3IBFB

Crystal structure of unliganded caspase-7
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
b'KIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-7
publication title Conformational similarity in the activation of caspase-3 and -7 revealed by the unliganded and inhibited structures of caspase-7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 18
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2009-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3ibfB00
1SC3B 2DKOB 1RWVB 2HBYB 2H65B 1RWXB 3KJQB 3R7SB 2C2MB 4LSZB 3QNWB 2XYPB 3EDQB 1PAUB 3KJNB 1QTNB 3EDRB 3SIPB 3R5JB 2CNKB 2HBQB 3D6FB 3IBFB 1RWMB 3GJSB 2C2OB 1RWWB 1RWKB 1BMQB 1RHUB 1RHJB 1RWNB 1RHKB 3P4UB 2XZTB 3GJRB 3R7NB 4JB8B 1RWOB 1NMEB 1RHQB 1I3OB 2C1EB 3R6GB 3GJQB 2HBZB 3R6LB 1ICEB 1SC4B 2H54B 1F9EB 2Y0BB 2XYGB 5IC6B 2H4WB 2XZDB 2CJXB 2QL7B 1RHRB 1PYOB 1RHMB 2QLJB 2QL9B 3KJFB 2QL5B 3NS7B 2CNNB 3D6MB 4ZVUB 3R7BB 4DCJB 2Y1LB 4ZVTB 3P45B 5IC4B 1I51B 2QLFB 3RJMB 2H51B 2C2KB 4DCPB 1SC1B 4ZVSB 1IBCB 2H5JB 3GJTB 2QLBB 2H5IB 4DCOB 1RE1B 2CDRB 4ZVOB 4ZVQB 1QDUB 2CNOB 2H48B 4ZVPB 2H4YB 2HBRB 2CNLB 2XYHB 4ZVRB 1RWPB 2P2CB 5K20B 3IBCB 3D6HB 2FQQB 1GFWB 2CJYB 2C2ZB
chains in the Genus database with same CATH superfamily
1URRA 4OFZA 5H1SV 3V6JA 3IM9A 1WC0A 4DV0J 1Q7LB 3OVSA 3R5AA 4KJIA 5HROA 4LF1A 1IQTA 3KUGA 1UFWA 5E3QA 4Y34A 3IC1A 4OYAA 1NNDA 3H0PA 2MZSA 2RKIB 4F2SA 2QMXA 2DRDA 1TUWA 2GNKA 2R8KA 3W2WA 2VA2A 2ZHBA 4IRCA 3MEEA 4X4SA 3SYZA 4LFBJ 2RNEA 1YVFA 1ROFA 1VBXA 4NA2A 1O5JA 3C16A 2PIIA 4A8WA 4OI3A 3KJVB 2HQ3A 1U0SA 3AJDA 3LAKA 3BGRB 4OI4A 1R8AA 2CQIA 2R2UA 3DM2B 3FGVA 4O3RA 4KHPJ 4OX9F 3TYTA 2O1PA 2DCUB 3R7SB 5L9NA 2W9AA 3C6TB 5K9FA 3U1LA 1N5VA 2RILA 4NEZA 4P7TA 1HKAA 4UOGA 3CT9A 2RHSB 4YQWA 2JEJA 4PKDB 1IN0A 2CPFA 2E44A 3KFWX 4KIAA 2Q1LA 3OL7A 4RNNA 3T5JA 4RBVA 2FJVA 2JLGA 1JLQB 1NK0A 4C97A 1Q95G 3MEDA 2GHWA 2AYBA 2DR9A 2QE5A 4B9VA 4JV5J 2M5YA 5C42A 2M3DA 1JLAA 3TUJC 1TL3A 4LBHA 3UI3A 2FJEB 3HHDA 3OTBA 1RHRB 1TKTB 4ZCIA 4RW9A 4XIUA 2N4CA 2DR8A 4X65J 3J81j 1T9VA 3SBMA 2M8DB 1RAGB 1MG7A 2CQ3A 3OR1A 4DPWA 4DX7A 3GZ7A 2NREA 1K9MT 1EAYC 3MM9A 3NOGA 3V6DA 1U24A 4LF9F 2RT3A 2V8DA 3MTJA 2QN6B 1PJ5A 3TJ8A 4FS1A 2DR5A 4GVLA 2DVIA 3CMES 4OIXA 5HO4A 4EO8A 5F8JA 3L7OA 4KT0C 1VIOA 4DPOA 4J9LA 2NPFA 3ZXWA 2YXLA 1VK3A 1B70B 3D68A 2HFZA 1RHUB 1UCNA 5DDRC 1LWFA 3D67A 2GMLA 3KXDA 3N4WA 3QGIA 1Y00A 4H4KC 5GADU 2NXEA 5EHHA 1CVJA 2WB1D 4FF4A 4PG6A 4DR3F 2H54B 2GQCA 5IWAF 2ACYA 3FBFA 4ECWA 3W2VA 4QYRA 4FF2A 1PYTA 1FFSB 4FKYA 2QMUB 4KO0A 4RW4A 2W8LA 4EK2A 2Q43A 1JIHA 4QWEA 3C66A 1YSJA 1SKSA 4ZP7A 2L08A 2Z57B 2VQFJ 4WZMA 1M1KT 3AHPA 3M2UB 4LVOP 2IYGA 2PN6A 2KZMA 1WSRA 3CWJA 3NCQA 4DR1J 2XCPA 2VKRA 3EGWB 1PYSB 2GFFA 1Y5NB 4QJVA 3CGIA 2AIRB 4LFAF 2B6AA 2QA2A 4PWUA 2HKEA 2AHOB 2CNKB 1R89A 4E2FB 2DGTA 2DXDA 4RUBA 1TQLA 4U95A 4WK1A 4TN2A 5KG2A 3G6XA 2HWIA 3HZEA 1TKZB 4P71A 2DIVA 2XO6A 4OHVA 1M1HA 1TL7B 4DN0A 3MGJA 2XSJB 4O23A 4CO0A 1XR5A 1TL1B 4LF2A 3T5LA 1S77D 2I8EA 3H7HB 2N7YA 2FTRA 3H8YA 3BB5A 2V4QA 3IFEA 3H59A 3EGZA 3U7JA 2HSEB 4X4PA 3DI6B 2CXEA 4W90B 4DL3A 3PTWA 3BKUA 3N28A 3PZPA 4TY8B 4M5LA 3KLEB 5DDQC 3BYRA 1SUQB 2LXFA 2HZCA 5K8NA 1JNRB 2YKPA 1JKHA 2BZ2A 5K20B 2A10A 3IRXB 5AJ3F 2HK2A 1FJ7A 2Z2MA 4ECUA 1NB2A 3CJRA 3PACA 3AB4B 7FDRA 2I1RA 2YX4A 4YP3A 3GFHA 1L3TA 1DHMA 4ES2A 4YB6A 2I38A 3BYPA 2NR0A 3NLCA 3POTB 5F8LA 2BKOA 5KT4A 3PR4A 1FK9A 4QQBA 1UPMB 4USKA 1VDHA 3GJQB 2RRNA 4YHHJ 4A8QA 4B3RJ 3U27A 3LOUA 5B0EA 3GIMA 1E6VA 2RUSA 1RJJA 3P5BP 3TVZA 2F5GA 1U1PA 3U1MA 1GXTA 2MLZA 3AD9C 3M8SA 2JWNA 2X51A 4USMA 4C0OC 2MZRA 3M05A 2MTLA 4B3SF 4G65A 2HBRB 3MAAB 2RF2A 3TWZA 1C1CB 2OFGX 1TMJA 2VC1A 2V9KA 4Q7AA 4YOEA 1YWXA 1J5OA 4LSLB 3C6UA 4YB7A 5B08A 1DQ8A 4C48A 1IQZA 2RAQA 1SJRA 3NWGA 2OUGA 2XBPA 4ZPWR 1TFWA 2BVZA 2E9ZA 1J5EJ 4A8SA 3QRQA 1N8RT 5K5MA 1WEYA 2QZ8A 4BBYA 3NBPB 4AD6A 1OIAA 4URGA 4LMZA 2QLXA 4OV1A 4J9SA 1M5VC 1Q1KA 1PC4A 2YQ1A 5J2PB 1U1NA 2AEMA 3S8SA 2UU9F 2DNLA 2V8HA 4QWBA 1NK8A 4L74A 4V19X 3L09A 4JI4F 1NKBA 1YI2S 2V50A 3A8JA 9RUBA 1LFWA 4QIGA 5K8PA 1VRUB 3OTOJ 2V4JB 1FRHA 2YNGA 1T3NA 2HFOA 3I5BA 3W3SA 5ETRA 1QLNA 5KT2A 3DOKA 1UVLA 2W01A 3CCLS 1S4FA 3CF5Q 3AJ2A 2CQDA 1R3NA 3UE2A 2LDIA 1RT3A 1UKUA 1KC8T 2XLJA 1VR6A 2XZWA 3OFFA 3GLJA 2ASDA 1VQSA 2GJ2A 4ZLJA 4JI8J 1YGYA 3PIOQ 1S1XA 2NPIA 3PFEA 4CCHA 1LW0B 2XLKA 2UUAF 4K5SA 1XMOJ 1SC6A 3CCZA 1WC5A 3ONQA 4G1IA 3I56S 1HQEB 4Z37A 1T05B 2BW2A 1D09B 1DAXA 5CYQB 3UPFA 4DF8A 4OI0A 4CO3A 4IFVA 1BE4A 4GKJF 2V68A 2KM8C 4EO6A 4NCGB 2KL8A 2HURA 3IR5B 3AJ1A 1FKPB 2BXJA 4K4TA 3W7BA 1V6HA 1EB0A 2IC3B 3QRPA 1OY6A 4LRFA 3J7Z5 1N6QA 5A8RA 3UD3P 1IBKJ 3TARA 1RYSA 2MKHA 4ID5A 4AXIA 2P5VA 2G1DA 2F7VA 5HLFB 1S0MA 2VBYA 2ZFHA 2LA4A 2VZ9A 2FC9A 3MMBA 1S48A 3H42A 4DX8H 1NSQA 4P73A 2ZD1B 3UCZP 2W9CA 1JLCB 3UVJB 4DL0C 1BQMA 2HHHJ 1RWKB 5F9LA 4O3SA 2GAHC 1VQ8S 4F02A 1RHJB 3HVTB 3MEGA 4H4OA 3RAQA 3IO1A 2WW8A 1YBTA 2FVRA 2AZ1A 4OYPA 3OBIA 2A3JA 2Y8WA 1O8BA 4JI6J 2RDJA 3OL8A 4O4GA 1MWYA 3UD4P 2EFPA 3MM7A 3PW0A 1GX5A 1YJ9S 2IFXA 1C0TB 3DGVA 5D3GA 4CLLA 1VC6A 2ZM6F 1S0OA 1FWLA 1QY7A 5J2MB 1GT8A 3J81Y 4ZVQB 2BRKA 1FX4A 4TY9A 1J2VA 5ITHA 2ZNZA 3K89A 4RUAA 5L9XA 2JH3A 1RXOB 1PAEX 3MAHA 3IBWA 1ZH5A 3THVA 4JYAF 2IM3A 1RCXB 2OPRB 1WKLA 4PPZA 3AB2B 3KHRA 3J81U 3AA9A 3BH6B 1GNKA 3E01A 3MECA 3ZTPA 1T9TA 4IDKB 1JLFA 2KYXA 3KMQA 1KLMB 4ZLLA 2CJBA 2KI2A 4IG0A 3FJ2A 2VPZB 4OV6A 2BOAA 1HBOB 4LSNA 1NJIT 4ZCKA 1K73T 1IKWB 1WKJA 3UDLA 3THTA 2XB2D 1N36F 1X9MA 2MHNA 1FKAF 1IVZA 2YWHA 4PQUB 4ECQA 2R7VA 3B54A 4QR0A 2DNZA 1VHIA 3J7A1 3AXKA 1CEZA 1IKVB 2J0SD 4OYOA 3BGUA 2VD3A 1CJVB 2QG9B 3S7RA 3MR6A 2DNPA 3IBCB 2HHQA 4MYTA 3F41A 3CJ8A 4ZITA 5ETOA 2Z2LA 3FFIA 3QGHA 3CJKA 4I6YA 1S76D 2LDYA 4C3LA 4HT5A 2CQGA 4WZQA 3GB0A 3OD2A 2R7SA 3DLHA 4DV7F 4DL2A 1M5SA 2HYIB 5KFPA 2WVDA 3M32B 2YBVA 3JS9A 3LP2B 3RRGA 3DOLA 3PFOA 1VQ9S 2NZCA 3MUTP 5HBMB 4KGXB 5FD1A 2LKZA 3M2VA 1ULRA 4LFCJ 1NDPA 1DRZA 3KOAA 3HHLB 3I87A 1N34J 2LECA 1XNRJ 4HI1A 1GEHA 2C22A 3RRHA 1AZSA 5H9FK 1IR1A 1QAJA 1DLOA 3OUYB 1I51B 2XI2A 3HD1A 2C2KB 1AB8A 1NSAA 2F63A 2PI5A 4F4YA 2RMLA 5K14A 4ZPAA 2P2CB 3VAFA 3HJFA 2X1FA 1XNQF 2ATCB 2O3DA 4DV5J 2I5JA 3M2RB 1YBAA 2A6OA 3RB0A 3MPUB 2MB0B 1FDNA 3I4PA 3Q22A 3G96A 5J2QA 2VJUA 3PJXA 4JI1J 2IM1A 1WORA 4EZ6A 4ECVA 2FJBB 3PHEA 1FRIA 3SDEB 5MAOA 4JV2A 3ETMA 1OYDA 2KTQA 4LF5J 3HD2A 2Q6CA 1IM6A 1OSDA 1NLKL 3WQPA 1ICEB 1IJEB 3SZ2A 3RR8A 3OFGA 1U48A 2XULA 3GYXB 4JI5J 3DXSX 4YB1P 3HKWA 1C4CA 2VFSA 4ZPCA 2UUCJ 4KKOB 2JC0A 1KNZA 3IWXA 1FKOA 3I55S 3VAKA 4MFBA 1SC1B 2FUG9 2H5JB 1WKKA 5DM6Q 2VIHA 3MOJB 2F3JA 3H5XA 1RQ0A 3CJ3A 2CPEA 1SKUB 2P9CA 5IM0B 3Q2SC 2FVQA 4L76A 1AW0A 3DLEB 4QU6A 1KVKA 4USIA 1B7FA 1DTTB 1VGYA 3M8ZA 1X4BA 1Y0HA 1U1MA 3RAMA 5IXUA 1LW2B 3MMAB 1LXNA 2CPHA 1GAOA 2MZ1A 3H20A 1H73A 4GKKF 3K5LA 2COLA 4NL5A 2CIMA 3EXCX 1H74A 1LV5A 2G0CA 5A6WA 4F25A 3RB4A 4JB8B 4CRJA 4D3HA 2C3UA 1HHSA 2XHWA 3M30A 4YDDB 1WG4A 4B3MJ 4TYBA 1V3RA 2A0FB 3L3CA 4OJ3A 3PW7A 4RO0A 3I0SB 3T1AA 4I2PB 3EM1A 2ZITA 2HRYA 4RR5A 4NZ6A 2JJ4D 2O66A 2MZJA 2DB1A 3SQGB 3V2UC 2HZAA 2MQ8A 4LF4F 2BM0A 5HMZA 2BANB 1UW9A 4YFUA 3ILOA 3Q23A 3LF0A 5KAKA 3FBEA 3KUEA 3OJUA 2CJYB 1X5OA 3HHLD 3OFEA 4DSJA 1UL3A 3BSAA 3QNWB 1VQ7S 2A6MA 2HLTA 1UETA 1S7HA 2AMCB 4HEA9 4ZPVR 4KH0B 1S6UA 1A7GE 3NCPA 3AFGA 5C7PA 4GRSA 3RG6A 4C7QA 1NPKA 2DO0A 2CPJA 3GMGA 3I4HX 2ZH8A 4C11B 3QIDA 2E1PA 3KJFB 2GX8A 2E9TA 3MM5B 1Q4RA 5ETLA 3OLBA 1NUEA 5LXYA 1C0UB 2ZH7A 3H5YA 5C24B 3L9ZA 1BWVA 1EQMA 2EKYA 3FRYA 4A8OA 2Q66A 3MOZA 1V5IB 3T1YJ 5LMUF 4HACB 4CNYA 2RRBA 5M2UA 4M5DA 3M8WA 1HQUA 1HNIB 1S49A 2XYPB 1JB0C 4OYWA 4YS2A 4PG4A 5D4LA 3HFKA 2LQBA 3OHBA 2R7UA 2R8IA 2EFQA 5E2QA 5HI7A 3EX7B 1FFGB 3AXMA 3DLBA 2PDAA 1HNZJ 2W4PA 1HNVA 3EXYA 1FTCA 3EVWA 5KFKA 1NK7A 2VOOA 1LK7A 3JSYA 3AQOA 2BX6A 3S01A 3FBBA 2DNMA 4QIVA 3MPWA 4ED0A 3R5CA 4LT6A 1P27B 2KVQE 3E8OA 4PYAA 3Q8QB 1UEKA 1OY8A 3UN5A 1OWXA 1Q8IA 1APSA 2HZVA 2LFVA 3PHTA 3QO9B 1N88A 3DLGB 1K44A 2F4VF 3D0IE 4G6VB 4ECXA 3M8PA 3NXZA 3H5SA 4B08A 5HMWA 2OPPA 4ERDA 3NNHA 2VC0A 3HI9A 3PW5A 1KWMA 3V5RA 1HYSA 3KK3A 4XDCA 1S72S 2K7KA 3C15A 5KT6A 3KLFB 1R7IA 4OYBA 2HVHA 1RWMB 3OPKA 3LWLA 3TANA 3QSYB 3KG1A 2GGPA 2XNRA 4C8KA 1X4DA 2K1RA 2BYCA 2V2VA 2HVDA 1WOOA 4Z7YA 3LP0A 2FLLA 2RU3A 1NPRA 2CJ9A 1SJ3P 4N8OA 1HNXF 4IOAQ 3KHHA 3B78A 4DV6J 3DDNA 4MK9A 3CJSA 2VA3A 3VGUA 1U25A 3TQEA 3Q2TC 3GONA 2X1GA 1GH8A 5GAHU 2FLOA 1HBNB 1B0VA 3NGRA 2HWHA 4C8MA 2HRTA 2ZH3A 3DRPB 1EJ7L 4KV8B 3TQ1A 2K3KA 1DZ5A 3FC9A 1LEOA 2ZC4A 3WDOA 4KBIA 2HBYB 5FDLB 2VQEJ 2BACA 2P8IA 4O44A 5BR8F 3L95X 2CAJA 5KFCA 3DLJA 5DS7A 2R2TA 4K0KJ 4XK8C 2J0QD 2W2NP 5DQHA 3NGDA 5G0RA 2R2RA 3TRGA 4HR2A 1Q5VA 2CQPA 1RWWB 2X3DA 5J1NA 4RU9A 5L1LA 3MM8B 3ENAA 2G0JA 2LMIA 5DZ7A 4DV1J 3TNVA 4G1QB 2W8KA 3ZZZA 1FJGJ 2CWKA 5LSRA 3AT1B 4N8NA 3W9IA 1NZAA 4JI3F 2YNFA 3CMQA 4OHYA 2F8MA 5BJRA 5IV4A 1TUGB 4RW7A 2G0IA 1G7CB 4OZJA 1MWQA 4F4AA 2GVDA 1ZS6A 4DU8A 1TK8A 2HFNA 2AGQA 2LXIA 3OT9A 2QLWA 1S9GB 3Q8PB 2VG7B 3EPGA 2H48B 3GIRA 1QJHA 2HGLA 1A9NB 5KFDA 3K58A 5C5JA 4Q5VA 3JQJA 4B9MA 4DUZF 2LQ9A 4CLZA 1KN6A 1KHVA 4IQMA 2ZOFA 5CD4A 4WYLA 1BY9A 2J7WA 4I1TA 5T41A 1RKIA 2HQDA 3J7AN 3DLKB 2DH9A 3ISND 4PUOA 4FYYB 5A8WA 2OHDA 4TU7A 4O3NA 2V2ZA 5KFIA 2EPIA 2HQGA 4AE5A 3KLIA 4B3OA 3HT3A 4URQU 3DMJA 2Z56B 3M8QA 2RE1A 2J8AA 3ZTRA 3NOCA 2HHXA 5SUHA 1YQHA 2XMKA 3LP1A 3P3DA 5E5NA 5B09A 4NXMF 1H7WA 3GPAA 3I5AA 1IM4A 4PPDA 5DETA 5GAEI 4KGKA 2MKJA 3TZYA 1N33F 3OTDA 3A3OB 5THWA 2R42A 1CULB 3A8KA 1CQNA 3QYYA 3DRRB 1PJ6A 3PX0A 4J9OA 2HHTA 2CPIA 1HHTP 2UXBF 2J6SA 4OHZA 2KFYA 2E1CA 3NGKA 4A8MP 1YJTA 1CQMA 5D15A 4X4VA 1AT1B 4Q45A 3KHGA 4Q8FA 1FRKA 3I31A 2OD4A 5B0DA 1ZA2B 4BLGA 1JLEA 4DR6J 1CJTA 4RNMA 4WFXA 5HROB 4PXBA 4Y65A 5DZ6A 5EWGA 1I3OB 2CZVC 2CFXA 1WHWA 4ZPTR 4ZOSA 1RTDA 4L6V3 1U1QA 1RTHA 1XK8A 1RABB 3O3LA 1VRTA 5IC6B 4EYHB 2FHOB 3W2WB 1V3ZA 4M94A 2QL5B 2BE2A 3BO2A 3T41A 1N4LA 3BGOP 1NEEA 2EBGA 1TZ0A 3MEEB 3NS5A 2W7PA 1N0VC 4OI2A 5CH7B 3JSRA 1GTHA 4F4WA 3GU0A 1XJWB 3R8YA 3O6QA 4X64J 2CVEA 3C16B 1AFJA 4Z7CA 1F9FA 2Y8YA 5IT0A 4NLPA 1O0PA 5KFTA 1LK5A 1MSWD 3HHLC 4WFZA 5CCMA 1NK5A 4FZVA 4JI7F 2KU7A 3QZ8A 2OJ3A 1S79A 2HBQB 4CI0B 1TV6A 4HHJA 3SQOP 4C0BA 3JAMY 2IM0A 3FKBA 4AQYF 4K4WA 1HWKA 3SV4A 2X1BA 1TVRA 3N6LA 1GMUA 4BC7A 4CH0S 2PSZA 2RSQA 3MEDB 3TJAA 1HBMA 2DISA 2KG1A 4ED3A 3RW7A 1NSKL 1Q79A 3NAIA 4HLBA 3MM6A 