3IBFB

Crystal structure of unliganded caspase-7
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
KIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-7
publication title Conformational similarity in the activation of caspase-3 and -7 revealed by the unliganded and inhibited structures of caspase-7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 18
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2009-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3ibfB00
4DCPB 4ZVTB 3D6MB 4DCOB 3GJRB 3R7NB 1PYOB 3IBCB 1SC4B 1QDUB 3GJTB 2C2KB 1RHUB 5IC6B 5IC4B 5K20B 4ZVSB 2CNKB 2FQQB 2H54B 2CJXB 2XYGB 2H48B 3KJQB 2CNLB 2H5JB 1GFWB 2CNOB 3R6LB 3GJSB 2HBYB 2H4WB 2XZDB 2QLJB 4ZVOB 2H5IB 3P4UB 3P45B 1RHMB 1RWWB 2P2CB 3GJQB 3KJFB 4LSZB 4ZVUB 3SIPB 3R5JB 1RWMB 2HBQB 1QTNB 1RHRB 3R7SB 1RHJB 1I51B 1RWVB 1SC3B 2C2ZB 1BMQB 3R6GB 2QLBB 3D6HB 3D6FB 4ZVQB 1RWOB 4ZVRB 2C1EB 1ICEB 1SC1B 2QL9B 1RE1B 2H65B 1RWKB 3RJMB 1IBCB 3R7BB 3EDQB 1RWXB 2CDRB 1I3OB 2Y0BB 1RWPB 2HBRB 3EDRB 4JB8B 2XZTB 4DCJB 2QL5B 2C2MB 3NS7B 1F9EB 3QNWB 2XYHB 2CJYB 2C2OB 2H4YB 2DKOB 2XYPB 1NMEB 1RHKB 2Y1LB 3KJNB 1PAUB 2HBZB 2QL7B 4ZVPB 3IBFB 1RHQB 2QLFB 1RWNB 2CNNB 2H51B
chains in the Genus database with same CATH superfamily
4UW2A 1WTBA 2VA3A 1PYOB 1FVQA 1RT7A 2VC0A 4PEOA 3OTBA 3ZXWA 2XLKA 3O3LA 5K20B 1HARA 5C2CA 3G6XA 3QRPA 2A6MA 2CQHA 3OVBA 5HP1A 1U24A 3K5NA 4BS2A 3ZZUA 3EPIA 1IKXA 1Q81T 3MECA 3MCNA 3QWPA 2R7SA 1FWKA 3TYTA 1U8SA 2KN4A 4M8LA 2XSJB 4C2MA 5HK4A 4A8WA 1RWMB 3T5LA 4LBPA 1HMVB 4FYWB 2F4VF 3FQKA 2BE9B 4YDXA 4V19J 2KO1A 2ZH8A 1WHWA 1RE1B 3OQ2A 2P8IA 3I9V9 4EO8A 4OYIA 2YNGB 1RWPB 1RBOB 2JDJA 2C2OB 4YB1P 1H2UX 2VKRA 1FCAA 3MFHA 1ZM3A 1UJ6A 1WF1A 3ZZ0A 1HIYA 3PYFA 2W8KA 2R8HA 4DBQA 2ZHBA 2B4VA 3OV7A 4YEAA 4LJMA 4TNOA 4DV3F 2MTLA 2I38A 5HQ8A 2C3MA 2FD2A 4TYAA 4DR7J 4M5IA 4R25A 4M63A 2M3DA 4ZCMA 2FHJD 2GHWA 2XQCA 3M9NB 3CCRS 2E5JA 2ZM6F 1H38A 3HLUA 2B3TB 3OUYA 1HWKA 3OJSA 3UW1A 2Y8WA 2WW8A 1R8PA 5JVGQ 5A0YB 3NAIA 3MEGA 4X4SA 5ADZA 2QFJA 4CIOA 3BF4A 2PN6A 3WQPA 4HH1A 3MAQA 4F4YA 4B9NA 5BR8F 3M9MB 4I2PA 3TI0A 5CD4A 4QWCA 4K4WA 1VR6A 1VFJA 2H3EB 3NGDA 3RRHA 7FD1A 4DR3J 4FYVB 3MEEA 2C2MB 1OYEA 3G6VA 1PAEX 4YR3A 5HMZA 1EQ0A 1HI1A 3V6HA 5GAEU 4P7TA 4C3KA 1SV5A 4EO6A 1IJEB 3ISND 1WHXA 4O44A 3TZXA 4Q0BB 2Y8YA 3UI3A 3H42A 1T9XA 2UXBF 2X1BA 2L48A 1GXTA 3S7RA 1JLCB 1K1SA 3H0PA 2DY9A 5J2NB 3M7VA 2DR8A 3KHGA 1DHMA 1M5PC 2RHSB 1QE1A 5KT2A 4OI0A 2B4UA 3QT6A 4F04B 3TAQA 1CQMA 3NKYA 3HZEA 1KQKA 2IM3A 3DDNA 3JQJA 1Z2LA 3IGNA 1MWZA 4NX9A 3K58A 2I8EA 1FKPB 2CWKA 3Q8SB 3UDVA 1PKUA 4OYPA 4M5DB 3QT7A 1RABB 4X4OA 3ILJA 5L1JA 2YKQA 5CH7B 2W2QP 3AH6A 2LXFA 3I96A 4O3SA 4RW7B 4P6QA 3R5CA 1B7FA 3GIRA 4CLFA 5EGYA 2IC3B 2DR9A 3VR1A 5F8NA 4NLYA 4P2MA 1Q4RA 3P3DA 3W63A 2Q66A 4RNHA 3JQMA 3K8VA 2RNEA 4XPCA 4MKAA 3QAEA 3CCLS 1FVSA 3HVTB 1U49A 3EWGA 2E5LF 3DNCA 4USHA 1RXOB 2HVEA 2DNYA 1Y11A 2JLFA 1J27A 5EN1A 1UW4A 1RKJA 2EKNA 2DNRA 1RA7A 2ZOMA 3HFKA 2KXHA 2Y1RI 3D3BJ 3CD6S 2ZD1B 3KNGA 3M2RB 1HKAA 3KTQA 2C22A 4KHPJ 5J2PB 4WK1A 3GFZA 1M1GA 4Y2CA 5DS7A 2AF6A 4JI1J 4UY85 5DQHA 1FFSB 2ZNYA 8AT1B 5ETQA 4ID5A 1T05A 2DJWA 1VQMS 4KTQA 1CULB 1CS4A 2N3OA 4HLBA 3A12A 1OMSA 5HMYA 3PW4A 5F3ZA 4HT7A 1TV6B 1SC6A 3M8RA 5KG2A 2CNKB 2Q1LA 5KFZA 1QY7A 1S9EA 4Z7CA 1HNVB 3LA0A 1ZAXA 4DPTA 1ZAVA 2OLWA 1SPBP 3PIPQ 2ZH7A 2A2DA 2ZDPA 3D0IE 1RT4A 4LRFA 5C24A 2YKAA 4GVLA 1HHSA 1IQTA 1S1UA 3ISNC 2MZ1A 3KLGA 4USTA 1NJXA 3HSJA 3TANA 1KONA 1KTVA 4RLEA 1RT3A 4NXNF 3CD0A 4YUDA 1FE0A 3OD2A 2BABA 2K1RB 3NNCA 2GVDB 3BGLA 5E41A 4DV0J 1AT1B 1M1KT 5HANA 1U4BA 1SJQA 2EC2A 4KBIA 4GKJJ 3GJRB 4D3HA 3K5OA 1URNA 2RKIA 4QZVB 2MHEA 4F2SA 4CH1A 4J9QA 2E66A 2W24A 2ALYB 4P72A 4WTOB 1KQGB 4LR8A 4FPRA 4IRDA 2NQPA 1X5PA 1K0VA 5LXRA 1NK4A 5GAGI 4B3OA 3P45B 4O3RA 4ZP6A 4J9RA 2R2RA 4IH5A 1SC3B 3J7YU 4J90A 2MQLA 2YWEA 3QFWA 3UN3A 2YPYA 5B0FA 4B3MF 2P5VA 3MEDA 2WVDA 4X4QA 4BWMA 3FCHA 4NI2A 4FNHA 3SSSA 5CAAA 3MM8B 1K0TA 2JEIA 3PNIA 4IG0B 4NLOA 3UNGC 2H4YB 4I6WA 5IT9Y 2IBKA 1CG2A 1SBRA 1FJ7A 2XY7A 4ZPTR 2UUCJ 3EVWA 3TAMA 1UL3A 1UVLA 5K5MA 4XAKA 2G13A 2VQFJ 3MMJA 2ZZMA 2OPQA 2PGCA 3RU0A 1CJKA 3AOBA 4DI6A 3HVAA 5ETVA 3U02A 4HEA9 4MIWA 5CYJA 2GNKA 4IQXA 4OI2A 1FF2A 4WIQA 2A0FB 3DOKB 1TL7B 3M4XA 1UWAA 3MAAB 2JEJA 2DGOA 3OFGA 1U47A 5G0RA 3BKFA 5D0RA 4R0JA 4A8MP 1JLAA 2EG1A 4H4MB 2XMMA 3SQOP 2RQCA 3C16A 3HPOA 4JI4F 2WHOA 4D3GA 1QTMA 1A0OB 3GIJA 2ZFHA 1TUVA 2IRXA 1R27B 5HO4A 2DGQA 1XMBA 1G2EA 4F4ZA 3ZTQA 2HBZB 4OZJA 1PJ7A 2DHSA 1H3DA 1VQPS 3ULHA 1N36F 4LF4F 3CXCR 5LL6d 4WK3A 5DLGA 1ULRA 4MYTA 3M8QB 1D09B 3C15A 3NAHA 3CT9A 4NLTA 4MIBA 1FWPA 2XMWA 4TU9A 4PXEA 5ETNA 2D74B 5KT3A 4NEZA 3AHPA 4TLRA 1HNIA 2IM0A 1Q16B 4JYAF 4YQWA 2OPPA 2CVIA 2RIJA 2VODA 4LF8F 3NP5A 1IBLJ 1E6YB 1NHUA 3CNQP 2EVZA 2CQDA 4WE1A 1GXLA 2FJEB 1X4DA 2ZBPA 4O23A 4URGA 1NDPA 3QZ8A 1V9OA 4EYHB 3JAMU 1P8GA 5AJ3J 1S1TA 1XMOF 1XMQJ 4C7QA 3JTOA 3THTA 1TL3A 2CPZA 2HMIB 3SCLE 3D6TB 4Q45A 1S9GB 4TXSA 3UNYA 3TW0A 4RBTA 2X1GA 4C0BA 2J8AA 2LEAA 1YIJS 2XB2D 2H51B 3HHLA 1DARA 1KVKA 4ZPWR 4LFCJ 3ZZOA 4GO7X 5HQLA 2BOAA 4ED4A 2A6OA 3DCAA 1N5QA 1FXLA 1QM9A 3QZ7A 2JHEA 5F8GA 5FDLA 3VWSA 5K14A 3BGRA 5H9FK 4NA1A 2D3OR 5CYQB 1T8EA 2LQBA 2DNOA 5JXSA 3RR8A 5J1NA 1B70B 2V9KA 2YY3A 1X0PA 1VQ4S 2I0XA 3N6NA 1I1GA 2MKJA 4CT9A 2YXLA 2JX2A 2F8MA 3R6GB 3UCZP 5FLXU 2AX0A 3DLLQ 4DFMA 3MM6A 3U1LA 2MSTA 2C3PA 4ED1A 3OFFA 5KFAA 3M8YA 2XZTB 3TNVA 2RDIA 1JLFA 5JVHQ 3MMAB 4DEZA 2D3UA 5E2QA 4U7UD 4KHRA 2VFSA 1RGVA 1NJWA 4NASA 3IAM9 4P10A 4O3OA 2B51A 3HHKA 7AT1B 3BR9A 5F8LA 5DG7A 1CJVB 1X5TA 1C0UA 3S8SA 2LVWA 2AGQA 2VG6A 2JH3A 2ZUAA 3MCMA 2KXFA 4OJ3A 2LXUA 4YOEA 5EHHA 3MM9A 2J6SA 3KHHA 4PAAA 4ZPAA 1FJGF 3CJTA 1JXEA 1NK7A 1EIYB 2GIRA 3R2DJ 3RW6A 2O66A 1NH8A 1HHTP 2N4DA 3RBDA 5C25A 5AXMA 4LBHA 3CVKA 1YX2A 3FDSA 1T3OA 2LXIA 1R0AA 3J7AN 4QYZJ 1C4CA 2JVRA 1H7XA 4TVAB 2JLGA 3QIPB 4Y2AA 2MMYA 4OYXA 4C3LA 2M0GB 5KT5A 2KH9A 5ETTA 2E5IA 5BXIA 4LSNB 3ADAC 4QIFA 3DDKA 1H6KX 2MEWA 3H8YA 3IBFB 3PRBA 5U47A 3D9BA 5IS2A 1YVFA 2A1BA 1R6VA 5K8PA 1L5UA 4GC7A 1YRUA 4IRCA 2DNQA 3PW7A 2JVOA 5EWFA 1WSVA 2FIUA 2GVZB 3J81Y 4J9VA 2HK3A 2FY8A 2GJFA 4DV4J 3QGGA 5KFHA 1WOSA 2FHMA 1KWMA 2DRBA 4ED6A 3FSIA 4RNOA 4BC7A 5F0UA 4WCEQ 4DHVA 3DXSX 3CJQA 2AHOB 3OTOJ 4N7TA 4J9MA 3I6PA 1P6TA 2D3ZA 3J7Z5 3QO9A 2QIFA 3BJYA 3D0HE 5DQGA 2CKWA 3D68A 4QWEA 3LGMA 1C4AA 2YKNA 1X4GA 1WOOA 4Y65A 5J2QA 5KFNA 4A8OA 4LF9J 4OZ5A 1NAQA 5DG9A 2YQ3A 3BKUA 2RT3A 4DF8A 2FTRA 3IM9A 5E3PA 4RW6A 2Q6BA 2YNFA 1HPZA 3CJ0A 3FCWA 2FJXA 5LSRA 2XC9A 4HHJA 4DLEA 3B54A 2HYIB 1NPRA 5L1KA 4TU7A 2VV5A 3DLGB 2XO7A 2DISA 4YN3B 2DTJA 1KD1T 2CPEA 4IFVA 2ATLA 2BM1A 5A8KB 4LF6J 4N77A 1WNEA 1JJ4A 5JJBA 1UVIA 3FZBA 1C2PA 1VGYA 2XBPA 2M7SA 3K59A 2HFOA 4ZLLA 1BUXA 4MKYA 5L8RC 5I3UA 4LF2A 5CD4H 2EEYA 4NRUA 4WU2A 2HHUA 2V67A 3D1HA 4HI1A 1ZETA 2DNZA 2WB4A 5A2QY 2FZGB 2QMXA 3A8KA 4MK8A 4U6PA 3ZTRA 1T0TV 1HBUB 2ZZNA 3JSMA 2K7JA 3QQCD 2CG8A 2DEJA 4J9LA 1MMNA 2DH8A 4U7CA 1GNKA 4CO3A 1LW0B 2VOOA 1WUUA 4ECZA 1T9WA 1LW2B 1BQMA 1Q8LA 1WF0A 3KLIA 3HHNB 3B82A 2N7CA 2DGTA 3V5RA 1K9MT 1FX4A 2CJXB 2MY8A 1RKIA 4DV7F 2E9RX 1XERA 1NJYA 3NCQA 1QD1A 1HYSB 2YNIB 3TVZA 1U2CA 3QRQA 3RZAA 1IR1A 5D8HB 1SCJB 1GMUA 1WELA 4NLWA 1YRTA 4ZVUB 2NXJA 1S1VA 3CDBA 5T7LB 4RUAA 1NUEA 4QIGA 1FXDA 1V5VA 1U6FA 1BC6A 2UXCJ 4DX7A 3PO4A 1U0SA 3PYEA 4L76A 4I67A 2W01A 1VQYA 4JB8B 2QL5B 2MKKA 1WKJA 1T94A 2VG7A 3IG1A 3EXCX 2HHXA 2HW3A 3BO2A 2PSZA 3T3FA 2CQ2A 4OX9F 2IAJB 3BSAA 2HFZA 2ZEJA 4M94A 2FDNA 3IR5B 2FGOA 1NHKL 4DPWA 2ZH5A 4KPYA 1HR0F 3NMAA 2XNQA 4JI5F 2DXDA 1SKWA 3K17A 2UUBF 4RNMA 3KHLA 2NREA 4IR1A 3CO9A 3PCOB 4CQ1A 1HBMB 3S01A 2DH9A 4JI7J 4GKKF 1KDNA 2XZWA 3GIKA 1KVIA 2D1CA 1JX4A 3DRSB 5A8RA 4DPYA 5K8MA 2LDYA 3SQGB 5GAEI 1N33J 1IKYA 3TVKA 4HHUA 5B7WA 4ID8A 1S77D 2MB0B 1UWBA 3CWJA 1S9FA 5E0OA 2ZBIA 1NDKA 2Z2ZA 4JV1A 3KG4A 1JB0C 2OKQA 5D77A 2RE1A 2ZBQA 2RDJA 4DUZJ 2W8LA 2YWHA 4AXIA 3ZZPA 3NWRA 2XLIA 5HVHA 3GJTB 2NS1B 3DLKA 3WIVA 3QGHA 5E3CA 2LA4A 3FEXB 1HQEA 1KC8T 2OHDA 1Y3KA 2RDDA 4EU0A 5KG4A 2NSBA 5ETKA 2V2ZA 4CZCA 1HWIA 4I0WA 4LRCA 3FBBA 2HQ3A 2FVPA 3DLEB 1H98A 3KUEA 1WEZA 1FNMA 2UUAJ 4IH7A 5K8OA 4EWTA 2KJVA 3OBIA 3GG0A 2VASA 2DR7A 4KQZA 3OR2B 4IFYB 2Y9HA 8ATCB 3HM9A 2ALZA 1RBLA 3BREA 3E2EA 3EDQB 1SH0A 4DL7A 5KG7A 1FDNA 1UVJA 4QQBA 1S1WA 4Y2KA 3U1NA 1S49A 3VAIA 1U1PA 3RYLA 4JI6J 2DCLA 4MJKA 3BN4A 2BQUA 1B64A 3LWLA 4OZNA 1KP6A 3PX6A 4O4GA 3LAKA 3RRGA 1U6ZA 4JI8F 4XK8C 1X0FA 3HXMA 1X4AA 4KR0B 1Y7PA 4EYIB 3BH6B 5SUHA 3M8PB 1GFWB 3I0SB 1V3SA 3TUJC 3CUNA 4WBFA 3EE3A 1HHQA 2GAHC 4B3MJ 3LQVA 4LF5F 1YZ6A 1VDHA 4ILRA 1PIEA 4C98A 2KTQA 3PFEA 5E3AA 4OHYA 4Y3CA 2RU9A 1N5YB 2V8GA 3IM8A 1FRIA 2KFZA 3LP1A 1HQUB 2G9OA 3TA0A 1OPIA 5GMEA 4PG7A 4G1IA 4ES3A 3THPA 2M52A 4DR2J 1KEKA 3RW7A 1UJ4A 2HWHA 3NGTA 1C1CA 3V6KA 4LF7F 3I5AA 4KV8B 1NKEA 4PCQA 4DG1A 3A3PB 2MKCA 3MD1A 1I5OB 2DNKA 3QATA 1LOUA 5J1EB 5JUMA 3BO4A 5IC6B 3V4MA 3ETMA 3N28A 1RYSA 3CC7S 2MDAA 1RAOA 3PX4A 3LP0B 3Q8RB 4GMKA 1S6QB 2CRLA 2FHJA 4OX8A 1XEZA 4RU2A 4X66J 3A8JA 3L4BC 2DNPA 3M1VA 4CP5A 3U7JA 1U09A 2HWIA 2L08A 4OV6A 2CQIA 2Z2LA 2AEFA 4KO0B 3Q22A 3W66A 4CO5A 1Y4ZB 2ZOFA 2PFFB 3MCSA 4AXJA 1OY9A 2W2PP 3ENAA 1G6BA 1UPMB 3KWMA 2DYAA 4LSLA 2C3OA 5IM0A 2HNDB 2Z8QA 3CJSA 4USJC 4C97A 1KVJA 3OL8A 1X60A 3RTVA 1DZ5A 2J0XA 2ZJRQ 3KUGA 3PACA 3QNWB 4AQYF 1D9FA 1KFDA 4C11B 4X4RA 3TX8A 2KG0A 2H1YA 3KJVA 1ZZNA 4DV2F 5BYQA 1IM4A 3PHEA 3BSNA 2V34A 3NXZA 2LKZA 4ELVA 1SC4B 4YDDB 3I32A 4JOUA 5E33A 4UF4A 4P71A 3GR1A 2DD8S 4KKOA 3Q8VA 2HQGA 2KU7A 5D0GA 3TEGA 3H2LA 2BE2B 1RLDA 2E1RA 3J7YI 3W9JA 3FNNA 3W5ZA 4EBCA 1CJUA 4DR1J 3O5TB 4B9TA 1FO1A 1NXIA 3PYGA 4N8OA 3TVYA 2BZ2A 4QPTA 3K89A 1IN0A 4DSEA 3O2IA 3NBPB 4PQUB 2UP1A 3MOZA 3TOQA 3TJ9A 1H73A 3CCVS 3UR0A 5KT7A 4UT4A 3ENQA 1M0SA 1FRMA 4W98A 3HT0A 3H4BA 2DEIA 3RAMA 3KLFA 4Q5VA 2F9JA 1RK8A 2BDPA 5BYRA 3DLBA 4F4AA 3LH2S 1YI2S 2ACMA 2IBOA 3PR5B 1NJZA 1HNZF 3THVA 4OZ2A 2R2TA 2POKA 3N6LA 1VI7A 1ITPA 3T1HF 4E0DA 2EC0A 4WXWA 1N5VA 2RHQB 5F0WA 4L3NA 3ILLA 2CQBA 1SIZA 5LOQA 1NU4A 5ETSA 2VJUA 2DXEA 1X31C 3PVXA 2I2YA 1LNQA 4AYBD 1F2HA 2ZH3A 4M5LA 3P49B 4AUKA 4ETZA 3T5JA 4LUBA 3OW2R 5I4MA 5LMUF 5IV4A 4G1QB 2MQ8A 2UV8G 1TFWA 1FKOB 1ZZFA 3ONQA 2OUGA 3CMES 1KHVA 5E7OB 4C8NA 3NGKA 3R1LA 5DM6Q 1D3WA 3SSQA 2YWKA 2BW7A 2WOMB 3DGVA 3T5KA 3IRXB 3GYXB 1WORA 4TQSA 2M4MA 4YMEA 3CEDA 3POTB 1C1BB 2HHHF 