BY9 A;  3KLH B;  4NI2 A;  1B64 A;  3HHN B;  1F5C A;  3C14 A;  1FD8 A;  4IQM A;  4XO0 A;  5GAE U;  3IA0 A;  3LAN A;  3SCK E;  4J9N A;  2CNO B;  2WOM B;  4HTI A;  1S57 A;  2OKQ A;  2RQK A;  1LWE A;  4EU0 A;  1UPM B;  2JNJ A;  1RAD B;  1X31 C;  3HKW A;  4KV8 A;  3MUR P;  1ZPV A;  1WEL A;  3K2Y A;  4NZ7 A;  5DRK A;  2ZH4 A;  2OGU A;  3MM8 B;  1SV5 B;  5D0G A;  5IV4 A;  5DJB A;  4TU9 A;  2I8E A;  4OHZ A;  4WBF A;  5RUB A;  2ZHB A;  3BBB A;  4UT4 A;  2EFG A;  1TVR A;  1F5B A;  3DOK B;  3EIC A;  3K5P A;  3ZZO A;  4X62 F;  1P8G A;  2LFV A;  1HPZ A;  3DN9 A;  2EEY A;  4CO0 A;  3BGL A;  2JLF A;  4KB7 A;  3V6K A;  2DGQ A;  1F0X A;  5D15 A;  4OZ2 A;  2UVV A;  2JX2 A;  2WVD A;  1VGY A;  3FC9 A;  3O6Q A;  1RT5 A;  4LF2 A;  4P71 A;  5J1P A;  4C8Z A;  1WC5 A;  1CBK A;  1KLM A;  1KQS R;  2RH3 A;  4F0M A;  1DTQ A;  1RT1 B;  2BJ1 A;  1IR0 A;  2GVD A;  1VBX A;  1Q81 T;  1R8P A;  2NXC A;  4EEY A;  4OZJ A;  4PG4 A;  3L7U A;  2WSC C;  3DLG A;  4DSF A;  3K89 A;  4I67 A;  2DEJ A;  5K8M A;  3FCV A;  2UUA J;  1NPP A;  2WHO A;  4LBP A;  4IO9 Q;  5MLC V;  2WW4 A;  2HG4 A;  3TX8 A;  2KDO A;  3BGR B;  2A0F B;  1H74 A;  4WIQ A;  5F9N A;  4AQY F;  2M8D B;  1N4L A;  2QC3 A;  1S1W B;  3SZ2 A;  1RT6 A;  2CZV C;  4K4S A;  3BO3 A;  3FBC A;  1MN7 A;  2FLL A;  1S97 A;  1Q8L A;  2IJF A;  4CLY A;  2AEJ A;  4AL6 A;  1PAE X;  1TMJ A;  2NXE A;  3B54 A;  4Z2X A;  2OEK A;  4RNO A;  4NLX A;  1UWB B;  2XG8 A;  2H1Y A;  2YKN B;  4RW7 B;  1KKH A;  7AT1 B;  5F8M A;  2E5L J;  1FJC A;  1EX8 A;  5A8K B;  2W2N P;  4A8Y A;  1FES A;  1DRZ A;  1NH7 A;  1HAR A;  1VDH A;  1JX4 A;  4V19 J;  1FKP A;  4HLB A;  1NK8 A;  5I3Q A;  4HHU A;  5AXM A;  2XGP A;  2K06 A;  4D3G A;  4D3H A;  4DL3 A;  1W25 A;  1UEU A;  5F8L A;  1L5U A;  1BQN A;  1IBM J;  1M5K C;  1TL7 A;  2C42 A;  2KYX A;  2FTR A;  2GHP A;  4ED0 A;  1SKR A;  3PYG A;  1E6V B;  2F8M A;  5B0D A;  4DSE A;  2DNP A;  2OD4 A;  3K8V A;  2CQ4 A;  3JQJ A;  3DRR A;  2W9B A;  2AJ1 A;  3OV7 A;  1RAH B;  2W2P P;  4K4T A;  1RHK B;  1V3R A;  3UNY A;  5HSP A;  5DG7 A;  3CCQ S;  1XMO F;  1GK8 A;  1NK5 A;  1DAR A;  2DR6 A;  1TL3 B;  2DNR A;  3ET6 A;  4DX5 A;  3VAH A;  2K3I A;  3KLI B;  3ZO7 A;  4ZLL A;  4HKQ A;  