4UZBA 5C42B 2OPQA 4I2QA 2H9ZA 2EW9A 5ETPA 1JLAB 2CPYA 1Z2LA 1TL3B 1ZM4A 3JAMU 5KFFA 4RW9B 1OS5A 5I3PA 1WOPA 2VH7A 2HVZA 3OR1B 1KOOA 2FJWA 2CNLB 4J91A 5AT1B 3SEOA 2W4DA 3QFWA 3UW1A 4UY85 5F0UA 3V6DB 1SC3B 2CRLA 5LM7E 2FD2A 5IZHA 1OY9A 5IT9Y 3NGTA 4QYZJ 1B64A 3L7PA 2HNDA 3CCVS 1FA0A 3IM8A 1W26A 2IHR1 1KD1T 4ILRA 4X62J 3QT5A 1NAQA 4ES3A 4TXSA 1WDDA 2FJXA 4UTGA 3QSIA 4I64A 3QATA 2V0NA 3QIPA 4DR2J 5KG1A 3PKYA 3P4UB 4ZA1A 3H90A 5GMDA 3DRSA 1MN7A 1WG1A 4U9RA 1FI4A 4U7UK 2ZOMA 3NKYA 2NQPA 1LWFB 2PD1A 5IT9U 3SCKE 1ZAWA 3EZ5A 3UR0A 4WCEQ 1RGVA 5ETKA 1CJUA 2DH8A 3GILA 3HX9A 1RDRA 2YPYA 3KLHB 3M9NB 1SXLA 1P6TA 2AJ0A 2VBXA 4KR0B 2XGPA 3TZXA 3CSKA 1REVA 3GE9A 4PZVA 4RW4B 4KO0B 4ILLA 5D0GA 5I42A 4B9UA 1K1SA 3V6HA 1YJNS 4ZCMA 2ZZTA 4ZN1A 1RWPB 1ZM3A 2HIQA 2AJ1A 2FQQB 3CD0A 3QAUA 5D6GA 1WHVA 4DUTA 5HANA 1F2HA 3A13A 1FO1A 2ACMA 3ENQA 2WSFC 3SXLA 3SIPB 4CIOA 2B7BB 2W7AA 3R1HA 4MH8A 2KJWA 2VBZA 2XS2A 4CLTA 2V63A 2B6AB 4DV4J 3IR7B 4MYUA 2R7WA 4DR4F 2DITA 1NZ8A 4DV3F 1RT1A 4DZ6A 2IDLA 2OP5A 2BJ8A 3GIKA 3GCWP 8AT1B 1HL6A 5C2CA 1R0AA 2ALYB 4P75A 4MK7A 3SFUA 2BV3A 5A8KA 4ED6A 4F4ZA 4Y6IA 3Q8SB 4M5KA 4ETZA 4Q44A 4JUZA 2VG5A 1R6YA 2GW8A 3V4MA 3VQSA 1ZYQA 1JJ4A 3BSOA 4DG1B 5E3CA 3D28A 1F6TA 4B9NA 3BREA 3ZTSA 3NNAA 1HIYA 4TQRA 3F0NA 4X4RA 3L7UA 4C2MA 4R25A 3KJVA 2FHKA 1HPZA 4CT9A 2L3MA 1RWXB 2HGNA 2VOPA 2XEXA 2GHPA 4KHRA 3RR7A 2DNKA 2H1YA 3ULHA 5DJBA 5DQGA 4ICLA 1RISA 2H5EA 2QSWA 1VI7A 1WNEA 3NG8A 4LRBA 4JBCA 3MMJA 1RA6A 1RU2A 1RT6A 1BHNA 4FVMA 2CVIA 4ZVHA 2JZ5A 3WHIA 6AT1B 4UQGA 2XMTA 2PI4A 2F4VJ 2CADA 3ENVA 1CLFA 3VGVA 1BXNA 2CQCA 4P9SA 1FK9B 1MU2A 4NLRA 3R5DA 2ZH5A 2QLFB 4DPYA 4OI1A 3B6BA 1E6VB 4ECZA 2R7RA 2EFGA 1K1QA 3TJ9A 3FSIA 2XO7A 1U45A 4IR1A 3MMCA 3Q89A 4KQZA 4DFKA 2JEGA 1ELOA 2WK4A 4WFNQ 2XS5A 2CQ2A 2XGQA 4DV2F 4TVAB 1ZTTA 4Q2LA 4UUWA 3M9MB 3HSDA 4C8OA 2RF2B 3U02A 2PEHA 5L38A 1U6FA 2AF6A 5JVGQ 3Q83A 4ZHRA 1YLXA 2ZHAA 2IAJA 2UVWA 5F3ZA 1J5OB 3TR5A 2BABA 3C6UB 5LOQA 1DQAA 4J9UE 3S1TA 4ENOA 2C2EA 2W24A 3R6GB 5IS2A 3JTNA 4R0JA 1Q81T 4EUVA 3VGSA 3OV7A 1PBUA 4A4JA 3AY0A 1O51A 3QJPA 2ZH4A 2QL9B 2EKNA 3QT7A 3R7BB 2Y1LB 1JLBA 3PW2A 2RQMA 3D0GE 3V4IB 1J27A 1ZAXA 4NMXA 1RBAA 2HIYA 1FJEB 1MROB 4OYZA 4CM0A 2RQCA 3CUNA 3VZIA 2RRAA 1VQLS 4ZP6A 1QM9A 4ETXA 5RUBA 4Q2MA 2D9PA 5AXNA 4J9MA 2YNGB 3BBFA 2NXJA 2Q3PA 3BV8A 2L9NA 2DPIA 4F50A 3MTKA 4WIQA 3DOKB 2Z8QA 3FNNA 4YEAA 2EK6A 4AXJA 2KZZA 2J6UA 1FNOA 1S1WB 1RT3B 4KRWA 4TLQA 1I94F 2BKPA 4LF8J 1FXLA 1S1XB 1TL7A 4DR7J 5L8RC 3I9V9 2HFUA 2GS8A 3K8WA 1RTJB 2CQ0A 2HK3A 1UA0A 1KLNA 2MY8A 2BMBA 1B7YB 2DRBA 1UFLA 3HHKA 3DI6A 4IFVB 3EPIA 3O5TB 4ZVEA 3PYEA 4YN3B 1SUQA 2MQPA 4DR5F 1UMJA 2BA9A 2BJ9A 1GX6A 1P9QC 3HVAA 1N6QB 5HAOA 5A8RB 3JSBA 3CJ4A 3VR1A 4CO1A 1BQNA 1HWJA 5LSLA 4ID5B 3DN9A 4YR0A 3TA2A 4DS4A 5T14A 2KB2A 1Q8LA 2W9CB 4DMZA 3CPWR 4RX6A 1VIXA 6FDRA 1BQMB 1Q53A 3FMWA 1VBKA 3G8SA 2RB7A 1RCOB 3POTA 2ATLA 4LF6J 3MEGB 4H4OB 1MMNA 2KVIA 3ZZTA 5KFQA 3QGGA 2J76E 2ASYA 5F8HA 2HVEA 1WTBA 3UN3A 1RHMB 1NU4A 2V8GA 3AD7C 1F3VA 2R3VA 4P7VA 2YQ3A 3RBZA 4O4GB 2AP6A 3W5ZA 2HNYA 3MM7B 5KT7A 5H9EJ 2ZWPA 2F40A 3Q0AA 5D3GB 4CYUB 3QAEA 3UFCX 2C2ZB 1N56A 3CCQS 1X4AA 2LU2A 3G6ES 4DUYF 2C42A 3MAAA 4C4WA 5F8IA 3W8PA 1HARA 3SMZA 1T11A 1D8ZA 4B3TF 3QGPA 1SJFA 2Z2YB 3H25A 2VPYB 2IJFA 4MKBA 3KK1A 1DFDA 2VHGA 4BCAA 2G2YA 1H2UX 2GA7A 2IRYA 2UXCJ 2MHEA 4CLSA 1JXEA 3LANA 5HSPA 3R6LB 3CDWA 1JLFB 5J1EA 3RAXA 1REGX 3S6EA 5CCLA 2DGXA 1IBLJ 3CDBA 4IG0B 5KFUA 2C28A 1JXVA 3CDAA 3DHXA 1U8SA 2AX1A 1U2RA 1T9WA 4LSNB 1U7LA 5J2PA 2OKQA 4H4MA 3DDIA 2AYGA 2E5LF 2B5JA 1W2IA 3TX8A 3OL6A 1S9FA 1KQFB 4O4RA 5L1IA 4DLGA 4ED1A 2RIJA 1W2BR 5HP1A 1GMWA 2ZJPQ 4CO2A 2VICA 4DL6A 3Q24A 3A4TA 3BJYA 4AL5A 3FVYA 3U1NA 3BO3A 3T1HJ 4AT1B 5C25A 3KJNB 4WBFA 2ZEJA 2B8QA 4DSIA 1B0PA 4CO5A 5D8HB 1WUUA 4C8NA 2K8GA 3RB6A 4B9TA 3CJKB 3IRWP 2VG6A 4J5OA 2V9WA 2MKYA 4RW8A 1S0NA 4O3PA 1H3DA 3OVAA 1ZA1B 1X5PA 3MPDA 4A8YA 3DOLB 3P49B 4DL5A 1IBMF 3D0HE 3CJTA 5HMYA 3W62A 1LW0A 4ZLNA 3M6XA 4NLDA 2F8EX 1D8YA 3CE8A 3TAQA 2B9EA 5CYQA 4DQRA 1S97A 9ATCB 2EG2A 1NCLA 5J1PA 2QYGA 3E2EA 1RACB 2W1BA 4NLOA 4KY3A 1AZSB 3CD6S 4JI0F 4WK3A 1DY3A 5KOWA 2OTJS 2HAFA 1DLOB 2K06A 3LW5C 2AJ2A 2UUWA 5I4MA 2QGFB 1S6QA 1IKYA 2I9SA 3EGNA 4Y3CA 4EU0A 4ZJLA 5K14B 4CLUA 2XWYA 4F3OA 2MEWA 2LEBA 4PXDA 5LMNF 5HJYA 2I5JB 2UUBJ 4J9VA 2OPSA 1JLCA 1HI8A 2MY7A 5J2QB 1FDAA 3RBXA 1H2VZ 1X9SA 1TAUA 5I3QA 3UCUP 4EGLA 3GSIA 3RB3A 2C3YA 2D9OA 1U1RA 1T9YA 3W65A 2BRLA 3ZZYA 4RNOA 2AQ4A 1DTQA 3OTCA 4OI6A 2PMHA 2H51B 1UWBA 3J7ZT 2AKWB 1L3VA 2ZVIA 1WTFA 2D3OR 2YKAA 1FKOB 2XMMA 2G4BA 1KP6A 4XO0A 4MFBB 1FRJA 1S1VA 4FPIA 2DR6A 2GAGC 1SV5A 2DNNA 1KSPA 1PAUB 4DWIA 1CG2A 2ASJA 4Y2KA 1IKXA 5KFWA 2LQJA 3N9UC 4RUHA 1WC4A 3SSQA 3CCJS 4DS5A 3D3CJ 1Q8BA 1H38A 4USUA 4J90A 4C6AA 5SZTA 2MKSA 2UZAA 3FZBA 1HNWF 5KG6A 3KYLA 4AFFA 2EK1A 3K17A 1WEZA 3R7NB 5AE3A 1N48A 5KFSA 3HF5A 2ZKTA 1KLMA 1HWUA 4CH7A 5EX3A 1EZZB 2KRBA 4ZVGA 3EGVA 2CJXB 2D1CA 4LF7F 4QW8A 3M30B 3WIVA 4HH0A 4ZVUB 1ZZNA 1F5CA 2DGOA 1OSCA 2V67A 1IBCB 2JEIA 3GJTB 2I2YA 4W4MA 3LGMA 4C3KA 3N6MA 4LIWA 4OJGA 2PFDA 2ZZMA 4FF3A 4DSFA 4USJC 3TEGA 5E33A 2JRSA 5HJXA 2W9BA 2HVIA 1T7PA 5KG4A 4RL1A 3G87A 1A0OB 4X4NA 1VQ4S 1NJZA 1UAWA 2XC9A 5JUMA 2ZNYA 2OEJA 4CM2A 2WRMA 4NXNF 2PE8A 4WP3A 2WB4A 1WI8A 3LP2A 2OEKA 2YX7A 3BBCA 1NKCA 4ED8A 4NRUA 4I68A 2VASA 2P9EA 1R0BG 1YK9A 3C19A 5DDPC 4I7FA 4N7TA 2B9YA 1RAOA 4DFPA 3R5BA 5U47A 1FWKA 4OJHA 2DNYA 1NKEA 3G6VA 5MLCV 4LUBA 2RHQB 4KAIA 4X66J 1VQOS 1HWLA 2E9RX 4NLVA 1Y4ZB 4ZKAA 5DM7Q 4DV0F 2YNIA 5CYJA 3D1HA 3IGVA 3ILLA 3NWRA 2E7XA 4ALZA 2HFVA 1FWPA 2HHPA 3OUYA 2VDHA 1L3SA 2FB0A 4WKRA 1NHUA 3HCXA 4P72A 1QUPA 2R7TA 3EUNA 2J9DE 2J9EA 3A12A 3FSYA 4AYBD 2DKOB 1CC7A 3WC0A 2G13A 1NPPA 3C3LA 3OVBA 3G6YA 3D4JA 2YNHA 8RUCA 2R9LA 4N47A 4J9QA 4M5DB 3IXQA 4LFBF 4CQ1A 2LEAA 1LOUA 4M5NA 5GMKa 1CS4A 1W7WA 2OELA 1S1UA 2KFZA 5HQMA 1UJ5A 3SDEA 3K5PA 4FYXB 2QX0A 1U2FA 1NMEB 1UZDA 3GYNA 4CZCA 3BR9A 1CSJA 2CYYA 4KHPF 2Y0BB 2L41A 2QSFA 3BN4A 3US5A 1U6BA 3IG1A 1G4CA 3OR2A 2ILZA 3KLGA 2EVZA 2DPJA 1RAFB 2DNQA 1RWUA 4DCPB 3E51A 4DX6A 4KKOA 2W25A 3SCLE 4K4UA 1C2PA 3PDNA 1HBUA 2AGOA 1UEVA 4NLTA 2L48A 4HHUA 1HA1A 3MPVA 3M8PB 2DGVA 4LSZB 4DSLA 3GSDA 2ASLA 4JV5F 3MHYA 2GVZA 2VJVA 2CQHA 1L3KA 2EC0A 3KHLA 4ZJQA 3FQKA 4QW9A 4X65F 3KK3B 1XMQJ 4G3IA 3CEDA 1RZMA 2CUYA 3I82A 4NLSA 1KS2A 3WX8A 4NLYA 4IOBA 2MJNA 5IQ6A 1N32J 2F65A 5D0HA 1RT2B 1JJCB 1M5KC 1PSDA 2K1RB 5KT5A 3D54A 1FDDA 3BO4A 2F9DA 1SL0A 2OIHA 1K47A 4ANEA 1RBOB 3CC2S 3PEJA 4DFMA 1S6OA 4QPTA 3SV3A 5CXTA 3CO9A 1RTZA 4J37A 1NM2A 4NI2A 2Y1IA 3QZ7A 2V69A 1FT8A 2H4YB 2ADBA 1VQ6S 3RYLA 2N7CA 4C8ZA 3G82A 2C2MB 1B4SA 3M6UA 2RJZA 1QTNB 2UVVA 3BR8A 1DARA 2FC8A 3CDEA 2ZBRA 2JEFA 3QMQA 4O44B 2E1RA 5KG5A 2LXUA 2EEYA 3MI7X 2VQFF 5G0RB 4DLEA 4IH6A 5B0GA 1MWZA 2BJ7A 4DR1F 4WP9A 2KYZA 2QMWA 2V2QA 3GR0A 3EJMA 1DJ0A 2ZC3A 2YKMA 1MW7A 1GK8A 4X4UA 1YIJS 4UF4A 2XY5A 2PA3A 3BEGB 3BPDA 3GFXA 5DLFA 2YNFB 3B8HA 2CZ9A 5G4DA 4XPCA 1YZ6A 4RW7B 1TKXB 4PABA 3LALA 1LWXA 4LBPA 2A18A 4FNIA 1YITS 2GVDB 2BDPA 3R27A 1HR0J 4ANCA 1X31C 4HACA 4Y2CA 3K57A 4IRDA 3EDQB 2ZBPA 4BWJA 2KT5A 2W2QP 4CLFA 1I6JA 2OGUA 3DOMA 3ENWA 2I6WA 4RWWA 1FJCA 4WFAQ 1FCAA 7FD1A 3O8WA 1KFDA 2FGCA 1D9DA 2QJ3A 2Z0GA 1X5TA 1MMDA 3W63A 5BXIA 5M2RA 2JDJA 2QT7A 5A8WB 1VOMA 4RPFA 2E5HA 1YG0A 4YY3J 2CPDA 5EGYA 4XAKA 3DC2A 2HHVA 4QBUA 2FLNA 3FEXB 4B3OB 3DMJB 5HVHA 1SIZA 1LFPA 2GQQA 2K7JA 1S9EA 3M8QB 3LPEA 4TYAA 3Q86A 2PO4A 3TAPA 4QIEA 3LP1B 3VWSA 2UXDJ 3K2YA 1WF1A 3J80Y 8ATCB 3ZC4A 2DBBA 4U8VA 3M8RA 5CYMA 1SVDA 2IVMA 3IWNC 1YRUA 1F0XA 5B0FA 3F73A 2A2DA 2A1BA 4P74A 4YHHF 1XQIA 1EQ0A 4WU3A 4B3RF 3AOBA 3EDRB 2VV5A 2KO1A 4PQAA 2EG1A 1FVQA 1G1XA 2DGUA 4KTQA 2WSEC 2C2OB 3J80U 4K2JA 1IWGA 1P1LA 1RWNB 3W5YA 4JI2J 4CNZA 1UJ6A 2FY1A 2W4CA 2IDEA 4F0HA 1NDKA 4RNFA 2M52A 2MKCA 4K50A 5H9FJ 1S4EA 1CJTB 2HPUA 5GMEA 5ETMA 4D3GA 5T7LA 4M5HA 2OSQA 3I6PA 4WYWA 1X4CA 2CQ4A 1RTDB 3EMTA 1RTHB 5B0AA 5CAAA 1VRTB 2DH7A 2P6TA 4TU9A 2B51A 3GV5B 1JWWA 2FHJD 4F0KA 2FHMA 2CDRB 4K59A 1J5EF 4OX6A 3H4BA 3FSXA 1EP4A 3AODA 4YR3A 2M88A 3KJQB 4DPXA 4JV0A 4Z2XA 2ILYA 2NYIA 3PRVA 1T03A 2XY6A 4ANDA 2GC8A 2HNZB 1F5AA 2G2ZA 2J0WA 4DL7A 4E8UA 4OLOA 4OHWA 3ZNUA 2CQBA 2HHSA 2DJWA 4OX9J 1TV6B 4WTYA 3K0JA 3CC4S 3OTOF 1QSYA 4CTAA 3GG0A 2ZH1A 1N5YA 1RBLA 1N0UA 2RQKA 2MSSA 1TVRB 2KT2A 4PWDA 2BQ3A 1SKRA 2J6TA 1S1TA 3TVKA 2QEXS 5J2NA 1WJ9A 2BOPA 2F9JA 4MT1A 3N5BA 2WONA 1HBMB 2B0GA 1E6YA 2U1AA 1TFYA 1F2GA 5I3UA 4JI8F 5D0EA 3I0RB 2B43A 2OPQB 3ITHB 1YZ7A 3ZTQA 5E3PA 3BH7B 2RS8A 1VQ5S 4RW6A 4F04B 1XMOF 3FQLA 1W25A 1RWVB 4P6QA 5JVHQ 2HGMA 5GAEU 3GYGA 2R4FA 5L39A 2YPZA 5L1JA 3AOCA 2E29A 3MCOA 3EE3A 3M1VA 4DQSA 2HNDB 1URNA 2V6AA 4LF9J 5DQIA 1SH2A 2R8GA 4YR2A 2ZVSA 3DLKA 2HQFA 3J7YI 4LIRA 2J8SA 3QIPB 1YJVA 1H6KX 2IRXA 5CQGA 3D2WA 2M70A 4BHQA 1RT7B 1IBKF 3DRSB 3GIIA 1VHFA 4IO1A 5KFAA 4M95A 1FEHA 1JNZB 3UN2A 3BN7A 4TLRA 1CJUB 1Y7PA 3RJMB 4KGVB 1OJ4A 3BPSP 1N5QA 2O5DA 4K4SA 4RUCA 2HHHF 2CNOB 4DR3J 2DNRA 3JXOA 3FUYA 5IWAJ 2LQ5A 3TUIC 4Q0BA 4RZRA 4ITSA 4OZ0A 4O0IA 1XEZA 1U0HA 4JI6F 3MWBA 2DEIA 2KFNA 4MKYA 4U6PA 4HDHA 4FP9A 3IBFB 2DHXA 3D7SB 3CTRA 4C3MA 3A3NB 3W60A 1JJHA 1TP7A 3OJSA 4MIBA 5EDWA 1EETB 2YKNA 2VONA 1LQ9A 1KTVA 3V81A 3VF0B 2HHUA 1FRMA 3PYFA 2E66A 4USVA 3NCRA 2DYAA 2ZKUA 3B4DA 1RT1B 4DDFA 4LFAJ 2FJDB 1RSCA 3RGIA 2PMWA 3NL0A 4PEOA 1R0AB 4HDGA 1V9OA 1Y9OA 2FZGB 2HS4A 4IFYA 4IH5A 3CCRS 2QLJB 1TK5A 5A8KB 3EYZA 2VUGA 3MCMA 3BM7A 2N3OA 2CG4A 3KDNA 4WKYA 1FXDA 2WBMA 1RT4A 1YTYA 2VG5B 1VISA 2NXUA 2UV8A 1RB0A 1QDUB 3QWPA 2VKZG 2NXCA 4R8UA 1VQPS 3Q8YA 4ZVRB 2HAIA 1WD6A 4CH1A 4FXDA 4LR9A 3OL9A 4CLKA 2OH2A 5GAGI 4Y2MA 5CHCB 3B82A 2LEPA 3RUBL 1QAYA 1YJ7A 1Q5YA 2DHGA 3NNCA 1HPZB 4NZ0A 3N79A 4OJ1A 3KK2A 2XQCA 4EI2A 3OW2R 4K5RA 2DGQA 3PX4A 1LWCA 1TELA 5HN0A 2JVRA 4ICLB 2YWKA 4NASA 3FBCA 5AJ3J 3BQ1A 4QCLA 1XC9A 1RT6B 3NP5A 3QT8A 3TA0A 2E7WA 1TUVA 1EKRA 2YVSA 5F3TA 2XYGB 1UJ4A 1Y3JA 1UP1A 2LVWA 3PVXA 3NS7B 1QSLA 1RTIA 3CMAS 2MLXA 3QQCD 2WOMA 4L3KA 2PC6A 4A8XA 1WELA 2DY9A 4ELVA 2BE7D 4KYZA 1FEEA 2AD9A 4ZLPA 2D74B 1MU2B 3TX0A 4LFCF 2B8PA 3EWGA 4UOCA 1N34F 3MMCB 1XNRF 4WE1A 1SQEA 1DQ9A 1TTHB 3ILJA 3OQ2A 1EIYB 3GWCA 1G6BA 2BE9B 3FEYB 1WI6A 1FESA 4CT8A 3OSNA 4H54A 2VF3A 2GO8A 3N6NA 3CO0P 3UWTA 1BWEA 4F2RA 1LNQA 2MPUA 4B3SJ 1X5SA 5A0YA 1VBYA 1U4BA 4ZHRB 3DRYA 2DHAA 1Z4UA 4ID8A 2XTJP 1I1GA 