3CGIA 2F65A 4CLZA 2MPUA 4WP8A 4RNFA 3GWCA 1VBKA 3RUBL 1TKTA 2BJ8A 5EUHA 4X65J 2HK2A 2VBWA 4Q0BA 2DCUB 1NHVA 4ECXA 1CLFA 4NMXA 1RBAA 2G0JA 5THWA 3HX9A 4MKBA 2H9ZA 4YHHJ 2LEPA 3I56S 3BBFA 2XYGB 3GV7B 2CPJA 4TY8A 3W9IA 2XLJA 3D67A 3CTRA 3GPAA 1VQLS 2R4FA 4L73A 4ZVGA 3EGZA 4XO0A 3VGSA 4PWWA 5B08A 4AL5A 1OJ4A 3B78A 3M2VB 2VF3A 2E5GA 4F7VA 5CCMA 3AA8A 4ZP7A 3UR3C 2BE7D 4RW9A 5LMNF 3OVAA 2KVIA 1APSA 2HHQA 2AJ0A 3FKBA 2WB1D 2OTJS 5KG6A 1FKPA 4DR6F 3MPWA 4C8YA 3QYYA 2XYPB 1Y0HA 5AXNA 1DRZA 3PTWA 4Q44A 2YWGA 2VBZA 4NPOA 2CNNB 4I7FB 2MGZB 3FGVA 4LRDA 4BLGA 4RW7A 3KLHA 4IO9Q 1S12A 3LOUA 3BPDA 1QDUB 4NE9C 2APOA 3MFIA 3W65A 2NXUA 2W9CB 1T3NA 4LRBA 3MOJB 5LXYA 4BHQA 3OFEA 3AOCA 3G8SA 2DRAA 1UVMA 1N34J 2BJ1A 3FMBA 2IHR1 2HFSA 4TYBA 4OLOA 1T9UA 4DS5A 2W4DA 2QYGA 3HVTA 2FPHX 3H5UA 5HP1B 1DQ9A 1RWUA 2AT1B 3MR3A 1IKXB 2UXDF 2RQ4A 4DSFA 3MECB 1D1UA 2G1HA 4FF3A 2PA3A 4IR9A 4EZ9A 2K3IA 3QAUA 2M5YA 3Q0AA 1HD0A 1MROB 2GJIA 4YFUA 4J9SA 2ZD1A 2IPOB 4OMFG 3M2RA 5KFLA 1XR7A 5I3PA 1FRXA 4JV5F 2Z0GA 3DRRA 4NZ6A 2V2VA 3L9ZA 5DRKA 4NZ7A 3AQPA 3NCRA 1QJHA 1LFPA 2KVQE 1TP7A 4DR5F 4QJVA 2L9NA 4IG3A 1VRUA 1S10A 1CULA 3TQEA 1JLGA 2M9KA 3IA0A 2KFNA 1K47A 2WSFC 3R2CJ 1TV6A 2IM2A 3VGUA 4OFZA 2QT7A 2XMKA 5T14A 2JSXA 1A6LA 2NCKL 3K57A 4MIAA 4J5OA 4K5SA 4ZVOB 2J8SA 1HNVA 2JRSA 4V19X 3I5BA 3OUYB 5E3QA 1FRHA 1S0VA 3UD5A 1X9SA 2XMJA 3O6QA 3FFIA 1HW9A 5KFXA 1XQIA 1SC1B 2GAGC 4HL9A 2R7OA 4B3TF 3DKDA 5KAKA 2G2OA 5MLCV 3MM7A 3OXFA 5AE1A 4LR7A 2C42A 4ED8A 1PYSB 3IGVA 2VU5A 2BANA 4I2PB 2I5JB 4PG4A 2IJNA 2RU3A 4QU7A 3OLBA 1JLQA 2VIHA 4Q8EA 1OY8A 3C6TA 2V8DA 2GVDA 3MEEB 2G4BA 2AMCB 2B4OA 2Q79A 2IA0A 2HHPA 3MCOA 1RTHB 3LWMA 3G6YA 5HQMA 1RHUB 3N9UC 1DLOB 4KE5A 1SV5B 5IT0A 1QUPA 3PIOQ 1T03A 2BOPA 2OTLS 4MK7A 1SL1A 2HGLA 4QBUA 1EX8A 4DUYF 5C2GA 4M5HA 4ECRA 3SFGA 1P9QC 5KFIA 4I68A 1TKXB 3GMGA 1RHJB 3GIMA 4IOCQ 1RT2A 3CJ3A 5HMWA 1X4CA 1QE1B 1NSAA 4P74A 2C1EB 1V5IB 4B17A 4W92B 2HEKA 4FNIA 2ZBCA 2QEXS 3PZPA 5KFKA 1Q78A 1CSJA 4ZPVR 1YZ7A 2NSCA 2J76E 4DL3A 2OFGX 4IG0A 1Z2ZA 4OZLA 3V81A 1PAUB 2IRYA 5C7PA 5KG1A 1D8ZA 4J37A 1F5CA 2M70A 1R8CA 4DV6F 1U45A 3SSRA 2FC8A 4ER8A 2AIRB 1EAYC 4OQJA 1AUSL 2WSCC 2LP4A 4WU3A 2Z2YB 2EFOA 4AFFA 3DC2A 3B8HA 1SH2A 4M5MA 2KFYA 3LPEA 4B3SJ 4N76A 2V94A 3X3UA 4DV5F 1SB6A 2JWNA 5L39A 4ED7A 2NXCA 2LCWA 5GAHU 2IYGA 1TL7A 1NK9A 1HNXJ 3MAAA 5T41A 1VS3A 2HNZB 2HQIA 1YK9A 3MGJA 3DMJA 2ZH1A 1Y00A 2FJBB 2Y1IA 2WBRA 4UOFA 3VQSA 3CCES 4OHZA 4ICLA 5EWGA 2IJFA 2QG9B 4N47A 1N56A 3DM2A 5KFOA 4NXMF 5KT4A 3F41A 1YHQS 3EUNA 4N8NA 5CABA 3CCUS 4C8ZA 4K4VA 2HQDA 2YH1A 1F9FA 3TRGA 2ZE2B 2HVDA 4KY3A 3HJVA 2F8HA 3IBCB 2MZQA 4C0OC 3W64A 1EB0A 1RTDA 3G86A 1T05B 3H5YA 5KG0A 4NLRA 3M8QA 2VG5A 4ZITA 2PDAA 3QT8A 1I94F 1IWAA 1SJ4P 1OWXA 3M6XA 1EP4A 1FTCA 1HWJA 1U0HA 2OPRB 2YWWA 3CCJS 2VDIA 2F9DA 2VQEF 2CPXA 4U8VA 1E6YA 3NG8A 2LU2A 3RR7A 1BHNA 2J7UA 2XWXA 3VQTA 2GMJA 2HWTA 5CXTA 1M5VC 3S1TA 4TKTA 4M95A 3RJMB 5C42A 2WW4A 1R43A 1RT4B 5H1SV 4I1TA 3RGIA 5C24B 2Q3PA 1AROP 1R8AA 1S1UB 5DO2A 2W7PA 3C8YA 4A8YA 3CD5A 4XTTA 1H2VZ 3A4TA 2BACA 4YY3J 3GLJA 4OI3A 1GTEA 3UD3P 1Y10A 2V0NA 1RT3B 2GIFA 4WP9A 2YWFA 5I42A 1N0UA 4EMDA 3IS9A 3TARA 4X62F 3E01B 3M8ZA 2RKIB 5KFVA 2ACYA 3DHWC 1YJVA 1SQFA 3N79A 4HT5A 4WIIA 2P9GA 3QIDA 3ENVA 5CYQA 1VBYA 1QAXA 2HBYB 2V4RA 1GK8A 2W7OA 1IBKJ 1GT8A 3FEYB 1RI7A 5H9EJ 4C8OA 1JLBB 1R0CB 1VBZA 2AJ2A 4NA2A 4ZLNA 3ZNUA 2WVEA 4EBDA 1J5EF 5DDQC 4CLSA 2QFIA 5A2QU 1KSPA 2WVBA 2WAQD 1KRPA 3LTOA 2BJEA 4E8UA 2HFNA 2HKEA 2B56A 2LQ8A 2OSRA 1PGZA 2V2QA 2MQPA 4ED0A 2VBXA 1IR0A 3MEDB 4NI2B 3MMAA 7FDRA 1IWGA 3VVUA 2R7WA 2QRRA 1ZS6A 3DGPB 2BMBA 3K5PA 4I4BA 2CQ1A 4QIVA 1X4EA 3BGUA 4LFAF 4ZVFA 3W62A 1P27B 4OHWA 4KGXB 5DM7Q 2DRDA 1YJ9S 3RB0A 3KOAA 2R2UA 1BXNA 5CZXA 3ZTPA 4K4SA 5KFEA 2IY5B 2OPQB 1CJKB 4RUCA 3AB4B 2H5JB 1FKAF 3T19A 2JLEA 2KYZA 3T1YF 2UU9F 3H5XA 2VPXB 3VAGA 3SYZA 1Y5LB 2HRTA 1R0BG 2IYIA 4C4WA 1N32J 3D28A 2GHPA 5G0RB 4ED2A 3Q8PB 5G4DA 3V4IB 1GX6A 2AZ1A 2CPDA 2AYBA 2MQOA 1DQ8A 4JI3F 5M2RA 1JLAB 4OLPA 3VF0B 3QIPA 5HVGA 3JSYA 3QLHB 1Q95G 3EXYA 2PI5A 3QSYB 3M6VA 2W2MP 2QL7B 4RBUA 4LSNA 2HSEB 4F25A 1RHQB 3CCSS 3HVWA 1T9TA 5D0HA 1FK9B 5KFQA 3GSDA 4DN0A 1E6VA 3BN7A 1T02A 4WWSA 3ETOA 2ZOGA 1OQ3A 5HBMB 3HZGA 1S72S 1GXUA 2ADBA 4R8UA 1PSDA 1NSQA 2GVZA 1OSDA 1UEVA 2HS3A 4KHMA 1WHVA 2ZWOA 3HHEA 2W2OP 4Q8FA 1HA1A 4ZKAA 1HNIB 5HI7A 3MPYA 1KQFB 2RAQA 3SIPB 1BLUA 3WHIA 3A8IA 2ZKUA 4C48A 3MR2A 4FVMA 3UE2A 3PG9A 4I2QB 3U27A 3R1HA 3FVYA 1XNQF 4WE1B 3Q8YA 4YB5A 2RS2A 3M2UA 1S1XB 2OP5A 2DGXA 4QYZK 2ZVSA 4ECQA 3AAWB 3IP0A 4LIWA 2J6TA 1S1TB 1QSYA 4UOHA 4FN5A 4AL6A 4K4TA 4PWDA 1K44A 2B5JA 2PIIA 2V2KA 4NYPA 1VYAA 1F2GA 2HAIA 2OELA 3MF5A 2JFKA 2D69A 4EUVA 2QTWA 3G82B 2HFVA 1WDDA 3VAKA 1GQEA 4I69A 2HG4A 2COLA 2G0CA 3MM5B 4CNYA 2MYFA 2FYXA 1X4FA 9ATCB 1JWWA 4FZVA 5F41A 1RLCL 4A8XA 2KRRA 2QZ8A 4K0KJ 5A8KA 2BKNA 3CCWA 5K14B 3BGRB 1F3FA 1REGX 1RT6B 4DR7F 4WFXA 1B0TA 4JBCA 2E44A 1YJ7A 2B43A 3KK2B 2CUYA 2OI2A 1Y9OA 2DR6A 1V3ZA 1WI6A 4PG6A 1LXJA 2PO4A 3GONA 4C6AA 5IWAJ 4J7CA 1TFYA 2VB6A 2JFDA 1SL2A 4P7VA 1RT5B 5KTQA 3EYZA 1SUQA 3L7UA 2FB0A 3MM6B 2NR0A 4NZ0A 1GMVA 5BYSA 1JLFB 4WFNQ 4ZMMA 5LM7E 3TEHB 3AJ2A 1LW0A 1DQAA 2F63A 1LW2A 3GFYA 4OZ3A 1T9YA 4K50A 2YH0A 1L3UA 2FVQA 4DR3F 2EFPA 1BQNA 3W5XA 2J9CA 2DNLA 3BYPA 5A6WA 4B9MA 4DL2A 3TZWA 2OGUA 1B99A 4DWIA 1WTFA 1HYSA 2EI5A 3KMSA 5L9NA 2DHGA 3MM9B 3TR5A 3IO1A 1I51B 4DL5A 2XWYA 1MLAA 2HHWA 4EBEA 3S6EA 1TL1A 2CQGA 4P73A 3UDEA 1JMTA 5T7LA 4DR6J 5LJ3Y 5C25B 1UVKA 5IZHA 2ASDA 3QWUA 3DOLA 4UQGA 2Y0BB 1FDBA 4DCJB 1R0AB 2F3JA 1TQLA 2GV1A 2FJDB 5B09A 1SIWB 2BBEA 2CQ4A 1S4EA 5KFRA 4JI0J 4S0MA 1T95A 4I6AA 4F0KA 5KFFA 2IAJA 3E3XA 2VL1A 3BBCA 2O1PA 1V6HA 3KNAA 3CSKA 1X5SA 1PYTA 3HHDA 5DGAA 3EM1A 4HACB 3JQKA 3CD7A 5KFWA 1HFEL 1IKWA 2MHNA 3P4UB 4CCHA 1K1QA 2NUHA 1DFDA 1WD6A 3UN5A 4ANCA 5B0DA 1B0VA 1RTZA 1WF2A 1BMQB 1BGXT 1SQGA 2OFHX 1VLYA 2BYCA 3ILOA 2WONB 1YG0A 3DYAA 3TUZC 3D7SB 5F8JA 4WFBQ 2QC3A 3D54A 4RZRA 2G0IA 3OL7A 3JAMY 2HFUA 5KOWA 1F9EB 1U26A 3H5SA 1FEHA 3WX4A 3QJJA 2YKMA 2C2DA 2L41A 2O5DA 1NPKA 3CJ2A 1AZSA 4DCOB 1MWYA 2YKNB 4HKQA 2R8JA 2VBYA 2AKWB 5J2QB 3R5BA 5J1PA 4PRFA 1MG7A 1NSKL 2MLZA 3SXLA 5HJYA 4KHPF 3UN2A 4ES2A 2BQRA 3H7HB 4RW6B 4JI1F 2C2NA 2YNFB 1YJUA 2H54B 4DX8H 4ANEA 3PJXA 1CJTA 4CLKA 4WXOA 3BPSP 2RRBA 3NL0A 2U2FA 1FFWB 2OEJA 3OXGA 4N41A 1REVB 2Q6CA 4DF4A 3D5MA 4DFKA 1FEEA 3WC2A 3O1LA 5HATA 1TVRA 2K06A 2K7KA 2F4FA 2XULA 2HGMA 4A8KA 3C3LA 4O3NA 1RAHB 3AQOA 2DKOB 2W9AA 5FLXY 2ASLA 1YITS 3G2XA 2KHDA 3ET6B 4F8RA 1MW7A 4USKA 3TWZA 4OI1A 4K2XA 4LFBJ 1N8RT 3VGTA 2K8GA 2C2KB 4ELUA 2BV3A 3H25A 2HZCA 4ZVSB 4ZP9A 4CLLA 3KLIB 3R5DA 2RF2B 1N88A 2YX4A 4DV0F 4ZPCA 3DRPB 1JNZB 3M8PA 4XIUA 4DSLA 4ECUA 4MTPA 5B0GA 4GKJF 3HULA 3NRBA 4DFPA 1NBEB 3VZIA 1G1XA 1F6TA 3R7SB 3PW5A 4FXVA 1NM2A 4L75A 4L3KA 2UUTA 3UCGA 4CO2A 1KN6A 1O0PA 1CC7A 2GW8A 3L7PA 3KDNA 1S1VB 4OJ1A 3BQ1A 1HQUA 2GGPB 4PYDA 3IBWA 1DTTA 2J9DE 1CEZA 1K8AT 1UMJA 3HSDA 2BM0A 3AD8C 1CPZA 1QSLA 3D1OA 2CJBA 2VG7B 4X64J 1G7CB 2FUG9 3M32A 3SMZA 3CMAS 2DO0A 1YJWS 3JYTB 3IG1B 1RZMA 1XN9A 3TA2A 4ZS6A 5J1EA 2FJVA 2B9WA 4NLVA 1ZOTA 1QAIA 2UVUA 4RPFA 3N4WA 2GX8A 2CNLB 3KG0A 2XY6A 1TK0A 2UUCF 2AP6A 1N5SA 3NOCA 2Z57B 2VQFF 4DV1J 2H5IB 2IFXA 2R7XA 1C0TA 3DXBA 1SKRA 2QLXA 1KKHA 5ETRA 1Q5VA 4OYZA 4TN2A 1Q8BA 1BD6A 2CZ4A 4NCGA 3J80U 2EFQA 1VRQC 3EDRB 3Q89A 2B6AA 1KLNA 2ZBRA 1LK7A 4ZJLA 1KLMA 3D66A 5LT5A 2K2PA 4PPDA 1ZYQA 4C11A 1RAIB 4KJIA 3B4MA 1LWCA 1O6XA 2GMHA 5F8HA 1VQ7S 3G96A 4B3RJ 4K8RA 3SI8A 1QSSA 2DHHA 3DI6B 3ZTSA 3NWGA 1VC5A 3QGIA 2JOQA 3D4JA 5HLFA 2FVCA 1QAJA 3UCUP 4A47A 4A8QA 3CDAA 2FQQB 2RSQA 1UAWA 1XR5A 1AUDA 2FHKA 1RT1B 3X1LB 1WACA 2M2BA 3TJ8A 4QR0A 3ZFVA 3FSYA 5L9XA 4DJBA 5CYMA 1HQEB 3D0GE 2FLPA 5K9FA 4X84A 4JV2A 2QA4G 4KGMA 3PM9A 2XMAA 4UY8T 4NMLA 2E29A 1FX2A 1HBNA 2J0WA 2A18A 2RUGA 1M5HA 2BQ3A 4UUWA 2F7VA 1MU2A 2RJZA 1T11A 2F5GA 1S5ZA 1I3OB 4DR4J 4ED3A 5KFUA 1AFJA 2WRMA 4LBIA 3IAS9 1ZTTA 4B02A 3WDOA 4PQAA 4KT0C 2R9LA 4OYOA 5AJ3F 2KL8A 1LWEA 1XMQF 3HF5A 5KFJA 4TU8A 2AJQA 3OR1A 3NLCA 5DDRC 1IBMJ 2P6SA 5GAHI 2GMLA 2QYCA 1EKRA 1RDRA 1XNRJ 2BXJA 4H54A 1ZPWX 2QMWA 1KNZA 2E7XA 4ZCKA 3EVOA 1SKSA 1N6QB 4KC5A 3K7RA 2EK6A 2LQ5A 4EZ6A 3BGOP 3ITHA 2CYYA 1X7VA 2KKHA 1S0MA 1EHWA 3FRZA 1YBTA 3GJQB 3FSXA 4LFCF 2MY7A 3BH7B 4MT1A 3R5JB 4ZDNA 1D0EA 2VPYB 1TKZA 3RBEA 3FEZA 4CRJA 4RU9A 4F36A 1U25A 3TO8A 1RISA 2CXEA 1FKOA 1U1MA 4CLUA 3I87A 3KK3A 4CM2A 4QPXA 3SDEB 3CJ4A 1Q5YA 4A8SA 2IRUA 5E3RA 3PJWA 3W7BA 1PCAA 3LP1B 3AOAA 4ZJQA 5GMDA 1S7IA 1OY6A 1KQSR 3NGRA 3AJ1A 1OYDA 1C1CB 4DQQA 2KZZA 3BEGB 1IKVB 3CCQS 4X4PA 1RB0A 4JI2J 2IJRA 5HROB 2IMOA 4BDPA 4QR1A 2V6AA 4I6YA 1FTRA 3QGPA 1CQNA 4ZLJA 1AW0A 3F0NA 5DETA 5KG5A 2NZ4A 3KYLA 3PHTA 4O0IA 3M1VB 3M2VA 4RX6A 2W7AA 2HS0A 2GC8A 4NLUA 2P6TA 2HPUA 1B0PA 5E5NA 2HHSA 1S6UA 3DOMB 1WG1A 4LSLB 5IM0B 1UETA 2HS4A 1ROFA 4QR2A 3TQ1A 1H2TZ 1XIQA 4DL4A 4F4XA 1BQXA 2OPSA 1S0OA 5EX0A 1W26A 1VQSA 3KMQA 2IVFB 4ZHRA 4KB7A 1RTJA 2UVWA 3V6DB 1FDDA 2F4VJ 4E2FB 3KLEB 2U1AA 3AJDA 2ERRA 3FUYA 2XG8A 1FJCA 1CBKA 3R5AA 3RB3A 1QVFR 3GTYX 4DL0C 2H4WB 2LYVA 2QLJB 2BW2A 1PO6A 1VC0A 4KKOB 1OO0B 1Q0NA 3W2WA 2VOPA 3Q2TC 4UOCA 3UVJA 1XNQJ 5D4NA 1CJUB 2BJDA 3T6BA 3KK1B 1PBUA 4DV3J 2UUWA 2AW0A 1PILA 1WOPA 5M2PA 4PXCA 1NZ8A 2RMLA 4W90B 2D9OA 1MROA 1VK8A 4DV4F 4N56A 5D6GA 2XCPA 2ZM6J 3HKWA 2CPYA 2VA2A 1DTQA 3OTOF 5KG3A 2AYMA 3HD2A 1TTHB 4V1Ak 3KLFB 2CAJA 3C46A 3WC0A 4XDCA 1TL5A 3CW2C 3MTJA 5BR8J 2E5HA 2VDHA 3PRDA 2GA7A 3CIZA 2P9EA 3C6UB 4DMZA 4MFBB 2CJKA 4LF9F 3MMCB 3FRYA 4HTIA 5DG8A 1N0VC 3LF0A 1PC4A 5D3GB 1LWFB 1JLEB 3KJFB 2HVZA 4U96A 4K4ZA 4QW9A 4NRTA 2DVIA 4KGVB 1JIHA 5HL7Q 3CJ8A 1T7PA 3KUHA 3B4DA 2MSSA 1TK8A 5KFDA 2H65B 5ETMA 4LF6F 1N5TA 2UXBJ 3PO5A 4HDHA 4ZA1A 2VPWB 4DSIA 2J9DA 3G71S 3JTNA 2I5JA 3I0RB 4OYBA 1RTIA 1DBDA 4LREA 4CH0S 2IVYA 4ECYA 2W9BA 2YKOA 1RU2A 2E9ZA 4PUOB 1URRA 1RTHA 3FK4A 4UQTA 3HDSA 3P6YC 2G2YA 1DLOA 2NLWA 2ZUGA 1TKTB 3Q2SC 1WSRA 4Y34A 3IFEA 5L46A 1NDLA 2GO9A 4TY8B 2HBQB 3SCKE 1TKXA 2G1DA 4AE5A 2HNYB 4NLQA 2ZITA 1O8BA 2YNHA 1SKUB 1J5OB 5IXUA 3OFHA 5EWEA 3L3CA 1NJIT 4TLQA 5D15A 2AGOA 2BKOA 4H4KC 3K5LA 3MWBA 4QU6A 4RW9B 2HVHA 1QUVA 3LP2A 1U1KA 1JJHA 3BDEA 1UA0A 3MXHP 2E5LJ 2QLFB 1RUSA 1H7WA 4DCPB 3QBCA 4ZCIA 2EFVA 1M1HA 4HHHA 1V3RA 3L95X 2CQ0A 1HBOB 2HVIA 2UXCF 2LA6A 1JKHB 4NYOA 5AT1B 2MKHA 4DQIA 2KB2A 2AU0A 1VQKS 