1U1O A;  1X7V A;  2YKP A;  2GW8 A;  5DO2 A;  1LEO A;  2W4D A;  1RT6 B;  2Q6B A;  1S6U A;  2RAQ A;  4N8O A;  1VC6 A;  5H9E K;  3DRX A;  1OPZ A;  2AJ4 A;  2RKI A;  3BGR A;  1C0T A;  3FRY A;  5H9F K;  5C24 A;  1Y7P A;  3JB9 k;  2XMA A;  1T9X A;  1DZ5 A;  2ZKU A;  4BDP A;  3PW7 A;  2UV8 A;  1M5H A;  1RWN B;  2Y1R I;  1DY3 A;  2DKO B;  1S6Q A;  3FCH A;  1WKJ A;  3A8E A;  1X4G A;  3KUE A;  2JC1 A;  4PYA A;  3F56 A;  1X60 A;  1WDD A;  4UUX A;  3VTI A;  1H38 A;  4FNH A;  4Y34 A;  4GKJ F;  3TAM A;  5L39 A;  1WF2 A;  2RDJ A;  4CRJ A;  2JVR A;  2OPR B;  4KFB B;  3S1T A;  2H9Z A;  2ZC3 A;  2BQ3 A;  2YWW A;  4JI6 J;  3ONQ A;  1TU0 B;  3N6N A;  4NOH A;  5DLG A;  2VBX A;  3M8Y A;  5CZX A;  4NLG A;  2HFN A;  3IXQ A;  1RAC B;  1KSP A;  2HAI A;  4DN0 A;  2R8K A;  4O3R A;  1ZZF A;  2LVW A;  3ADA C;  3G96 A;  1GFW B;  1MW7 A;  2E5G A;  2MQN A;  5I3U A;  4NA1 A;  4ED4 A;  3R6L B;  4HHJ A;  3KG1 A;  3BKU A;  2A2C A;  2VQE J;  3AA8 A;  4RW8 B;  1U02 A;  1U1N A;  2W25 A;  5IQQ A;  4KPC A;  1HNV A;  3FBF A;  2HLT A;  1RIS A;  3CDW A;  2CPE A;  2YKM B;  1K1S A;  3RGI A;  2VBW A;  1TUG B;  4JV0 A;  2FVC A;  1NEE A;  1TR0 A;  1ZOT A;  4GVB B;  3LP0 A;  4IFY A;  5JVG Q;  1SJ4 P;  1JJ2 R;  4RWW A;  1T11 A;  4C4W A;  3JAM U;  1WEX A;  2ZOG A;  3ISZ A;  3AOB A;  4USI A;  4YP3 A;  2R7S A;  2DPI A;  3GR1 A;  5A0Y A;  2XEX A;  1IKV A;  3M8Z A;  1WWH A;  3KLH A;  1S6Q B;  3UD4 P;  3D66 A;  3CD0 A;  2KRB A;  3D0I E;  4C8M A;  3CJR A;  4ZIT A;  3OLB A;  3H0P A;  4AND A;  1LFW A;  1IJF B;  3BQ0 A;  3T41 A;  3J7Y U;  3CJQ A;  1FTR A;  4DR3 F;  1VJW A;  3C16 B;  1IBK J;  1SC1 B;  4KO0 A;  1Q4R A;  4F2S A;  4X65 F;  3EVO A;  4HL9 A;  4JI7 F;  4NCG B;  5KG3 A;  4J90 A;  3KMQ A;  2V8G A;  1S1X B;  1LXJ A;  4JI7 J;  1OYD A;  2DXD A;  4ZCM A;  2QN6 B;  5D0E A;  1D9F A;  4I2Q B;  3AB2 B;  2V6A A;  4QIG A;  3BM7 A;  5FJ4 A;  4QZV B;  2VH7 A;  4J5O A;  1OY8 A;  2DNL A;  1TK0 A;  2AJ2 A;  4EO6 A;  1TL7 B;  2J0S D;  1TVR B;  1U8W A;  1Y5N B;  4LVN P;  2ACY A;  2U1A A;  1HNZ J;  4Z7Y A;  2JEG A;  4B9N A;  1RA6 A;  4ZLN A;  3KYL A;  3KWM A;  3VHQ A;  2DXE A;  3I0R B;  4CYU A;  3PX4 A;  2XTJ P;  3VF0 B;  1HWJ A;  3DLE B;  3QMQ A;  4ED7 A;  