2IAJB 4BDPA 3T3FA 1SIWB 1R6VA 2BQRA 3HDSA 4K4ZA 2DGWA 3MUVP 1C1BA 2VFUA 4OZLA 4EWTA 4DV5F 1WSVA 3KLHA 2FYXA 4JI1F 2NYHA 3O1LA 1HWIA 1GXLA 2HHWA 5LXRA 4J9NA 4UY8T 3UO0A 4F0MA 1JLBB 4LF5F 1IWAA 3PEHA 2XG8A 3AOAA 3DRXA 4XPEA 1WDTA 1KQSR 2BJ1A 2UU9J 1D3WA 4YMEA 4ZS6A 2I0XA 3K59A 1ZOTA 3VVUA 4JI5F 4JI4J 3H2LA 2IRUA 2YH1A 2J7KA 2UUCF 3NGSA 3D6TB 5ETTA 3O2IA 2Y1RI 2GHVC 4F4XA 1D9FA 1WWHA 2JLEA 3DGPA 2WAQD 2PT0A 1WACA 4KFBA 1ZM9A 3IMQJ 1AUDA 1SC4B 1XERA 2WTFA 1MMLA 4B17A 3OXFA 4PXCA 2VPXB 1JLGA 1ZAVA 1KBRA 4HHHA 1CC8A 3IS9A 1M5HA 2OMOA 1SL2A 3LPYA 4H4KA 3UR3C 4NPOA 3QRRA 1NSPA 3CCSS 3IAS9 4USTA 4ELTA 2NZ4A 4DG1A 3HP6A 1S6PA 2ROEA 5KFRA 2UUAJ 1IUJA 2MQNA 2XMJA 3CD5A 2XMAA 4RNHA 4OZ5A 3BF4A 3DYAA 3TZWA 1GFWB 1JX4A 4ATNA 2HFSA 4K4XA 4B3MF 1VK8A 3LWMA 4GKJJ 1G3OA 1RAJA 1R43A 1TU0B 2OLWA 1S5ZA 3ZZRA 4Y2IA 5KFYA 4FPRA 1NK6A 1KONA 1GTEA 2OSRA 4WFYA 1TL5A 3PR5B 4USWA 1BQNB 1TKDA 2DRAA 3ET6A 2RH3A 2WBRA 1T8EA 2HWTA 1N5TA 3G2XA 4EYIB 4WPAA 1HQ2A 4FXWA 5E41A 1FD2A 2BJEA 2QRRA 3RW6A 4M1KA 2U2FA 3LUYA 2NS1B 2GQ2A 4ZIVA 3QPIA 4NEYA 2DHHA 4IUFA 1X4EA 1NHKL 1KEKA 1PYOB 4K4VA 2IIHA 1Y5LB 1G2EA 1EHWA 3THPA 2OI2A 2JFKA 3CC7S 2NLWA 2ZBQA 1NK9A 3FZ2A 2OAUA 2FHJA 4L75A 1QSSA 3PX6A 2F1FA 3MR3A 1HMVA 3D6HB 5LSOA 2HNYB 5KFOA 1VYAA 1I5OB 4NOHA 3VHQA 1Z1ZA 3H2VE 1FERA 5DLGA 1SCJB 1FXRA 3CVKA 3PYDA 5D4NA 1NJYA 2B4PA 1R0CB 2L9WA 4P2MA 2ZM6J 5EN1A 4HYKA 2CG8A 1PCAA 1VC0A 4ZMMA 1U1LA 1KTQA 2WHOA 1VJQA 2D69A 2JOQA 2KT3A 3TAMA 3KK1B 2HRUA 2ZBIA 3T1YF 3JYTA 2MGZA 4DJBA 2UVUA 5F0WA 4FF1A 4P52A 4V19J 1WG5A 3MUMP 1RKJA 4M8LA 4NA1A 3DCAA 1X0FA 2IYIA 4JYAJ 5J1EB 1NDCA 4DPUA 4P2XA 1HNZF 4H4MB 4FDFA 2B5JB 3KLVA 3V4IA 3KWMA 1U47A 3BGLA 2R7QA 3PY8A 4MKVA 1VFJA 1MROA 2UVRA 2YWEA 3TW0A 5HP1B 1N36J 4R5PA 2Z58B 3ADAC 3D3BJ 3PJWA 3HFVA 5KFNA 4K2XA 2V2KA 3A1YG 3GJSB 5C25B 1RT5A 1KKHA 2GZOA 5B0CA 3TA1A 1IR0A 2GO9A 3G4SS 2FDNA 3PIPQ 3T5KA 2VG6B 1Q16B 3JTPA 2HQCA 1R31A 3MEKA 5DG7A 4RW8B 2ABYA 4KGMA 2HEKA 1S1WA 2IMOA 2JL9A 1LWEA 3UDCA 3NS6A 3HULA 2XMWA 1U1OA 3PW4A 1SQGA 2Z4PA 5JJBA 4I6AA 4A8KA 4DV7J 3CNQP 4IQXA 3C46A 3T6JA 2HQIA 4WJBA 2W7OA 1SB6A 1RTJA 4OX8A 5AXLA 5KFHA 3EZOA 4OZ1A 1Q8KA 2XWXA 5D0RA 1RAEB 3QLHA 4NLUA 4ZVPB 2EFOA 2Z2ZA 3W64A 1UWAA 4ZN3A 4J9PA 5DRKA 4QU7A 4EBEA 4RKUC 4ECTA 4ED5A 5D77A 1S6QB 1IKYB 2RDDA 4DV6F 2IJRA 3ILIA 2YQ0A 3HLUA 4LJMA 5ETSA 2CJAA 4ZCLA 3R9LA 4NWBA 4DX5A 1M0SA 5IT4A 2OPSB 3KUHA 4KPYA 2Y0SD 4OZ2A 4YB5A 1XNQJ 2B56A 4OYXA 4EBCA 4DEZA 3TP2A 4NCBA 5ETVA 4DHVA 1X4HA 1HHQA 2JSXA 2NSCA 2VQEF 2YWFA 1ZZFA 4WF9Q 3A8EA 2QA4G 2MSTA 1DBDA 3MF5A 1H2TZ 3LO3A 4UT4A 4K0KF 1RP5A 3K8VA 2VFTA 1ZBTA 2W2PP 2CPXA 1H7XA 2R2SA 1DTQB 4Y28C 3VALA 1LXJA 4IG3A 1Y5IB 5KTQA 1HI0P 2LCWA 1QE1A 2R7OA 1XTZA 2E5IA 1FNMA 1UWBB 1FE0A 4DV1F 4FYVB 3HO1A 2ZUAA 4ZDNA 4CYUA 2ZE2A 1FJGF 4AUKA 1S1VB 1VJWA 2DHSA 1D0EA 3I96A 3T5HA 1S7IA 3R2DJ 1SV5B 1HD1A 5ADZA 2Q79A 4Q8EA 1IKXB 3C14A 3KMSA 3D5MA 4PR6A 2IJNA 2J0XA 1XR7A 4QIWD 1YRTA 1SI9A 2EI5A 4RBUA 2HMIA 2AYEA 1RA7A 5BYRA 4M5JA 1T94A 3WC2A 1V3SA 3JQKA 1GMWD 4FXVA 4HTJA 1SJQA 3LAMA 1OPIA 3IWLA 1UA1A 2QL7B 3R5GA 4U7CA 4KB7A 4Y00A 4GKKJ 4NMLA 4TU8A 1P1TA 3MM9B 3MDFA 3KDOA 1R27B 3VAMA 4TQSA 2RUGA 4F4KA 5HQ8A 3NMAA 1K0TA 4DQIA 3VGTA 3BKFA 5DGBA 3W9JA 3BQ2A 3H40A 1YBUA 1R8CA 5EWFA 2WVFA 3CIZA 5IQQA 2W9BB 4LF4J 1RAHB 2CA9A 2XY7A 2XNQA 2M0GB 3JSMA 4LQ3A 2JFDA 4URSA 1L3UA 1KVIA 1RWOB 2YX1A 4OHXA 4FYWB 4WFBQ 1AXQA 3W2VB 5HATA 3ZTOA 1F9EB 4F8RA 3OXLA 3PXGa 1CJKA 1FX2A 2Z30B 1P8GA 1YHQS 4GVBA 4LRAA 2IVYA 4I7FB 2D3ZA 1WC1A 2N3LA 1U49A 2F8HA 2IBKA 1XMBA 2H5IB 1WEXA 1JXLA 3FCHA 2YNIB 4XDDA 4GC7A 3CXCR 1EARA 1X4GA 4DR6F 1WC3A 5KG3A 1RLCL 1RAAB 2V94A 1MN9A 1PKUA 4EEYA 4WXOA 4ZP9A 2ROPA 4LRDA 3WX4A 1X0PA 1QVGR 1VS3A 3RBEA 3ZZPA 2RS2A 3MD1A 4WWSA 1S57A 4IR9A 1LKZA 2M8HA 2RKIA 5E7OB 1XWLA 5A76A 5GADI 4O3OA 3GQCA 4ZK7M 4XTTA 5M2PA 2RQ4A 1YX2A 2BM1A 2YNHB 2B4OA 4PG8A 2HW3A 2ZWOA 3G9CA 2VBWA 5LMUJ 5F8NA 1CS4B 4X64F 4NLQA 1S1UB 3T19A 4GC6A 5KFEA 4NLXA 3HHEA 4USHA 4CP5A 4CDIA 4GMKA 3AD8C 2QYCA 2VODA 3MZIA 2QFIA 1FVSA 5HVGA 1WF0A 4KHMA 1JQGA 2ROGA 2QIFA 3BGRA 1EX8A 3DM2A 2AW0A 3GCXP 1TAQA 4ZVSB 1JKHB 2XS7A 3IG1B 3OR2B 3C6TA 3KLGB 1XN9A 2GJFA 4FBUA 4K8RA 1OQ6A 4UZCA 2V4RA 1QUVA 2C3PA 4YDXA 2H65B 1HBUB 3M7VA 1X4FA 4RU2A 3HK2A 3ZZOA 1X60A 1IXKA 2VB6A 3CCWA 3M6WA 2XM3A 1S59A 1JLQA 3PCOB 1VMBA 2IA0A 2ZDPA 3BZQA 2GVZB 2MKKA 3TZZA 4F67A 5EUHA 3PKMA 4HT7A 1XIQA 2PGCA 4LR7A 3JTOA 2CZ4A 2QC3A 1RYRA 4MIAA 1TKTA 2HBZB 3AQPA 4JP8A 5EX0A 3IA0A 4EFAC 3W61A 5KG7A 3KKFA 1QVFR 1UTAA 2JNJA 3HVWA 1AYEA 3R1LA 3LGNA 4F36A 4X62F 3RU0A 4DN9A 4N77A 4UW2A 3H98A 4HI2A 2MKIA 1KRPA 1MNEA 4JV1A 3DHWC 4DR2F 3ICLA 3UQSA 3OLAA 1HNXJ 4NI2B 3CW2C 4NYOA 3M8YA 1Q82T 3ISNC 2KJVA 3G82B 3ZFVA 1NH7A 1ZPVA 4OYMA 4NRTA 4G1PA 4UOFA 2RDIA 2AWZA 3TEHB 1N54B 4M5IA 3FK4A 4IKAA 2XZTB 4ED7A 1Q86T 4LREA 1M5OC 1BGXT 2EFVA 5BR8J 3DKDA 3IP0A 3LH2S 1AFIA 5LL6d 2H4WB 5GVQA 3M2UA 2DR7A 5AE1A 3TOQA 1WHXA 3X1LB 4X4OA 4ECRA 3CD7A 5DO2A 4DV4F 3I9ZA 2YKMB 2OD6A 3LTOA 5CD4H 4I4BA 1RLDA 5E3AA 2ZJQQ 2GIQA 1SJ4P 4JI3J 4HVZA 2DGSA 1F5BA 1FF2A 3PYGA 2YWWA 1RAIB 1TKZA 4L73A 3NY0A 3V6KA 1S10A 5K8MA 4RBTA 3CJ5A 1P9YA 1X9WA 4IRKA 2XSJA 3DOMB 2ZH9A 1TL1A 1UFKA 3P8BB 2WSCC 5KFZA 4S0MA 1DURA 1IJFB 2D41A 3BGFA 3BSCA 3W5XA 4L3NA 3O44A 1ZM2A 4DUZJ 2VFVA 1M1GA 2ALZA 2J9CA 2Y9HA 4DFJA 2KXNB 4QR2A 5KG0A 3H2UB 3R2CJ 5E0OA 1KFSA 4ED2A 2XZDB 2EBEA 2RVJA 4U67Q 2FY8A 4TY8A 3KLEA 5HK4A 1VC5A 3F56A 2ZH6A 3UDVA 3P45B 1YJWS 3OFHA 3IRXA 2EXUA 1CBKA 2QLBB 3GTYX 1FDBA 1S9EB 4M5MA 5L1KA 3UNGC 3W1YC 2C2NA 3HSZA 1U1KA 1BQXA 3MMBB 1T95A 3QFHA 4MJKA 2ZJRQ 5CYMB 2MXYA 1FD8A 4NXMJ 2MLYA 2JC1A 4F3QA 5KFGA 3VV2B 3PV8A 1B0TA 4Q43A 2APOA 3AH6A 4CWBA 2PEBA 4PAAA 1F60B 2R8HA 1N33J 1KR4A 3TO8A 2KXHA 2K2PA 2WVEA 5ETQA 4LBIA 2UXBJ 3G8TA 4KPCA 4CLYA 2M4MA 2NUHA 3KNGA 1RT2A 1UW4A 3TUPA 3MCNA 1JK9B 1FRLA 5IC4B 5T7LB 4UUXA 2FVSA 1F9HA 4PYDA 2FJAB 1ITPA 1C1CA 2HS3A 2YKQA 1H98A 1K8AT 4N41A 1YDLA 4QR1A 3CJ2A 3T6BA 2KXFA 5FJ4A 2M9KA 1T9XA 4LSLA 1TMMA 1OQ3A 3PO4A 3QJLA 5CABA 4J9RA 2FZKB 4KSEB 2DY1A 3NMRA 2VPWB 3VQTA 3R5JB 4ZIWA 1EP4B 4EBDA 1CPZA 2QA1A 1Q0NA 3E01B 3PO5A 2G2OA 2AU0A 3MECB 3NBPA 2QO3A 4BS2A 1T03B 2ZUGA 1FRXA 1VRQC 2E7VA 4KH1B 1KOHA 3EVOA 2AT1B 2VDIA 5F41A 2G9OA 3BBBA 3BKTA 3KTQA 1N5SA 2WVCA 2MZTA 4WTOB 2HG4A 2FPHX 4JI7J 2ZZNA 2C3OA 4U7UD 1BLUA 5JXSA 4CTAB 4DQQA 1N5YB 3P6YC 1H72C 1U02A 1VRUA 4QWAA 3MR2A 4QIFA 1QTMA 4PCQA 4PWDB 5FIIA 2O67A 2AZ3A 2V4JA 1S1TB 3VAIA 2N4DA 4AQYJ 5J2NB 4A47A 2WONB 5CZVA 2CJKA 1E6YB 1D9AA 3FFIB 1TKXA 2DXFA 5I3UB 2XI3A 4LF8F 1RI7A 2YWGA 2DT9A 1UEUA 3LGHA 4KGZB 3MFHA 3BS9A 3NEKA 4DR7F 2MDAA 4RW6B 2W2OP 5AXMA 4I69A 2XSFA 4ILMA 3BDPA 1UZHA 2O01C 1PJ7A 3GIJA 3PRDA 1RADB 2J9DA 5KT3A 4ECSA 1VLOA 4HKQA 3M2VB 4OMFG 3TVYA 3CJQA 1HQEA 1T05A 3M1VB 3PJ9A 2L9DA 4EZ9A 4DBQA 3M6VA 4PWWA 3HMJG 3ZZ0A 2FGOA 2DO4A 4NCGA 4C8LA 4YUDA 1FKPA 5B7WA 2AJFE 1YKWA 3UD5A 5FLXY 2IC3A 4X84A 2XMVA 1FTRA 4ZVTB 2V34A 1NB7A 2B4UA 1QD1A 3ZZUA 5KOXA 1WF2A 5C2GA 4CLPA 5HLFA 4F7VA 2CWXA 4DQPA 5KFVA 2DNOA 1U09A 2POKA 2ZD1A 1L5UA 3UVJA 4AL6A 5HQLA 4LF6F 5KFXA 5FLXU 2DK2A 3E3XA 3OSPA 3HVTA 2GJIA 3K5NA 4Q0BB 1YJRA 1RUSA 1JJ2R 4P2FA 2E1MC 2EWHA 1OYEA 2F4FA 1U0HB 2LU1A 2LLZA 3EICA 4DSKA 3KNAA 4DSEA 1RK8A 1VLYA 3HT0A 2YKOA 1F1BB 5CZXA 5D4OA 2KHDA 4JOUA 6FD1A 2YKNB 4F3MA 5DDOC 3V81B 3TUZC 1C0TA 3SI8A 3BSNA 2PA8D 4A48A 5AE2A 5J2MA 2DTJA 2LYVA 1HD0A 2CPZA 4DR4J 4NCAA 2QV6A 3RBDA 4IFYB 4DV3J 4MKAA 3R3TA 4FN5A 1SKWA 5CA5A 3CCES 3DNCA 1NJWA 1RT4B 3FDSA 3N01A 4QWDA 2UXCF 2OMLA 2JVOA 2OPRA 3VAGA 4R8UB 1TR0A 1IBLF 1F3FA 1GXUA 4RLEA 4IDKA 2RU9A 3I5CA 2E5GA 1BC6A 3LA0A 4NA3A 3LQVA 1HBOA 2HNZA 3KK2B 3BQ0A 1RHKB 5HMXA 1XR6A 3N5FA 3VTIA 1VQYA 2YTCA 3AAWB 1IKWA 4FS2A 4MTPA 1LWCB 1PG5B 5IFMA 4PQUA 4W92B 3J7YU 1Q78A 4MK8A 3T1HF 3HSGA 4I0WA 1IKVA 1GMVA 3QBCA 1AA1B 1CJVA 1NBEB 2AV5A 2LA6A 3NRBA 1RTIB 4ZVOB 2EFNA 2WOMB 1U2CA 4U96A 3GV7B 3GFYA 3MR7A 1S12A 4OLPA 4OZNA 4HL9A 3I0RA 3MPYA 3ITHA 2Q6BA 4LQ9A 4B02A 2WVBA 4NE9C 4NLWA 3M32A 5DG8A 4BC9A 3B4MA 4IOCQ 1ACMB 2JHEA 4DI6A 3HXMA 3W9HA 3H4DA 3VZHA 5HBMA 3P96A 2ADCA 4I67A 1KHWA 2NSBA 3JQMA 4WE1B 1SBRA 2HLUA 3SSRA 3I32A 1T0TV 4Y0FA 5D78A 3HHLA 3UCGA 2FIUA 2FVPA 3MXHP 2KHCA 3ZNJ1 5F8GA 4E0DA 1H0HB 3HZGA 1YRXA 2OFHX 3TI0A 1UPPA 5ETNA 4J7CA 3G86A 1QAXA 2C2RA 2BEFA 3IGNA 4DV2J 1FE4A 5A0YB 4LVNP 3K5MA 1SJ1A 1FFWB 1OPZA 2IY5B 2ERRA 1RU1A 4DXLA 1RT7A 2QA4S 2CNNB 2Y1JA 1D1UA 4DCJB 1TL4A 1C1BB 2X3GA 3W66A 4C98A 2UUBF 4WIIA 3HHNB 5HL7Q 2BUNA 1FNXH 3HSJA 2BBEA 4ZP8A 3M2RA 3EZUA 1HQUB 4GO5X 4QWCA 2Y3YA 2MQOA 3DFEA 3WBZA 2QTWA 2N82B 4N56A 2B9WA 1HLWA 4DPTA 2GMJA 3C8YA 3OHAA 4FNHA 2OO4A 4IH7A 2C3MA 2YH0A 3HJVA 3RZAA 1TK0A 2XMUA 5GAGU 3MR5A 2ZBCA 1HNVB 4V1Ak 3MAQA 2BR0A 4DOZA 3HPOA 3M9OB 3A3PB 4X2BA 3GJRB 2LQ8A 2DEJA 1EETA 1YJUA 3G8QA 1PILA 2KDOA 4L72B 4HH1A 2JX2A 2B3TB 3DGPB 2GIRA 2RD5C 4CLWA 4IYQA 3IAM9 4J9KA 4KFBB 2IMWP 4TNOA 3GR1A 4GO7X 3AA8A 5IM0A 2B4VA 5F9NA 1JLGB 3DLEA 4ZVFA 3IS9B 2H3EB 3G71S 2WW4A 1I94J 4MIWA 4DCOB 1WC6A 1EKSA 5DGAA 1DTTA 2LP4A 2OPPB 1KQGB 3EVMA 1NXIA 1NK4A 1LW2A 3MMAA 1S6PB 1HYSB 3C15B 2VL1A 1U6ZA 7AT1B 1SPBP 2A2CA 2DNHA 2AGPA 3PM9A 4WP8A 1K0VA 3DYAB 2IVFB 3Q8VA 4DZDA 2MQQA 2E5JA 2YY3A 2GGPB 1T9UA 2JLFA 4QYZK 1IR2A 1BMQB 2P9GA 3MCSA 1M5PC 3UDEA 3LP0B 3DXBA 1Z2ZA 3FCWA 4DR5J 4B9SA 2DNGA 3RTVA 3I0SA 4I2PA 3ELHA 5JMNA 1PGZA 3ET6B 3HFZB 4KE5A 2CJQA 3SQGA 4EMDA 3VVTA 1NRKA 2K3IA 2IA6A 4MMOA 1VBZA 4N76A 1M90T 2BANA 2E1AA 1BD6A 1VCTA 4PXEA 3FEZA 4WXWA 4U8YA 1R8HA 1KVJA 1R8PA 3IN5A 4OQJA 5DG9A 4QZVB 2V8VA 1T02A 4OZ3A 2DIUA 3DDKA 1V5VA 2UUTA 5KFLA 3CCUS 2GMHA 3T9NA 4WU2A 5A6PA 4O0NA 2MQLA 5D4PA 3D1OA 4FKXA 3SCIE 2SXLA 1VQKS 2EC2A 2BKNA 1HMVB 4UOHA 2BQUA 3HVRA 1PIEA 4X66F 3D6FB 4DF4A 1A6LA 4QPXA 4DU7A 3X3UA 1KQKA 2KG0A 3IR6B 4E98A 5K8OA 3CIMA 4ED4A 3WIUA 3D1QA 4AL7A 3K5OA 2C1EB 4C11A 2OTLS 3BDEA 2M2BA 4DUYJ 3MM5A 1UVMA 3SSSA 5GAHI 3DU5A 3D9BA 3TAMB 4B3TJ 3MURP 1C0UA 3JYTB 2MGZB 4A46A 1PC5A 5C24A 1XBWA 2HS0A 5KFJA 4K4YA 4ER8A 1WHYA 3FRZA 5LT5A 3VAJA 1UVIA 2GIFA 4ES1A 3ETOA 2BW7A 2KN4A 3ISZA 2CQ1A 1NJXA 4F26A 1VQNS 1HNIA 2MJUA 2XCAA 1MLAA 3CULA 1PO6A 2AEJA 2AX0A 1UVNA 2P6SA 2MZQA 2E5LJ 4PG7A 1NO8A 4PUOB 2B7CB 1SH3A 4P10A 5L46A 1Y11A 4R5PB 3KLIB 2W2MP 1T3OA 4X4QA 3OXGA 2XLIA 4ZJOA 1QAIA 1RT5B 1OMSA 1WOSA 3P5TL 3MD3A 4UQTA 3RRKA 1ZTWA 1AUSL 1NH8A 2MQMA 5A2QY 