2FZCB 1IUJA 4IKAA 3KLHB 4RW8A 1D9DA 2PA8D 2CADA 4IDKB 3IR6B 2FLNA 3DRXA 2C2EA 4O3QA 4FKXA 3D2WA 2ZHOA 3DFEA 3Q8QB 1RHMB 4WFZA 1X8DA 1N52B 1Q8IA 3MR7A 1FESA 1UZHA 3CE8A 3QPIA 2HNZA 3I4PA 3MTKA 1NLKL 4USVA 3U1MA 5B0CA 1TL4A 4MYUA 4OZ1A 3UO0A 2MQNA 3OTDA 4LT6A 2ZZTA 1KR4A 1Q7LB 6FDRA 2K3KA 2PFDA 3H59A 2V9WA 4JI7F 3VZHA 1TZ0A 5A8WA 2HIYA 3Q24A 5DGBA 3EZOA 2Z58B 3DRRB 2MKSA 1ZM9A 2ZE2A 1N33F 2JL9A 2WCXA 2PEHA 1Q1KA 1VOMA 4GVBB 2ZNZA 2VZ9A 1GMWD 2YX7A 4IUFA 4WYLA 1WWHA 5RUBA 3JSRA 4IG3B 3CCMS 1VRUB 8RUCA 4RWXA 2QA2A 3J7ZT 1F60B 1JLGB 4DUZF 1IVZA 3BR8A 3PRVA 2KHCA 4RBVA 2DBBA 4NXNJ 2BJ9A 1R89A 2OPRA 4O3PA 1TUWA 2XO6A 4BWJA 3M30B 3OHBA 4CYUB 2IA6A 2QL9B 1D9AA 2YQ1A 3P8BB 2ILYA 4H4OA 2DY1A 2CPIA 3IRWP 2C2RA 4ZOSA 4NWBA 3FBCA 1CC8A 3FFIB 3D3CJ 3MR6A 2UUAF 4CO4A 1YQHA 4IYQA 2PMWA 3MM7B 5J2MB 3CJKA 3O8WA 5DZ6A 4NYZA 4ZVTB 2BANB 1HWUA 3SFUA 4HR2A 1SJ1A 3FBFA 1JLQB 4R5PB 4KFBA 3C6TB 3PDNA 2DNHA 2VFRA 2GO8A 1WG5A 3VALA 4RWWA 2OSQA 3JSBA 3CCZA 1XK8A 1WC6A 4ZJOA 3HKZD 3E01A 4USUA 3AD7C 4GRSA 4MAKA 4WJBA 2N82B 4JI6F 1NPPA 1XJWB 2C3YA 3ZC4A 2JZ5A 2NPIA 1T03B 3CDUA 1VQOS 1EQMA 1RWWB 1LQ9A 3BBBA 2FY1A 2R7TA 2AV5A 3PEHA 1RWVB 1XWLA 1JLBA 2BA9A 3H40A 3Q83A 3IC1A 3W8PA 3C19A 4CI0B 2CIMA 1Y5NB 2SXLA 1RWKB 3EX7B 1NKBA 4FF2A 2XTJP 5DDOC 2PT0A 4L6V3 2QGFB 3MPUB 3W2VB 2W1BA 1RT2B 2EK1A 2HHTA 2X7IA 2XYHB 5FJ4A 3J7A1 3GQCA 1T9VA 3IR7B 2FHOB 1DURA 1LK5A 2XI2A 4FP9A 3NNHA 4Y28C 4ITSA 3PXGa 2VHGA 3OTCA 3DGPA 3Q8UA 1UTAA 3V81B 3AXMA 1UP1A 4CTAA 1TU0B 2XMUA 1EETA 5KFCA 3W5YA 4ECVA 3OXLA 2HLTA 4OYMA 4DR2F 4NA3A 4JI4J 2DNNA 2OMLA 3OL6A 2AYEA 4MMOA 3G8QA 1HQ2A 2Z56B 3OLAA 1VRTB 4AD6A 2JC1A 2NYIA 3VCDA 4ALZA 2B9XA 3MMBA 3A1YG 1B4SA 3BDPA 1S6PA 1N36J 4LF4J 3GILA 4B9SA 5H9EK 4DPUA 1RWOB 2CWXA 1RJJA 2ZC4A 3QMQA 2RD5C 3V4IA 3SV4A 2CJQA 1P1TA 3MUMP 3DMJB 4X66F 1UFKA 2RRNA 4U95A 4CLTA 1F0XA 1VQ9S 3AFGA 3UWTA 3QLHA 4JYAJ 3KFWX 3UPFA 4LF8J 1Q82T 4ICLB 4IRKA 4J9UE 2DXFA 3UQSA 4GO5X 1WC0A 2KG1A 2ABYA 3DM2B 2GHVC 2DR5A 3I5CA 4C9DA 1F5AA 4OI4A 3DU5A 2DIUA 2V4JB 1FK9A 1XMOJ 2CA9A 3OHAA 3HFVA 2EW9A 2AZ3A 1NO8A 3CDEA 4NCBA 1RAEB 1U1OA 3DU6A 1TAUA 2XSJA 4EFAC 1WEXA 5HBMA 4FS2A 2D9PA 1RTDB 2MXYA 4O4RA 1HMVA 2YX1A 5CQGA 4RW4B 1NK8A 4DQRA 2VG5B 5CZVA 3VTIA 2KJWA 4U8YA 4QIWD 5F3TA 2ZVIA 2EFGA 3N01A 2ASYA 1EP4B 3QSIA 1U0HB 2C2ZB 2YNGA 4ELTA 4DX6A 4C8LA 2OO4A 1MSWD 3OT9A 4I2QA 4RR5A 2FJAB 2CJAA 4NLDA 3T5HA 4NLGA 2V50A 1S1XA 4DR1F 2J0QD 1XC9A 1Y5IB 2EFNA 3J81j 1VQ8S 3LAMA 1KHWA 1JK9B 2FGCA 5HVFA 5C42B 3HSZA 4C0HA 4C8KA 5A6PA 2RUSA 5IV3A 3FBEA 3RAQA 1FD2A 1S7HA 3OPKA 3G82A 4URQU 4F50A 4IO1A 1M5SA 1K73T 5AXLA 2DH7A 5A0YA 2LFVA 1YRXA 3MM5A 5KFYA 4KRWA 3T9ZA 1U1NA 1FRLA 1KS2A 4A4JA 3TAPA 5I42B 1KFSA 1HNWF 4NLXA 2KI2A 5GADU 2QA4S 2HQFA 3IS9B 2LQJA 3GE9A 4Y6IA 3QJPA 2VH7A 4LSZB 4BC9A 2HLUA 4CH7A 4ZP8A 4PWUA 3Q86A 4ILLA 1OS5A 1RT6A 3DDIA 1VIXA 3G9CA 1U2FA 1MN9A 3KK2A 2A10A 1UEUA 4UZBA 4PABA 4TQRA 3GSIA 1HW8A 1Q7YT 4YB7A 3CF5Q 1SH3A 3I82A 1RHKB 3F56A 1RT5A 3AY0A 1FJGJ 4KYZA 2G2ZA 4G3IA 2DHXA 2XMVA 4K4XA 1YJRA 4OI6A 3D1QA 2NZCA 2DK2A 1JLCA 1GH8A 3PEJA 3MDFA 3MURP 2VPZB 4FVCA 4CWBA 4C3MA 5J2NA 4WF9Q 2NXNA 5LJ5Y 1X5OA 4TY9A 1HI8A 1TAQA 2IMWP 2MZTA 1YJNS 5HN0A 2F1FA 3T41A 3C14B 4ZK7M 1PBAA 2AEJA 1ZTWA 2UV8A 1J2VA 4G65A 4Q7AA 3BS9A 3OL9A 3EVMA 3M9OB 1AA1B 2CNOB 1SJ3P 1HD1A 5DLFA 1SXLA 1RADB 3F44A 1MMLA 1R7IA 4X65F 3PJ9A 3V6JA 4M5DA 2PI4A 5IT9U 2YBVA 4CO0A 4PR6A 4YHHF 2B9YA 1NB7A 2M8DB 2HRYA 5ETLA 3C66A 5M2UA 4KAIA 4F2RA 3CIMA 2IC3A 4RL1A 2RQKA 4CLWA 1VHIA 4KSEB 5HAOA 4HDGA 4Q43A 2IDEA 3G8TA 1RAGB 1F9HA 1Y3JA 5B0EA 2MLXA 1RWNB 1WKKA 3HVRA 2X3GA 1RT7B 2B7CB 3TX0A 2C28A 2EG2A 2ADCA 2XY5A 1PJ5A 4EEYA 1VIOA 4WYWA 3PKYA 3H98A 3DN9A 1QVGR 1U6BA 2CQ3A 5IOLA 1LWXA 1E6VB 2KZMA 3PR4A 3BZQA 2XGQA 1U1RA 3VAFA 2AJ1A 4X2BA 4DU7A 3TA1A 4HACA 3PY8A 1SVDA 3GIIA 4CLPA 4K4UA 3G87A 2XS7A 3SZ2A 3MPVA 2MJNA 4R8UB 4OHVA 1I6JA 4DSKA 2A2CA 4F3MA 5J2PA 4F26A 4MKVA 2LECA 4DPOA 4ZVQB 1FA0A 3SV3A 4M5NA 4ED5A 1ZBTA 4AL7A 2WONA 1N34F 2ZDOA 2OAUA 1FJEB 3GCWP 4C8MA 3LUYA 3HCXA 3UFCX 1RCOB 4U7UK 2HURA 3M2UB 4X4TA 3AB2B 3PFOA 3CMQA 2HAFA 3HD1A 3W3SA 1DAXA 3WBZA 3DRYA 4I56A 2V69A 1VJQA 1VBXA 4PWDB 4DUTA 2B5JB 1RCXB 1GTHA 4P75A 3JS9A 1RA6A 2N3LA 1EARA 2CFXA 4PXBA 2DGSA 3HO1A 4KH0B 4PKDB 1YJTA 3PYDA 3MEGB 3P5TL 3FCVA 5F9LA 2HQCA 4QIEA 3RG6A 1R3NA 3R27A 5A76A 2PD1A 3HFZB 2WSEC 3MAHA 2EBEA 1WC1A 1WJ9A 1REVA 1S99A 1TR0A 2K1RA 3FC9A 3EICA 2GJ2A 1VJWA 3FQLA 5MAOA 1BWVA 1JXLA 1EJ7L 3EGNA 3CPWR 4DV7J 3A8EA 3OSPA 3ENWA 3M6WA 1PJ6A 4O44B 4NLSA 1AB8A 3ET6A 3EMTA 1YBUA 5KFTA 2FLOA 3AT1B 3A3NB 1SUQB 3MZIA 1ZA2B 4Y00A 3LGHA 1YDLA 2I9SA 2BKPA 5C5JA 2GQ2A 5D4OA 2GS8A 2XMTA 1NK0A 2E1PA 4JV0A 2X3DA 4RUBA 2Z2MA 2RF2A 1BQNB 3A13A 3DRPA 3W8GA 3IWNC 2OD6A 2ZJQQ 3R8YA 2YTCA 4N5SA 3MM8A 5CHCB 2H5EA 1FHTA 4OX9J 1P9YA 2QLBB 3CJ5A 4WKYA 4USIA 5ETPA 4WPAA 3VVTA 4OIXA 4F0MA 1U48A 3R9LA 1HR0J 2YQ0A 4L72B 3I31A 1TL1B 2OJ3A 1ZA1B 2GGPA 3MHYA 4JI5J 3DOLB 3P5BP 2UUBJ 3D6MB 4Z37A 3KHRA 3N5BA 4GKKJ 2P9CA 1TK5A 1YKWA 5LSLA 2D7SA 2MQQA 1XBWA 2V4QA 4IH6A 3DOKA 3JYTA 4QW8A 3WZ0A 1D8YA 4DFJA 4ILMA 3GFHA 1ZH5A 4ECSA 1NK6A 1O51A 4CLYA 4HTJA 2XCAA 2DO4A 1QAYA 1FI4A 4H4MA 3HSGA 4DDFA 4WFYA 3PX0A 3SCIE 1FNXH 2EBGA 1GX5A 1UVNA 1UZDA 3MI7X 1VQ6S 2WZ1A 4F02A 1IKWB 2GFFA 2F40A 4B3SF 2Q43A 3HI9A 4DQPA 3MEKA 3C2PA 1R6YA 3HMJG 1S0NA 5IQQA 3NS7B 5D4PA 1FRKA 1U1LA 3DYAB 4ID5B 1HNXF 4LQ9A 3NEKA 1NCLA 2GIQA 4FBUA 2AJ4A 4J9PA 4DX5A 3J81U 1CS4B 1TELA 3NS6A 3HT3A 2CZ9A 5AE3A 3BSCA 4W4MA 2X51A 2YKMB 3E8OA 3GR0A 1WG4A 1MN7A 5EDWA 4OL8A 3KG1A 3DI6A 3SEOA 1AZSB 2ZC3A 3ZNJ1 4RUHA 1S9EB 4X4NA 5FIIA 2H48B 1VK3A 4Y0FA 4NCAA 1RT1A 3GJSB 1YTYA 3KDOA 3TUIC 3K5MA 3G6ES 4Z2XA 4FS1A 2HMIA 2QLWA 1S9GA 4CO1A 4QWDA 4CT8A 4CNZA 1CJTB 2EWHA 5CA5A 2J6UA 3KLGB 2M8HA 2CZVC 2E1CA 1ICEB 2J5AA 2KM8B 4LQ3A 2KRBA 4JI8J 1U7LA 4ECTA 5F8MA 4EGLA 2HZAA 2W25A 3GZ7A 4DSJA 2Y1LB 3LALA 1TVRB 3R3TA 3AODA 2MKIA 4IOAQ 5KOXA 3I4HX 3NCPA 4OYWA 3CO0P 3MUVP 4KPCA 4LF5J 4L74A 4IOBA 2UZAA 3CC2S 2NYHA 1SQEA 2LU1A 1ZM4A 3DLJA 1G4CA 3M6UA 1VC6A 2PEBA 4QYRA 2JEGA 1SL0A 2DPIA 4H4KA 4ECWA 2ROEA 4B3OB 2XZDB 4ZPDA 1UPPA 4LVOP 4YY3F 2Y1JA 1N6QA 4OZ0A 2LMIA 2ATCB 4LF7J 1RAAB 3FMWA 2JNJA 3H20A 4KGKA 2JC0A 2W4PA 4QOTA 4F67A 4YP3A 1ELOA 2VJVA 1N4LA 1JNRB 5B0BA 3LGNA 4KGZB 4P52A 2E1AA 3GV8B 3GU0A 4OX7A 3ZO7A 2L9WA 5IQ6A 2RS8A 3ILIA 1CJVA 1S4FA 4FYDA 1Z1ZA 1IBKF 1NEEA 3SDEA 3TAMB 2OEMA 4ZVHA 1BWEA 1HWLA 4A46A 2VKZG 2B8PA 4P2FA 4WKRA 1S6OA 2QMUB 5ETOA 4P2XA 1DTTB 2MZRA 2R2SA 1UCNA 4FXWA 1S97A 1FE4A 3BB5A 2XHWA 5F9NA 4R0EA 1IKVA 2R3VA 3M32B 4FXDA 3RB4A 5DJBA 4G1PA 5KT6A 3I55S 3L7OA 3ZZTA 5HROA 4YR0A 2R7VA 3H90A 4X4UA 4AQYJ 2KT5A 2OD4A 4U9RA 3BQ2A 2P2CB 3TJAA 4DV2J 3WX8A 1RHRB 1X4HA 4MK9A 1RACB 3C16B 2IM1A 1R8HA 2WTFA 4DS4A 3EGWB 3W60A 3IWLA 1C0TB 5HSPA 2M88A 3DOMA 1TKDA 3PKMA 2LQ9A 2D3O1 3KJNB 2MZJA 2CQPA 2RVJA 1CVJA 4NCGB 1WHYA 2QE5A 2O01C 1YWXA 2RRAA 4QWAA 1N32F 2ZHAA 2B6AB 2DITA 3BGFA 1U02A 1KLMB 3C15B 3W61A 3HP6A 5AE2A 1LWCB 4RKUC 2OEKA 2DGVA 3V6DA 2B4PA 5H9FJ 3KLEA 1B7YB 2OPPB 1DJ0A 4Y2MA 3NGUA 5HLFB 5LSOA 3MR5A 2NPFA 2UVRA 1TL3B 2V8HA 4USMA 1HNZJ 5KFGA 3W1YC 2V68A 5CYMB 4LF1A 5JMNA 2FVSA 3HJFA 3KK1A 4WZMA 2X1AA 4DZDA 4B9UA 3MPDA 3NNAA 2ASJA 3RB6A 2KDOA 1UFLA 3VAJA 1O5JA 3T1HJ 4LR9A 4JP8A 1HBNB 4K7QA 2I1RA 2OIHA 2J7WA 3RBXA 2E1MC 1MU2B 3HHLB 3T6JA 3DLGA 2MKYA 2L9DA 1SJRA 2B8QA 3IN5A 2RH3A 4WP3A 2HHVA 5LMUJ 5AXKA 4HI2A 3VGVA 5FDLB 4UTGA 2BJ7A 1HNWJ 5IC4B 1VLOA 1LWEB 3CC4S 3OR1B 4FYXB 2O3DA 1Q86T 3C6UA 4MFBA 4J9OA 1ZPVA 1VQ5S 3MMCA 2CVEA 3BSOA 3NOGA 2L3MA 1NKCA 4ERDA 4OYAA 1Q8KA 5D3GA 1LWFA 3BV8A 1JLEA 2VFTA 2HHHJ 3UDCA 3LANA 2HGNA 3AD9C 3E51A 3ITHB 1NK5A 3D6HB 1HBUA 3ZZRA 1WDTA 3EZUA 4M5KA 4B08A 1U1QA 3VHQA 1L3TA 1TKZB 3KLVA 4K0KF 2VD3A 3GG1A 1R8BA 1UJ5A 3H4DA 4ES1A 1F5BA 1YLXA 2V63A 2ROPA 3M05A 1MWQA 1W2IA 3I0RA 3PW0A 3GP9A 1C0UB 1W25A 1P1LA 3KK3B 4OV1A 5KFBA 2VG6B 6FD1A 1W7WA 1Z4UA 2QSWA 2YNIA 2VC1A 5IWAF 1FWLA 2IDLA 1FT8A 4LIRA 1YSJA 3IWXA 1WC5A 2ZJPQ 2LDIA 4PUOA 3TZZA 1BE4A 3NMRA 1IJFB 5LMNJ 2XNRA 2KM8C 1GMWA 4DL6A 2RB7A 3R6LB 3TP2A 1X9WA 4UOGA 4WZQA 4JUZA 3OVSA 3LPYA 3TZYA 3T9NA 2AJFE 1F3VA 3K8WA 1Q79A 1UW9A 2R7QA 1NB2A 2HNYA 3IXQA 4CDIA 1X9MA 3A3OB 1IBCB 2R8IA 3R7BB 2AWZA 4DZ6A 2BRLA 4Q2LA 1J5OA 2XS5A 2DGWA 4UZCA 3LO3A 2JJ4D 3DLHA 3OSNA 1S59A 2ZKTA 4FF1A 3HHLD 1PC5A 2E7WA 2WBMA 3Q23A 1HI0P 2NXEA 4XPEA 3J80Y 4YB6A 2Y3YA 2C3UA 2QV6A 5GADI 1PG5B 2OPSB 2QJ3A 2UXDJ 1LV5A 4J9KA 1HBOA 4OJGA 4ZHRB 3CDWA 2GZOA 1JKHA 1RTJB 2X1FA 3P96A 2Z4PA 1AXQA 1HBMA 2R8GA 5EX3A 3IMQJ 4WFAQ 4LRAA 2CPHA 2ROGA 3M8WA 2V8VA 4FYYB 1VQNS 4GC6A 5FD1A 5D0EA 3DRSA 1KTQA 4JV5J 4IDKA 1NNDA 1JJCB 4JI0F 3SQGA 2E9TA 1JQGA 3MD3A 4ZLPA 1NRKA 4X4VA 4DR5J 5L1LA 4EK2A 3WIUA 3QO9B 2YPZA 3W2WB 3CCTA 3UVJB 5GAGU 1WC3A 1WEYA 2RQMA 4I64A 2R42A 4WTYA 1JJ2R 4G6VB 4KH1B 3CULA 2BRKA 4PG8A 4EI2A 2B7BB 2CJYB 2DPJA 5K8NA 4PYAA 5L38A 3I9ZA 1S57A 2ZH4A 1RP5A 4HYKA 1HPZB 4DXLA 1UA1A 2AYGA 1MNEA 4NOHA 3CB4A 2O67A 4QWBA 3R7NB 1M5OC 3NS5A 2AEMA 4ZIWA 2D41A 1G3OA 1DTQB 1KOOA 4AT1B 1TMJA 3GCXP 3DLEA 2J9EA 2V8PA 4GVBA 4IFVB 3ZZZA 1NH7A 2VONA 4B3TJ 2B9EA 1M5KC 2FVRA 2HRUA 3VAHA 4MH8A 4NL5A 1NZAA 3OR2A 4PPZA 3SCJE 4A48A 4NLPA 1NDCA 3BYRA 4IFYA 3GB0A 4M1KA 4ENOA 3V2UC 4Y2IA 2WVCA 4DOZA 5I3UB 5B0AA 1MMDA 3GYGA 1OQ6A 1QTNB 5ITHA 3K0JA 2I6WA 3RAXA 1IQZA 4OX6A 3M30A 5DDPC 4CYUA 4URSA 2EPIA 1KOHA 4FF4A 1JXVA 2CJ9A 3CJRA 3OJUA 3JSMB 2KYXA 2ZH6A 4DU8A 3N6MA 4ZN1A 1FDAA 4FPIA 3ISZA 1ACMB 5D78A 2WVFA 2XS2A 2Y0SD 2XGPA 2W2NP 2XM3A 1KBRA 4DUYJ 5J2MA 1BQMB 2W4CA 2DGUA 4B9LA 1X4BA 3H2UB 4DPXA 1RTIB 2CDQA 4FBTA 1FXRA 4R5PA 3I0SA 9RUBA 2R7UA 1BY9A 1H72C 3US5A 3BO3A 1TUGB 1EKSA 2W9BB 2VFVA 1TMMA 3QJLA 2F8EX 2FC9A 4M5GA 1N5YA 3GV5B 5D4LA 3HHLC 4LFBF 1A9NB 3GYNA 4KIAA 3KKFA 4DV6J 3D6FB 4ZVRB 1FD8A 3AA9A 2R8KA 4NEYA 1LFWA 1VMBA 3ICLA 4KV8A 3K2YA 4ZCLA 4PG5A 2E7VA 4ETXA 3H2VE 2DNMA 1WC4A 1QLNA 1XR6A 2LEBA 2YNHB 3W2VA 4FDFA 4BBYA 5HMXA 4DV5J 4RNNA 2PE8A 2VUGA 2V5HG 1U8WA 2QX0A 4ZVPB 2YKPA 4M5JA 3BM7A 1NSPA 3LP0A 2DB1A 1H0HB 1S6QA 3LP2B 2IVMA 2DIVA 1S48A 4HH0A 2ZH9A 1N54B 1L3KA 2FLLA 1RAFB 2JEFA 4F4WA 1HL6A 1A7GE 4YS2A 1S79A 4Z7YA 1AYEA 4KO0A 2ILZA 1UEKA 1LEOA 2KXNB 1ZM2A 4NXMJ 4O0NA 1RU1A 2BJ3A 6AT1B 2GCFA 2HNDA 2XSFA 4RW8B 1RAJA 4X64F 1VRTA 2B0GA 4P2SA 1HLWA 2AGPA 1ZAWA 3JTPA 5A8RB 1N48A 2QA1A 2J0SD 1IKYB 5GVQA 3EPGA 