2DTJ A;  3SEO A;  1RTI A;  1RI7 A;  1VQY A;  4DR2 J;  2D74 B;  2ROE A;  5ITH A;  2J7W A;  4AE5 A;  2YQ3 A;  1UZH A;  3F73 A;  1D9A A;  2G0J A;  1VIS A;  2RF2 B;  4GVL A;  5KFL A;  4K4Z A;  2YWF A;  2V68 A;  3PTW A;  1XTZ A;  4U9R A;  2HNY B;  3GWC A;  4E8U A;  1YLX A;  4A8W A;  4LRA A;  4WE1 A;  2K2P A;  3ENQ A;  3CO9 A;  1T03 A;  4J9L A;  2CQP A;  2GS8 A;  3I0S B;  3IGV A;  2P9C A;  3WC0 A;  5KFE A;  2RML A;  1IR1 A;  2CPJ A;  5BYS A;  2F40 A;  1FD2 A;  2MKJ A;  3AAW B;  1G7C B;  1RP5 A;  1Q5V A;  3C6U A;  3IGN A;  1REV B;  4CTA B;  2MKH A;  3NGR A;  2W9A A;  3MHY A;  4JI1 F;  3FGV A;  4DUY J;  1NK6 A;  3QGG A;  2OPR A;  2HNZ B;  3CO0 P;  3W1Y C;  2KRR A;  4USV A;  2JEJ A;  3HFK A;  3NCQ A;  4WP3 A;  4KHP J;  1DQ8 A;  2IM1 A;  1NAQ A;  1TQL A;  1V9O A;  4HDH A;  4ZP8 A;  4O0N A;  2B6A A;  1RLC L;  5L9N A;  1SCJ B;  2IDE A;  2J8A A;  1DLO B;  5U47 A;  3TEG A;  4G3I A;  1FDN A;  5LL6 d;  2DNQ A;  4WYL A;  3W8G A;  4LF4 J;  1LFP A;  2VD3 A;  3PY8 A;  2AP6 A;  4I6Y A;  1MMD A;  2PN6 A;  4ILM A;  2MQM A;  4I68 A;  4B9V A;  3WQP A;  4TVA B;  3N6L A;  2E5J A;  4H54 A;  3T19 A;  3BKT A;  3TJ8 A;  1JLF B;  1GXL A;  3M8W A;  4LQ3 A;  3OR2 B;  2UXD J;  1GMW A;  2PI4 A;  1NME B;  1U0H B;  5H9F J;  5L1I A;  1MG7 A;  1HNI A;  3OFE A;  1RLD A;  5J2P B;  2NRE A;  2KTQ A;  1FRM A;  4RPF A;  7FD1 A;  1YGY A;  3KXD A;  3A3P B;  2MQ8 A;  1NHU A;  3H8Y A;  4ITS A;  8ATC B;  2W9B B;  1CJV A;  2VDI A;  3NGS A;  3Q0A A;  2Z4P A;  1JNZ B;  4Y2M A;  4B9U A;  4NCA A;  4K5S A;  2NCK L;  1JB0 C;  5HQL A;  1HBU A;  2CWX A;  3MAQ A;  5KFB A;  2IAJ A;  4OI6 A;  1JLC B;  4C3L A;  1KTQ A;  1KHV A;  1Q1K A;  1U6B A;  2N4C A;  3M9N B;  5DZ7 A;  3H25 A;  4J9K A;  1RTJ B;  4K4W A;  2GHV C;  3I4H X;  4FYV B;  2AYG A;  3HHL B;  3GV8 B;  3PW5 A;  4NXN F;  4X65 J;  2PA8 D;  1N88 A;  2LMI A;  2HFO A;  3HUL A;  3CCV S;  3GJS B;  1MMN A;  2J0W A;  1S9G B;  1RAB B;  2KI2 A;  1YBA A;  2VUG A;  3OTC A;  4BHQ A;  4ZPA A;  4ETZ A;  1S77 D;  2XLJ A;  5KTQ A;  2HVE A;  1VQS A;  2RRN A;  2CQ2 A;  4M1K A;  5DQH A;  2GHW A;  5KT3 A;  1CG2 A;  1WOO A;  2IYG A;  1U25 A;  1VIO A;  2BJ9 A;  1NH8 A;  2Z58 B;  4ZCK A;  1LV5 A;  3LP1 B;  4IDK B;  