4PRFA 1S0VA 4N5SA 2G1HA 1U8WA 3QO9A 1HFEL 1LWEB 1ZPWX 2D3O1 3HM9A 3GP9A 3DLGA 1NHVA 4W98A 2VU5A 2KKHA 3W8GA 2NCKL 1R8BA 3N0VA 2C2DA 1BUXA 3GV8B 3C2PA 1XMQF 5E3RA 3PG9A 4DL4A 4K7QA 1GQEA 3M4XA 1IBMJ 3NAHA 4C8YA 1C4AA 4KC5A 5A2QU 3KLFA 1N32F 4PG5A 4OL8A 3QLHB 3GG1A 3QWUA 4CO4A 5EWEA 5BYSA 2KH9A 2R7XA 2UV8G 3WZ0A 1JLEB 4I6WA 4JI0J 4O3QA 2BJDA 4B9LA 2R8JA 3DU6A 1JMTA 4FVCA 2MYFA 1O6XA 3ZO7A 1AROP 2M7SA 3PNIA 3GFZA 2DCLA 3CCMS 2IBOA 4ZPDA 2BE2B 4M5GA 2AJ4A 4OX7A 2NUUG 2OEMA 2FVCA 2FLPA 1FHTA 1HBNA 5LMNJ 2QFJA 3CDUA 3UNYA 1HI1A 1B99A 3DRPA 1SQFA 4KV8A 3T9ZA 4BWMA 3Q8UA 4QOTA 2IPOB 1RE1B 4C9DA 5FDLA 4FBTA 3D66A 2XHCA 3CB4A 2XYHB 2IM2A 3QT6A 3H5UA 1N52B 3F44A 2VFRA 4OYIA 2V5HG 4IG3B 2CDQA 1QE1B 2KM8B 1SL1A 4TKTA 2BJ3A 3K7RA 2ZHOA 3MM8A 5KFMA 5F8MA 5HVFA 3CCTA 2ZE2B 3OTEA 2UP1A 2PMZD 4P2SA 4I56A 3QJJA 4G1QA 4M63A 1SH0A 2AEFA 2J7UA 2NXNA 1RHQB 3C14B 4X4TA 4C0HA 5LJ3Y 1OO0B 1HR0F 2FZCB 3MM6B 4HTIA 4NYPA 4MAKA 1NDLA 2MMYA 2HMIB 3R97A 4I2QB 3DLLQ 4Y2AA 4A8FA 2PFFB 5B0BA 1S9GA 2ZDOA 2VG7A 3NGUA 1HNWJ 1VQMS 2DD8S 3A8IA 4RWXA 3Q8RB 4IO9Q 1KDNA 1PBAA 4LRCA 2X7IA 3VCDA 2B9XA 5LJ5Y 2AYMA 4FYDA 3KG4A 3L4BC 4LR8A 3SCJE 1Y10A 4LF7J 4YY3F 2WCXA 3MFIA 4ELUA 5IOLA 3JB9k 5IV3A 1S99A 2WZ1A 4NLGA 3CJ0A 4R0EA 3HKZD 1UVJA 2ZOGA 2D3UA 1ZETA 4NZ7A 2UXDF 2DXEA 4RJVA 3FMBA 4NX9A 2GV1A 3KG0A 5KFBA 1X8DA 3JSMB 1HW8A 1B3TA 1Q7YT 2X1AA 2GCFA 4NYZA 3PRBA 4ZPBA 1HW9A 1REVB 3FCVA 3D6MB 2J5AA 4NXNJ 5I42B 3SFGA 2V8PA 4ECYA 1CULA 1CJKB 2ZH2A 3DRRA 2AJQA 4GVBB 5BYQA 1UVKA 1X7VA 2KRRA 1Y3KA 3VAHA 4JI2F 2CKWA 5AXKA 5H9EK 1U26A 2D7SA
chains in the Genus database with same CATH topology
1SC3B 2DKOB 1RWVB 2HBYB 2H65B 1RWXB 3KJQB 3R7SB 2C2MB 4LSZB 3QNWB 2XYPB 3EDQB 1PAUB 3KJNB 1QTNB 3EDRB 3SIPB 3R5JB 2CNKB 2HBQB 3D6FB 3IBFB 1RWMB 3GJSB 2C2OB 1RWWB 1RWKB 1BMQB 1RHUB 1RHJB 1RWNB 1RHKB 3P4UB 2XZTB 3GJRB 3R7NB 4JB8B 1RWOB 1NMEB 1RHQB 1I3OB 2C1EB 3R6GB 3GJQB 2HBZB 3R6LB 1ICEB 1SC4B 2H54B 1F9EB 2Y0BB 2XYGB 5IC6B 2H4WB 2XZDB 2CJXB 2QL7B 1RHRB 1PYOB 1RHMB 2QLJB 2QL9B 3KJFB 2QL5B 3NS7B 2CNNB 3D6MB 4ZVUB 3R7BB 4DCJB 2Y1LB 4ZVTB 3P45B 5IC4B 1I51B 2QLFB 3RJMB 2H51B 2C2KB 4DCPB 1SC1B 4ZVSB 1IBCB 2H5JB 3GJTB 2QLBB 2H5IB 4DCOB 1RE1B 2CDRB 4ZVOB 4ZVQB 1QDUB 2CNOB 2H48B 4ZVPB 2H4YB 2HBRB 2CNLB 2XYHB 4ZVRB 1RWPB 2P2CB 5K20B 3IBCB 3D6HB 2FQQB 1GFWB 2CJYB 2C2ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SC3 B;  2DKO B;  1RWV B;  2HBY B;  2H65 B;  1RWX B;  3KJQ B;  3R7S B;  2C2M B;  4LSZ B;  3QNW B;  2XYP B;  3EDQ B;  1PAU B;  3KJN B;  1QTN B;  3EDR B;  3SIP B;  3R5J B;  2CNK B;  2HBQ B;  3D6F B;  3IBF B;  1RWM B;  3GJS B;  2C2O B;  1RWW B;  1RWK B;  1BMQ B;  1RHU B;  1RHJ B;  1RWN B;  1RHK B;  3P4U B;  2XZT B;  3GJR B;  3R7N B;  4JB8 B;  1RWO B;  1NME B;  1RHQ B;  1I3O B;  2C1E B;  3R6G B;  3GJQ B;  2HBZ B;  3R6L B;  1ICE B;  1SC4 B;  2H54 B;  1F9E B;  2Y0B B;  2XYG B;  5IC6 B;  2H4W B;  2XZD B;  2CJX B;  2QL7 B;  1RHR B;  1PYO B;  1RHM B;  2QLJ B;  2QL9 B;  3KJF B;  2QL5 B;  3NS7 B;  2CNN B;  3D6M B;  4ZVU B;  3R7B B;  4DCJ B;  2Y1L B;  4ZVT B;  3P45 B;  5IC4 B;  1I51 B;  2QLF B;  3RJM B;  2H51 B;  2C2K B;  4DCP B;  1SC1 B;  4ZVS B;  1IBC B;  2H5J B;  3GJT B;  2QLB B;  2H5I B;  4DCO B;  1RE1 B;  2CDR B;  4ZVO B;  4ZVQ B;  1QDU B;  2CNO B;  2H48 B;  4ZVP B;  2H4Y B;  2HBR B;  2CNL B;  2XYH B;  4ZVR B;  1RWP B;  2P2C B;  5K20 B;  3IBC B;  3D6H B;  2FQQ B;  1GFW B;  2CJY B;  2C2Z B; 
#chains in the Genus database with same CATH topology
 1URR A;  4OFZ A;  5H1S V;  3V6J A;  3IM9 A;  1WC0 A;  4DV0 J;  1Q7L B;  3OVS A;  3R5A A;  4KJI A;  5HRO A;  4LF1 A;  1IQT A;  3KUG A;  1UFW A;  5E3Q A;  4Y34 A;  3IC1 A;  4OYA A;  1NND A;  3H0P A;  2MZS A;  2RKI B;  4F2S A;  2QMX A;  2DRD A;  1TUW A;  2GNK A;  2R8K A;  3W2W A;  2VA2 A;  2ZHB A;  4IRC A;  3MEE A;  4X4S A;  3SYZ A;  4LFB J;  2RNE A;  1YVF A;  1ROF A;  1VBX A;  4NA2 A;  1O5J A;  3C16 A;  2PII A;  4A8W A;  4OI3 A;  3KJV B;  2HQ3 A;  1U0S A;  3AJD A;  3LAK A;  3BGR B;  4OI4 A;  1R8A A;  2CQI A;  2R2U A;  3DM2 B;  3FGV A;  4O3R A;  4KHP J;  4OX9 F;  3TYT A;  2O1P A;  2DCU B;  3R7S B;  5L9N A;  2W9A A;  3C6T B;  5K9F A;  3U1L A;  1N5V A;  2RIL A;  4NEZ A;  4P7T A;  1HKA A;  4UOG A;  3CT9 A;  2RHS B;  4YQW A;  2JEJ A;  4PKD B;  1IN0 A;  2CPF A;  2E44 A;  3KFW X;  4KIA A;  2Q1L A;  3OL7 A;  4RNN A;  3T5J A;  4RBV A;  2FJV A;  2JLG A;  1JLQ B;  1NK0 A;  4C97 A;  1Q95 G;  3MED A;  2GHW A;  2AYB A;  2DR9 A;  2QE5 A;  4B9V A;  4JV5 J;  2M5Y A;  5C42 A;  2M3D A;  1JLA A;  3TUJ C;  1TL3 A;  4LBH A;  3UI3 A;  2FJE B;  3HHD A;  3OTB A;  1RHR B;  1TKT B;  4ZCI A;  4RW9 A;  4XIU A;  2N4C A;  2DR8 A;  4X65 J;  3J81 j;  1T9V A;  3SBM A;  2M8D B;  1RAG B;  1MG7 A;  2CQ3 A;  3OR1 A;  4DPW A;  4DX7 A;  3GZ7 A;  2NRE A;  1K9M T;  1EAY C;  3MM9 A;  3NOG A;  3V6D A;  1U24 A;  4LF9 F;  2RT3 A;  2V8D A;  3MTJ A;  2QN6 B;  1PJ5 A;  3TJ8 A;  4FS1 A;  2DR5 A;  4GVL A;  2DVI A;  3CME S;  4OIX A;  5HO4 A;  4EO8 A;  5F8J A;  3L7O A;  4KT0 C;  1VIO A;  4DPO A;  4J9L A;  2NPF A;  3ZXW A;  2YXL A;  1VK3 A;  1B70 B;  3D68 A;  2HFZ A;  1RHU B;  1UCN A;  5DDR C;  1LWF A;  3D67 A;  2GML A;  3KXD A;  3N4W A;  3QGI A;  1Y00 A;  4H4K C;  5GAD U;  2NXE A;  5EHH A;  1CVJ A;  2WB1 D;  4FF4 A;  4PG6 A;  4DR3 F;  2H54 B;  2GQC A;  5IWA F;  2ACY A;  3FBF A;  4ECW A;  3W2V A;  4QYR A;  4FF2 A;  1PYT A;  1FFS B;  4FKY A;  2QMU B;  4KO0 A;  4RW4 A;  2W8L A;  4EK2 A;  2Q43 A;  1JIH A;  4QWE A;  3C66 A;  1YSJ A;  1SKS A;  4ZP7 A;  2L08 A;  2Z57 B;  2VQF J;  4WZM A;  1M1K T;  3AHP A;  3M2U B;  4LVO P;  2IYG A;  2PN6 A;  2KZM A;  1WSR A;  3CWJ A;  3NCQ A;  4DR1 J;  2XCP A;  2VKR A;  3EGW B;  1PYS B;  2GFF A;  1Y5N B;  4QJV A;  3CGI A;  2AIR B;  4LFA F;  2B6A A;  2QA2 A;  4PWU A;  2HKE A;  2AHO B;  2CNK B;  1R89 A;  4E2F B;  2DGT A;  2DXD A;  4RUB A;  1TQL A;  4U95 A;  4WK1 A;  4TN2 A;  5KG2 A;  3G6X A;  2HWI A;  3HZE A;  1TKZ B;  4P71 A;  2DIV A;  2XO6 A;  4OHV A;  1M1H A;  1TL7 B;  4DN0 A;  3MGJ A;  2XSJ B;  4O23 A;  4CO0 A;  1XR5 A;  1TL1 B;  4LF2 A;  3T5L A;  1S77 D;  2I8E A;  3H7H B;  2N7Y A;  2FTR A;  3H8Y A;  3BB5 A;  2V4Q A;  3IFE A;  3H59 A;  3EGZ A;  3U7J A;  2HSE B;  4X4P A;  3DI6 B;  2CXE A;  4W90 B;  4DL3 A;  3PTW A;  3BKU A;  3N28 A;  3PZP A;  4TY8 B;  4M5L A;  3KLE B;  5DDQ C;  3BYR A;  1SUQ B;  2LXF A;  2HZC A;  5K8N A;  1JNR B;  2YKP A;  1JKH A;  2BZ2 A;  5K20 B;  2A10 A;  3IRX B;  5AJ3 F;  2HK2 A;  1FJ7 A;  2Z2M A;  4ECU A;  1NB2 A;  3CJR A;  3PAC A;  3AB4 B;  7FDR A;  2I1R A;  2YX4 A;  4YP3 A;  3GFH A;  1L3T A;  1DHM A;  4ES2 A;  4YB6 A;  2I38 A;  3BYP A;  2NR0 A;  3NLC A;  3POT B;  5F8L A;  2BKO A;  5KT4 A;  3PR4 A;  1FK9 A;  4QQB A;  1UPM B;  4USK A;  1VDH A;  3GJQ B;  2RRN A;  4YHH J;  4A8Q A;  4B3R J;  3U27 A;  3LOU A;  5B0E A;  3GIM A;  1E6V A;  2RUS A;  1RJJ A;  3P5B P;  3TVZ A;  2F5G A;  1U1P A;  3U1M A;  1GXT A;  2MLZ A;  3AD9 C;  3M8S A;  2JWN A;  2X51 A;  4USM A;  4C0O C;  2MZR A;  3M05 A;  2MTL A;  4B3S F;  4G65 A;  2HBR B;  3MAA B;  2RF2 A;  3TWZ A;  1C1C B;  2OFG X;  1TMJ A;  2VC1 A;  2V9K A;  4Q7A A;  4YOE A;  1YWX A;  1J5O A;  4LSL B;  3C6U A;  4YB7 A;  5B08 A;  1DQ8 A;  4C48 A;  1IQZ A;  2RAQ A;  1SJR A;  3NWG A;  2OUG A;  2XBP A;  4ZPW R;  1TFW A;  2BVZ A;  2E9Z A;  1J5E J;  4A8S A;  3QRQ A;  1N8R T;  5K5M A;  1WEY A;  2QZ8 A;  4BBY A;  3NBP B;  4AD6 A;  1OIA A;  4URG A;  4LMZ A;  2QLX A;  4OV1 A;  4J9S A;  1M5V C;  1Q1K A;  1PC4 A;  2YQ1 A;  5J2P B;  1U1N A;  2AEM A;  3S8S A;  2UU9 F;  2DNL A;  2V8H A;  4QWB A;  1NK8 A;  4L74 A;  4V19 X;  3L09 A;  4JI4 F;  1NKB A;  1YI2 S;  2V50 A;  3A8J A;  9RUB A;  1LFW A;  4QIG A;  5K8P A;  1VRU B;  3OTO J;  2V4J B;  1FRH A;  2YNG A;  1T3N A;  2HFO A;  3I5B A;  3W3S A;  5ETR A;  1QLN A;  5KT2 A;  3DOK A;  1UVL A;  2W01 A;  3CCL S;  1S4F A;  3CF5 Q;  3AJ2 A;  2CQD A;  1R3N A;  3UE2 A;  2LDI A;  1RT3 A;  1UKU A;  1KC8 T;  2XLJ A;  1VR6 A;  2XZW A;  3OFF A;  3GLJ A;  2ASD A;  1VQS A;  2GJ2 A;  4ZLJ A;  4JI8 J;  1YGY A;  3PIO Q;  1S1X A;  2NPI A;  3PFE A;  4CCH A;  1LW0 B;  2XLK A;  2UUA F;  4K5S A;  1XMO J;  1SC6 A;  3CCZ A;  1WC5 A;  3ONQ A;  4G1I A;  3I56 S;  1HQE B;  4Z37 A;  1T05 B;  2BW2 A;  1D09 B;  1DAX A;  5CYQ B;  3UPF A;  4DF8 A;  4OI0 A;  4CO3 A;  4IFV A;  1BE4 A;  4GKJ F;  2V68 A;  2KM8 C;  4EO6 A;  4NCG B;  2KL8 A;  2HUR A;  3IR5 B;  3AJ1 A;  1FKP B;  2BXJ A;  4K4T A;  3W7B A;  1V6H A;  1EB0 A;  2IC3 B;  3QRP A;  1OY6 A;  4LRF A;  3J7Z 5;  1N6Q A;  5A8R A;  3UD3 P;  1IBK J;  3TAR A;  1RYS A;  2MKH A;  4ID5 A;  4AXI A;  2P5V A;  2G1D A;  2F7V A;  5HLF B;  1S0M A;  2VBY A;  2ZFH A;  2LA4 A;  2VZ9 A;  2FC9 A;  3MMB A;  1S48 A;  3H42 A;  4DX8 H;  1NSQ A;  4P73 A;  2ZD1 B;  3UCZ P;  2W9C A;  1JLC B;  3UVJ B;  4DL0 C;  1BQM A;  2HHH J;  1RWK B;  5F9L A;  4O3S A;  2GAH C;  1VQ8 S;  4F02 A;  1RHJ B;  3HVT B;  3MEG A;  4H4O A;  3RAQ A;  3IO1 A;  2WW8 A;  1YBT A;  2FVR A;  2AZ1 A;  4OYP A;  3OBI A;  2A3J A;  2Y8W A;  1O8B A;  4JI6 J;  2RDJ A;  3OL8 A;  4O4G A;  1MWY A;  3UD4 P;  2EFP A;  3MM7 A;  3PW0 A;  1GX5 A;  1YJ9 S;  2IFX A;  1C0T B;  3DGV A;  5D3G A;  4CLL A;  1VC6 A;  2ZM6 F;  1S0O A;  1FWL A;  1QY7 A;  5J2M B;  1GT8 A;  3J81 Y;  4ZVQ B;  2BRK A;  1FX4 A;  4TY9 A;  1J2V A;  5ITH A;  2ZNZ A;  3K89 A;  4RUA A;  5L9X A;  2JH3 A;  1RXO B;  1PAE X;  3MAH A;  3IBW A;  1ZH5 A;  3THV A;  4JYA F;  2IM3 A;  1RCX B;  2OPR B;  1WKL A;  4PPZ A;  3AB2 B;  3KHR A;  3J81 U;  3AA9 A;  3BH6 B;  1GNK A;  3E01 A;  3MEC A;  3ZTP A;  1T9T A;  4IDK B;  1JLF A;  2KYX A;  3KMQ A;  1KLM B;  4ZLL A;  2CJB A;  2KI2 A;  4IG0 A;  3FJ2 A;  2VPZ B;  4OV6 A;  2BOA A;  1HBO B;  4LSN A;  1NJI T;  4ZCK A;  1K73 T;  1IKW B;  1WKJ A;  3UDL A;  3THT A;  2XB2 D;  1N36 F;  1X9M A;  2MHN A;  1FKA F;  1IVZ A;  2YWH A;  4PQU B;  4ECQ A;  2R7V A;  3B54 A;  4QR0 A;  2DNZ A;  1VHI A;  3J7A 1;  3AXK A;  1CEZ A;  1IKV B;  2J0S D;  4OYO A;  3BGU A;  2VD3 A;  1CJV B;  2QG9 B;  3S7R A;  3MR6 A;  2DNP A;  3IBC B;  2HHQ A;  4MYT A;  3F41 A;  3CJ8 A;  4ZIT A;  5ETO A;  2Z2L A;  3FFI A;  3QGH A;  3CJK A;  4I6Y A;  1S76 D;  2LDY A;  4C3L A;  4HT5 A;  2CQG A;  4WZQ A;  3GB0 A;  3OD2 A;  2R7S A;  3DLH A;  4DV7 F;  4DL2 A;  1M5S A;  2HYI B;  5KFP A;  2WVD A;  