1UWBB 1FRJA 4XDDA 4LMZA 3R97A 4B9VA 1RWXB 5KFMA 3NY0A 2BEFA 2CPFA 2LLZA 3PW2A 1SI9A 2HBRB 3QRRA 2R7RA 4K59A 3DHXA 1IXKA 1I94J 4K2JA 4DV1F 2XEXA 2GQQA 1H74A 2PMHA 1VISA 3QFHA 2AQ4A 2N4CA 1FNOA 4A8FA 1FERA 2VQEJ 4DLGA 2OH2A 2BE2A 3ZZYA 4ZPBA 3DLKB 2MJUA 5IT4A 3G4SS 5A8WB 2YVSA 3KXDA 4K4YA 2V4JA 3TUPA 1YGYA 3UDLA 2BVZA 2N7YA 2UVVA 3F73A 1RQ0A 3NBPA 3KJQB 3UD4P 4F3OA 1WI8A 4PQUA 2BUNA 1LXNA 3N0VA 4RW4A 4B3RF 4PXDA 4OJHA 2BX6A 3OTEA 4RJVA 1IBLF 2QO3A 2QN6B 3T1AA 4IQMA 2HIQA 4K5RA 4RO0A 2J7KA 2DNGA 2EXUA 3ELHA 4QCLA 4E98A 4ANDA 3O44A 2CDRB 2BR0A 1S1WB 2KT2A 5IFMA 4J9NA 4X62J 3QT5A 2MQMA 3AXKA 1NMEB 4H4OB 4FKYA 5KFPA 3B6BA 1IM6A 3JB9k 1GEHA 1OSCA 4DQSA 1L3VA 5GMKa 4O4GB 4OHXA 3M8SA 2FJWA 1SJFA 2OMOA 1DY3A 1U2RA 3CJKB 2HZVA 4DR4F 3RBZA 1EZZB 4J91A 1J5EJ 5SZTA 2PMZD 1XTZA 4KFBB 4U67Q 4ATNA 4PZVA 1LKZA 2RILA 2ZWPA 4G1QA 2KT3A 4CM0A 1UFWA 1RYRA 2XI3A 3R5GA 2NUUG 1IR2A 1IBMF 2AX1A 5DZ7A 2GQCA 1XNRF 2WOMA 1W2BR 3IRXA 1RSCA 2CQCA 2IIHA 2VFUA 4P9SA 4LFAJ 4F3QA 1OPZA 3POTA 1C1BA 5KFSA 5I3QA 1L3SA 2AD9A 3FZ2A 2WK4A 3EJMA 4LVNP 5BJRA 4BCAA 1UKUA 3JXOA 1WKLA 4DG1B 1YBAA 2VICA 3T1YJ 2UU9J 4F0HA 2QSFA 2FZKB 3BKTA 3PV8A 2PC6A 1B3TA 3EGVA 2MLYA 3SBMA 4Q2MA 3HK2A 5F8IA 4YR2A 3VAMA 2DHAA 2EKYA 3RRKA 4ZN3A 3EZ5A 2ZH2A 2MZSA 3NGSA 1M90T 3GFXA 4JI3J 4CTAB 3C14A 3FJ2A 4USWA 3VV2B 1Q53A 1EETB 1GAOA 1R31A 3ZTOA 1VHFA 1AFIA 2A3JA 4DN9A 4ZIVA 5HJXA 5CCLA 5L1IA 3N5FA 3LW5C 1FFGB 1OIAA 5DQIA 2XHCA 4JI2F 1VCTA 3W9HA 3MMBB 1S6PB 1F1BB 4I7FA 2MGZA 2Z30B 4F4KA 4ZVEA 4UUXA 1S76D 4HVZA 2DT9A 3KJVB 2CG4A 3L09A 3BQ0A 2W9CA 3MUTP
chains in the Genus database with same CATH topology
4DCPB 4ZVTB 3D6MB 4DCOB 3GJRB 3R7NB 1PYOB 3IBCB 1SC4B 1QDUB 3GJTB 2C2KB 1RHUB 5IC6B 5IC4B 5K20B 4ZVSB 2CNKB 2FQQB 2H54B 2CJXB 2XYGB 2H48B 3KJQB 2CNLB 2H5JB 1GFWB 2CNOB 3R6LB 3GJSB 2HBYB 2H4WB 2XZDB 2QLJB 4ZVOB 2H5IB 3P4UB 3P45B 1RHMB 1RWWB 2P2CB 3GJQB 3KJFB 4LSZB 4ZVUB 3SIPB 3R5JB 1RWMB 2HBQB 1QTNB 1RHRB 3R7SB 1RHJB 1I51B 1RWVB 1SC3B 2C2ZB 1BMQB 3R6GB 2QLBB 3D6HB 3D6FB 4ZVQB 1RWOB 4ZVRB 2C1EB 1ICEB 1SC1B 2QL9B 1RE1B 2H65B 1RWKB 3RJMB 1IBCB 3R7BB 3EDQB 1RWXB 2CDRB 1I3OB 2Y0BB 1RWPB 2HBRB 3EDRB 4JB8B 2XZTB 4DCJB 2QL5B 2C2MB 3NS7B 1F9EB 3QNWB 2XYHB 2CJYB 2C2OB 2H4YB 2DKOB 2XYPB 1NMEB 1RHKB 2Y1LB 3KJNB 1PAUB 2HBZB 2QL7B 4ZVPB 3IBFB 1RHQB 2QLFB 1RWNB 2CNNB 2H51B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DCP B;  4ZVT B;  3D6M B;  4DCO B;  3GJR B;  3R7N B;  1PYO B;  3IBC B;  1SC4 B;  1QDU B;  3GJT B;  2C2K B;  1RHU B;  5IC6 B;  5IC4 B;  5K20 B;  4ZVS B;  2CNK B;  2FQQ B;  2H54 B;  2CJX B;  2XYG B;  2H48 B;  3KJQ B;  2CNL B;  2H5J B;  1GFW B;  2CNO B;  3R6L B;  3GJS B;  2HBY B;  2H4W B;  2XZD B;  2QLJ B;  4ZVO B;  2H5I B;  3P4U B;  3P45 B;  1RHM B;  1RWW B;  2P2C B;  3GJQ B;  3KJF B;  4LSZ B;  4ZVU B;  3SIP B;  3R5J B;  1RWM B;  2HBQ B;  1QTN B;  1RHR B;  3R7S B;  1RHJ B;  1I51 B;  1RWV B;  1SC3 B;  2C2Z B;  1BMQ B;  3R6G B;  2QLB B;  3D6H B;  3D6F B;  4ZVQ B;  1RWO B;  4ZVR B;  2C1E B;  1ICE B;  1SC1 B;  2QL9 B;  1RE1 B;  2H65 B;  1RWK B;  3RJM B;  1IBC B;  3R7B B;  3EDQ B;  1RWX B;  2CDR B;  1I3O B;  2Y0B B;  1RWP B;  2HBR B;  3EDR B;  4JB8 B;  2XZT B;  4DCJ B;  2QL5 B;  2C2M B;  3NS7 B;  1F9E B;  3QNW B;  2XYH B;  2CJY B;  2C2O B;  2H4Y B;  2DKO B;  2XYP B;  1NME B;  1RHK B;  2Y1L B;  3KJN B;  1PAU B;  2HBZ B;  2QL7 B;  4ZVP B;  3IBF B;  1RHQ B;  2QLF B;  1RWN B;  2CNN B;  2H51 B; 
#chains in the Genus database with same CATH topology
 4UW2 A;  1WTB A;  2VA3 A;  1PYO B;  1FVQ A;  1RT7 A;  2VC0 A;  4PEO A;  3OTB A;  3ZXW A;  2XLK A;  3O3L A;  5K20 B;  1HAR A;  5C2C A;  3G6X A;  3QRP A;  2A6M A;  2CQH A;  3OVB A;  5HP1 A;  1U24 A;  3K5N A;  4BS2 A;  3ZZU A;  3EPI A;  1IKX A;  1Q81 T;  3MEC A;  3MCN A;  3QWP A;  2R7S A;  1FWK A;  3TYT A;  1U8S A;  2KN4 A;  4M8L A;  2XSJ B;  4C2M A;  5HK4 A;  4A8W A;  1RWM B;  3T5L A;  4LBP A;  1HMV B;  4FYW B;  2F4V F;  3FQK A;  2BE9 B;  4YDX A;  4V19 J;  2KO1 A;  2ZH8 A;  1WHW A;  1RE1 B;  3OQ2 A;  2P8I A;  3I9V 9;  4EO8 A;  4OYI A;  2YNG B;  1RWP B;  1RBO B;  2JDJ A;  2C2O B;  4YB1 P;  1H2U X;  2VKR A;  1FCA A;  3MFH A;  1ZM3 A;  1UJ6 A;  1WF1 A;  3ZZ0 A;  1HIY A;  3PYF A;  2W8K A;  2R8H A;  4DBQ A;  2ZHB A;  2B4V A;  3OV7 A;  4YEA A;  4LJM A;  4TNO A;  4DV3 F;  2MTL A;  2I38 A;  5HQ8 A;  2C3M A;  2FD2 A;  4TYA A;  4DR7 J;  4M5I A;  4R25 A;  4M63 A;  2M3D A;  4ZCM A;  2FHJ D;  2GHW A;  2XQC A;  3M9N B;  3CCR S;  2E5J A;  2ZM6 F;  1H38 A;  3HLU A;  2B3T B;  3OUY A;  1HWK A;  3OJS A;  3UW1 A;  2Y8W A;  2WW8 A;  1R8P A;  5JVG Q;  5A0Y B;  3NAI A;  3MEG A;  4X4S A;  5ADZ A;  2QFJ A;  4CIO A;  3BF4 A;  2PN6 A;  3WQP A;  4HH1 A;  3MAQ A;  4F4Y A;  4B9N A;  5BR8 F;  3M9M B;  4I2P A;  3TI0 A;  5CD4 A;  4QWC A;  4K4W A;  1VR6 A;  1VFJ A;  2H3E B;  3NGD A;  3RRH A;  7FD1 A;  4DR3 J;  4FYV B;  3MEE A;  2C2M B;  1OYE A;  3G6V A;  1PAE X;  4YR3 A;  5HMZ A;  1EQ0 A;  1HI1 A;  3V6H A;  5GAE U;  4P7T A;  4C3K A;  1SV5 A;  4EO6 A;  1IJE B;  3ISN D;  1WHX A;  4O44 A;  3TZX A;  4Q0B B;  2Y8Y A;  3UI3 A;  3H42 A;  1T9X A;  2UXB F;  2X1B A;  2L48 A;  1GXT A;  3S7R A;  1JLC B;  1K1S A;  3H0P A;  2DY9 A;  5J2N B;  3M7V A;  2DR8 A;  3KHG A;  1DHM A;  1M5P C;  2RHS B;  1QE1 A;  5KT2 A;  4OI0 A;  2B4U A;  3QT6 A;  4F04 B;  3TAQ A;  1CQM A;  3NKY A;  3HZE A;  1KQK A;  2IM3 A;  3DDN A;  3JQJ A;  1Z2L A;  3IGN A;  1MWZ A;  4NX9 A;  3K58 A;  2I8E A;  1FKP B;  2CWK A;  3Q8S B;  3UDV A;  1PKU A;  4OYP A;  4M5D B;  3QT7 A;  1RAB B;  4X4O A;  3ILJ A;  5L1J A;  2YKQ A;  5CH7 B;  2W2Q P;  3AH6 A;  2LXF A;  3I96 A;  4O3S A;  4RW7 B;  4P6Q A;  3R5C A;  1B7F A;  3GIR A;  4CLF A;  5EGY A;  2IC3 B;  2DR9 A;  3VR1 A;  5F8N A;  4NLY A;  4P2M A;  1Q4R A;  3P3D A;  3W63 A;  2Q66 A;  4RNH A;  3JQM A;  3K8V A;  2RNE A;  4XPC A;  4MKA A;  3QAE A;  3CCL S;  1FVS A;  3HVT B;  1U49 A;  3EWG A;  2E5L F;  3DNC A;  4USH A;  1RXO B;  2HVE A;  2DNY A;  1Y11 A;  2JLF A;  1J27 A;  5EN1 A;  1UW4 A;  1RKJ A;  2EKN A;  2DNR A;  1RA7 A;  2ZOM A;  3HFK A;  2KXH A;  2Y1R I;  3D3B J;  3CD6 S;  2ZD1 B;  3KNG A;  3M2R B;  1HKA A;  3KTQ A;  2C22 A;  4KHP J;  5J2P B;  4WK1 A;  3GFZ A;  1M1G A;  4Y2C A;  5DS7 A;  2AF6 A;  4JI1 J;  4UY8 5;  5DQH A;  1FFS B;  2ZNY A;  8AT1 B;  5ETQ A;  4ID5 A;  1T05 A;  2DJW A;  1VQM S;  4KTQ A;  1CUL B;  1CS4 A;  2N3O A;  4HLB A;  3A12 A;  1OMS A;  5HMY A;  3PW4 A;  5F3Z A;  4HT7 A;  1TV6 B;  1SC6 A;  3M8R A;  5KG2 A;  2CNK B;  2Q1L A;  5KFZ A;  1QY7 A;  1S9E A;  4Z7C A;  1HNV B;  3LA0 A;  1ZAX A;  4DPT A;  1ZAV A;  2OLW A;  1SPB P;  3PIP Q;  2ZH7 A;  2A2D A;  2ZDP A;  3D0I E;  1RT4 A;  4LRF A;  5C24 A;  2YKA A;  4GVL A;  1HHS A;  1IQT A;  1S1U A;  3ISN C;  2MZ1 A;  3KLG A;  4UST A;  1NJX A;  3HSJ A;  3TAN A;  1KON A;  1KTV A;  4RLE A;  1RT3 A;  4NXN F;  3CD0 A;  4YUD A;  1FE0 A;  3OD2 A;  2BAB A;  2K1R B;  3NNC A;  2GVD B;  3BGL A;  5E41 A;  4DV0 J;  1AT1 B;  1M1K T;  5HAN A;  1U4B A;  1SJQ A;  2EC2 A;  4KBI A;  4GKJ J;  3GJR B;  4D3H A;  3K5O A;  1URN A;  2RKI A;  4QZV B;  2MHE A;  4F2S A;  4CH1 A;  4J9Q A;  2E66 A;  2W24 A;  2ALY B;  4P72 A;  4WTO B;  1KQG B;  4LR8 A;  4FPR A;  4IRD A;  2NQP A;  1X5P A;  1K0V A;  5LXR A;  1NK4 A;  5GAG I;  4B3O A;  3P45 B;  4O3R A;  4ZP6 A;  4J9R A;  2R2R A;  4IH5 A;  1SC3 B;  3J7Y U;  4J90 A;  2MQL A;  2YWE A;  3QFW A;  3UN3 A;  2YPY A;  5B0F A;  4B3M F;  2P5V A;  3MED A;  2WVD A;  4X4Q A;  4BWM A;  3FCH A;  4NI2 A;  4FNH A;  3SSS A;  5CAA A;  3MM8 B;  1K0T A;  2JEI A;  3PNI A;  4IG0 B;  4NLO A;  3UNG C;  2H4Y B;  4I6W A;  5IT9 Y;  2IBK A;  1CG2 A;  1SBR A;  1FJ7 A;  2XY7 A;  4ZPT R;  2UUC J;  3EVW A;  3TAM A;  1UL3 A;  1UVL A;  5K5M A;  4XAK A;  2G13 A;  2VQF J;  3MMJ A;  2ZZM A;  2OPQ A;  2PGC A;  3RU0 A;  1CJK A;  3AOB A;  4DI6 A;  3HVA A;  5ETV A;  3U02 A;  4HEA 9;  4MIW A;  5CYJ A;  2GNK A;  4IQX A;  4OI2 A;  1FF2 A;  4WIQ A;  2A0F B;  3DOK B;  1TL7 B;  3M4X A;  1UWA A;  3MAA B;  2JEJ A;  2DGO A;  3OFG A;  1U47 A;  5G0R A;  3BKF A;  5D0R A;  4R0J A;  4A8M P;  1JLA A;  2EG1 A;  4H4M B;  2XMM A;  3SQO P;  2RQC A;  3C16 A;  3HPO A;  4JI4 F;  2WHO A;  4D3G A;  1QTM A;  1A0O B;  3GIJ A;  2ZFH A;  1TUV A;  2IRX A;  1R27 B;  5HO4 A;  2DGQ A;  1XMB A;  1G2E A;  4F4Z A;  3ZTQ A;  2HBZ B;  4OZJ A;  1PJ7 A;  2DHS A;  1H3D A;  1VQP S;  3ULH A;  1N36 F;  4LF4 F;  3CXC R;  5LL6 d;  4WK3 A;  5DLG A;  1ULR A;  4MYT A;  3M8Q B;  1D09 B;  3C15 A;  3NAH A;  3CT9 A;  4NLT A;  4MIB A;  1FWP A;  2XMW A;  4TU9 A;  4PXE A;  5ETN A;  2D74 B;  5KT3 A;  4NEZ A;  3AHP A;  4TLR A;  1HNI A;  2IM0 A;  1Q16 B;  4JYA F;  4YQW A;  2OPP A;  2CVI A;  2RIJ A;  2VOD A;  4LF8 F;  3NP5 A;  1IBL J;  1E6Y B;  1NHU A;  3CNQ P;  2EVZ A;  2CQD A;  4WE1 A;  1GXL A;  2FJE B;  1X4D A;  2ZBP A;  4O23 A;  4URG A;  1NDP A;  3QZ8 A;  1V9O A;  4EYH B;  3JAM U;  1P8G A;  5AJ3 J;  1S1T A;  1XMO F;  1XMQ J;  4C7Q A;  3JTO A;  3THT A;  1TL3 A;  2CPZ A;  2HMI B;  3SCL E;  3D6T B;  4Q45 A;  1S9G B;  4TXS A;  3UNY A;  3TW0 A;  4RBT A;  2X1G A;  4C0B A;  2J8A A;  2LEA A;  1YIJ S;  2XB2 D;  2H51 B;  3HHL A;  1DAR A;  1KVK A;  4ZPW R;  4LFC J;  3ZZO A;  4GO7 X;  5HQL A;  2BOA A;  4ED4 A;  2A6O A;  3DCA A;  1N5Q A;  1FXL A;  1QM9 A;  3QZ7 A;  2JHE A;  5F8G A;  5FDL A;  3VWS A;  5K14 A;  3BGR A;  5H9F K;  4NA1 A;  2D3O R;  5CYQ B;  1T8E A;  2LQB A;  2DNO A;  5JXS A;  3RR8 A;  5J1N A;  1B70 B;  2V9K A;  2YY3 A;  1X0P A;  1VQ4 S;  2I0X A;  3N6N A;  1I1G A;  2MKJ A;  4CT9 A;  2YXL A;  2JX2 A;  2F8M A;  3R6G B;  3UCZ P;  5FLX U;  2AX0 A;  3DLL Q;  4DFM A;  3MM6 A;  3U1L A;  2MST A;  2C3P A;  4ED1 A;  3OFF A;  5KFA A;  3M8Y A;  2XZT B;  3TNV A;  2RDI A;  1JLF A;  5JVH Q;  3MMA B;  4DEZ A;  2D3U A;  5E2Q A;  4U7U D;  4KHR A;  2VFS A;  1RGV A;  1NJW A;  4NAS A;  3IAM 9;  4P10 A;  4O3O A;  2B51 A;  3HHK A;  7AT1 B;  3BR9 A;  5F8L A;  5DG7 A;  1CJV B;  1X5T A;  1C0U A;  3S8S A;  2LVW A;  2AGQ A;  2VG6 A;  2JH3 A;  2ZUA A;  3MCM A;  2KXF A;  4OJ3 A;  2LXU A;  4YOE A;  5EHH A;  3MM9 A;  2J6S A;  3KHH A;  4PAA A;  4ZPA A;  1FJG F;  3CJT A;  1JXE A;  1NK7 A;  1EIY B;  2GIR A;  3R2D J;  3RW6 A;  2O66 A;  1NH8 A;  1HHT P;  2N4D A;  3RBD A;  5C25 A;  5AXM A;  4LBH A;  3CVK A;  1YX2 A;  3FDS A;  1T3O A;  2LXI A;  1R0A A;  3J7A N;  4QYZ J;  1C4C A;  2JVR A;  1H7X A;  4TVA B;  2JLG A;  3QIP B;  4Y2A A;  2MMY A;  4OYX A;  4C3L A;  2M0G B;  5KT5 A;  2KH9 A;  5ETT A;  2E5I A;  5BXI A;  4LSN B;  3ADA C;  4QIF A;  3DDK A;  1H6K X;  2MEW A;  3H8Y A;  3IBF B;  3PRB A;  5U47 A;  3D9B A;  5IS2 A;  1YVF A;  2A1B A;  1R6V A;  5K8P A;  1L5U A;  4GC7 A;  1YRU A;  4IRC A;  2DNQ A;  3PW7 A;  2JVO A;  5EWF A;  1WSV A;  2FIU A;  2GVZ B;  3J81 Y;  4J9V A;  2HK3 A;  2FY8 A;  2GJF A;  4DV4 J;  3QGG A;  5KFH A;  1WOS A;  2FHM A;  1KWM A;  2DRB A;  4ED6 A;  3FSI A;  4RNO A;  4BC7 A;  5F0U A;  4WCE Q;  4DHV A;  3DXS X;  3CJQ A;  2AHO B;  3OTO J;  4N7T A;  4J9M A;  3I6P A;  1P6T A;  2D3Z A;  3J7Z 5;  3QO9 A;  2QIF A;  3BJY A;  3D0H E;  5DQG A;  2CKW A;  3D68 A;  4QWE A;  3LGM A;  1C4A A;  2YKN A;  1X4G A;  1WOO A;  4Y65 A;  5J2Q A;  5KFN A;  4A8O A;  4LF9 J;  4OZ5 A;  1NAQ A;  5DG9 A;  2YQ3 A;  3BKU A;  2RT3 A;  4DF8 A;  2FTR A;  3IM9 A;  5E3P A;  4RW6 A;  2Q6B A;  2YNF A;  1HPZ A;  3CJ0 A;  3FCW A;  2FJX A;  5LSR A;  2XC9 A;  4HHJ A;  4DLE A;  3B54 A;  2HYI B;  1NPR A;  5L1K A;  4TU7 A;  2VV5 A;  3DLG B;  2XO7 A;  2DIS A;  4YN3 B;  2DTJ A;  1KD1 T;  2CPE A;  4IFV A;  2ATL A;  2BM1 A;  5A8K B;  4LF6 J;  4N77 A;  1WNE A;  1JJ4 A;  5JJB A;  1UVI A;  3FZB A;  1C2P A;  1VGY A;  2XBP A;  2M7S A;  3K59 A;  2HFO A;  4ZLL A;  1BUX A;  4MKY A;  5L8R C;  5I3U A;  4LF2 A;  5CD4 H;  2EEY A;  4NRU A;  4WU2 A;  2HHU A;  2V67 A;  3D1H A;  4HI1 A;  1ZET A;  2DNZ A;  2WB4 A;  5A2Q Y;  2FZG B;  2QMX A;  3A8K A;  4MK8 A;  4U6P A;  3ZTR A;  1T0T V;  1HBU B;  2ZZN A;  3JSM A;  2K7J A;  3QQC D;  2CG8 A;  2DEJ A;  4J9L A;  1MMN A;  2DH8 A;  4U7C A;  1GNK A;  4CO3 A;  1LW0 B;  2VOO A;  1WUU A;  4ECZ A;  1T9W A;  1LW2 B;  1BQM A;  1Q8L A;  1WF0 A;  3KLI A;  3HHN B;  3B82 A;  2N7C A;  2DGT A;  3V5R A;  1K9M T;  1FX4 A;  2CJX B;  2MY8 A;  1RKI A;  4DV7 F;  2E9R X;  1XER A;  1NJY A;  3NCQ A;  1QD1 A;  1HYS B;  2YNI B;  3TVZ A;  1U2C A;  3QRQ A;  3RZA A;  1IR1 A;  5D8H B;  1SCJ B;  1GMU A;  1WEL A;  4NLW A;  1YRT A;  4ZVU B;  2NXJ A;  1S1V A;  3CDB A;  5T7L B;  4RUA A;  1NUE A;  4QIG A;  1FXD A;  1V5V A;  1U6F A;  1BC6 A;  2UXC J;  4DX7 A;  3PO4 A;  1U0S A;  3PYE A;  4L76 A;  4I67 A;  2W01 A;  1VQY A;  4JB8 B;  2QL5 B;  2MKK A;  1WKJ A;  1T94 A;  2VG7 A;  3IG1 A;  3EXC X;  2HHX A;  2HW3 A;  3BO2 A;  2PSZ A;  3T3F A;  2CQ2 A;  4OX9 F;  2IAJ B;  3BSA A;  2HFZ A;  2ZEJ A;  4M94 A;  2FDN A;  3IR5 B;  2FGO A;  1NHK L;  4DPW A;  2ZH5 A;  4KPY A;  1HR0 F;  3NMA A;  2XNQ A;  4JI5 F;  2DXD A;  1SKW A;  3K17 A;  2UUB F;  4RNM A;  3KHL A;  2NRE A;  4IR1 A;  3CO9 A;  3PCO B;  4CQ1 A;  1HBM B;  3S01 A;  2DH9 A;  4JI7 J;  4GKK F;  1KDN A;  2XZW A;  3GIK A;  1KVI A;  2D1C A;  1JX4 A;  3DRS B;  5A8R A;  4DPY A;  5K8M A;  2LDY A;  3SQG B;  5GAE I;  1N33 J;  1IKY A;  3TVK A;  4HHU A;  5B7W A;  4ID8 A;  1S77 D;  2MB0 B;  1UWB A;  3CWJ A;  1S9F A;  5E0O A;  2ZBI A;  1NDK A;  2Z2Z A;  4JV1 A;  3KG4 A;  1JB0 C;  2OKQ A;  5D77 A;  2RE1 A;  2ZBQ A;  2RDJ A;  4DUZ J;  2W8L A;  2YWH A;  4AXI A;  3ZZP A;  3NWR A;  2XLI A;  5HVH A;  3GJT B;  2NS1 B;  3DLK A;  3WIV A;  3QGH A;  5E3C A;  2LA4 A;  3FEX B;  1HQE A;  1KC8 T;  2OHD A;  1Y3K A;  2RDD A;  4EU0 A;  5KG4 A;  2NSB A;  5ETK A;  2V2Z A;  4CZC A;  1HWI A;  4I0W A;  4LRC A;  3FBB A;  2HQ3 A;  2FVP A;  3DLE B;  1H98 A;  3KUE A;  1WEZ A;  1FNM A;  2UUA J;  4IH7 A;  5K8O A;  4EWT A;  2KJV A;  3OBI A;  3GG0 A;  2VAS A;  2DR7 A;  4KQZ A;  3OR2 B;  4IFY B;  2Y9H A;  8ATC B;  3HM9 A;  2ALZ A;  1RBL A;  3BRE A;  3E2E A;  3EDQ B;  1SH0 A;  4DL7 A;  5KG7 A;  1FDN A;  1UVJ A;  4QQB A;  1S1W A;  4Y2K A;  3U1N A;  1S49 A;  3VAI A;  1U1P A;  3RYL A;  4JI6 J;  2DCL A;  4MJK A;  3BN4 A;  2BQU A;  1B64 A;  3LWL A;  4OZN A;  1KP6 A;  3PX6 A;  4O4G A;  3LAK A;  3RRG A;  1U6Z A;  4JI8 F;  4XK8 C;  1X0F A;  3HXM A;  1X4A A;  4KR0 B;  1Y7P A;  4EYI B;  3BH6 B;  5SUH A;  3M8P B;  1GFW B;  3I0S B;  1V3S A;  3TUJ C;  3CUN A;  4WBF A;  3EE3 A;  1HHQ A;  2GAH C;  4B3M J;  3LQV A;  4LF5 F;  1YZ6 A;  1VDH A;  4ILR A;  1PIE A;  4C98 A;  2KTQ A;  3PFE A;  5E3A A;  4OHY A;  4Y3C A;  2RU9 A;  1N5Y B;  2V8G A;  3IM8 A;  1FRI A;  2KFZ A;  3LP1 A;  1HQU B;  2G9O A;  3TA0 A;  1OPI A;  5GME A;  4PG7 A;  4G1I A;  4ES3 A;  3THP A;  2M52 A;  4DR2 J;  1KEK A;  3RW7 A;  1UJ4 A;  2HWH A;  3NGT A;  1C1C A;  3V6K A;  4LF7 F;  3I5A A;  4KV8 B;  1NKE A;  4PCQ A;  4DG1 A;  3A3P B;  2MKC A;  3MD1 A;  1I5O B;  2DNK A;  3QAT A;  1LOU A;  5J1E B;  5JUM A;  3BO4 A;  5IC6 B;  3V4M A;  3ETM A;  3N28 A;  1RYS A;  3CC7 S;  2MDA A;  1RAO A;  3PX4 A;  3LP0 B;  3Q8R B;  4GMK A;  1S6Q B;  2CRL A;  2FHJ A;  4OX8 A;  1XEZ A;  4RU2 A;  4X66 J;  3A8J A;  3L4B C;  2DNP A;  3M1V A;  4CP5 A;  3U7J A;  1U09 A;  2HWI A;  2L08 A;  4OV6 A;  2CQI A;  2Z2L A;  2AEF A;  4KO0 B;  3Q22 A;  3W66 A;  4CO5 A;  1Y4Z B;  2ZOF A;  2PFF B;  3MCS A;  4AXJ A;  1OY9 A;  2W2P P;  3ENA A;  1G6B A;  1UPM B;  3KWM A;  2DYA A;  4LSL A;  2C3O A;  5IM0 A;  2HND B;  2Z8Q A;  3CJS A;  4USJ C;  4C97 A;  1KVJ A;  3OL8 A;  1X60 A;  3RTV A;  1DZ5 A;  2J0X A;  2ZJR Q;  3KUG A;  3PAC A;  3QNW B;  4AQY F;  1D9F A;  1KFD A;  4C11 B;  4X4R A;  3TX8 A;  2KG0 A;  2H1Y A;  3KJV A;  1ZZN A;  4DV2 F;  5BYQ A;  1IM4 A;  3PHE A;  3BSN A;  2V34 A;  3NXZ A;  2LKZ A;  4ELV A;  1SC4 B;  4YDD B;  3I32 A;  4JOU A;  5E33 A;  4UF4 A;  4P71 A;  3GR1 A;  2DD8 S;  4KKO A;  3Q8V A;  2HQG A;  2KU7 A;  5D0G A;  3TEG A;  3H2L A;  2BE2 B;  1RLD A;  2E1R A;  3J7Y I;  3W9J A;  3FNN A;  3W5Z A;  4EBC A;  1CJU A;  4DR1 J;  3O5T B;  4B9T A;  1FO1 A;  1NXI A;  3PYG A;  4N8O A;  3TVY A;  2BZ2 A;  4QPT A;  3K89 A;  1IN0 A;  4DSE A;  3O2I A;  3NBP B;  4PQU B;  2UP1 A;  3MOZ A;  3TOQ A;  3TJ9 A;  1H73 A;  3CCV S;  3UR0 A;  5KT7 A;  4UT4 A;  3ENQ A;  1M0S A;  1FRM A;  4W98 A;  3HT0 A;  3H4B A;  2DEI A;  3RAM A;  3KLF A;  4Q5V A;  2F9J A;  1RK8 A;  2BDP A;  5BYR A;  3DLB A;  4F4A A;  3LH2 S;  1YI2 S;  2ACM A;  2IBO A;  3PR5 B;  1NJZ A;  1HNZ F;  3THV A;  4OZ2 A;  2R2T A;  2POK A;  3N6L A;  1VI7 A;  1ITP A;  3T1H F;  4E0D A;  2EC0 A;  4WXW A;  1N5V A;  2RHQ B;  5F0W A;  4L3N A;  3ILL A;  2CQB A;  1SIZ A;  5LOQ A;  1NU4 A;  5ETS A;  2VJU A;  2DXE A;  1X31 C;  3PVX A;  2I2Y A;  1LNQ A;  4AYB D;  1F2H A;  2ZH3 A;  4M5L A;  3P49 B;  4AUK A;  4ETZ A;  3T5J A;  4LUB A;  3OW2 R;  5I4M A;  5LMU F;  5IV4 A;  4G1Q B;  2MQ8 A;  2UV8 G;  1TFW A;  1FKO B;  1ZZF A;  3ONQ A;  2OUG A;  3CME S;  1KHV A;  5E7O B;  4C8N A;  3NGK A;  3R1L A;  5DM6 Q;  1D3W A;  3SSQ A;  2YWK A;  2BW7 A;  2WOM B;  3DGV A;  3T5K A;  3IRX B;  3GYX B;  1WOR A;  4TQS A;  2M4M A;  4YME A;  3CED A;  3POT B;  1C1B B;  2HHH F;  3CGI A;  2F65 A;  4CLZ A;  2MPU A;  4WP8 A;  4RNF A;  3GWC A;  1VBK A;  3RUB L;  1TKT A;  2BJ8 A;  5EUH A;  4X65 J;  2HK2 A;  2VBW A;  4Q0B A;  2DCU B;  1NHV A;  4ECX A;  1CLF A;  4NMX A;  1RBA A;  2G0J A;  5THW A;  3HX9 A;  4MKB A;  2H9Z A;  4YHH J;  2LEP A;  3I56 S;  3BBF A;  2XYG B;  3GV7 B;  2CPJ A;  4TY8 A;  3W9I A;  2XLJ A;  3D67 A;  3CTR A;  3GPA A;  1VQL S;  2R4F A;  4L73 A;  4ZVG A;  3EGZ A;  4XO0 A;  3VGS A;  4PWW A;  5B08 A;  4AL5 A;  1OJ4 A;  3B78 A;  3M2V B;  2VF3 A;  2E5G A;  4F7V A;  5CCM A;  3AA8 A;  4ZP7 A;  3UR3 C;  2BE7 D;  4RW9 A;  5LMN F;  3OVA A;  2KVI A;  1APS A;  2HHQ A;  2AJ0 A;  3FKB A;  2WB1 D;  2OTJ S;  5KG6 A;  1FKP A;  4DR6 F;  3MPW A;  4C8Y A;  3QYY A;  2XYP B;  1Y0H A;  5AXN A;  1DRZ A;  3PTW A;  4Q44 A;  2YWG A;  2VBZ A;  4NPO A;  2CNN B;  4I7F B;  2MGZ B;  3FGV A;  4LRD A;  4BLG A;  4RW7 A;  3KLH A;  4IO9 Q;  1S12 A;  3LOU A;  3BPD A;  1QDU B;  4NE9 C;  2APO A;  3MFI A;  3W65 A;  2NXU A;  2W9C B;  1T3N A;  4LRB A;  3MOJ B;  5LXY A;  4BHQ A;  3OFE A;  3AOC A;  3G8S A;  2DRA A;  1UVM A;  1N34 J;  2BJ1 A;  3FMB A;  2IHR 1;  2HFS A;  4TYB A;  4OLO A;  1T9U A;  4DS5 A;  2W4D A;  2QYG A;  3HVT A;  2FPH X;  3H5U A;  5HP1 B;  1DQ9 A;  1RWU A;  2AT1 B;  3MR3 A;  1IKX B;  2UXD F;  2RQ4 A;  4DSF A;  3MEC B;  1D1U A;  2G1H A;  4FF3 A;  2PA3 A;  4IR9 A;  4EZ9 A;  2K3I A;  3QAU A;  2M5Y A;  3Q0A A;  1HD0 A;  1MRO B;  2GJI A;  4YFU A;  4J9S A;  2ZD1 A;  2IPO B;  4OMF G;  3M2R A;  5KFL A;  1XR7 A;  5I3P A;  1FRX A;  4JV5 F;  2Z0G A;  3DRR A;  4NZ6 A;  2V2V A;  3L9Z A;  5DRK A;  4NZ7 A;  3AQP A;  3NCR A;  1QJH A;  1LFP A;  2KVQ E;  1TP7 A;  4DR5 F;  4QJV A;  2L9N A;  4IG3 A;  1VRU A;  1S10 A;  1CUL A;  3TQE A;  1JLG A;  2M9K A;  3IA0 A;  2KFN A;  1K47 A;  2WSF C;  3R2C J;  1TV6 A;  2IM2 A;  3VGU A;  4OFZ A;  2QT7 A;  2XMK A;  5T14 A;  2JSX A;  1A6L A;  2NCK L;  3K57 A;  4MIA A;  4J5O A;  4K5S A;  4ZVO B;  2J8S A;  1HNV A;  2JRS A;  4V19 X;  3I5B A;  3OUY B;  5E3Q A;  1FRH A;  1S0V A;  3UD5 A;  1X9S A;  2XMJ A;  3O6Q A;  3FFI A;  1HW9 A;  5KFX A;  1XQI A;  1SC1 B;  2GAG C;  4HL9 A;  2R7O A;  4B3T F;  3DKD A;  5KAK A;  2G2O A;  5MLC V;  3MM7 A;  3OXF A;  5AE1 A;  4LR7 A;  2C42 A;  4ED8 A;  1PYS B;  3IGV A;  2VU5 A;  2BAN A;  4I2P B;  2I5J B;  4PG4 A;  2IJN A;  2RU3 A;  4QU7 A;  3OLB A;  1JLQ A;  2VIH A;  4Q8E A;  1OY8 A;  3C6T A;  2V8D A;  2GVD A;  3MEE B;  2G4B A;  2AMC B;  2B4O A;  2Q79 A;  2IA0 A;  2HHP A;  3MCO A;  1RTH B;  3LWM A;  3G6Y A;  5HQM A;  1RHU B;  3N9U C;  1DLO B;  4KE5 A;  1SV5 B;  5IT0 A;  1QUP A;  3PIO Q;  1T03 A;  2BOP A;  2OTL S;  4MK7 A;  1SL1 A;  2HGL A;  4QBU A;  1EX8 A;  4DUY F;  5C2G A;  4M5H A;  4ECR A;  3SFG A;  1P9Q C;  5KFI A;  4I68 A;  1TKX B;  3GMG A;  1RHJ B;  3GIM A;  4IOC Q;  1RT2 A;  3CJ3 A;  5HMW A;  1X4C A;  1QE1 B;  1NSA A;  4P74 A;  2C1E B;  1V5I B;  4B17 A;  4W92 B;  2HEK A;  4FNI A;  2ZBC A;  2QEX S;  3PZP A;  5KFK A;  1Q78 A;  1CSJ A;  4ZPV R;  1YZ7 A;  2NSC A;  2J76 E;  4DL3 A;  2OFG X;  4IG0 A;  1Z2Z A;  4OZL A;  3V81 A;  1PAU B;  2IRY A;  5C7P A;  5KG1 A;  1D8Z A;  4J37 A;  1F5C A;  2M70 A;  1R8C A;  4DV6 F;  1U45 A;  3SSR A;  2FC8 A;  4ER8 A;  2AIR B;  1EAY C;  4OQJ A;  1AUS L;  2WSC C;  2LP4 A;  4WU3 A;  2Z2Y B;  2EFO A;  4AFF A;  3DC2 A;  3B8H A;  1SH2 A;  4M5M A;  2KFY A;  3LPE A;  4B3S J;  4N76 A;  2V94 A;  3X3U A;  4DV5 F;  1SB6 A;  2JWN A;  5L39 A;  4ED7 A;  2NXC A;  2LCW A;  5GAH U;  2IYG A;  1TL7 A;  1NK9 A;  1HNX J;  3MAA A;  5T41 A;  1VS3 A;  