1S1U B;  3B82 A;  3LGN A;  4DR5 J;  4Q2L A;  3NKY A;  2ALZ A;  3AJ1 A;  1J27 A;  5KFD A;  3RB6 A;  2KT3 A;  3GON A;  3TVK A;  1R27 B;  2P5V A;  3LH2 S;  1XMO J;  3DLE A;  2MLX A;  3R7B B;  1PKU A;  4ZCI A;  2G1D A;  2FHM A;  2DIT A;  2NS1 B;  3S7R A;  5KFQ A;  1SJ3 P;  1PJ5 A;  4WFZ A;  4USW A;  3UO0 A;  3F41 A;  3IBW A;  9RUB A;  1KD1 T;  5GMK a;  2A6O A;  3HHL C;  5FDL B;  1ROF A;  4XPE A;  3V6H A;  4FXW A;  4JV5 F;  3R7S B;  1WKK A;  4B3M F;  3MAH A;  4DSK A;  2DH9 A;  3IRX B;  4OYM A;  1CPZ A;  3D0G E;  2AYE A;  1D8Z A;  2XYH B;  4RW4 B;  3K5N A;  4NX9 A;  3ELH A;  2KM8 B;  3H4B A;  3D28 A;  2HIQ A;  2LKZ A;  2CJ9 A;  3BDE A;  4P74 A;  3OR1 A;  3MTJ A;  3LUY A;  4ZCL A;  2HQF A;  4H4O B;  3CCS S;  1SJF A;  3R2D J;  2BA9 A;  4QWC A;  4RWX A;  3MUT P;  3BO4 A;  2Y8W A;  3D68 A;  4ZA1 A;  4WFY A;  3R7N B;  4DZD A;  2YNF A;  3KLV A;  1H6K X;  1WTF A;  2DHA A;  1RWM B;  1C4C A;  4DQQ A;  1KON A;  1NB7 A;  3EMT A;  2FJX A;  2MJN A;  2QLW A;  4ID5 A;  1SJ1 A;  5IZH A;  4YHH J;  3DMJ B;  1K44 A;  3SMZ A;  4ECQ A;  2UU9 J;  1NK9 A;  1IWA A;  1PC4 A;  2RDI A;  2W7P A;  4DUZ F;  1VQ7 S;  1CLF A;  3VGT A;  1D3W A;  1E6Y B;  3MPU B;  5HP1 B;  1VQ5 S;  1X4F A;  3NY0 A;  2C2Z B;  1Q0N A;  2LQJ A;  4MJK A;  4X4N A;  3EVW A;  3HCX A;  5KFK A;  2IRY A;  1KRP A;  5J2P A;  1HHQ A;  2A6M A;  1EZZ B;  4OI4 A;  2V9W A;  2YNI B;  2R4F A;  2RF2 A;  3JTO A;  2DHX A;  3GIJ A;  3GR0 A;  3PNI A;  2B7B B;  1RZM A;  2PSZ A;  2ACM A;  1SH2 A;  1CC7 A;  2R7O A;  1X8D A;  3TWZ A;  3VGU A;  5C2G A;  1KVJ A;  4LVO P;  2KG1 A;  3SDE B;  4ES2 A;  5ETS A;  3DYA B;  3VAF A;  1N6Q B;  3C3L A;  1SJR A;  4QU7 A;  4YB6 A;  5C7P A;  4OZN A;  2CQI A;  1H98 A;  1UJ4 A;  3IAS 9;  1XBW A;  5GAD U;  2QEX S;  1Q8B A;  2Q66 A;  2KYZ A;  3VGS A;  2V34 A;  2XSJ B;  4DG1 A;  1NB2 A;  1RE1 B;  2HWH A;  2W4P A;  1I5O B;  3FSI A;  3MFH A;  1RAI B;  1RXO B;  3AQP A;  3L9Z A;  3U1M A;  5F3Z A;  5F8H A;  2DHH A;  2V2V A;  1S9F A;  3KTQ A;  4O4G B;  3QRR A;  2FJV A;  3DI6 A;  1EAR A;  2BJ7 A;  2CA9 A;  3LP2 B;  2ZUG A;  4BBY A;  3C46 A;  5CCL A;  1C1C A;  1NBE B;  4EZ6 A;  2UUB F;  2QMW A;  1GX6 A;  2VKZ G;  4LR8 A;  3ZC4 A;  3GII A;  3DOK A;  