3M32 B;  2YBV A;  3JS9 A;  3LP2 B;  3RRG A;  3DOL A;  3PFO A;  1VQ9 S;  2NZC A;  3MUT P;  5HBM B;  4KGX B;  5FD1 A;  2LKZ A;  3M2V A;  1ULR A;  4LFC J;  1NDP A;  1DRZ A;  3KOA A;  3HHL B;  3I87 A;  1N34 J;  2LEC A;  1XNR J;  4HI1 A;  1GEH A;  2C22 A;  3RRH A;  1AZS A;  5H9F K;  1IR1 A;  1QAJ A;  1DLO A;  3OUY B;  1I51 B;  2XI2 A;  3HD1 A;  2C2K B;  1AB8 A;  1NSA A;  2F63 A;  2PI5 A;  4F4Y A;  2RML A;  5K14 A;  4ZPA A;  2P2C B;  3VAF A;  3HJF A;  2X1F A;  1XNQ F;  2ATC B;  2O3D A;  4DV5 J;  2I5J A;  3M2R B;  1YBA A;  2A6O A;  3RB0 A;  3MPU B;  2MB0 B;  1FDN A;  3I4P A;  3Q22 A;  3G96 A;  5J2Q A;  2VJU A;  3PJX A;  4JI1 J;  2IM1 A;  1WOR A;  4EZ6 A;  4ECV A;  2FJB B;  3PHE A;  1FRI A;  3SDE B;  5MAO A;  4JV2 A;  3ETM A;  1OYD A;  2KTQ A;  4LF5 J;  3HD2 A;  2Q6C A;  1IM6 A;  1OSD A;  1NLK L;  3WQP A;  1ICE B;  1IJE B;  3SZ2 A;  3RR8 A;  3OFG A;  1U48 A;  2XUL A;  3GYX B;  4JI5 J;  3DXS X;  4YB1 P;  3HKW A;  1C4C A;  2VFS A;  4ZPC A;  2UUC J;  4KKO B;  2JC0 A;  1KNZ A;  3IWX A;  1FKO A;  3I55 S;  3VAK A;  4MFB A;  1SC1 B;  2FUG 9;  2H5J B;  1WKK A;  5DM6 Q;  2VIH A;  3MOJ B;  2F3J A;  3H5X A;  1RQ0 A;  3CJ3 A;  2CPE A;  1SKU B;  2P9C A;  5IM0 B;  3Q2S C;  2FVQ A;  4L76 A;  1AW0 A;  3DLE B;  4QU6 A;  1KVK A;  4USI A;  1B7F A;  1DTT B;  1VGY A;  3M8Z A;  1X4B A;  1Y0H A;  1U1M A;  3RAM A;  5IXU A;  1LW2 B;  3MMA B;  1LXN A;  2CPH A;  1GAO A;  2MZ1 A;  3H20 A;  1H73 A;  4GKK F;  3K5L A;  2COL A;  4NL5 A;  2CIM A;  3EXC X;  1H74 A;  1LV5 A;  2G0C A;  5A6W A;  4F25 A;  3RB4 A;  4JB8 B;  4CRJ A;  4D3H A;  2C3U A;  1HHS A;  2XHW A;  3M30 A;  4YDD B;  1WG4 A;  4B3M J;  4TYB A;  1V3R A;  2A0F B;  3L3C A;  4OJ3 A;  3PW7 A;  4RO0 A;  3I0S B;  3T1A A;  4I2P B;  3EM1 A;  2ZIT A;  2HRY A;  4RR5 A;  4NZ6 A;  2JJ4 D;  2O66 A;  2MZJ A;  2DB1 A;  3SQG B;  3V2U C;  2HZA A;  2MQ8 A;  4LF4 F;  2BM0 A;  5HMZ A;  2BAN B;  1UW9 A;  4YFU A;  3ILO A;  3Q23 A;  3LF0 A;  5KAK A;  3FBE A;  3KUE A;  3OJU A;  2CJY B;  1X5O A;  3HHL D;  3OFE A;  4DSJ A;  1UL3 A;  3BSA A;  3QNW B;  1VQ7 S;  2A6M A;  2HLT A;  1UET A;  1S7H A;  2AMC B;  4HEA 9;  4ZPV R;  4KH0 B;  1S6U A;  1A7G E;  3NCP A;  3AFG A;  5C7P A;  4GRS A;  3RG6 A;  4C7Q A;  1NPK A;  2DO0 A;  2CPJ A;  3GMG A;  3I4H X;  2ZH8 A;  4C11 B;  3QID A;  2E1P A;  3KJF B;  2GX8 A;  2E9T A;  3MM5 B;  1Q4R A;  5ETL A;  3OLB A;  1NUE A;  5LXY A;  1C0U B;  2ZH7 A;  3H5Y A;  5C24 B;  3L9Z A;  1BWV A;  1EQM A;  2EKY A;  3FRY A;  4A8O A;  2Q66 A;  3MOZ A;  1V5I B;  3T1Y J;  5LMU F;  4HAC B;  4CNY A;  2RRB A;  5M2U A;  4M5D A;  3M8W A;  1HQU A;  1HNI B;  1S49 A;  2XYP B;  1JB0 C;  4OYW A;  4YS2 A;  4PG4 A;  5D4L A;  3HFK A;  2LQB A;  3OHB A;  2R7U A;  2R8I A;  2EFQ A;  5E2Q A;  5HI7 A;  3EX7 B;  1FFG B;  3AXM A;  3DLB A;  2PDA A;  1HNZ J;  2W4P A;  1HNV A;  3EXY A;  1FTC A;  3EVW A;  5KFK A;  1NK7 A;  2VOO A;  1LK7 A;  3JSY A;  3AQO A;  2BX6 A;  3S01 A;  3FBB A;  2DNM A;  4QIV A;  3MPW A;  4ED0 A;  3R5C A;  4LT6 A;  1P27 B;  2KVQ E;  3E8O A;  4PYA A;  3Q8Q B;  1UEK A;  1OY8 A;  3UN5 A;  1OWX A;  1Q8I A;  1APS A;  2HZV A;  2LFV A;  3PHT A;  3QO9 B;  1N88 A;  3DLG B;  1K44 A;  2F4V F;  3D0I E;  4G6V B;  4ECX A;  3M8P A;  3NXZ A;  3H5S A;  4B08 A;  5HMW A;  2OPP A;  4ERD A;  3NNH A;  2VC0 A;  3HI9 A;  3PW5 A;  1KWM A;  3V5R A;  1HYS A;  3KK3 A;  4XDC A;  1S72 S;  2K7K A;  3C15 A;  5KT6 A;  3KLF B;  1R7I A;  4OYB A;  2HVH A;  1RWM B;  3OPK A;  3LWL A;  3TAN A;  3QSY B;  3KG1 A;  2GGP A;  2XNR A;  4C8K A;  1X4D A;  2K1R A;  2BYC A;  2V2V A;  2HVD A;  1WOO A;  4Z7Y A;  3LP0 A;  2FLL A;  2RU3 A;  1NPR A;  2CJ9 A;  1SJ3 P;  4N8O A;  1HNX F;  4IOA Q;  3KHH A;  3B78 A;  4DV6 J;  3DDN A;  4MK9 A;  3CJS A;  2VA3 A;  3VGU A;  1U25 A;  3TQE A;  3Q2T C;  3GON A;  2X1G A;  1GH8 A;  5GAH U;  2FLO A;  1HBN B;  1B0V A;  3NGR A;  2HWH A;  4C8M A;  2HRT A;  2ZH3 A;  3DRP B;  1EJ7 L;  4KV8 B;  3TQ1 A;  2K3K A;  1DZ5 A;  3FC9 A;  1LEO A;  2ZC4 A;  3WDO A;  4KBI A;  2HBY B;  5FDL B;  2VQE J;  2BAC A;  2P8I A;  4O44 A;  5BR8 F;  3L95 X;  2CAJ A;  5KFC A;  3DLJ A;  5DS7 A;  2R2T A;  4K0K J;  4XK8 C;  2J0Q D;  2W2N P;  5DQH A;  3NGD A;  5G0R A;  2R2R A;  3TRG A;  4HR2 A;  1Q5V A;  2CQP A;  1RWW B;  2X3D A;  5J1N A;  4RU9 A;  5L1L A;  3MM8 B;  3ENA A;  2G0J A;  2LMI A;  5DZ7 A;  4DV1 J;  3TNV A;  4G1Q B;  2W8K A;  3ZZZ A;  1FJG J;  2CWK A;  5LSR A;  3AT1 B;  4N8N A;  3W9I A;  1NZA A;  4JI3 F;  2YNF A;  3CMQ A;  4OHY A;  2F8M A;  5BJR A;  5IV4 A;  1TUG B;  4RW7 A;  2G0I A;  1G7C B;  4OZJ A;  1MWQ A;  4F4A A;  2GVD A;  1ZS6 A;  4DU8 A;  1TK8 A;  2HFN A;  2AGQ A;  2LXI A;  3OT9 A;  2QLW A;  1S9G B;  3Q8P B;  2VG7 B;  3EPG A;  2H48 B;  3GIR A;  1QJH A;  2HGL A;  1A9N B;  5KFD A;  3K58 A;  5C5J A;  4Q5V A;  3JQJ A;  4B9M A;  4DUZ F;  2LQ9 A;  4CLZ A;  1KN6 A;  1KHV A;  4IQM A;  2ZOF A;  5CD4 A;  4WYL A;  1BY9 A;  2J7W A;  4I1T A;  5T41 A;  1RKI A;  2HQD A;  3J7A N;  3DLK B;  2DH9 A;  3ISN D;  4PUO A;  4FYY B;  5A8W A;  2OHD A;  4TU7 A;  4O3N A;  2V2Z A;  5KFI A;  2EPI A;  2HQG A;  4AE5 A;  3KLI A;  4B3O A;  3HT3 A;  4URQ U;  3DMJ A;  2Z56 B;  3M8Q A;  2RE1 A;  2J8A A;  3ZTR A;  3NOC A;  2HHX A;  5SUH A;  1YQH A;  2XMK A;  3LP1 A;  3P3D A;  5E5N A;  5B09 A;  4NXM F;  1H7W A;  3GPA A;  3I5A A;  1IM4 A;  4PPD A;  5DET A;  5GAE I;  4KGK A;  2MKJ A;  3TZY A;  1N33 F;  3OTD A;  3A3O B;  5THW A;  2R42 A;  1CUL B;  3A8K A;  1CQN A;  3QYY A;  3DRR B;  1PJ6 A;  3PX0 A;  4J9O A;  2HHT A;  2CPI A;  1HHT P;  2UXB F;  2J6S A;  4OHZ A;  2KFY A;  2E1C A;  3NGK A;  4A8M P;  1YJT A;  1CQM A;  5D15 A;  4X4V A;  1AT1 B;  4Q45 A;  3KHG A;  4Q8F A;  1FRK A;  3I31 A;  2OD4 A;  5B0D A;  1ZA2 B;  4BLG A;  1JLE A;  4DR6 J;  1CJT A;  4RNM A;  4WFX A;  5HRO B;  4PXB A;  4Y65 A;  5DZ6 A;  5EWG A;  1I3O B;  2CZV C;  2CFX A;  1WHW A;  4ZPT R;  4ZOS A;  1RTD A;  4L6V 3;  1U1Q A;  1RTH A;  1XK8 A;  1RAB B;  3O3L A;  1VRT A;  5IC6 B;  4EYH B;  2FHO B;  3W2W B;  1V3Z A;  4M94 A;  2QL5 B;  2BE2 A;  3BO2 A;  3T41 A;  1N4L A;  3BGO P;  1NEE A;  2EBG A;  1TZ0 A;  3MEE B;  3NS5 A;  2W7P A;  1N0V C;  4OI2 A;  5CH7 B;  3JSR A;  1GTH A;  4F4W A;  3GU0 A;  1XJW B;  3R8Y A;  3O6Q A;  4X64 J;  2CVE A;  3C16 B;  1AFJ A;  4Z7C A;  1F9F A;  2Y8Y A;  5IT0 A;  4NLP A;  1O0P A;  5KFT A;  1LK5 A;  1MSW D;  3HHL C;  4WFZ A;  5CCM A;  1NK5 A;  4FZV A;  4JI7 F;  2KU7 A;  3QZ8 A;  2OJ3 A;  1S79 A;  2HBQ B;  4CI0 B;  1TV6 A;  4HHJ A;  3SQO P;  4C0B A;  3JAM Y;  2IM0 A;  3FKB A;  4AQY F;  4K4W A;  1HWK A;  3SV4 A;  2X1B A;  1TVR A;  3N6L A;  1GMU A;  4BC7 A;  4CH0 S;  2PSZ A;  2RSQ A;  3MED B;  3TJA A;  1HBM A;  2DIS A;  2KG1 A;  4ED3 A;  3RW7 A;  1NSK L;  1Q79 A;  3NAI A;  4HLB A;  3MM6 A;  4UZB A;  5C42 B;  2OPQ A;  4I2Q A;  2H9Z A;  2EW9 A;  5ETP A;  1JLA B;  2CPY A;  1Z2L A;  1TL3 B;  1ZM4 A;  3JAM U;  5KFF A;  4RW9 B;  1OS5 A;  5I3P A;  1WOP A;  2VH7 A;  2HVZ A;  3OR1 B;  1KOO A;  2FJW A;  2CNL B;  4J91 A;  5AT1 B;  3SEO A;  2W4D A;  3QFW A;  3UW1 A;  4UY8 5;  5F0U A;  3V6D B;  1SC3 B;  2CRL A;  5LM7 E;  2FD2 A;  5IZH A;  1OY9 A;  5IT9 Y;  3NGT A;  4QYZ J;  1B64 A;  3L7P A;  2HND A;  3CCV S;  1FA0 A;  3IM8 A;  1W26 A;  2IHR 1;  1KD1 T;  4ILR A;  4X62 J;  3QT5 A;  1NAQ A;  4ES3 A;  4TXS A;  1WDD A;  2FJX A;  4UTG A;  3QSI A;  4I64 A;  3QAT A;  2V0N A;  3QIP A;  4DR2 J;  5KG1 A;  3PKY A;  3P4U B;  4ZA1 A;  3H90 A;  5GMD A;  3DRS A;  1MN7 A;  1WG1 A;  4U9R A;  1FI4 A;  4U7U K;  2ZOM A;  3NKY A;  2NQP A;  1LWF B;  2PD1 A;  5IT9 U;  3SCK E;  1ZAW A;  3EZ5 A;  3UR0 A;  4WCE Q;  1RGV A;  5ETK A;  1CJU A;  2DH8 A;  3GIL A;  3HX9 A;  1RDR A;  2YPY A;  3KLH B;  3M9N B;  1SXL A;  1P6T A;  2AJ0 A;  2VBX A;  4KR0 B;  2XGP A;  3TZX A;  3CSK A;  1REV A;  3GE9 A;  4PZV A;  4RW4 B;  4KO0 B;  4ILL A;  5D0G A;  5I42 A;  4B9U A;  1K1S A;  3V6H A;  1YJN S;  4ZCM A;  2ZZT A;  4ZN1 A;  1RWP B;  1ZM3 A;  2HIQ A;  2AJ1 A;  2FQQ B;  3CD0 A;  3QAU A;  5D6G A;  1WHV A;  4DUT A;  5HAN A;  1F2H A;  3A13 A;  1FO1 A;  2ACM A;  3ENQ A;  2WSF C;  3SXL A;  3SIP B;  4CIO A;  2B7B B;  2W7A A;  3R1H A;  4MH8 A;  2KJW A;  2VBZ A;  2XS2 A;  4CLT A;  2V63 A;  2B6A B;  4DV4 J;  3IR7 B;  4MYU A;  2R7W A;  4DR4 F;  2DIT A;  1NZ8 A;  4DV3 F;  1RT1 A;  4DZ6 A;  2IDL A;  2OP5 A;  2BJ8 A;  3GIK A;  3GCW P;  8AT1 B;  1HL6 A;  5C2C A;  1R0A A;  2ALY B;  4P75 A;  4MK7 A;  3SFU A;  2BV3 A;  5A8K A;  4ED6 A;  4F4Z A;  4Y6I A;  3Q8S B;  4M5K A;  4ETZ A;  4Q44 A;  4JUZ A;  2VG5 A;  1R6Y A;  2GW8 A;  3V4M A;  3VQS A;  1ZYQ A;  1JJ4 A;  3BSO A;  4DG1 B;  5E3C A;  3D28 A;  1F6T A;  4B9N A;  3BRE A;  3ZTS A;  3NNA A;  1HIY A;  4TQR A;  3F0N A;  4X4R A;  3L7U A;  4C2M A;  4R25 A;  3KJV A;  2FHK A;  1HPZ A;  4CT9 A;  2L3M A;  1RWX B;  2HGN A;  2VOP A;  2XEX A;  2GHP A;  4KHR A;  3RR7 A;  2DNK A;  2H1Y A;  3ULH A;  5DJB A;  5DQG A;  4ICL A;  1RIS A;  2H5E A;  2QSW A;  1VI7 A;  1WNE A;  3NG8 A;  4LRB A;  4JBC A;  3MMJ A;  1RA6 A;  1RU2 A;  1RT6 A;  1BHN A;  4FVM A;  2CVI A;  4ZVH A;  2JZ5 A;  3WHI A;  6AT1 B;  4UQG A;  2XMT A;  2PI4 A;  2F4V J;  2CAD A;  3ENV A;  1CLF A;  3VGV A;  1BXN A;  2CQC A;  4P9S A;  1FK9 B;  1MU2 A;  4NLR A;  3R5D A;  2ZH5 A;  2QLF B;  4DPY A;  4OI1 A;  3B6B A;  1E6V B;  4ECZ A;  2R7R A;  2EFG A;  1K1Q A;  3TJ9 A;  3FSI A;  2XO7 A;  1U45 A;  4IR1 A;  3MMC A;  3Q89 A;  4KQZ A;  4DFK A;  2JEG A;  1ELO A;  2WK4 A;  4WFN Q;  2XS5 A;  2CQ2 A;  2XGQ A;  4DV2 F;  4TVA B;  1ZTT A;  4Q2L A;  4UUW A;  3M9M B;  3HSD A;  4C8O A;  2RF2 B;  3U02 A;  2PEH A;  5L38 A;  1U6F A;  2AF6 A;  5JVG Q;  3Q83 A;  4ZHR A;  1YLX A;  2ZHA A;  2IAJ A;  2UVW A;  5F3Z A;  1J5O B;  3TR5 A;  2BAB A;  3C6U B;  5LOQ A;  1DQA A;  4J9U E;  3S1T A;  4ENO A;  2C2E A;  2W24 A;  3R6G B;  5IS2 A;  3JTN A;  4R0J A;  1Q81 T;  4EUV A;  3VGS A;  3OV7 A;  1PBU A;  4A4J A;  3AY0 A;  1O51 A;  3QJP A;  2ZH4 A;  2QL9 B;  2EKN A;  3QT7 A;  3R7B B;  2Y1L B;  1JLB A;  3PW2 A;  2RQM A;  3D0G E;  3V4I B;  1J27 A;  1ZAX A;  4NMX A;  1RBA A;  2HIY A;  1FJE B;  1MRO B;  4OYZ A;  4CM0 A;  2RQC A;  3CUN A;  3VZI A;  2RRA A;  1VQL S;  4ZP6 A;  1QM9 A;  4ETX A;  5RUB A;  4Q2M A;  2D9P A;  5AXN A;  4J9M A;  2YNG B;  3BBF A;  2NXJ A;  2Q3P A;  3BV8 A;  2L9N A;  2DPI A;  4F50 A;  3MTK A;  4WIQ A;  3DOK B;  2Z8Q A;  3FNN A;  4YEA A;  2EK6 A;  4AXJ A;  2KZZ A;  2J6U A;  1FNO A;  1S1W B;  1RT3 B;  4KRW A;  4TLQ A;  1I94 F;  2BKP A;  4LF8 J;  1FXL A;  1S1X B;  1TL7 A;  4DR7 J;  5L8R C;  3I9V 9;  2HFU A;  2GS8 A;  3K8W A;  1RTJ B;  2CQ0 A;  2HK3 A;  1UA0 A;  1KLN A;  2MY8 A;  2BMB A;  1B7Y B;  2DRB A;  1UFL A;  3HHK A;  3DI6 A;  4IFV B;  3EPI A;  3O5T B;  4ZVE A;  3PYE A;  4YN3 B;  1SUQ A;  2MQP A;  4DR5 F;  1UMJ A;  2BA9 A;  2BJ9 A;  1GX6 A;  1P9Q C;  3HVA A;  1N6Q B;  5HAO A;  5A8R B;  3JSB A;  3CJ4 A;  3VR1 A;  4CO1 A;  1BQN A;  1HWJ A;  5LSL A;  4ID5 B;  3DN9 A;  4YR0 A;  3TA2 A;  4DS4 A;  5T14 A;  2KB2 A;  1Q8L A;  2W9C B;  4DMZ A;  3CPW R;  4RX6 A;  1VIX A;  6FDR A;  1BQM B;  1Q53 A;  3FMW A;  1VBK A;  3G8S A;  2RB7 A;  1RCO B;  3POT A;  2ATL A;  4LF6 J;  3MEG B;  4H4O B;  1MMN A;  2KVI A;  3ZZT A;  5KFQ A;  3QGG A;  2J76 E;  2ASY A;  5F8H A;  2HVE A;  1WTB A;  3UN3 A;  1RHM B;  1NU4 A;  2V8G A;  3AD7 C;  1F3V A;  2R3V A;  4P7V A;  2YQ3 A;  3RBZ A;  4O4G B;  2AP6 A;  3W5Z A;  2HNY A;  3MM7 B;  5KT7 A;  5H9E J;  2ZWP A;  2F40 A;  3Q0A A;  5D3G B;  4CYU B;  3QAE A;  3UFC X;  2C2Z B;  1N56 A;  3CCQ S;  1X4A A;  2LU2 A;  3G6E S;  4DUY F;  2C42 A;  3MAA A;  4C4W A;  5F8I A;  3W8P A;  1HAR A;  3SMZ A;  1T11 A;  1D8Z A;  4B3T F;  3QGP A;  1SJF A;  2Z2Y B;  3H25 A;  2VPY B;  2IJF A;  4MKB A;  3KK1 A;  1DFD A;  2VHG A;  4BCA A;  2G2Y A;  1H2U X;  2GA7 A;  2IRY A;  2UXC J;  2MHE A;  4CLS A;  1JXE A;  3LAN A;  5HSP A;  3R6L B;  3CDW A;  1JLF B;  5J1E A;  3RAX A;  1REG X;  3S6E A;  5CCL A;  2DGX A;  1IBL J;  3CDB A;  4IG0 B;  5KFU A;  2C28 A;  1JXV A;  3CDA A;  3DHX A;  1U8S A;  2AX1 A;  1U2R A;  1T9W A;  4LSN B;  1U7L A;  5J2P A;  2OKQ A;  4H4M A;  3DDI A;  2AYG A;  2E5L F;  2B5J A;  1W2I A;  3TX8 A;  3OL6 A;  1S9F A;  1KQF B;  4O4R A;  5L1I A;  4DLG A;  4ED1 A;  2RIJ A;  1W2B R;  5HP1 A;  1GMW A;  2ZJP Q;  4CO2 A;  2VIC A;  4DL6 A;  3Q24 A;  3A4T A;  3BJY A;  4AL5 A;  3FVY A;  3U1N A;  3BO3 A;  3T1H J;  4AT1 B;  5C25 A;  3KJN B;  4WBF A;  2ZEJ A;  2B8Q A;  4DSI A;  1B0P A;  4CO5 A;  5D8H B;  1WUU A;  4C8N A;  2K8G A;  3RB6 A;  4B9T A;  3CJK B;  3IRW P;  2VG6 A;  4J5O A;  2V9W A;  2MKY A;  4RW8 A;  1S0N A;  4O3P A;  1H3D A;  3OVA A;  1ZA1 B;  1X5P A;  3MPD A;  4A8Y A;  3DOL B;  3P49 B;  4DL5 A;  1IBM F;  3D0H E;  3CJT A;  5HMY A;  3W62 A;  1LW0 A;  4ZLN A;  3M6X A;  4NLD A;  2F8E X;  1D8Y A;  3CE8 A;  3TAQ A;  2B9E A;  5CYQ A;  4DQR A;  1S97 A;  9ATC B;  2EG2 A;  1NCL A;  5J1P A;  2QYG A;  3E2E A;  1RAC B;  2W1B A;  4NLO A;  4KY3 A;  1AZS B;  3CD6 S;  4JI0 F;  4WK3 A;  1DY3 A;  5KOW A;  2OTJ S;  2HAF A;  1DLO B;  2K06 A;  3LW5 C;  2AJ2 A;  2UUW A;  5I4M A;  2QGF B;  1S6Q A;  1IKY A;  2I9S A;  3EGN A;  4Y3C A;  4EU0 A;  4ZJL A;  5K14 B;  4CLU A;  2XWY A;  4F3O A;  2MEW A;  2LEB A;  4PXD A;  5LMN F;  5HJY A;  2I5J B;  2UUB J;  4J9V A;  2OPS A;  1JLC A;  1HI8 A;  2MY7 A;  5J2Q B;  1FDA A;  3RBX A;  1H2V Z;  1X9S A;  1TAU A;  5I3Q A;  3UCU P;  4EGL A;  3GSI A;  3RB3 A;  2C3Y A;  2D9O A;  1U1R A;  1T9Y A;  3W65 A;  2BRL A;  3ZZY A;  4RNO A;  2AQ4 A;  1DTQ A;  3OTC A;  4OI6 A;  2PMH A;  2H51 B;  1UWB A;  3J7Z T;  2AKW B;  1L3V A;  2ZVI A;  1WTF A;  2D3O R;  2YKA A;  1FKO B;  2XMM A;  2G4B A;  1KP6 A;  4XO0 A;  4MFB B;  1FRJ A;  1S1V A;  4FPI A;  2DR6 A;  2GAG C;  1SV5 A;  2DNN A;  1KSP A;  1PAU B;  4DWI A;  1CG2 A;  2ASJ A;  4Y2K A;  1IKX A;  5KFW A;  2LQJ A;  3N9U C;  4RUH A;  1WC4 A;  3SSQ A;  3CCJ S;  4DS5 A;  3D3C J;  1Q8B A;  1H38 A;  4USU A;  4J90 A;  4C6A A;  5SZT A;  2MKS A;  2UZA A;  3FZB A;  1HNW F;  5KG6 A;  3KYL A;  4AFF A;  2EK1 A;  3K17 A;  1WEZ A;  3R7N B;  5AE3 A;  1N48 A;  5KFS A;  3HF5 A;  2ZKT A;  1KLM A;  1HWU A;  4CH7 A;  5EX3 A;  1EZZ B;  2KRB A;  4ZVG A;  3EGV A;  2CJX B;  2D1C A;  4LF7 F;  4QW8 A;  3M30 B;  3WIV A;  4HH0 A;  4ZVU B;  1ZZN A;  1F5C A;  2DGO A;  1OSC A;  2V67 A;  1IBC B;  2JEI A;  3GJT B;  2I2Y A;  4W4M A;  3LGM A;  4C3K A;  3N6M A;  4LIW A;  4OJG A;  2PFD A;  2ZZM A;  4FF3 A;  4DSF A;  4USJ C;  3TEG A;  5E33 A;  2JRS A;  5HJX A;  2W9B A;  2HVI A;  1T7P A;  5KG4 A;  4RL1 A;  3G87 A;  1A0O B;  4X4N A;  1VQ4 S;  1NJZ A;  1UAW A;  2XC9 A;  5JUM A;  2ZNY A;  2OEJ A;  4CM2 A;  2WRM A;  4NXN F;  2PE8 A;  4WP3 A;  2WB4 A;  1WI8 A;  3LP2 A;  2OEK A;  2YX7 A;  3BBC A;  1NKC A;  4ED8 A;  4NRU A;  4I68 A;  2VAS A;  2P9E A;  1R0B G;  1YK9 A;  3C19 A;  5DDP C;  4I7F A;  4N7T A;  2B9Y A;  1RAO A;  4DFP A;  3R5B A;  5U47 A;  1FWK A;  4OJH A;  2DNY A;  1NKE A;  3G6V A;  5MLC V;  4LUB A;  2RHQ B;  4KAI A;  4X66 J;  1VQO S;  1HWL A;  2E9R X;  4NLV A;  1Y4Z B;  4ZKA A;  5DM7 Q;  4DV0 F;  2YNI A;  5CYJ A;  3D1H A;  3IGV A;  3ILL A;  3NWR A;  2E7X A;  4ALZ A;  2HFV A;  1FWP A;  2HHP A;  3OUY A;  2VDH A;  1L3S A;  2FB0 A;  4WKR A;  1NHU A;  3HCX A;  4P72 A;  1QUP A;  2R7T A;  3EUN A;  2J9D E;  2J9E A;  3A12 A;  3FSY A;  4AYB D;  2DKO B;  1CC7 A;  3WC0 A;  2G13 A;  1NPP A;  3C3L A;  3OVB A;  3G6Y A;  3D4J A;  2YNH A;  8RUC A;  2R9L A;  4N47 A;  4J9Q A;  4M5D B;  3IXQ A;  4LFB F;  4CQ1 A;  2LEA A;  1LOU A;  4M5N A;  5GMK a;  1CS4 A;  1W7W A;  2OEL A;  1S1U A;  2KFZ A;  5HQM A;  1UJ5 A;  3SDE A;  3K5P A;  4FYX B;  2QX0 A;  1U2F A;  1NME B;  1UZD A;  3GYN A;  4CZC A;  3BR9 A;  1CSJ A;  2CYY A;  4KHP F;  2Y0B B;  2L41 A;  2QSF A;  3BN4 A;  3US5 A;  1U6B A;  3IG1 A;  1G4C A;  3OR2 A;  2ILZ A;  3KLG A;  2EVZ A;  2DPJ A;  1RAF B;  2DNQ A;  1RWU A;  4DCP B;  3E51 A;  4DX6 A;  4KKO A;  2W25 A;  3SCL E;  4K4U A;  1C2P A;  3PDN A;  1HBU A;  2AGO A;  1UEV A;  4NLT A;  2L48 A;  4HHU A;  1HA1 A;  3MPV A;  3M8P B;  2DGV A;  4LSZ B;  4DSL A;  3GSD A;  2ASL A;  4JV5 F;  3MHY A;  2GVZ A;  2VJV A;  2CQH A;  1L3K A;  2EC0 A;  3KHL A;  4ZJQ A;  3FQK A;  4QW9 A;  4X65 F;  3KK3 B;  1XMQ J;  4G3I A;  3CED A;  1RZM A;  2CUY A;  3I82 A;  4NLS A;  1KS2 A;  3WX8 A;  4NLY A;  4IOB A;  2MJN A;  5IQ6 A;  1N32 J;  2F65 A;  5D0H A;  1RT2 B;  1JJC B;  1M5K C;  1PSD A;  2K1R B;  5KT5 A;  3D54 A;  1FDD A;  3BO4 A;  2F9D A;  1SL0 A;  2OIH A;  1K47 A;  4ANE A;  1RBO B;  3CC2 S;  3PEJ A;  4DFM A;  1S6O A;  4QPT A;  3SV3 A;  5CXT A;  3CO9 A;  1RTZ A;  4J37 A;  1NM2 A;  4NI2 A;  2Y1I A;  3QZ7 A;  2V69 A;  1FT8 A;  2H4Y B;  2ADB A;  1VQ6 S;  3RYL A;  2N7C A;  4C8Z A;  3G82 A;  2C2M B;  1B4S A;  3M6U A;  2RJZ A;  1QTN B;  2UVV A;  3BR8 A;  1DAR A;  2FC8 A;  3CDE A;  2ZBR A;  2JEF A;  3QMQ A;  4O44 B;  2E1R A;  5KG5 A;  2LXU A;  2EEY A;  3MI7 X;  2VQF F;  5G0R B;  4DLE A;  4IH6 A;  5B0G A;  1MWZ A;  2BJ7 A;  4DR1 F;  4WP9 A;  2KYZ A;  2QMW A;  2V2Q A;  3GR0 A;  3EJM A;  1DJ0 A;  2ZC3 A;  2YKM A;  1MW7 A;  1GK8 A;  4X4U A;  1YIJ S;  4UF4 A;  2XY5 A;  2PA3 A;  3BEG B;  3BPD A;  3GFX A;  5DLF A;  2YNF B;  3B8H A;  2CZ9 A;  5G4D A;  4XPC A;  1YZ6 A;  4RW7 B;  1TKX B;  4PAB A;  3LAL A;  1LWX A;  4LBP A;  2A18 A;  4FNI A;  1YIT S;  2GVD B;  2BDP A;  3R27 A;  1HR0 J;  4ANC A;  1X31 C;  4HAC A;  4Y2C A;  3K57 A;  4IRD A;  3EDQ B;  2ZBP A;  4BWJ A;  2KT5 A;  2W2Q P;  4CLF A;  1I6J A;  2OGU A;  3DOM A;  3ENW A;  2I6W A;  4RWW A;  1FJC A;  4WFA Q;  1FCA A;  7FD1 A;  3O8W A;  1KFD A;  2FGC A;  1D9D A;  2QJ3 A;  2Z0G A;  1X5T A;  1MMD A;  3W63 A;  5BXI A;  5M2R A;  2JDJ A;  2QT7 A;  5A8W B;  1VOM A;  4RPF A;  2E5H A;  1YG0 A;  4YY3 J;  2CPD A;  5EGY A;  4XAK A;  3DC2 A;  2HHV A;  4QBU A;  2FLN A;  3FEX B;  4B3O B;  3DMJ B;  5HVH A;  1SIZ A;  1LFP A;  2GQQ A;  2K7J A;  1S9E A;  3M8Q B;  3LPE A;  4TYA A;  3Q86 A;  2PO4 A;  3TAP A;  4QIE A;  3LP1 B;  3VWS A;  2UXD J;  3K2Y A;  1WF1 A;  3J80 Y;  8ATC B;  3ZC4 A;  2DBB A;  4U8V A;  3M8R A;  5CYM A;  1SVD A;  2IVM A;  3IWN C;  1YRU A;  1F0X A;  5B0F A;  3F73 A;  2A2D A;  2A1B A;  4P74 A;  4YHH F;  1XQI A;  1EQ0 A;  4WU3 A;  4B3R F;  3AOB A;  3EDR B;  2VV5 A;  2KO1 A;  4PQA A;  2EG1 A;  1FVQ A;  1G1X A;  2DGU A;  4KTQ A;  2WSE C;  2C2O B;  3J80 U;  4K2J A;  1IWG A;  1P1L A;  1RWN B;  3W5Y A;  4JI2 J;  4CNZ A;  1UJ6 A;  2FY1 A;  2W4C A;  2IDE A;  4F0H A;  1NDK A;  4RNF A;  2M52 A;  2MKC A;  4K50 A;  5H9F J;  1S4E A;  1CJT B;  2HPU A;  5GME A;  5ETM A;  4D3G A;  5T7L A;  4M5H A;  2OSQ A;  3I6P A;  4WYW A;  1X4C A;  2CQ4 A;  1RTD B;  3EMT A;  1RTH B;  5B0A A;  5CAA A;  1VRT B;  2DH7 A;  2P6T A;  4TU9 A;  2B51 A;  3GV5 B;  1JWW A;  2FHJ D;  4F0K A;  2FHM A;  2CDR B;  4K59 A;  1J5E F;  4OX6 A;  3H4B A;  3FSX A;  1EP4 A;  3AOD A;  4YR3 A;  2M88 A;  3KJQ B;  4DPX A;  4JV0 A;  4Z2X A;  2ILY A;  2NYI A;  3PRV A;  1T03 A;  2XY6 A;  4AND A;  2GC8 A;  2HNZ B;  1F5A A;  2G2Z A;  2J0W A;  4DL7 A;  4E8U A;  4OLO A;  4OHW A;  3ZNU A;  2CQB A;  2HHS A;  2DJW A;  4OX9 J;  1TV6 B;  4WTY A;  3K0J A;  3CC4 S;  3OTO F;  1QSY A;  4CTA A;  3GG0 A;  2ZH1 A;  1N5Y A;  1RBL A;  1N0U A;  2RQK A;  2MSS A;  1TVR B;  2KT2 A;  4PWD A;  2BQ3 A;  1SKR A;  2J6T A;  1S1T A;  3TVK A;  2QEX S;  5J2N A;  1WJ9 A;  2BOP A;  2F9J A;  4MT1 A;  3N5B A;  2WON A;  1HBM B;  2B0G A;  1E6Y A;  2U1A A;  1TFY A;  1F2G A;  5I3U A;  4JI8 F;  5D0E A;  3I0R B;  2B43 A;  2OPQ B;  3ITH B;  1YZ7 A;  3ZTQ A;  5E3P A;  3BH7 B;  2RS8 A;  1VQ5 S;  4RW6 A;  4F04 B;  1XMO F;  3FQL A;  1W25 A;  1RWV B;  4P6Q A;  5JVH Q;  2HGM A;  5GAE U;  3GYG A;  2R4F A;  5L39 A;  2YPZ A;  5L1J A;  3AOC A;  2E29 A;  3MCO A;  3EE3 A;  3M1V A;  4DQS A;  2HND B;  1URN A;  2V6A A;  4LF9 J;  5DQI A;  1SH2 A;  2R8G A;  4YR2 A;  2ZVS A;  3DLK A;  2HQF A;  3J7Y I;  4LIR A;  2J8S A;  3QIP B;  1YJV A;  1H6K X;  2IRX A;  5CQG A;  3D2W A;  2M70 A;  4BHQ A;  1RT7 B;  1IBK F;  3DRS B;  3GII A;  1VHF A;  4IO1 A;  5KFA A;  4M95 A;  1FEH A;  1JNZ B;  3UN2 A;  3BN7 A;  4TLR A;  1CJU B;  1Y7P A;  3RJM B;  4KGV B;  1OJ4 A;  3BPS P;  1N5Q A;  2O5D A;  4K4S A;  4RUC A;  2HHH F;  2CNO B;  4DR3 J;  2DNR A;  3JXO A;  3FUY A;  5IWA J;  2LQ5 A;  3TUI C;  4Q0B A;  4RZR A;  4ITS A;  4OZ0 A;  4O0I A;  1XEZ A;  1U0H A;  4JI6 F;  3MWB A;  2DEI A;  2KFN A;  4MKY A;  4U6P A;  4HDH A;  4FP9 A;  3IBF B;  2DHX A;  3D7S B;  3CTR A;  4C3M A;  3A3N B;  3W60 A;  1JJH A;  1TP7 A;  3OJS A;  4MIB A;  5EDW A;  1EET B;  2YKN A;  2VON A;  1LQ9 A;  1KTV A;  3V81 A;  3VF0 B;  2HHU A;  1FRM A;  3PYF A;  2E66 A;  4USV A;  3NCR A;  2DYA A;  2ZKU