2HNZ B;  2HQI A;  1YK9 A;  3MGJ A;  3DMJ A;  2ZH1 A;  1Y00 A;  2FJB B;  2Y1I A;  2WBR A;  4UOF A;  3VQS A;  3CCE S;  4OHZ A;  4ICL A;  5EWG A;  2IJF A;  2QG9 B;  4N47 A;  1N56 A;  3DM2 A;  5KFO A;  4NXM F;  5KT4 A;  3F41 A;  1YHQ S;  3EUN A;  4N8N A;  5CAB A;  3CCU S;  4C8Z A;  4K4V A;  2HQD A;  2YH1 A;  1F9F A;  3TRG A;  2ZE2 B;  2HVD A;  4KY3 A;  3HJV A;  2F8H A;  3IBC B;  2MZQ A;  4C0O C;  3W64 A;  1EB0 A;  1RTD A;  3G86 A;  1T05 B;  3H5Y A;  5KG0 A;  4NLR A;  3M8Q A;  2VG5 A;  4ZIT A;  2PDA A;  3QT8 A;  1I94 F;  1IWA A;  1SJ4 P;  1OWX A;  3M6X A;  1EP4 A;  1FTC A;  1HWJ A;  1U0H A;  2OPR B;  2YWW A;  3CCJ S;  2VDI A;  2F9D A;  2VQE F;  2CPX A;  4U8V A;  1E6Y A;  3NG8 A;  2LU2 A;  3RR7 A;  1BHN A;  2J7U A;  2XWX A;  3VQT A;  2GMJ A;  2HWT A;  5CXT A;  1M5V C;  3S1T A;  4TKT A;  4M95 A;  3RJM B;  5C42 A;  2WW4 A;  1R43 A;  1RT4 B;  5H1S V;  4I1T A;  3RGI A;  5C24 B;  2Q3P A;  1ARO P;  1R8A A;  1S1U B;  5DO2 A;  2W7P A;  3C8Y A;  4A8Y A;  3CD5 A;  4XTT A;  1H2V Z;  3A4T A;  2BAC A;  4YY3 J;  3GLJ A;  4OI3 A;  1GTE A;  3UD3 P;  1Y10 A;  2V0N A;  1RT3 B;  2GIF A;  4WP9 A;  2YWF A;  5I42 A;  1N0U A;  4EMD A;  3IS9 A;  3TAR A;  4X62 F;  3E01 B;  3M8Z A;  2RKI B;  5KFV A;  2ACY A;  3DHW C;  1YJV A;  1SQF A;  3N79 A;  4HT5 A;  4WII A;  2P9G A;  3QID A;  3ENV A;  5CYQ A;  1VBY A;  1QAX A;  2HBY B;  2V4R A;  1GK8 A;  2W7O A;  1IBK J;  1GT8 A;  3FEY B;  1RI7 A;  5H9E J;  4C8O A;  1JLB B;  1R0C B;  1VBZ A;  2AJ2 A;  4NA2 A;  4ZLN A;  3ZNU A;  2WVE A;  4EBD A;  1J5E F;  5DDQ C;  4CLS A;  2QFI A;  5A2Q U;  1KSP A;  2WVB A;  2WAQ D;  1KRP A;  3LTO A;  2BJE A;  4E8U A;  2HFN A;  2HKE A;  2B56 A;  2LQ8 A;  2OSR A;  1PGZ A;  2V2Q A;  2MQP A;  4ED0 A;  2VBX A;  1IR0 A;  3MED B;  4NI2 B;  3MMA A;  7FDR A;  1IWG A;  3VVU A;  2R7W A;  2QRR A;  1ZS6 A;  3DGP B;  2BMB A;  3K5P A;  4I4B A;  2CQ1 A;  4QIV A;  1X4E A;  3BGU A;  4LFA F;  4ZVF A;  3W62 A;  1P27 B;  4OHW A;  4KGX B;  5DM7 Q;  2DRD A;  1YJ9 S;  3RB0 A;  3KOA A;  2R2U A;  1BXN A;  5CZX A;  3ZTP A;  4K4S A;  5KFE A;  2IY5 B;  2OPQ B;  1CJK B;  4RUC A;  3AB4 B;  2H5J B;  1FKA F;  3T19 A;  2JLE A;  2KYZ A;  3T1Y F;  2UU9 F;  3H5X A;  2VPX B;  3VAG A;  3SYZ A;  1Y5L B;  2HRT A;  1R0B G;  2IYI A;  4C4W A;  1N32 J;  3D28 A;  2GHP A;  5G0R B;  4ED2 A;  3Q8P B;  5G4D A;  3V4I B;  1GX6 A;  2AZ1 A;  2CPD A;  2AYB A;  2MQO A;  1DQ8 A;  4JI3 F;  5M2R A;  1JLA B;  4OLP A;  3VF0 B;  3QIP A;  5HVG A;  3JSY A;  3QLH B;  1Q95 G;  3EXY A;  2PI5 A;  3QSY B;  3M6V A;  2W2M P;  2QL7 B;  4RBU A;  4LSN A;  2HSE B;  4F25 A;  1RHQ B;  3CCS S;  3HVW A;  1T9T A;  5D0H A;  1FK9 B;  5KFQ A;  3GSD A;  4DN0 A;  1E6V A;  3BN7 A;  1T02 A;  4WWS A;  3ETO A;  2ZOG A;  1OQ3 A;  5HBM B;  3HZG A;  1S72 S;  1GXU A;  2ADB A;  4R8U A;  1PSD A;  1NSQ A;  2GVZ A;  1OSD A;  1UEV A;  2HS3 A;  4KHM A;  1WHV A;  2ZWO A;  3HHE A;  2W2O P;  4Q8F A;  1HA1 A;  4ZKA A;  1HNI B;  5HI7 A;  3MPY A;  1KQF B;  2RAQ A;  3SIP B;  1BLU A;  3WHI A;  3A8I A;  2ZKU A;  4C48 A;  3MR2 A;  4FVM A;  3UE2 A;  3PG9 A;  4I2Q B;  3U27 A;  3R1H A;  3FVY A;  1XNQ F;  4WE1 B;  3Q8Y A;  4YB5 A;  2RS2 A;  3M2U A;  1S1X B;  2OP5 A;  2DGX A;  4QYZ K;  2ZVS A;  4ECQ A;  3AAW B;  3IP0 A;  4LIW A;  2J6T A;  1S1T B;  1QSY A;  4UOH A;  4FN5 A;  4AL6 A;  4K4T A;  4PWD A;  1K44 A;  2B5J A;  2PII A;  2V2K A;  4NYP A;  1VYA A;  1F2G A;  2HAI A;  2OEL A;  3MF5 A;  2JFK A;  2D69 A;  4EUV A;  2QTW A;  3G82 B;  2HFV A;  1WDD A;  3VAK A;  1GQE A;  4I69 A;  2HG4 A;  2COL A;  2G0C A;  3MM5 B;  4CNY A;  2MYF A;  2FYX A;  1X4F A;  9ATC B;  1JWW A;  4FZV A;  5F41 A;  1RLC L;  4A8X A;  2KRR A;  2QZ8 A;  4K0K J;  5A8K A;  2BKN A;  3CCW A;  5K14 B;  3BGR B;  1F3F A;  1REG X;  1RT6 B;  4DR7 F;  4WFX A;  1B0T A;  4JBC A;  2E44 A;  1YJ7 A;  2B43 A;  3KK2 B;  2CUY A;  2OI2 A;  1Y9O A;  2DR6 A;  1V3Z A;  1WI6 A;  4PG6 A;  1LXJ A;  2PO4 A;  3GON A;  4C6A A;  5IWA J;  4J7C A;  1TFY A;  2VB6 A;  2JFD A;  1SL2 A;  4P7V A;  1RT5 B;  5KTQ A;  3EYZ A;  1SUQ A;  3L7U A;  2FB0 A;  3MM6 B;  2NR0 A;  4NZ0 A;  1GMV A;  5BYS A;  1JLF B;  4WFN Q;  4ZMM A;  5LM7 E;  3TEH B;  3AJ2 A;  1LW0 A;  1DQA A;  2F63 A;  1LW2 A;  3GFY A;  4OZ3 A;  1T9Y A;  4K50 A;  2YH0 A;  1L3U A;  2FVQ A;  4DR3 F;  2EFP A;  1BQN A;  3W5X A;  2J9C A;  2DNL A;  3BYP A;  5A6W A;  4B9M A;  4DL2 A;  3TZW A;  2OGU A;  1B99 A;  4DWI A;  1WTF A;  1HYS A;  2EI5 A;  3KMS A;  5L9N A;  2DHG A;  3MM9 B;  3TR5 A;  3IO1 A;  1I51 B;  4DL5 A;  2XWY A;  1MLA A;  2HHW A;  4EBE A;  3S6E A;  1TL1 A;  2CQG A;  4P73 A;  3UDE A;  1JMT A;  5T7L A;  4DR6 J;  5LJ3 Y;  5C25 B;  1UVK A;  5IZH A;  2ASD A;  3QWU A;  3DOL A;  4UQG A;  2Y0B B;  1FDB A;  4DCJ B;  1R0A B;  2F3J A;  1TQL A;  2GV1 A;  2FJD B;  5B09 A;  1SIW B;  2BBE A;  2CQ4 A;  1S4E A;  5KFR A;  4JI0 J;  4S0M A;  1T95 A;  4I6A A;  4F0K A;  5KFF A;  2IAJ A;  3E3X A;  2VL1 A;  3BBC A;  2O1P A;  1V6H A;  3KNA A;  3CSK A;  1X5S A;  1PYT A;  3HHD A;  5DGA A;  3EM1 A;  4HAC B;  3JQK A;  3CD7 A;  5KFW A;  1HFE L;  1IKW A;  2MHN A;  3P4U B;  4CCH A;  1K1Q A;  2NUH A;  1DFD A;  1WD6 A;  3UN5 A;  4ANC A;  5B0D A;  1B0V A;  1RTZ A;  1WF2 A;  1BMQ B;  1BGX T;  1SQG A;  2OFH X;  1VLY A;  2BYC A;  3ILO A;  2WON B;  1YG0 A;  3DYA A;  3TUZ C;  3D7S B;  5F8J A;  4WFB Q;  2QC3 A;  3D54 A;  4RZR A;  2G0I A;  3OL7 A;  3JAM Y;  2HFU A;  5KOW A;  1F9E B;  1U26 A;  3H5S A;  1FEH A;  3WX4 A;  3QJJ A;  2YKM A;  2C2D A;  2L41 A;  2O5D A;  1NPK A;  3CJ2 A;  1AZS A;  4DCO B;  1MWY A;  2YKN B;  4HKQ A;  2R8J A;  2VBY A;  2AKW B;  5J2Q B;  3R5B A;  5J1P A;  4PRF A;  1MG7 A;  1NSK L;  2MLZ A;  3SXL A;  5HJY A;  4KHP F;  3UN2 A;  4ES2 A;  2BQR A;  3H7H B;  4RW6 B;  4JI1 F;  2C2N A;  2YNF B;  1YJU A;  2H54 B;  4DX8 H;  4ANE A;  3PJX A;  1CJT A;  4CLK A;  4WXO A;  3BPS P;  2RRB A;  3NL0 A;  2U2F A;  1FFW B;  2OEJ A;  3OXG A;  4N41 A;  1REV B;  2Q6C A;  4DF4 A;  3D5M A;  4DFK A;  1FEE A;  3WC2 A;  3O1L A;  5HAT A;  1TVR A;  2K06 A;  2K7K A;  2F4F A;  2XUL A;  2HGM A;  4A8K A;  3C3L A;  4O3N A;  1RAH B;  3AQO A;  2DKO B;  2W9A A;  5FLX Y;  2ASL A;  1YIT S;  3G2X A;  2KHD A;  3ET6 B;  4F8R A;  1MW7 A;  4USK A;  3TWZ A;  4OI1 A;  4K2X A;  4LFB J;  1N8R T;  3VGT A;  2K8G A;  2C2K B;  4ELU A;  2BV3 A;  3H25 A;  2HZC A;  4ZVS B;  4ZP9 A;  4CLL A;  3KLI B;  3R5D A;  2RF2 B;  1N88 A;  2YX4 A;  4DV0 F;  4ZPC A;  3DRP B;  1JNZ B;  3M8P A;  4XIU A;  4DSL A;  4ECU A;  4MTP A;  5B0G A;  4GKJ F;  3HUL A;  3NRB A;  4DFP A;  1NBE B;  3VZI A;  1G1X A;  1F6T A;  3R7S B;  3PW5 A;  4FXV A;  1NM2 A;  4L75 A;  4L3K A;  2UUT A;  3UCG A;  4CO2 A;  1KN6 A;  1O0P A;  1CC7 A;  2GW8 A;  3L7P A;  3KDN A;  1S1V B;  4OJ1 A;  3BQ1 A;  1HQU A;  2GGP B;  4PYD A;  3IBW A;  1DTT A;  2J9D E;  1CEZ A;  1K8A T;  1UMJ A;  3HSD A;  2BM0 A;  3AD8 C;  1CPZ A;  1QSL A;  3D1O A;  2CJB A;  2VG7 B;  4X64 J;  1G7C B;  2FUG 9;  3M32 A;  3SMZ A;  3CMA S;  2DO0 A;  1YJW S;  3JYT B;  3IG1 B;  1RZM A;  1XN9 A;  3TA2 A;  4ZS6 A;  5J1E A;  2FJV A;  2B9W A;  4NLV A;  1ZOT A;  1QAI A;  2UVU A;  4RPF A;  3N4W A;  2GX8 A;  2CNL B;  3KG0 A;  2XY6 A;  1TK0 A;  2UUC F;  2AP6 A;  1N5S A;  3NOC A;  2Z57 B;  2VQF F;  4DV1 J;  2H5I B;  2IFX A;  2R7X A;  1C0T A;  3DXB A;  1SKR A;  2QLX A;  1KKH A;  5ETR A;  1Q5V A;  4OYZ A;  4TN2 A;  1Q8B A;  1BD6 A;  2CZ4 A;  4NCG A;  3J80 U;  2EFQ A;  1VRQ C;  3EDR B;  3Q89 A;  2B6A A;  1KLN A;  2ZBR A;  1LK7 A;  4ZJL A;  1KLM A;  3D66 A;  5LT5 A;  2K2P A;  4PPD A;  1ZYQ A;  4C11 A;  1RAI B;  4KJI A;  3B4M A;  1LWC A;  1O6X A;  2GMH A;  5F8H A;  1VQ7 S;  3G96 A;  4B3R J;  4K8R A;  3SI8 A;  1QSS A;  2DHH A;  3DI6 B;  3ZTS A;  3NWG A;  1VC5 A;  3QGI A;  2JOQ A;  3D4J A;  5HLF A;  2FVC A;  1QAJ A;  3UCU P;  4A47 A;  4A8Q A;  3CDA A;  2FQQ B;  2RSQ A;  1UAW A;  1XR5 A;  1AUD A;  2FHK A;  1RT1 B;  3X1L B;  1WAC A;  2M2B A;  3TJ8 A;  4QR0 A;  3ZFV A;  3FSY A;  5L9X A;  4DJB A;  5CYM A;  1HQE B;  3D0G E;  2FLP A;  5K9F A;  4X84 A;  4JV2 A;  2QA4 G;  4KGM A;  3PM9 A;  2XMA A;  4UY8 T;  4NML A;  2E29 A;  1FX2 A;  1HBN A;  2J0W A;  2A18 A;  2RUG A;  1M5H A;  2BQ3 A;  4UUW A;  2F7V A;  1MU2 A;  2RJZ A;  1T11 A;  2F5G A;  1S5Z A;  1I3O B;  4DR4 J;  4ED3 A;  5KFU A;  1AFJ A;  2WRM A;  4LBI A;  3IAS 9;  1ZTT A;  4B02 A;  3WDO A;  4PQA A;  4KT0 C;  2R9L A;  4OYO A;  5AJ3 F;  2KL8 A;  1LWE A;  1XMQ F;  3HF5 A;  5KFJ A;  4TU8 A;  2AJQ A;  3OR1 A;  3NLC A;  5DDR C;  1IBM J;  2P6S A;  5GAH I;  2GML A;  2QYC A;  1EKR A;  1RDR A;  1XNR J;  2BXJ A;  4H54 A;  1ZPW X;  2QMW A;  1KNZ A;  2E7X A;  4ZCK A;  3EVO A;  1SKS A;  1N6Q B;  4KC5 A;  3K7R A;  2EK6 A;  2LQ5 A;  4EZ6 A;  3BGO P;  3ITH A;  2CYY A;  1X7V A;  2KKH A;  1S0M A;  1EHW A;  3FRZ A;  1YBT A;  3GJQ B;  3FSX A;  4LFC F;  2MY7 A;  3BH7 B;  4MT1 A;  3R5J B;  4ZDN A;  1D0E A;  2VPY B;  1TKZ A;  3RBE A;  3FEZ A;  4CRJ A;  4RU9 A;  4F36 A;  1U25 A;  3TO8 A;  1RIS A;  2CXE A;  1FKO A;  1U1M A;  4CLU A;  3I87 A;  3KK3 A;  4CM2 A;  4QPX A;  3SDE B;  3CJ4 A;  1Q5Y A;  4A8S A;  2IRU A;  5E3R A;  3PJW A;  3W7B A;  1PCA A;  3LP1 B;  3AOA A;  4ZJQ A;  5GMD A;  1S7I A;  1OY6 A;  1KQS R;  3NGR A;  3AJ1 A;  1OYD A;  1C1C B;  4DQQ A;  2KZZ A;  3BEG B;  1IKV B;  3CCQ S;  4X4P A;  1RB0 A;  4JI2 J;  2IJR A;  5HRO B;  2IMO A;  4BDP A;  4QR1 A;  2V6A A;  4I6Y A;  1FTR A;  3QGP A;  1CQN A;  4ZLJ A;  1AW0 A;  3F0N A;  5DET A;  5KG5 A;  2NZ4 A;  3KYL A;  3PHT A;  4O0I A;  3M1V B;  3M2V A;  4RX6 A;  2W7A A;  2HS0 A;  2GC8 A;  4NLU A;  2P6T A;  2HPU A;  1B0P A;  5E5N A;  2HHS A;  1S6U A;  3DOM B;  1WG1 A;  4LSL B;  5IM0 B;  1UET A;  2HS4 A;  1ROF A;  4QR2 A;  3TQ1 A;  1H2T Z;  1XIQ A;  4DL4 A;  4F4X A;  1BQX A;  2OPS A;  1S0O A;  5EX0 A;  1W26 A;  1VQS A;  3KMQ A;  2IVF B;  4ZHR A;  4KB7 A;  1RTJ A;  2UVW A;  3V6D B;  1FDD A;  2F4V J;  4E2F B;  3KLE B;  2U1A A;  3AJD A;  2ERR A;  3FUY A;  2XG8 A;  1FJC A;  1CBK A;  3R5A A;  3RB3 A;  1QVF R;  3GTY X;  4DL0 C;  2H4W B;  2LYV A;  2QLJ B;  2BW2 A;  1PO6 A;  1VC0 A;  4KKO B;  1OO0 B;  1Q0N A;  3W2W A;  2VOP A;  3Q2T C;  4UOC A;  3UVJ A;  1XNQ J;  5D4N A;  1CJU B;  2BJD A;  3T6B A;  3KK1 B;  1PBU A;  4DV3 J;  2UUW A;  2AW0 A;  1PIL A;  1WOP A;  5M2P A;  4PXC A;  1NZ8 A;  2RML A;  4W90 B;  2D9O