1A6L A;  3GIL A;  1Q16 B;  2MQL A;  3PVX A;  1HNZ F;  4Z7C A;  1N5Y B;  3J81 j;  3VVT A;  1JLB B;  1EET A;  4DCO B;  1BHN A;  1EP4 B;  1H3D A;  1YJV A;  3DYA A;  1OJ4 A;  3FFI A;  1IKV B;  1XJW B;  2BXJ A;  1X4C A;  2FYX A;  4LSN B;  3JAM Y;  2ZOM A;  2GAH C;  4N7T A;  1ZTT A;  1X4H A;  5K14 A;  4Y2C A;  5GVQ A;  4AXI A;  3QT8 A;  3WX4 A;  3AFG A;  1B0P A;  1KQK A;  4FVC A;  2LXU A;  2R9L A;  3CC4 S;  3CJT A;  4FDF A;  2BJE A;  2ZNZ A;  4ZPW R;  5A8R A;  5DDQ C;  3K5M A;  2GGP A;  4EBD A;  4JV5 J;  1QAJ A;  1MRO A;  3I55 S;  1QSY A;  4RW8 A;  1ZH5 A;  3G9C A;  2MZT A;  5BYR A;  3UVJ B;  4X66 J;  3GV5 B;  5C42 A;  2PEB A;  3RUB L;  4NWB A;  4O3S A;  1C1C B;  1M1G A;  2YY3 A;  2OEJ A;  5J2N A;  2CQH A;  3D6M B;  4DU7 A;  1AA1 B;  1UW4 A;  3N9U C;  1F3V A;  3DC2 A;  3ZXW A;  1VI7 A;  9ATC B;  3CXC R;  2DGX A;  2HHW A;  4ZVR B;  3KK2 B;  1HBO A;  2ZBC A;  1S7I A;  4WFX A;  2IMO A;  1CS4 B;  1B99 A;  5I4M A;  4FBT A;  2MLZ A;  4JI0 J;  5HRO A;  5ETT A;  1VC0 A;  5T7L B;  3VZI A;  3KJV A;  4KQZ A;  1Y10 A;  5A8W B;  1UW9 A;  2B4V A;  2M70 A;  3UE2 A;  5CD4 A;  3MR5 A;  4FKY A;  1NKE A;  3E3X A;  3WDO A;  2ZJR Q;  4LFA F;  1NSA A;  1IKX A;  4FNI A;  2BE2 A;  3D6T B;  3JS9 A;  3DLK B;  2KXF A;  3SXL A;  2VHG A;  4FF4 A;  3PKY A;  2MLY A;  3NL0 A;  2IC3 B;  3J80 U;  4Q43 A;  1NK4 A;  2NLW A;  5DQG A;  1U8S A;  1ZM3 A;  3GSD A;  1U24 A;  4IKA A;  2QLB B;  2AYB A;  5L1K A;  1F60 B;  4N47 A;  1WF0 A;  1L3S A;  4LF7 F;  1X5P A;  3VQS A;  3BBC A;  1RT3 B;  3QFH A;  2XC9 A;  2IRU A;  1TL3 A;  3ET6 B;  2YNI A;  1R7I A;  1XQI A;  4P2X A;  5E0O A;  4CLU A;  3HD2 A;  3CIM A;  4LFB F;  4WP8 A;  5KFI A;  1FJE B;  4USK A;  4USM A;  2B4U A;  3J7Z T;  2OO4 A;  4OYX A;  2P6S A;  2HKE A;  3GSI A;  3DGP A;  1YJ7 A;  5KG7 A;  2V8P A;  3RRG A;  4WKR A;  2LA6 A;  4ED8 A;  3G82 B;  1VQ4 S;  4IRC A;  3ZNU A;  2WB1 D;  1RU2 A;  2IPO B;  3QO9 A;  3MMB A;  2JSX A;  1XNR F;  1U09 A;  3K8W A;  3OSN A;  2I0X A;  2XMW A;  3S6E A;  5CCM A;  4OJ3 A;  3GMG A;  5J2M B;  4DF8 A;  2DVI A;  2FJE B;  4OX9 J;  5DLF A;  4CO5 A;  4MIA A;  4UOH A;  3W5Z A;  4WTY A;  1LK7 A;  2HBQ B;  1EKS A;  2DYA A;  3BGF A;  3AXM A;  3DLJ A;  4C9D A;  