A;  3B4D A;  1RT1 B;  4DDF A;  4LFA J;  2FJD B;  1RSC A;  3RGI A;  2PMW A;  3NL0 A;  4PEO A;  1R0A B;  4HDG A;  1V9O A;  1Y9O A;  2FZG B;  2HS4 A;  4IFY A;  4IH5 A;  3CCR S;  2QLJ B;  1TK5 A;  5A8K B;  3EYZ A;  2VUG A;  3MCM A;  3BM7 A;  2N3O A;  2CG4 A;  3KDN A;  4WKY A;  1FXD A;  2WBM A;  1RT4 A;  1YTY A;  2VG5 B;  1VIS A;  2NXU A;  2UV8 A;  1RB0 A;  1QDU B;  3QWP A;  2VKZ G;  2NXC A;  4R8U A;  1VQP S;  3Q8Y A;  4ZVR B;  2HAI A;  1WD6 A;  4CH1 A;  4FXD A;  4LR9 A;  3OL9 A;  4CLK A;  2OH2 A;  5GAG I;  4Y2M A;  5CHC B;  3B82 A;  2LEP A;  3RUB L;  1QAY A;  1YJ7 A;  1Q5Y A;  2DHG A;  3NNC A;  1HPZ B;  4NZ0 A;  3N79 A;  4OJ1 A;  3KK2 A;  2XQC A;  4EI2 A;  3OW2 R;  4K5R A;  2DGQ A;  3PX4 A;  1LWC A;  1TEL A;  5HN0 A;  2JVR A;  4ICL B;  2YWK A;  4NAS A;  3FBC A;  5AJ3 J;  3BQ1 A;  4QCL A;  1XC9 A;  1RT6 B;  3NP5 A;  3QT8 A;  3TA0 A;  2E7W A;  1TUV A;  1EKR A;  2YVS A;  5F3T A;  2XYG B;  1UJ4 A;  1Y3J A;  1UP1 A;  2LVW A;  3PVX A;  3NS7 B;  1QSL A;  1RTI A;  3CMA S;  2MLX A;  3QQC D;  2WOM A;  4L3K A;  2PC6 A;  4A8X A;  1WEL A;  2DY9 A;  4ELV A;  2BE7 D;  4KYZ A;  1FEE A;  2AD9 A;  4ZLP A;  2D74 B;  1MU2 B;  3TX0 A;  4LFC F;  2B8P A;  3EWG A;  4UOC A;  1N34 F;  3MMC B;  1XNR F;  4WE1 A;  1SQE A;  1DQ9 A;  1TTH B;  3ILJ A;  3OQ2 A;  1EIY B;  3GWC A;  1G6B A;  2BE9 B;  3FEY B;  1WI6 A;  1FES A;  4CT8 A;  3OSN A;  4H54 A;  2VF3 A;  2GO8 A;  3N6N A;  3CO0 P;  3UWT A;  1BWE A;  4F2R A;  1LNQ A;  2MPU A;  4B3S J;  1X5S A;  5A0Y A;  1VBY A;  1U4B A;  4ZHR B;  3DRY A;  2DHA A;  1Z4U A;  4ID8 A;  2XTJ P;  1I1G A;  2IAJ B;  4BDP A;  3T3F A;  1SIW B;  1R6V A;  2BQR A;  3HDS A;  4K4Z A;  2DGW A;  3MUV P;  1C1B A;  2VFU A;  4OZL A;  4EWT A;  4DV5 F;  1WSV A;  3KLH A;  2FYX A;  4JI1 F;  2NYH A;  3O1L A;  1HWI A;  1GXL A;  2HHW A;  5LXR A;  4J9N A;  4UY8 T;  3UO0 A;  4F0M A;  1JLB B;  4LF5 F;  1IWA A;  3PEH A;  2XG8 A;  3AOA A;  3DRX A;  4XPE A;  1WDT A;  1KQS R;  2BJ1 A;  2UU9 J;  1D3W A;  4YME A;  4ZS6 A;  2I0X A;  3K59 A;  1ZOT A;  3VVU A;  4JI5 F;  4JI4 J;  3H2L A;  2IRU A;  2YH1 A;  2J7K A;  2UUC F;  3NGS A;  3D6T B;  5ETT A;  3O2I A;  2Y1R I;  2GHV C;  4F4X A;  1D9F A;  1WWH A;  2JLE A;  3DGP A;  2WAQ D;  2PT0 A;  1WAC A;  4KFB A;  1ZM9 A;  3IMQ J;  1AUD A;  1SC4 B;  1XER A;  2WTF A;  1MML A;  4B17 A;  3OXF A;  4PXC A;  2VPX B;  1JLG A;  1ZAV A;  1KBR A;  4HHH A;  1CC8 A;  3IS9 A;  1M5H A;  2OMO A;  1SL2 A;  3LPY A;  4H4K A;  3UR3 C;  4NPO A;  3QRR A;  1NSP A;  3CCS S;  3IAS 9;  4UST A;  4ELT A;  2NZ4 A;  4DG1 A;  3HP6 A;  1S6P A;  2ROE A;  5KFR A;  2UUA J;  1IUJ A;  2MQN A;  2XMJ A;  3CD5 A;  2XMA A;  4RNH A;  4OZ5 A;  3BF4 A;  3DYA A;  3TZW A;  1GFW B;  1JX4 A;  4ATN A;  2HFS A;  4K4X A;  4B3M F;  1VK8 A;  3LWM A;  4GKJ J;  1G3O A;  1RAJ A;  1R43 A;  1TU0 B;  2OLW A;  1S5Z A;  3ZZR A;  4Y2I A;  5KFY A;  4FPR A;  1NK6 A;  1KON A;  1GTE A;  2OSR A;  4WFY A;  1TL5 A;  3PR5 B;  4USW A;  1BQN B;  1TKD A;  2DRA A;  3ET6 A;  2RH3 A;  2WBR A;  1T8E A;  2HWT A;  1N5T A;  3G2X A;  4EYI B;  4WPA A;  1HQ2 A;  4FXW A;  5E41 A;  1FD2 A;  2BJE A;  2QRR A;  3RW6 A;  4M1K A;  2U2F A;  3LUY A;  2NS1 B;  2GQ2 A;  4ZIV A;  3QPI A;  4NEY A;  2DHH A;  4IUF A;  1X4E A;  1NHK L;  1KEK A;  1PYO B;  4K4V A;  2IIH A;  1Y5L B;  1G2E A;  1EHW A;  3THP A;  2OI2 A;  2JFK A;  3CC7 S;  2NLW A;  2ZBQ A;  1NK9 A;  3FZ2 A;  2OAU A;  2FHJ A;  4L75 A;  1QSS A;  3PX6 A;  2F1F A;  3MR3 A;  1HMV A;  3D6H B;  5LSO A;  2HNY B;  5KFO A;  1VYA A;  1I5O B;  4NOH A;  3VHQ A;  1Z1Z A;  3H2V E;  1FER A;  5DLG A;  1SCJ B;  1FXR A;  3CVK A;  3PYD A;  5D4N A;  1NJY A;  2B4P A;  1R0C B;  2L9W A;  4P2M A;  2ZM6 J;  5EN1 A;  4HYK A;  2CG8 A;  1PCA A;  1VC0 A;  4ZMM A;  1U1L A;  1KTQ A;  2WHO A;  1VJQ A;  2D69 A;  2JOQ A;  2KT3 A;  3TAM A;  3KK1 B;  2HRU A;  2ZBI A;  3T1Y F;  3JYT A;  2MGZ A;  4DJB A;  2UVU A;  5F0W A;  4FF1 A;  4P52 A;  4V19 J;  1WG5 A;  3MUM P;  1RKJ A;  4M8L A;  4NA1 A;  3DCA A;  1X0F A;  2IYI A;  4JYA J;  5J1E B;  1NDC A;  4DPU A;  4P2X A;  1HNZ F;  4H4M B;  4FDF A;  2B5J B;  3KLV A;  3V4I A;  3KWM A;  1U47 A;  3BGL A;  2R7Q A;  3PY8 A;  4MKV A;  1VFJ A;  1MRO A;  2UVR A;  2YWE A;  3TW0 A;  5HP1 B;  1N36 J;  4R5P A;  2Z58 B;  3ADA C;  3D3B J;  3PJW A;  3HFV A;  5KFN A;  4K2X A;  2V2K A;  3A1Y G;  3GJS B;  5C25 B;  1RT5 A;  1KKH A;  2GZO A;  5B0C A;  3TA1 A;  1IR0 A;  2GO9 A;  3G4S S;  2FDN A;  3PIP Q;  3T5K A;  2VG6 B;  1Q16 B;  3JTP A;  2HQC A;  1R31 A;  3MEK A;  5DG7 A;  4RW8 B;  2ABY A;  4KGM A;  2HEK A;  1S1W A;  2IMO A;  2JL9 A;  1LWE A;  3UDC A;  3NS6 A;  3HUL A;  2XMW A;  1U1O A;  3PW4 A;  1SQG A;  2Z4P A;  5JJB A;  4I6A A;  4A8K A;  4DV7 J;  3CNQ P;  4IQX A;  3C46 A;  3T6J A;  2HQI A;  4WJB A;  2W7O A;  1SB6 A;  1RTJ A;  4OX8 A;  5AXL A;  5KFH A;  3EZO A;  4OZ1 A;  1Q8K A;  2XWX A;  5D0R A;  1RAE B;  3QLH A;  4NLU A;  4ZVP B;  2EFO A;  2Z2Z A;  3W64 A;  1UWA A;  4ZN3 A;  4J9P A;  5DRK A;  4QU7 A;  4EBE A;  4RKU C;  4ECT A;  4ED5 A;  5D77 A;  1S6Q B;  1IKY B;  2RDD A;  4DV6 F;  2IJR A;  3ILI A;  2YQ0 A;  3HLU A;  4LJM A;  5ETS A;  2CJA A;  4ZCL A;  3R9L A;  4NWB A;  4DX5 A;  1M0S A;  5IT4 A;  2OPS B;  3KUH A;  4KPY A;  2Y0S D;  4OZ2 A;  4YB5 A;  1XNQ J;  2B56 A;  4OYX A;  4EBC A;  4DEZ A;  3TP2 A;  4NCB A;  5ETV A;  4DHV A;  1X4H A;  1HHQ A;  2JSX A;  2NSC A;  2VQE F;  2YWF A;  1ZZF A;  4WF9 Q;  3A8E A;  2QA4 G;  2MST A;  1DBD A;  3MF5 A;  1H2T Z;  3LO3 A;  4UT4 A;  4K0K F;  1RP5 A;  3K8V A;  2VFT A;  1ZBT A;  2W2P P;  2CPX A;  1H7X A;  2R2S A;  1DTQ B;  4Y28 C;  3VAL A;  1LXJ A;  4IG3 A;  1Y5I B;  5KTQ A;  1HI0 P;  2LCW A;  1QE1 A;  2R7O A;  1XTZ A;  2E5I A;  1FNM A;  1UWB B;  1FE0 A;  4DV1 F;  4FYV B;  3HO1 A;  2ZUA A;  4ZDN A;  4CYU A;  2ZE2 A;  1FJG F;  4AUK A;  1S1V B;  1VJW A;  2DHS A;  1D0E A;  3I96 A;  3T5H A;  1S7I A;  3R2D J;  1SV5 B;  1HD1 A;  5ADZ A;  2Q79 A;  4Q8E A;  1IKX B;  3C14 A;  3KMS A;  3D5M A;  4PR6 A;  2IJN A;  2J0X A;  1XR7 A;  4QIW D;  1YRT A;  1SI9 A;  2EI5 A;  4RBU A;  2HMI A;  2AYE A;  1RA7 A;  5BYR A;  4M5J A;  1T94 A;  3WC2 A;  1V3S A;  3JQK A;  1GMW D;  4FXV A;  4HTJ A;  1SJQ A;  3LAM A;  1OPI A;  3IWL A;  1UA1 A;  2QL7 B;  3R5G A;  4U7C A;  4KB7 A;  4Y00 A;  4GKK J;  4NML A;  4TU8 A;  1P1T A;  3MM9 B;  3MDF A;  3KDO A;  1R27 B;  3VAM A;  4TQS A;  2RUG A;  4F4K A;  5HQ8 A;  3NMA A;  1K0T A;  4DQI A;  3VGT A;  3BKF A;  5DGB A;  3W9J A;  3BQ2 A;  3H40 A;  1YBU A;  1R8C A;  5EWF A;  2WVF A;  3CIZ A;  5IQQ A;  2W9B B;  4LF4 J;  1RAH B;  2CA9 A;  2XY7 A;  2XNQ A;  2M0G B;  3JSM A;  4LQ3 A;  2JFD A;  4URS A;  1L3U A;  1KVI A;  1RWO B;  2YX1 A;  4OHX A;  4FYW B;  4WFB Q;  1AXQ A;  3W2V B;  5HAT A;  3ZTO A;  1F9E B;  4F8R A;  3OXL A;  3PXG a;  1CJK A;  1FX2 A;  2Z30 B;  1P8G A;  1YHQ S;  4GVB A;  4LRA A;  2IVY A;  4I7F B;  2D3Z A;  1WC1 A;  2N3L A;  1U49 A;  2F8H A;  2IBK A;  1XMB A;  2H5I B;  1WEX A;  1JXL A;  3FCH A;  2YNI B;  4XDD A;  4GC7 A;  3CXC R;  1EAR A;  1X4G A;  4DR6 F;  1WC3 A;  5KG3 A;  1RLC L;  1RAA B;  2V94 A;  1MN9 A;  1PKU A;  4EEY A;  4WXO A;  4ZP9 A;  2ROP A;  4LRD A;  3WX4 A;  1X0P A;  1QVG R;  1VS3 A;  3RBE A;  3ZZP A;  2RS2 A;  3MD1 A;  4WWS A;  1S57 A;  4IR9 A;  1LKZ A;  2M8H A;  2RKI A;  5E7O B;  1XWL A;  5A76 A;  5GAD I;  4O3O A;  3GQC A;  4ZK7 M;  4XTT A;  5M2P A;  2RQ4 A;  1YX2 A;  2BM1 A;  2YNH B;  2B4O A;  4PG8 A;  2HW3 A;  2ZWO A;  3G9C A;  2VBW A;  5LMU J;  5F8N A;  1CS4 B;  4X64 F;  4NLQ A;  1S1U B;  3T19 A;  4GC6 A;  5KFE A;  4NLX A;  3HHE A;  4USH A;  4CP5 A;  4CDI A;  4GMK A;  3AD8 C;  2QYC A;  2VOD A;  3MZI A;  2QFI A;  1FVS A;  5HVG A;  1WF0 A;  4KHM A;  1JQG A;  2ROG A;  2QIF A;  3BGR A;  1EX8 A;  3DM2 A;  2AW0 A;  3GCX P;  1TAQ A;  4ZVS B;  1JKH B;  2XS7 A;  3IG1 B;  3OR2 B;  3C6T A;  3KLG B;  1XN9 A;  2GJF A;  4FBU A;  4K8R A;  1OQ6 A;  4UZC A;  2V4R A;  1QUV A;  2C3P A;  4YDX A;  2H65 B;  1HBU B;  3M7V A;  1X4F A;  4RU2 A;  3HK2 A;  3ZZO A;  1X60 A;  1IXK A;  2VB6 A;  3CCW A;  3M6W A;  2XM3 A;  1S59 A;  1JLQ A;  3PCO B;  1VMB A;  2IA0 A;  2ZDP A;  3BZQ A;  2GVZ B;  2MKK A;  3TZZ A;  4F67 A;  5EUH A;  3PKM A;  4HT7 A;  1XIQ A;  2PGC A;  4LR7 A;  3JTO A;  2CZ4 A;  2QC3 A;  1RYR A;  4MIA A;  1TKT A;  2HBZ B;  3AQP A;  4JP8 A;  5EX0 A;  3IA0 A;  4EFA C;  3W61 A;  5KG7 A;  3KKF A;  1QVF R;  1UTA A;  2JNJ A;  3HVW A;  1AYE A;  3R1L A;  3LGN A;  4F36 A;  4X62 F;  3RU0 A;  4DN9 A;  4N77 A;  4UW2 A;  3H98 A;  4HI2 A;  2MKI A;  1KRP A;  1MNE A;  4JV1 A;  3DHW C;  4DR2 F;  3ICL A;  3UQS A;  3OLA A;  1HNX J;  4NI2 B;  3CW2 C;  4NYO A;  3M8Y A;  1Q82 T;  3ISN C;  2KJV A;  3G82 B;  3ZFV A;  1NH7 A;  1ZPV A;  4OYM A;  4NRT A;  4G1P A;  4UOF A;  2RDI A;  2AWZ A;  3TEH B;  1N54 B;  4M5I A;  3FK4 A;  4IKA A;  2XZT B;  4ED7 A;  1Q86 T;  4LRE A;  1M5O C;  1BGX T;  2EFV A;  5BR8 J;  3DKD A;  3IP0 A;  3LH2 S;  1AFI A;  5LL6 d;  2H4W B;  5GVQ A;  3M2U A;  2DR7 A;  5AE1 A;  3TOQ A;  1WHX A;  3X1L B;  4X4O A;  4ECR A;  3CD7 A;  5DO2 A;  4DV4 F;  3I9Z A;  2YKM B;  2OD6 A;  3LTO A;  5CD4 H;  4I4B A;  1RLD A;  5E3A A;  2ZJQ Q;  2GIQ A;  1SJ4 P;  4JI3 J;  4HVZ A;  2DGS A;  1F5B A;  1FF2 A;  3PYG A;  2YWW A;  1RAI B;  1TKZ A;  4L73 A;  3NY0 A;  3V6K A;  1S10 A;  5K8M A;  4RBT A;  3CJ5 A;  1P9Y A;  1X9W A;  4IRK A;  2XSJ A;  3DOM B;  2ZH9 A;  1TL1 A;  1UFK A;  3P8B B;  2WSC C;  5KFZ A;  4S0M A;  1DUR A;  1IJF B;  2D41 A;  3BGF A;  3BSC A;  3W5X A;  4L3N A;  3O44 A;  1ZM2 A;  4DUZ J;  2VFV A;  1M1G A;  2ALZ A;  2J9C A;  2Y9H A;  4DFJ A;  2KXN B;  4QR2 A;  5KG0 A;  3H2U B;  3R2C J;  5E0O A;  1KFS A;  4ED2 A;  2XZD B;  2EBE A;  2RVJ A;  4U67 Q;  2FY8 A;  4TY8 A;  3KLE A;  5HK4 A;  1VC5 A;  3F56 A;  2ZH6 A;  3UDV A;  3P45 B;  1YJW S;  3OFH A;  3IRX A;  2EXU A;  1CBK A;  2QLB B;  3GTY X;  1FDB A;  1S9E B;  4M5M A;  5L1K A;  3UNG C;  3W1Y C;  2C2N A;  3HSZ A;  1U1K A;  1BQX A;  3MMB B;  1T95 A;  3QFH A;  4MJK A;  2ZJR Q;  5CYM B;  2MXY A;  1FD8 A;  4NXM J;  2MLY A;  2JC1 A;  4F3Q A;  5KFG A;  3VV2 B;  3PV8 A;  1B0T A;  4Q43 A;  2APO A;  3AH6 A;  4CWB A;  2PEB A;  4PAA A;  1F60 B;  2R8H A;  1N33 J;  1KR4 A;  3TO8 A;  2KXH A;  2K2P A;  2WVE A;  5ETQ A;  4LBI A;  2UXB J;  3G8T A;  4KPC A;  4CLY A;  2M4M A;  2NUH A;  3KNG A;  