A;  1MRO A;  1VK8 A;  4DV4 F;  4N56 A;  5D6G A;  2XCP A;  2ZM6 J;  3HKW A;  2CPY A;  2VA2 A;  1DTQ A;  3OTO F;  5KG3 A;  2AYM A;  3HD2 A;  1TTH B;  4V1A k;  3KLF B;  2CAJ A;  3C46 A;  3WC0 A;  4XDC A;  1TL5 A;  3CW2 C;  3MTJ A;  5BR8 J;  2E5H A;  2VDH A;  3PRD A;  2GA7 A;  3CIZ A;  2P9E A;  3C6U B;  4DMZ A;  4MFB B;  2CJK A;  4LF9 F;  3MMC B;  3FRY A;  4HTI A;  5DG8 A;  1N0V C;  3LF0 A;  1PC4 A;  5D3G B;  1LWF B;  1JLE B;  3KJF B;  2HVZ A;  4U96 A;  4K4Z A;  4QW9 A;  4NRT A;  2DVI A;  4KGV B;  1JIH A;  5HL7 Q;  3CJ8 A;  1T7P A;  3KUH A;  3B4D A;  2MSS A;  1TK8 A;  5KFD A;  2H65 B;  5ETM A;  4LF6 F;  1N5T A;  2UXB J;  3PO5 A;  4HDH A;  4ZA1 A;  2VPW B;  4DSI A;  2J9D A;  3G71 S;  3JTN A;  2I5J A;  3I0R B;  4OYB A;  1RTI A;  1DBD A;  4LRE A;  4CH0 S;  2IVY A;  4ECY A;  2W9B A;  2YKO A;  1RU2 A;  2E9Z A;  4PUO B;  1URR A;  1RTH A;  3FK4 A;  4UQT A;  3HDS A;  3P6Y C;  2G2Y A;  1DLO A;  2NLW A;  2ZUG A;  1TKT B;  3Q2S C;  1WSR A;  4Y34 A;  3IFE A;  5L46 A;  1NDL A;  2GO9 A;  4TY8 B;  2HBQ B;  3SCK E;  1TKX A;  2G1D A;  4AE5 A;  2HNY B;  4NLQ A;  2ZIT A;  1O8B A;  2YNH A;  1SKU B;  1J5O B;  5IXU A;  3OFH A;  5EWE A;  3L3C A;  1NJI T;  4TLQ A;  5D15 A;  2AGO A;  2BKO A;  4H4K C;  3K5L A;  3MWB A;  4QU6 A;  4RW9 B;  2HVH A;  1QUV A;  3LP2 A;  1U1K A;  1JJH A;  3BDE A;  1UA0 A;  3MXH P;  2E5L J;  2QLF B;  1RUS A;  1H7W A;  4DCP B;  3QBC A;  4ZCI A;  2EFV A;  1M1H A;  4HHH A;  1V3R A;  3L95 X;  2CQ0 A;  1HBO B;  2HVI A;  2UXC F;  2LA6 A;  1JKH B;  4NYO A;  5AT1 B;  2MKH A;  4DQI A;  2KB2 A;  2AU0 A;  1VQK S;  2FZC B;  1IUJ A;  4IKA A;  3KLH B;  4RW8 A;  1D9D A;  2PA8 D;  2CAD A;  4IDK B;  3IR6 B;  2FLN A;  3DRX A;  2C2E A;  4O3Q A;  4FKX A;  3D2W A;  2ZHO A;  3DFE A;  3Q8Q B;  1RHM B;  4WFZ A;  1X8D A;  1N52 B;  1Q8I A;  3MR7 A;  1FES A;  1UZH A;  3CE8 A;  3QPI A;  2HNZ A;  3I4P A;  3MTK A;  1NLK L;  4USV A;  3U1M A;  5B0C A;  1TL4 A;  4MYU A;  4OZ1 A;  3UO0 A;  2MQN A;  3OTD A;  4LT6 A;  2ZZT A;  1KR4 A;  1Q7L B;  6FDR A;  2K3K A;  2PFD A;  3H59 A;  2V9W A;  4JI7 F;  3VZH A;  1TZ0 A;  5A8W A;  2HIY A;  3Q24 A;  5DGB A;  3EZO A;  2Z58 B;  3DRR B;  2MKS A;  1ZM9 A;  2ZE2 A;  1N33 F;  2JL9 A;  2WCX A;  2PEH A;  1Q1K A;  1VOM A;  4GVB B;  2ZNZ A;  2VZ9 A;  1GMW D;  2YX7 A;  4IUF A;  4WYL A;  1WWH A;  5RUB A;  3JSR A;  4IG3 B;  3CCM S;  1VRU B;  8RUC A;  4RWX A;  2QA2 A;  3J7Z T;  1F60 B;  1JLG B;  4DUZ F;  1IVZ A;  3BR8 A;  3PRV A;  2KHC A;  4RBV A;  2DBB A;  4NXN J;  2BJ9 A;  1R89 A;  2OPR A;  4O3P A;  1TUW A;  2XO6 A;  4BWJ A;  3M30 B;  3OHB A;  4CYU B;  2IA6 A;  2QL9 B;  1D9A A;  2YQ1 A;  3P8B B;  2ILY A;  4H4O A;  2DY1 A;  2CPI A;  3IRW P;  2C2R A;  4ZOS A;  4NWB A;  3FBC A;  1CC8 A;  3FFI B;  3D3C J;  3MR6 A;  2UUA F;  4CO4 A;  1YQH A;  4IYQ A;  2PMW A;  3MM7 B;  5J2M B;  3CJK A;  3O8W A;  5DZ6 A;  4NYZ A;  4ZVT B;  2BAN B;  1HWU A;  3SFU A;  4HR2 A;  1SJ1 A;  3FBF A;  1JLQ B;  4R5P B;  4KFB A;  3C6T B;  3PDN A;  2DNH A;  2VFR A;  2GO8 A;  1WG5 A;  3VAL A;  4RWW A;  2OSQ A;  3JSB A;  3CCZ A;  1XK8 A;  1WC6 A;  4ZJO A;  3HKZ D;  3E01 A;  4USU A;  3AD7 C;  4GRS A;  4MAK A;  4WJB A;  2N82 B;  4JI6 F;  1NPP A;  1XJW B;  2C3Y A;  3ZC4 A;  2JZ5 A;  2NPI A;  1T03 B;  3CDU A;  1VQO S;  1EQM A;  1RWW B;  1LQ9 A;  3BBB A;  2FY1 A;  2R7T A;  2AV5 A;  3PEH A;  1RWV B;  1XWL A;  1JLB A;  2BA9 A;  3H40 A;  3Q83 A;  3IC1 A;  3W8P A;  3C19 A;  4CI0 B;  2CIM A;  1Y5N B;  2SXL A;  1RWK B;  3EX7 B;  1NKB A;  4FF2 A;  2XTJ P;  5DDO C;  2PT0 A;  4L6V 3;  2QGF B;  3MPU B;  3W2V B;  2W1B A;  1RT2 B;  2EK1 A;  2HHT A;  2X7I A;  2XYH B;  5FJ4 A;  3J7A 1;  3GQC A;  1T9V A;  3IR7 B;  2FHO B;  1DUR A;  1LK5 A;  2XI2 A;  4FP9 A;  3NNH A;  4Y28 C;  4ITS A;  3PXG a;  2VHG A;  3OTC A;  3DGP A;  3Q8U A;  1UTA A;  3V81 B;  3AXM A;  1UP1 A;  4CTA A;  1TU0 B;  2XMU A;  1EET A;  5KFC A;  3W5Y A;  4ECV A;  3OXL A;  2HLT A;  4OYM A;  4DR2 F;  4NA3 A;  4JI4 J;  2DNN A;  2OML A;  3OL6 A;  2AYE A;  4MMO A;  3G8Q A;  1HQ2 A;  2Z56 B;  3OLA A;  1VRT B;  4AD6 A;  2JC1 A;  2NYI A;  3VCD A;  4ALZ A;  2B9X A;  3MMB A;  3A1Y G;  1B4S A;  3BDP A;  1S6P A;  1N36 J;  4LF4 J;  3GIL A;  4B9S A;  5H9E K;  4DPU A;  1RWO B;  2CWX A;  1RJJ A;  2ZC4 A;  3QMQ A;  2RD5 C;  3V4I A;  3SV4 A;  2CJQ A;  1P1T A;  3MUM P;  3DMJ B;  4X66 F;  1UFK A;  2RRN A;  4U95 A;  4CLT A;  1F0X A;  1VQ9 S;  3AFG A;  3UWT A;  3QLH A;  4JYA J;  3KFW X;  3UPF A;  4LF8 J;  1Q82 T;  4ICL B;  4IRK A;  4J9U E;  2DXF A;  3UQS A;  4GO5 X;  1WC0 A;  2KG1 A;  2ABY A;  3DM2 B;  2GHV C;  2DR5 A;  3I5C A;  4C9D A;  1F5A A;  4OI4 A;  3DU5 A;  2DIU A;  2V4J B;  1FK9 A;  1XMO J;  2CA9 A;  3OHA A;  3HFV A;  2EW9 A;  2AZ3 A;  1NO8 A;  3CDE A;  4NCB A;  1RAE B;  1U1O A;  3DU6 A;  1TAU A;  2XSJ A;  4EFA C;  1WEX A;  5HBM A;  4FS2 A;  2D9P A;  1RTD B;  2MXY A;  4O4R A;  1HMV A;  2YX1 A;  5CQG A;  4RW4 B;  1NK8 A;  4DQR A;  2VG5 B;  5CZV A;  3VTI A;  2KJW A;  4U8Y A;  4QIW D;  5F3T A;  2ZVI A;  2EFG A;  3N01 A;  2ASY A;  1EP4 B;  3QSI A;  1U0H B;  2C2Z B;  2YNG A;  4ELT A;  4DX6 A;  4C8L A;  2OO4 A;  1MSW D;  3OT9 A;  4I2Q A;  4RR5 A;  2FJA B;  2CJA A;  4NLD A;  3T5H A;  4NLG A;  2V50 A;  1S1X A;  4DR1 F;  2J0Q D;  1XC9 A;  1Y5I B;  2EFN A;  3J81 j;  1VQ8 S;  3LAM A;  1KHW A;  1JK9 B;  2FGC A;  5HVF A;  5C42 B;  3HSZ A;  4C0H A;  4C8K A;  5A6P A;  2RUS A;  5IV3 A;  3FBE A;  3RAQ A;  1FD2 A;  1S7H A;  3OPK A;  3G82 A;  4URQ U;  4F50 A;  4IO1 A;  1M5S A;  1K73 T;  5AXL A;  2DH7 A;  5A0Y A;  2LFV A;  1YRX A;  3MM5 A;  5KFY A;  4KRW A;  3T9Z A;  1U1N A;  1FRL A;  1KS2 A;  4A4J A;  3TAP A;  5I42 B;  1KFS A;  1HNW F;  4NLX A;  2KI2 A;  5GAD U;  2QA4 S;  2HQF A;  3IS9 B;  2LQJ A;  3GE9 A;  4Y6I A;  3QJP A;  2VH7 A;  4LSZ B;  4BC9 A;  2HLU A;  4CH7 A;  4ZP8 A;  4PWU A;  3Q86 A;  4ILL A;  1OS5 A;  1RT6 A;  3DDI A;  1VIX A;  3G9C A;  1U2F A;  1MN9 A;  3KK2 A;  2A10 A;  1UEU A;  4UZB A;  4PAB A;  4TQR A;  3GSI A;  1HW8 A;  1Q7Y T;  4YB7 A;  3CF5 Q;  1SH3 A;  3I82 A;  1RHK B;  3F56 A;  1RT5 A;  3AY0 A;  1FJG J;  4KYZ A;  2G2Z A;  4G3I A;  2DHX A;  2XMV A;  4K4X A;  1YJR A;  4OI6 A;  3D1Q A;  2NZC A;  2DK2 A;  1JLC A;  1GH8 A;  3PEJ A;  3MDF A;  3MUR P;  2VPZ B;  4FVC A;  4CWB A;  4C3M A;  5J2N A;  4WF9 Q;  2NXN A;  5LJ5 Y;  1X5O A;  4TY9 A;  1HI8 A;  1TAQ A;  2IMW P;  2MZT A;  1YJN S;  5HN0 A;  2F1F A;  3T41 A;  3C14 B;  4ZK7 M;  1PBA A;  2AEJ A;  1ZTW A;  2UV8 A;  1J2V A;  4G65 A;  4Q7A A;  3BS9 A;  3OL9 A;  3EVM A;  3M9O B;  1AA1 B;  2CNO B;  1SJ3 P;  1HD1 A;  5DLF A;  1SXL A;  1RAD B;  3F44 A;  1MML A;  1R7I A;  4X65 F;  3PJ9 A;  3V6J A;  4M5D A;  2PI4 A;  5IT9 U;  2YBV A;  4CO0 A;  4PR6 A;  4YHH F;  2B9Y A;  1NB7 A;  2M8D B;  2HRY A;  5ETL A;  3C66 A;  5M2U A;  4KAI A;  4F2R A;  3CIM A;  2IC3 A;  4RL1 A;  2RQK A;  4CLW A;  1VHI A;  4KSE B;  5HAO A;  4HDG A;  4Q43 A;  2IDE A;  3G8T A;  1RAG B;  1F9H A;  1Y3J A;  5B0E A;  2MLX A;  1RWN B;  1WKK A;  3HVR A;  2X3G A;  1RT7 B;  2B7C B;  3TX0 A;  2C28 A;  2EG2 A;  2ADC A;  2XY5 A;  1PJ5 A;  4EEY A;  1VIO A;  4WYW A;  3PKY A;  3H98 A;  3DN9 A;  1QVG R;  1U6B A;  2CQ3 A;  5IOL A;  1LWX A;  1E6V B;  2KZM A;  3PR4 A;  3BZQ A;  2XGQ A;  1U1R A;  3VAF A;  2AJ1 A;  4X2B A;  4DU7 A;  3TA1 A;  4HAC A;  3PY8 A;  1SVD A;  3GII A;  4CLP A;  4K4U A;  3G87 A;  2XS7 A;  3SZ2 A;  3MPV A;  2MJN A;  4R8U B;  4OHV A;  1I6J A;  4DSK A;  2A2C A;  4F3M A;  5J2P A;  4F26 A;  4MKV A;  2LEC A;  4DPO A;  4ZVQ B;  1FA0 A;  3SV3 A;  4M5N A;  4ED5 A;  1ZBT A;  4AL7 A;  2WON A;  1N34 F;  2ZDO A;  2OAU A;  1FJE B;  3GCW P;  4C8M A;  3LUY A;  3HCX A;  3UFC X;  1RCO B;  4U7U K;  2HUR A;  3M2U B;  4X4T A;  3AB2 B;  3PFO A;  3CMQ A;  2HAF A;  3HD1 A;  3W3S A;  1DAX A;  3WBZ A;  3DRY A;  4I56 A;  2V69 A;  1VJQ A;  1VBX A;  4PWD B;  4DUT A;  2B5J B;  1RCX B;  1GTH A;  4P75 A;  3JS9 A;  1RA6 A;  2N3L A;  1EAR A;  2CFX A;  4PXB A;  2DGS A;  3HO1 A;  4KH0 B;  4PKD B;  1YJT A;  3PYD A;  3MEG B;  3P5T L;  3FCV A;  5F9L A;  2HQC A;  4QIE A;  3RG6 A;  1R3N A;  3R27 A;  5A76 A;  2PD1 A;  3HFZ B;  2WSE C;  3MAH A;  2EBE A;  1WC1 A;  1WJ9 A;  1REV A;  1S99 A;  1TR0 A;  2K1R A;  3FC9 A;  3EIC A;  2GJ2 A;  1VJW A;  3FQL A;  5MAO A;  1BWV A;  1JXL A;  1EJ7 L;  3EGN A;  3CPW R;  4DV7 J;  3A8E A;  3OSP A;  3ENW A;  3M6W A;  1PJ6 A;  4O44 B;  4NLS A;  1AB8 A;  3ET6 A;  3EMT A;  1YBU A;  5KFT A;  2FLO A;  3AT1 B;  3A3N B;  1SUQ B;  3MZI A;  1ZA2 B;  4Y00 A;  3LGH A;  1YDL A;  2I9S A;  2BKP A;  5C5J A;  2GQ2 A;  5D4O A;  2GS8 A;  2XMT A;  1NK0 A;  2E1P A;  4JV0 A;  2X3D A;  4RUB A;  2Z2M A;  2RF2 A;  1BQN B;  3A13 A;  3DRP A;  3W8G A;  3IWN C;  2OD6 A;  2ZJQ Q;  3R8Y A;  2YTC A;  4N5S A;  3MM8 A;  5CHC B;  2H5E A;  1FHT A;  4OX9 J;  1P9Y A;  2QLB B;  3CJ5 A;  4WKY A;  4USI A;  5ETP A;  4WPA A;  3VVT A;  4OIX A;  4F0M A;  1U48 A;  3R9L A;  1HR0 J;  2YQ0 A;  4L72 B;  3I31 A;  1TL1 B;  2OJ3 A;  1ZA1 B;  2GGP A;  3MHY A;  4JI5 J;  3DOL B;  3P5B P;  2UUB J;  3D6M B;  4Z37 A;  3KHR A;  3N5B A;  4GKK J;  2P9C A;  1TK5 A;  1YKW A;  5LSL A;  2D7S A;  2MQQ A;  1XBW A;  2V4Q A;  4IH6 A;  3DOK A;  3JYT A;  4QW8 A;  3WZ0 A;  1D8Y A;  4DFJ A;  4ILM A;  3GFH A;  1ZH5 A;  4ECS A;  1NK6 A;  1O51 A;  4CLY A;  4HTJ A;  2XCA A;  2DO4 A;  1QAY A;  1FI4 A;  4H4M A;  3HSG A;  4DDF A;  4WFY A;  3PX0 A;  3SCI E;  1FNX H;  2EBG A;  1GX5 A;  1UVN A;  1UZD A;  3MI7 X;  1VQ6 S;  2WZ1 A;  4F02 A;  1IKW B;  2GFF A;  2F40 A;  4B3S F;  2Q43 A;  3HI9 A;  4DQP A;  3MEK A;  3C2P A;  1R6Y A;  3HMJ G;  1S0N A;  5IQQ A;  3NS7 B;  5D4P A;  1FRK A;  1U1L A;  3DYA B;  4ID5 B;  1HNX F;  4LQ9 A;  3NEK A;  1NCL A;  2GIQ A;  4FBU A;  2AJ4 A;  4J9P A;  4DX5 A;  3J81 U;  1CS4 B;  1TEL A;  3NS6 A;  3HT3 A;  2CZ9 A;  5AE3 A;  3BSC A;  4W4M A;  2X51 A;  2YKM B;  3E8O A;  3GR0 A;  1WG4 A;  1MN7 A;  5EDW A;  4OL8 A;  3KG1 A;  3DI6 A;  3SEO A;  1AZS B;  2ZC3 A;  3ZNJ 1;  4RUH A;  1S9E B;  4X4N A;  5FII A;  2H48 B;  1VK3 A;  4Y0F A;  4NCA A;  1RT1 A;  3GJS B;  1YTY A;  3KDO A;  3TUI C;  3K5M A;  3G6E S;  4Z2X A;  4FS1 A;  2HMI A;  2QLW A;  1S9G A;  4CO1 A;  4QWD A;  4CT8 A;  4CNZ A;  1CJT B;  2EWH A;  5CA5 A;  2J6U A;  3KLG B;  2M8H A;  2CZV C;  2E1C A;  1ICE B;  2J5A A;  2KM8 B;  4LQ3 A;  