5LT5 A;  1S7H A;  2H4Y B;  3IR7 B;  1RCO B;  1JLB A;  3TVY A;  4Y2K A;  5T41 A;  1NK7 A;  5D6G A;  4H4M A;  1HI0 P;  1SI9 A;  4DFM A;  4NMX A;  1GTH A;  2DNM A;  2K1R A;  2ZVS A;  4PWU A;  4DLG A;  1LWX A;  3HJV A;  2B4P A;  4ECU A;  1EB0 A;  2BVZ A;  2F9D A;  2XI2 A;  3HHL D;  3R3T A;  3MEC A;  1X9S A;  1SH0 A;  4IG0 A;  1TP7 A;  3VR1 A;  2CUY A;  4P7T A;  1VQM S;  3DCA A;  3MEG B;  3NGD A;  2UXB F;  3CCZ A;  2L48 A;  5D3G A;  1ACM B;  2DGW A;  4UF4 A;  3RRK A;  2R7Q A;  1FHT A;  2OPP A;  2LXI A;  3OJS A;  5HK4 A;  2V8H A;  4WFB Q;  2DXF A;  3QSY B;  1TL1 A;  3FZ2 A;  4C48 A;  1PJ6 A;  4ZHR A;  2AKW B;  2I2Y A;  3FQL A;  3MR7 A;  4UOF A;  3W2W A;  2ZVI A;  4C11 A;  1S79 A;  2JOQ A;  4LRD A;  3TVZ A;  2DH8 A;  1QLN A;  3F44 A;  5J2N B;  3VVU A;  1QJH A;  1VK8 A;  4C2M A;  4URQ U;  2BJ3 A;  1QVG R;  5C42 B;  5LJ3 Y;  4J9Q A;  4J9M A;  3HSJ A;  1RA7 A;  1D8Y A;  3UW1 A;  1S1T A;  4MK7 A;  1O51 A;  2XB2 D;  2HGN A;  1XMQ J;  4MYU A;  4PXB A;  4OL8 A;  2HRU A;  3THP A;  2HNZ A;  4BC7 A;  3W2V B;  4DQS A; 
#chains in the Genus database with same CATH homology
 2CJX B;  3GJS B;  2CNK B;  2H51 B;  4DCJ B;  2QLJ B;  2XYP B;  3R6G B;  2C2K B;  1RWW B;  5K20 B;  2H48 B;  2QL9 B;  3D6M B;  4LSZ B;  2H4W B;  2QL5 B;  4ZVU B;  4ZVR B;  2FQQ B;  1SC1 B;  3R7B B;  3EDQ B;  3P45 B;  4DCP B;  3IBF B;  1SC3 B;  1BMQ B;  2HBY B;  3R7S B;  2HBR B;  2C1E B;  1ICE B;  2XYH B;  1RWV B;  1IBC B;  2QLB B;  2HBZ B;  2C2M B;  3D6F B;  2QLF B;  2XYG B;  4ZVS B;  3EDR B;  1RWX B;  1QDU B;  1RWK B;  3R7N B;  3KJF B;  1PYO B;  2C2O B;  2CDR B;  1RHM B;  1RWM B;  2CNL B;  1F9E B;  3IBC B;  3R5J B;  2H5J B;  4ZVQ B;  1I3O B;  5IC4 B;  3GJQ B;  3RJM B;  2H65 B;  2C2Z B;  1RHJ B;  4ZVP B;  1RHK B;  2HBQ B;  1PAU B;  3NS7 B;  2H4Y B;  2CNN B;  5IC6 B;  1RWP B;  3SIP B;  3KJN B;  1RHQ B;  2XZD B;  1RWN B;  2XZT B;  2DKO B;  1I51 B;  1RE1 B;  2H54 B;  3D6H B;  3KJQ B;  1RHU B;  1NME B;  2H5I B;  1SC4 B;  4ZVO B;  2Y0B B;  1RWO B;  2QL7 B;  1RHR B;  3GJT B;  4ZVT B;  1GFW B;  2P2C B;  4DCO B;  2CJY B;  3R6L B;  1QTN B;  3P4U B;  2CNO B;  2Y1L B;  3QNW B;  4JB8 B;  3GJR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...