1RT2 A;  1UW4 A;  3TUP A;  3MCN A;  1JK9 B;  1FRL A;  5IC4 B;  5T7L B;  4UUX A;  2FVS A;  1F9H A;  4PYD A;  2FJA B;  1ITP A;  1C1C A;  2HS3 A;  2YKQ A;  1H98 A;  1K8A T;  4N41 A;  1YDL A;  4QR1 A;  3CJ2 A;  3T6B A;  2KXF A;  5FJ4 A;  2M9K A;  1T9X A;  4LSL A;  1TMM A;  1OQ3 A;  3PO4 A;  3QJL A;  5CAB A;  4J9R A;  2FZK B;  4KSE B;  2DY1 A;  3NMR A;  2VPW B;  3VQT A;  3R5J B;  4ZIW A;  1EP4 B;  4EBD A;  1CPZ A;  2QA1 A;  1Q0N A;  3E01 B;  3PO5 A;  2G2O A;  2AU0 A;  3MEC B;  3NBP A;  2QO3 A;  4BS2 A;  1T03 B;  2ZUG A;  1FRX A;  1VRQ C;  2E7V A;  4KH1 B;  1KOH A;  3EVO A;  2AT1 B;  2VDI A;  5F41 A;  2G9O A;  3BBB A;  3BKT A;  3KTQ A;  1N5S A;  2WVC A;  2MZT A;  4WTO B;  2HG4 A;  2FPH X;  4JI7 J;  2ZZN A;  2C3O A;  4U7U D;  1BLU A;  5JXS A;  4CTA B;  4DQQ A;  1N5Y B;  3P6Y C;  1H72 C;  1U02 A;  1VRU A;  4QWA A;  3MR2 A;  4QIF A;  1QTM A;  4PCQ A;  4PWD B;  5FII A;  2O67 A;  2AZ3 A;  2V4J A;  1S1T B;  3VAI A;  2N4D A;  4AQY J;  5J2N B;  4A47 A;  2WON B;  5CZV A;  2CJK A;  1E6Y B;  1D9A A;  3FFI B;  1TKX A;  2DXF A;  5I3U B;  2XI3 A;  4LF8 F;  1RI7 A;  2YWG A;  2DT9 A;  1UEU A;  3LGH A;  4KGZ B;  3MFH A;  3BS9 A;  3NEK A;  4DR7 F;  2MDA A;  4RW6 B;  2W2O P;  5AXM A;  4I69 A;  2XSF A;  4ILM A;  3BDP A;  1UZH A;  2O01 C;  1PJ7 A;  3GIJ A;  3PRD A;  1RAD B;  2J9D A;  5KT3 A;  4ECS A;  1VLO A;  4HKQ A;  3M2V B;  4OMF G;  3TVY A;  3CJQ A;  1HQE A;  1T05 A;  3M1V B;  3PJ9 A;  2L9D A;  4EZ9 A;  4DBQ A;  3M6V A;  4PWW A;  3HMJ G;  3ZZ0 A;  2FGO A;  2DO4 A;  4NCG A;  4C8L A;  4YUD A;  1FKP A;  5B7W A;  2AJF E;  1YKW A;  3UD5 A;  5FLX Y;  2IC3 A;  4X84 A;  2XMV A;  1FTR A;  4ZVT B;  2V34 A;  1NB7 A;  2B4U A;  1QD1 A;  3ZZU A;  5KOX A;  1WF2 A;  5C2G A;  4CLP A;  5HLF A;  4F7V A;  2CWX A;  4DQP A;  5KFV A;  2DNO A;  1U09 A;  2POK A;  2ZD1 A;  1L5U A;  3UVJ A;  4AL6 A;  5HQL A;  4LF6 F;  5KFX A;  5FLX U;  2DK2 A;  3E3X A;  3OSP A;  3HVT A;  2GJI A;  3K5N A;  4Q0B B;  1YJR A;  1RUS A;  1JJ2 R;  4P2F A;  2E1M C;  2EWH A;  1OYE A;  2F4F A;  1U0H B;  2LU1 A;  2LLZ A;  3EIC A;  4DSK A;  3KNA A;  4DSE A;  1RK8 A;  1VLY A;  3HT0 A;  2YKO A;  1F1B B;  5CZX A;  5D4O A;  2KHD A;  4JOU A;  6FD1 A;  2YKN B;  4F3M A;  5DDO C;  3V81 B;  3TUZ C;  1C0T A;  3SI8 A;  3BSN A;  2PA8 D;  4A48 A;  5AE2 A;  5J2M A;  2DTJ A;  2LYV A;  1HD0 A;  2CPZ A;  4DR4 J;  4NCA A;  2QV6 A;  3RBD A;  4IFY B;  4DV3 J;  4MKA A;  3R3T A;  4FN5 A;  1SKW A;  5CA5 A;  3CCE S;  3DNC A;  1NJW A;  1RT4 B;  3FDS A;  3N01 A;  4QWD A;  2UXC F;  2OML A;  2JVO A;  2OPR A;  3VAG A;  4R8U B;  1TR0 A;  1IBL F;  1F3F A;  1GXU A;  4RLE A;  4IDK A;  2RU9 A;  3I5C A;  2E5G A;  1BC6 A;  3LA0 A;  4NA3 A;  3LQV A;  1HBO A;  2HNZ A;  3KK2 B;  3BQ0 A;  1RHK B;  5HMX A;  1XR6 A;  3N5F A;  3VTI A;  1VQY A;  2YTC A;  3AAW B;  1IKW A;  4FS2 A;  4MTP A;  1LWC B;  1PG5 B;  5IFM A;  4PQU A;  4W92 B;  3J7Y U;  1Q78 A;  4MK8 A;  3T1H F;  3HSG A;  4I0W A;  1IKV A;  1GMV A;  3QBC A;  1AA1 B;  1CJV A;  1NBE B;  2AV5 A;  2LA6 A;  3NRB A;  1RTI B;  4ZVO B;  2EFN A;  2WOM B;  1U2C A;  4U96 A;  3GV7 B;  3GFY A;  3MR7 A;  1S12 A;  4OLP A;  4OZN A;  4HL9 A;  3I0R A;  3MPY A;  3ITH A;  2Q6B A;  4LQ9 A;  4B02 A;  2WVB A;  4NE9 C;  4NLW A;  3M32 A;  5DG8 A;  4BC9 A;  3B4M A;  4IOC Q;  1ACM B;  2JHE A;  4DI6 A;  3HXM A;  3W9H A;  3H4D A;  3VZH A;  5HBM A;  3P96 A;  2ADC A;  4I67 A;  1KHW A;  2NSB A;  3JQM A;  4WE1 B;  1SBR A;  2HLU A;  3SSR A;  3I32 A;  1T0T V;  4Y0F A;  5D78 A;  3HHL A;  3UCG A;  2FIU A;  2FVP A;  3MXH P;  2KHC A;  3ZNJ 1;  5F8G A;  4E0D A;  1H0H B;  3HZG A;  1YRX A;  2OFH X;  3TI0 A;  1UPP A;  5ETN A;  4J7C A;  3G86 A;  1QAX A;  2C2R A;  2BEF A;  3IGN A;  4DV2 J;  1FE4 A;  5A0Y B;  4LVN P;  3K5M A;  1SJ1 A;  1FFW B;  1OPZ A;  2IY5 B;  2ERR A;  1RU1 A;  4DXL A;  1RT7 A;  2QA4 S;  2CNN B;  2Y1J A;  1D1U A;  4DCJ B;  1TL4 A;  1C1B B;  2X3G A;  3W66 A;  4C98 A;  2UUB F;  4WII A;  3HHN B;  5HL7 Q;  2BUN A;  1FNX H;  3HSJ A;  2BBE A;  4ZP8 A;  3M2R A;  3EZU A;  1HQU B;  4GO5 X;  4QWC A;  2Y3Y A;  2MQO A;  3DFE A;  3WBZ A;  2QTW A;  2N82 B;  4N56 A;  2B9W A;  1HLW A;  4DPT A;  2GMJ A;  3C8Y A;  3OHA A;  4FNH A;  2OO4 A;  4IH7 A;  2C3M A;  2YH0 A;  3HJV A;  3RZA A;  1TK0 A;  2XMU A;  5GAG U;  3MR5 A;  2ZBC A;  1HNV B;  4V1A k;  3MAQ A;  2BR0 A;  4DOZ A;  3HPO A;  3M9O B;  3A3P B;  4X2B A;  3GJR B;  2LQ8 A;  2DEJ A;  1EET A;  1YJU A;  3G8Q A;  1PIL A;  2KDO A;  4L72 B;  4HH1 A;  2JX2 A;  2B3T B;  3DGP B;  2GIR A;  2RD5 C;  4CLW A;  4IYQ A;  3IAM 9;  4J9K A;  4KFB B;  2IMW P;  4TNO A;  3GR1 A;  4GO7 X;  3AA8 A;  5IM0 A;  2B4V A;  5F9N A;  1JLG B;  3DLE A;  4ZVF A;  3IS9 B;  2H3E B;  3G71 S;  2WW4 A;  1I94 J;  4MIW A;  4DCO B;  1WC6 A;  1EKS A;  5DGA A;  1DTT A;  2LP4 A;  2OPP B;  1KQG B;  3EVM A;  1NXI A;  1NK4 A;  1LW2 A;  3MMA A;  1S6P B;  1HYS B;  3C15 B;  2VL1 A;  1U6Z A;  7AT1 B;  1SPB P;  2A2C A;  2DNH A;  2AGP A;  3PM9 A;  4WP8 A;  1K0V A;  3DYA B;  2IVF B;  3Q8V A;  4DZD A;  2MQQ A;  2E5J A;  2YY3 A;  2GGP B;  1T9U A;  2JLF A;  4QYZ K;  1IR2 A;  1BMQ B;  2P9G A;  3MCS A;  1M5P C;  3UDE A;  3LP0 B;  3DXB A;  1Z2Z A;  3FCW A;  4DR5 J;  4B9S A;  2DNG A;  3RTV A;  3I0S A;  4I2P A;  3ELH A;  5JMN A;  1PGZ A;  3ET6 B;  3HFZ B;  4KE5 A;  2CJQ A;  3SQG A;  4EMD A;  3VVT A;  1NRK A;  2K3I A;  2IA6 A;  4MMO A;  1VBZ A;  4N76 A;  1M90 T;  2BAN A;  2E1A A;  1BD6 A;  1VCT A;  4PXE A;  3FEZ A;  4WXW A;  4U8Y A;  1R8H A;  1KVJ A;  1R8P A;  3IN5 A;  4OQJ A;  5DG9 A;  4QZV B;  2V8V A;  1T02 A;  4OZ3 A;  2DIU A;  3DDK A;  1V5V A;  2UUT A;  5KFL A;  3CCU S;  2GMH A;  3T9N A;  4WU2 A;  5A6P A;  4O0N A;  2MQL A;  5D4P A;  3D1O A;  4FKX A;  3SCI E;  2SXL A;  1VQK S;  2EC2 A;  2BKN A;  1HMV B;  4UOH A;  2BQU A;  3HVR A;  1PIE A;  4X66 F;  3D6F B;  4DF4 A;  1A6L A;  4QPX A;  4DU7 A;  3X3U A;  1KQK A;  2KG0 A;  3IR6 B;  4E98 A;  5K8O A;  3CIM A;  4ED4 A;  3WIU A;  3D1Q A;  4AL7 A;  3K5O A;  2C1E B;  4C11 A;  2OTL S;  3BDE A;  2M2B A;  4DUY J;  3MM5 A;  1UVM A;  3SSS A;  5GAH I;  3DU5 A;  3D9B A;  3TAM B;  4B3T J;  3MUR P;  1C0U A;  3JYT B;  2MGZ B;  4A46 A;  1PC5 A;  5C24 A;  1XBW A;  2HS0 A;  5KFJ A;  4K4Y A;  4ER8 A;  1WHY A;  3FRZ A;  5LT5 A;  3VAJ A;  1UVI A;  2GIF A;  4ES1 A;  3ETO A;  2BW7 A;  2KN4 A;  3ISZ A;  2CQ1 A;  1NJX A;  4F26 A;  1VQN S;  1HNI A;  2MJU A;  2XCA A;  1MLA A;  3CUL A;  1PO6 A;  2AEJ A;  2AX0 A;  1UVN A;  2P6S A;  2MZQ A;  2E5L J;  4PG7 A;  1NO8 A;  4PUO B;  2B7C B;  1SH3 A;  4P10 A;  5L46 A;  1Y11 A;  4R5P B;  3KLI B;  2W2M P;  1T3O A;  4X4Q A;  3OXG A;  2XLI A;  4ZJO A;  1QAI A;  1RT5 B;  1OMS A;  1WOS A;  3P5T L;  3MD3 A;  4UQT A;  3RRK A;  1ZTW A;  1AUS L;  1NH8 A;  2MQM A;  5A2Q Y;  4PRF A;  1S0V A;  4N5S A;  2G1H A;  1U8W A;  3QO9 A;  1HFE L;  1LWE B;  1ZPW X;  2D3O 1;  3HM9 A;  3GP9 A;  3DLG A;  1NHV A;  4W98 A;  2VU5 A;  2KKH A;  3W8G A;  2NCK L;  1R8B A;  3N0V A;  2C2D A;  1BUX A;  3GV8 B;  3C2P A;  1XMQ F;  5E3R A;  3PG9 A;  4DL4 A;  4K7Q A;  1GQE A;  3M4X A;  1IBM J;  3NAH A;  4C8Y A;  1C4A A;  4KC5 A;  5A2Q U;  3KLF A;  1N32 F;  4PG5 A;  4OL8 A;  3QLH B;  3GG1 A;  3QWU A;  4CO4 A;  5EWE A;  5BYS A;  2KH9 A;  2R7X A;  2UV8 G;  3WZ0 A;  1JLE B;  4I6W A;  4JI0 J;  4O3Q A;  2BJD A;  4B9L A;  2R8J A;  3DU6 A;  1JMT A;  4FVC A;  2MYF A;  1O6X A;  3ZO7 A;  1ARO P;  2M7S A;  3PNI A;  3GFZ A;  2DCL A;  3CCM S;  2IBO A;  4ZPD A;  2BE2 B;  4M5G A;  2AJ4 A;  4OX7 A;  2NUU G;  2OEM A;  2FVC A;  2FLP A;  1FHT A;  1HBN A;  5LMN J;  2QFJ A;  3CDU A;  3UNY A;  1HI1 A;  1B99 A;  3DRP A;  1SQF A;  4KV8 A;  3T9Z A;  4BWM A;  3Q8U A;  4QOT A;  2IPO B;  1RE1 B;  4C9D A;  5FDL A;  4FBT A;  3D66 A;  2XHC A;  3CB4 A;  2XYH B;  2IM2 A;  3QT6 A;  3H5U A;  1N52 B;  3F44 A;  2VFR A;  4OYI A;  2V5H G;  4IG3 B;  2CDQ A;  1QE1 B;  2KM8 B;  1SL1 A;  4TKT A;  2BJ3 A;  3K7R A;  2ZHO A;  3MM8 A;  5KFM A;  5F8M A;  5HVF A;  3CCT A;  2ZE2 B;  3OTE A;  2UP1 A;  2PMZ D;  4P2S A;  4I56 A;  3QJJ A;  4G1Q A;  4M63 A;  1SH0 A;  2AEF A;  2J7U A;  2NXN A;  1RHQ B;  3C14 B;  4X4T A;  4C0H A;  5LJ3 Y;  1OO0 B;  1HR0 F;  2FZC B;  3MM6 B;  4HTI A;  4NYP A;  4MAK A;  1NDL A;  2MMY A;  2HMI B;  3R97 A;  4I2Q B;  3DLL Q;  4Y2A A;  4A8F A;  2PFF B;  5B0B A;  1S9G A;  2ZDO A;  2VG7 A;  3NGU A;  1HNW J;  1VQM S;  2DD8 S;  3A8I A;  4RWX A;  3Q8R B;  4IO9 Q;  1KDN A;  1PBA A;  4LRC A;  2X7I A;  3VCD A;  2B9X A;  5LJ5 Y;  2AYM A;  4FYD A;  3KG4 A;  3L4B C;  4LR8 A;  3SCJ E;  1Y10 A;  4LF7 J;  4YY3 F;  2WCX A;  3MFI A;  4ELU A;  5IOL A;  3JB9 k;  5IV3 A;  1S99 A;  2WZ1 A;  4NLG A;  3CJ0 A;  4R0E A;  3HKZ D;  1UVJ A;  2ZOG A;  2D3U A;  1ZET A;  4NZ7 A;  2UXD F;  2DXE A;  4RJV A;  3FMB A;  4NX9 A;  2GV1 A;  3KG0 A;  5KFB A;  1X8D A;  3JSM B;  1HW8 A;  1B3T A;  1Q7Y T;  2X1A A;  2GCF A;  4NYZ A;  3PRB A;  4ZPB A;  1HW9 A;  1REV B;  3FCV A;  3D6M B;  2J5A A;  4NXN J;  5I42 B;  3SFG A;  2V8P A;  4ECY A;  1CUL A;  1CJK B;  2ZH2 A;  3DRR A;  2AJQ A;  4GVB B;  5BYQ A;  1UVK A;  1X7V A;  2KRR A;  1Y3K A;  3VAH A;  4JI2 F;  2CKW A;  5AXK A;  5H9E K;  1U26 A;  2D7S A; 
#chains in the Genus database with same CATH homology
 1SC3 B;  2DKO B;  1RWV B;  2HBY B;  2H65 B;  1RWX B;  3KJQ B;  3R7S B;  2C2M B;  4LSZ B;  3QNW B;  2XYP B;  3EDQ B;  1PAU B;  3KJN B;  1QTN B;  3EDR B;  3SIP B;  3R5J B;  2CNK B;  2HBQ B;  3D6F B;  3IBF B;  1RWM B;  3GJS B;  2C2O B;  1RWW B;  1RWK B;  1BMQ B;  1RHU B;  1RHJ B;  1RWN B;  1RHK B;  3P4U B;  2XZT B;  3GJR B;  3R7N B;  4JB8 B;  1RWO B;  1NME B;  1RHQ B;  1I3O B;  2C1E B;  3R6G B;  3GJQ B;  2HBZ B;  3R6L B;  1ICE B;  1SC4 B;  2H54 B;  1F9E B;  2Y0B B;  2XYG B;  5IC6 B;  2H4W B;  2XZD B;  2CJX B;  2QL7 B;  1RHR B;  1PYO B;  1RHM B;  2QLJ B;  2QL9 B;  3KJF B;  2QL5 B;  3NS7 B;  2CNN B;  3D6M B;  4ZVU B;  3R7B B;  4DCJ B;  2Y1L B;  4ZVT B;  3P45 B;  5IC4 B;  1I51 B;  2QLF B;  3RJM B;  2H51 B;  2C2K B;  4DCP B;  1SC1 B;  4ZVS B;  1IBC B;  2H5J B;  3GJT B;  2QLB B;  2H5I B;  4DCO B;  1RE1 B;  2CDR B;  4ZVO B;  4ZVQ B;  1QDU B;  2CNO B;  2H48 B;  4ZVP B;  2H4Y B;  2HBR B;  2CNL B;  2XYH B;  4ZVR B;  1RWP B;  2P2C B;  5K20 B;  3IBC B;  3D6H B;  2FQQ B;  1GFW B;  2CJY B;  2C2Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...