2KRB A;  4JI8 J;  1U7L A;  4ECT A;  5F8M A;  4EGL A;  2HZA A;  2W25 A;  3GZ7 A;  4DSJ A;  2Y1L B;  3LAL A;  1TVR B;  3R3T A;  3AOD A;  2MKI A;  4IOA Q;  5KOX A;  3I4H X;  3NCP A;  4OYW A;  3CO0 P;  3MUV P;  4KPC A;  4LF5 J;  4L74 A;  4IOB A;  2UZA A;  3CC2 S;  2NYH A;  1SQE A;  2LU1 A;  1ZM4 A;  3DLJ A;  1G4C A;  3M6U A;  1VC6 A;  2PEB A;  4QYR A;  2JEG A;  1SL0 A;  2DPI A;  4H4K A;  4ECW A;  2ROE A;  4B3O B;  2XZD B;  4ZPD A;  1UPP A;  4LVO P;  4YY3 F;  2Y1J A;  1N6Q A;  4OZ0 A;  2LMI A;  2ATC B;  4LF7 J;  1RAA B;  3FMW A;  2JNJ A;  3H20 A;  4KGK A;  2JC0 A;  2W4P A;  4QOT A;  4F67 A;  4YP3 A;  1ELO A;  2VJV A;  1N4L A;  1JNR B;  5B0B A;  3LGN A;  4KGZ B;  4P52 A;  2E1A A;  3GV8 B;  3GU0 A;  4OX7 A;  3ZO7 A;  2L9W A;  5IQ6 A;  2RS8 A;  3ILI A;  1CJV A;  1S4F A;  4FYD A;  1Z1Z A;  1IBK F;  1NEE A;  3SDE A;  3TAM B;  2OEM A;  4ZVH A;  1BWE A;  1HWL A;  4A46 A;  2VKZ G;  2B8P A;  4P2F A;  4WKR A;  1S6O A;  2QMU B;  5ETO A;  4P2X A;  1DTT B;  2MZR A;  2R2S A;  1UCN A;  4FXW A;  1S97 A;  1FE4 A;  3BB5 A;  2XHW A;  5F9N A;  4R0E A;  1IKV A;  2R3V A;  3M32 B;  4FXD A;  3RB4 A;  5DJB A;  4G1P A;  5KT6 A;  3I55 S;  3L7O A;  3ZZT A;  5HRO A;  4YR0 A;  2R7V A;  3H90 A;  4X4U A;  4AQY J;  2KT5 A;  2OD4 A;  4U9R A;  3BQ2 A;  2P2C B;  3TJA A;  4DV2 J;  3WX8 A;  1RHR B;  1X4H A;  4MK9 A;  1RAC B;  3C16 B;  2IM1 A;  1R8H A;  2WTF A;  4DS4 A;  3EGW B;  3W60 A;  3IWL A;  1C0T B;  5HSP A;  2M88 A;  3DOM A;  1TKD A;  3PKM A;  2LQ9 A;  2D3O 1;  3KJN B;  2MZJ A;  2CQP A;  2RVJ A;  1CVJ A;  4NCG B;  1WHY A;  2QE5 A;  2O01 C;  1YWX A;  2RRA A;  4QWA A;  1N32 F;  2ZHA A;  2B6A B;  2DIT A;  3BGF A;  1U02 A;  1KLM B;  3C15 B;  3W61 A;  3HP6 A;  5AE2 A;  1LWC B;  4RKU C;  2OEK A;  2DGV A;  3V6D A;  2B4P A;  5H9F J;  3KLE A;  1B7Y B;  2OPP B;  1DJ0 A;  4Y2M A;  3NGU A;  5HLF B;  5LSO A;  3MR5 A;  2NPF A;  2UVR A;  1TL3 B;  2V8H A;  4USM A;  1HNZ J;  5KFG A;  3W1Y C;  2V68 A;  5CYM B;  4LF1 A;  5JMN A;  2FVS A;  3HJF A;  3KK1 A;  4WZM A;  2X1A A;  4DZD A;  4B9U A;  3MPD A;  3NNA A;  2ASJ A;  3RB6 A;  2KDO A;  1UFL A;  3VAJ A;  1O5J A;  3T1H J;  4LR9 A;  4JP8 A;  1HBN B;  4K7Q A;  2I1R A;  2OIH A;  2J7W A;  3RBX A;  2E1M C;  1MU2 B;  3HHL B;  3T6J A;  3DLG A;  2MKY A;  2L9D A;  1SJR A;  2B8Q A;  3IN5 A;  2RH3 A;  4WP3 A;  2HHV A;  5LMU J;  5AXK A;  4HI2 A;  3VGV A;  5FDL B;  4UTG A;  2BJ7 A;  1HNW J;  5IC4 B;  1VLO A;  1LWE B;  3CC4 S;  3OR1 B;  4FYX B;  2O3D A;  1Q86 T;  3C6U A;  4MFB A;  4J9O A;  1ZPV A;  1VQ5 S;  3MMC A;  2CVE A;  3BSO A;  3NOG A;  2L3M A;  1NKC A;  4ERD A;  4OYA A;  1Q8K A;  5D3G A;  1LWF A;  3BV8 A;  1JLE A;  2VFT A;  2HHH J;  3UDC A;  3LAN A;  2HGN A;  3AD9 C;  3E51 A;  3ITH B;  1NK5 A;  3D6H B;  1HBU A;  3ZZR A;  1WDT A;  3EZU A;  4M5K A;  4B08 A;  1U1Q A;  3VHQ A;  1L3T A;  1TKZ B;  3KLV A;  4K0K F;  2VD3 A;  3GG1 A;  1R8B A;  1UJ5 A;  3H4D A;  4ES1 A;  1F5B A;  1YLX A;  2V63 A;  2ROP A;  3M05 A;  1MWQ A;  1W2I A;  3I0R A;  3PW0 A;  3GP9 A;  1C0U B;  1W25 A;  1P1L A;  3KK3 B;  4OV1 A;  5KFB A;  2VG6 B;  6FD1 A;  1W7W A;  1Z4U A;  2QSW A;  2YNI A;  2VC1 A;  5IWA F;  1FWL A;  2IDL A;  1FT8 A;  4LIR A;  1YSJ A;  3IWX A;  1WC5 A;  2ZJP Q;  2LDI A;  4PUO A;  3TZZ A;  1BE4 A;  3NMR A;  1IJF B;  5LMN J;  2XNR A;  2KM8 C;  1GMW A;  4DL6 A;  2RB7 A;  3R6L B;  3TP2 A;  1X9W A;  4UOG A;  4WZQ A;  4JUZ A;  3OVS A;  3LPY A;  3TZY A;  3T9N A;  2AJF E;  1F3V A;  3K8W A;  1Q79 A;  1UW9 A;  2R7Q A;  1NB2 A;  2HNY A;  3IXQ A;  4CDI A;  1X9M A;  3A3O B;  1IBC B;  2R8I A;  3R7B B;  2AWZ A;  4DZ6 A;  2BRL A;  4Q2L A;  1J5O A;  2XS5 A;  2DGW A;  4UZC A;  3LO3 A;  2JJ4 D;  3DLH A;  3OSN A;  1S59 A;  2ZKT A;  4FF1 A;  3HHL D;  1PC5 A;  2E7W A;  2WBM A;  3Q23 A;  1HI0 P;  2NXE A;  4XPE A;  3J80 Y;  4YB6 A;  2Y3Y A;  2C3U A;  2QV6 A;  5GAD I;  1PG5 B;  2OPS B;  2QJ3 A;  2UXD J;  1LV5 A;  4J9K A;  1HBO A;  4OJG A;  4ZHR B;  3CDW A;  2GZO A;  1JKH A;  1RTJ B;  2X1F A;  3P96 A;  2Z4P A;  1AXQ A;  1HBM A;  2R8G A;  5EX3 A;  3IMQ J;  4WFA Q;  4LRA A;  2CPH A;  2ROG A;  3M8W A;  2V8V A;  4FYY B;  1VQN S;  4GC6 A;  5FD1 A;  5D0E A;  3DRS A;  1KTQ A;  4JV5 J;  4IDK A;  1NND A;  1JJC B;  4JI0 F;  3SQG A;  2E9T A;  1JQG A;  3MD3 A;  4ZLP A;  1NRK A;  4X4V A;  4DR5 J;  5L1L A;  4EK2 A;  3WIU A;  3QO9 B;  2YPZ A;  3W2W B;  3CCT A;  3UVJ B;  5GAG U;  1WC3 A;  1WEY A;  2RQM A;  4I64 A;  2R42 A;  4WTY A;  1JJ2 R;  4G6V B;  4KH1 B;  3CUL A;  2BRK A;  4PG8 A;  4EI2 A;  2B7B B;  2CJY B;  2DPJ A;  5K8N A;  4PYA A;  5L38 A;  3I9Z A;  1S57 A;  2ZH4 A;  1RP5 A;  4HYK A;  1HPZ B;  4DXL A;  1UA1 A;  2AYG A;  1MNE A;  4NOH A;  3CB4 A;  2O67 A;  4QWB A;  3R7N B;  1M5O C;  3NS5 A;  2AEM A;  4ZIW A;  2D41 A;  1G3O A;  1DTQ B;  1KOO A;  4AT1 B;  1TMJ A;  3GCX P;  3DLE A;  2J9E A;  2V8P A;  4GVB A;  4IFV B;  3ZZZ A;  1NH7 A;  2VON A;  4B3T J;  2B9E A;  1M5K C;  2FVR A;  2HRU A;  3VAH A;  4MH8 A;  4NL5 A;  1NZA A;  3OR2 A;  4PPZ A;  3SCJ E;  4A48 A;  4NLP A;  1NDC A;  3BYR A;  4IFY A;  3GB0 A;  4M1K A;  4ENO A;  3V2U C;  4Y2I A;  2WVC A;  4DOZ A;  5I3U B;  5B0A A;  1MMD A;  3GYG A;  1OQ6 A;  1QTN B;  5ITH A;  3K0J A;  2I6W A;  3RAX A;  1IQZ A;  4OX6 A;  3M30 A;  5DDP C;  4CYU A;  4URS A;  2EPI A;  1KOH A;  4FF4 A;  1JXV A;  2CJ9 A;  3CJR A;  3OJU A;  3JSM B;  2KYX A;  2ZH6 A;  4DU8 A;  3N6M A;  4ZN1 A;  1FDA A;  4FPI A;  3ISZ A;  1ACM B;  5D78 A;  2WVF A;  2XS2 A;  2Y0S D;  2XGP A;  2W2N P;  2XM3 A;  1KBR A;  4DUY J;  5J2M A;  1BQM B;  2W4C A;  2DGU A;  4B9L A;  1X4B A;  3H2U B;  4DPX A;  1RTI B;  2CDQ A;  4FBT A;  1FXR A;  4R5P A;  3I0S A;  9RUB A;  2R7U A;  1BY9 A;  1H72 C;  3US5 A;  3BO3 A;  1TUG B;  1EKS A;  2W9B B;  2VFV A;  1TMM A;  3QJL A;  2F8E X;  2FC9 A;  4M5G A;  1N5Y A;  3GV5 B;  5D4L A;  3HHL C;  4LFB F;  1A9N B;  3GYN A;  4KIA A;  3KKF A;  4DV6 J;  3D6F B;  4ZVR B;  1FD8 A;  3AA9 A;  2R8K A;  4NEY A;  1LFW A;  1VMB A;  3ICL A;  4KV8 A;  3K2Y A;  4ZCL A;  4PG5 A;  2E7V A;  4ETX A;  3H2V E;  2DNM A;  1WC4 A;  1QLN A;  1XR6 A;  2LEB A;  2YNH B;  3W2V A;  4FDF A;  4BBY A;  5HMX A;  4DV5 J;  4RNN A;  2PE8 A;  2VUG A;  2V5H G;  1U8W A;  2QX0 A;  4ZVP B;  2YKP A;  4M5J A;  3BM7 A;  1NSP A;  3LP0 A;  2DB1 A;  1H0H B;  1S6Q A;  3LP2 B;  2IVM A;  2DIV A;  1S48 A;  4HH0 A;  2ZH9 A;  1N54 B;  1L3K A;  2FLL A;  1RAF B;  2JEF A;  4F4W A;  1HL6 A;  1A7G E;  4YS2 A;  1S79 A;  4Z7Y A;  1AYE A;  4KO0 A;  2ILZ A;  1UEK A;  1LEO A;  2KXN B;  1ZM2 A;  4NXM J;  4O0N A;  1RU1 A;  2BJ3 A;  6AT1 B;  2GCF A;  2HND A;  2XSF A;  4RW8 B;  1RAJ A;  4X64 F;  1VRT A;  2B0G A;  4P2S A;  1HLW A;  2AGP A;  1ZAW A;  3JTP A;  5A8R B;  1N48 A;  2QA1 A;  2J0S D;  1IKY B;  5GVQ A;  3EPG A;  1UWB B;  1FRJ A;  4XDD A;  4LMZ A;  3R97 A;  4B9V A;  1RWX B;  5KFM A;  3NY0 A;  2BEF A;  2CPF A;  2LLZ A;  3PW2 A;  1SI9 A;  2HBR B;  3QRR A;  2R7R A;  4K59 A;  3DHX A;  1IXK A;  1I94 J;  4K2J A;  4DV1 F;  2XEX A;  2GQQ A;  1H74 A;  2PMH A;  1VIS A;  3QFH A;  2AQ4 A;  2N4C A;  1FNO A;  4A8F A;  1FER A;  2VQE J;  4DLG A;  2OH2 A;  2BE2 A;  3ZZY A;  4ZPB A;  3DLK B;  2MJU A;  5IT4 A;  3G4S S;  5A8W B;  2YVS A;  3KXD A;  4K4Y A;  2V4J A;  3TUP A;  1YGY A;  3UDL A;  2BVZ A;  2N7Y A;  2UVV A;  3F73 A;  1RQ0 A;  3NBP A;  3KJQ B;  3UD4 P;  4F3O A;  1WI8 A;  4PQU A;  2BUN A;  1LXN A;  3N0V A;  4RW4 A;  4B3R F;  4PXD A;  4OJH A;  2BX6 A;  3OTE A;  4RJV A;  1IBL F;  2QO3 A;  2QN6 B;  3T1A A;  4IQM A;  2HIQ A;  4K5R A;  4RO0 A;  2J7K A;  2DNG A;  2EXU A;  3ELH A;  4QCL A;  4E98 A;  4AND A;  3O44 A;  2CDR B;  2BR0 A;  1S1W B;  2KT2 A;  5IFM A;  4J9N A;  4X62 J;  3QT5 A;  2MQM A;  3AXK A;  1NME B;  4H4O B;  4FKY A;  5KFP A;  3B6B A;  1IM6 A;  3JB9 k;  1GEH A;  1OSC A;  4DQS A;  1L3V A;  5GMK a;  4O4G B;  4OHX A;  3M8S A;  2FJW A;  1SJF A;  2OMO A;  1DY3 A;  1U2R A;  3CJK B;  2HZV A;  4DR4 F;  3RBZ A;  1EZZ B;  4J91 A;  1J5E J;  5SZT A;  2PMZ D;  1XTZ A;  4KFB B;  4U67 Q;  4ATN A;  4PZV A;  1LKZ A;  2RIL A;  2ZWP A;  4G1Q A;  2KT3 A;  4CM0 A;  1UFW A;  1RYR A;  2XI3 A;  3R5G A;  2NUU G;  1IR2 A;  1IBM F;  2AX1 A;  5DZ7 A;  2GQC A;  1XNR F;  2WOM A;  1W2B R;  3IRX A;  1RSC A;  2CQC A;  2IIH A;  2VFU A;  4P9S A;  4LFA J;  4F3Q A;  1OPZ A;  3POT A;  1C1B A;  5KFS A;  5I3Q A;  1L3S A;  2AD9 A;  3FZ2 A;  2WK4 A;  3EJM A;  4LVN P;  5BJR A;  4BCA A;  1UKU A;  3JXO A;  1WKL A;  4DG1 B;  1YBA A;  2VIC A;  3T1Y J;  2UU9 J;  4F0H A;  2QSF A;  2FZK B;  3BKT A;  3PV8 A;  2PC6 A;  1B3T A;  3EGV A;  2MLY A;  3SBM A;  4Q2M A;  3HK2 A;  5F8I A;  4YR2 A;  3VAM A;  2DHA A;  2EKY A;  3RRK A;  4ZN3 A;  3EZ5 A;  2ZH2 A;  2MZS A;  3NGS A;  1M90 T;  3GFX A;  4JI3 J;  4CTA B;  3C14 A;  3FJ2 A;  4USW A;  3VV2 B;  1Q53 A;  1EET B;  1GAO A;  1R31 A;  3ZTO A;  1VHF A;  1AFI A;  2A3J A;  4DN9 A;  4ZIV A;  5HJX A;  5CCL A;  5L1I A;  3N5F A;  3LW5 C;  1FFG B;  1OIA A;  5DQI A;  2XHC A;  4JI2 F;  1VCT A;  3W9H A;  3MMB B;  1S6P B;  1F1B B;  4I7F A;  2MGZ A;  2Z30 B;  4F4K A;  4ZVE A;  4UUX A;  1S76 D;  4HVZ A;  2DT9 A;  3KJV B;  2CG4 A;  3L09 A;  3BQ0 A;  2W9C A;  3MUT P; 
#chains in the Genus database with same CATH homology
 4DCP B;  4ZVT B;  3D6M B;  4DCO B;  3GJR B;  3R7N B;  1PYO B;  3IBC B;  1SC4 B;  1QDU B;  3GJT B;  2C2K B;  1RHU B;  5IC6 B;  5IC4 B;  5K20 B;  4ZVS B;  2CNK B;  2FQQ B;  2H54 B;  2CJX B;  2XYG B;  2H48 B;  3KJQ B;  2CNL B;  2H5J B;  1GFW B;  2CNO B;  3R6L B;  3GJS B;  2HBY B;  2H4W B;  2XZD B;  2QLJ B;  4ZVO B;  2H5I B;  3P4U B;  3P45 B;  1RHM B;  1RWW B;  2P2C B;  3GJQ B;  3KJF B;  4LSZ B;  4ZVU B;  3SIP B;  3R5J B;  1RWM B;  2HBQ B;  1QTN B;  1RHR B;  3R7S B;  1RHJ B;  1I51 B;  1RWV B;  1SC3 B;  2C2Z B;  1BMQ B;  3R6G B;  2QLB B;  3D6H B;  3D6F B;  4ZVQ B;  1RWO B;  4ZVR B;  2C1E B;  1ICE B;  1SC1 B;  2QL9 B;  1RE1 B;  2H65 B;  1RWK B;  3RJM B;  1IBC B;  3R7B B;  3EDQ B;  1RWX B;  2CDR B;  1I3O B;  2Y0B B;  1RWP B;  2HBR B;  3EDR B;  4JB8 B;  2XZT B;  4DCJ B;  2QL5 B;  2C2M B;  3NS7 B;  1F9E B;  3QNW B;  2XYH B;  2CJY B;  2C2O B;  2H4Y B;  2DKO B;  2XYP B;  1NME B;  1RHK B;  2Y1L B;  3KJN B;  1PAU B;  2HBZ B;  2QL7 B;  4ZVP B;  3IBF B;  1RHQ B;  2QLF B;  1RWN B;  2CNN B;  2H51 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...