3IBFB

Crystal structure of unliganded caspase-7
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
KIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-7
publication title Conformational similarity in the activation of caspase-3 and -7 revealed by the unliganded and inhibited structures of caspase-7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 18
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2009-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3ibfB00
2QLFB 2H54B 2XYGB 2HBQB 1QDUB 1RHUB 3KJFB 4DCJB 2HBYB 2C2MB 1QTNB 1GFWB 2HBRB 3R6GB 3D6FB 4ZVTB 2H5JB 2XYPB 3KJNB 2H4WB 2HBZB 1I51B 2CNKB 3EDRB 1RE1B 4JB8B 2QL5B 4ZVPB 2XZDB 2H5IB 2QL9B 3D6HB 4ZVUB 4DCOB 1PYOB 3GJSB 3IBCB 1RWVB 3P45B 1BMQB 2XZTB 2CNLB 1PAUB 3NS7B 2QLJB 2H48B 2Y0BB 3GJTB 1RWMB 5IC6B 1SC4B 3R7SB 3R7BB 1RWXB 1RWKB 1RHJB 4ZVRB 2CNNB 2C2KB 2CJXB 4ZVOB 3QNWB 1IBCB 3GJQB 3D6MB 3R5JB 3R7NB 2C2OB 2QLBB 2Y1LB 1SC1B 2H65B 1RHRB 2FQQB 2CNOB 3RJMB 1NMEB 2C1EB 2H4YB 3R6LB 2CDRB 4ZVQB 1RHKB 1ICEB 2C2ZB 1RWNB 2DKOB 1F9EB 3KJQB 5IC4B 2QL7B 3IBFB 3P4UB 1I3OB 4LSZB 4DCPB 2H51B 3GJRB 2XYHB 1RWWB 3SIPB 1RHQB 2CJYB 1RWOB 2P2CB 1SC3B 4ZVSB 1RWPB 1RHMB 5K20B 3EDQB
chains in the Genus database with same CATH superfamily
5C7PA 3A13A 5KFOA 4CWBA 1G4CA 3OXLA 3FRZA 5HQLA 1B7FA 1EARA 1DBDA 4EI2A 4PWDA 1PG5B 4CNZA 4ER8A 1S5ZA 3K5LA 5IZHA 3IXQA 3PACA 4JI2F 3MMCB 1IVZA 1RT7B 4CZCA 3DRSB 1RZMA 3N28A 4ZPTR 2KYXA 5AXLA 3MI7X 2HW3A 3ETMA 5D4PA 3OHBA 3H2UB 5B0FA 1I1GA 1FE0A 1XMQF 4AFFA 3E2EA 1D9FA 4NXMJ 2Y1LB 1R3NA 1IBLF 1KVJA 2SXLA 3QMQA 2UXCF 2A6OA 3D0GE 2MKCA 3SV3A 2OFHX 5EX0A 3OXGA 2JEFA 3OFEA 3DU5A 3GJRB 5HROA 3C16B 3CDEA 4Q2LA 4CO2A 3W2VA 1MN9A 5HQ8A 1S9EA 4LMZA 3MURP 1BLUA 2YKNA 5HMYA 4JB8B 2FLPA 2Y3YA 2R7WA 1YBAA 2VBYA 1TVRB 2W7OA 4G65A 1MU2A 2MY8A 4LIWA 3DI6A 3TANA 1EAYC 2VOPA 5KFXA 4A48A 3CE8A 4NLSA 3KLIB 1P27B 4S0MA 2CJXB 2BJEA 1REGX 5IQQA 3BGUA 3PW0A 5DZ6A 5D77A 4OZLA 3GILA 2J8AA 3DDIA 1F60B 2MHNA 3NGKA 1NDCA 4YB5A 3HHLD 1WJ9A 1ZM2A 3WHIA 2C2ZB 5IXUA 4OI6A 4QR2A 2EKYA 1VQ7S 1R0AA 4MAKA 3GFHA 2KM8C 3KKFA 1TFYA 5KFNA 1FVQA 1X0FA 1W2IA 2IDEA 5B0CA 2B43A 4YEAA 1NRKA 3M9OB 4L3KA 3JSMB 1BGXT 2YQ3A 2C2MB 2ROEA 1GFWB 2HFUA 4DUYJ 1EIYB 3IR7B 3F73A 1JB0C 2MEWA 2E7WA 5C24B 3CXCR 4FNHA 4FVMA 4USMA 3H5SA 3FEYB 1J5EJ 4J7CA 2YXLA 2K1RA 4UW2A 4X4PA 3MEEA 2LDIA 4LRFA 4KHMA 3R5GA 3NKYA 1TK8A 3QLHB 1VJQA 1VQ8S 3I5BA 4UZBA 2YBVA 2BMBA 3MEDB 2RB7A 4I69A 1TFWA 1RT2A 1U47A 4CTAA 2W1BA 1U26A 2GGPA 2XY6A 1NDPA 1DRZA 5KFJA 2YNGA 2UUAJ 1AZSA 4PCQA 3K59A 2ZWOA 1X4DA 4DEZA 2HNYB 2CQGA 2BXJA 3C46A 5DQIA 5HI7A 3R3TA 4IOAQ 2IY5B 1AYEA 4OHZA 1QE1A 1HBMA 1XWLA 1RBOB 4MIAA 2FVPA 1N8RT 4OZ0A 4JYAJ 4EMDA 3GFXA 5E7OB 4U9RA 2J9DE 4UOCA 3PX4A 2MLXA 1URNA 2B4UA 4DL6A 1N54B 1PYTA 1BE4A 2R7XA 1JLBB 2FJAB 1U8SA 2GQCA 4IFYA 1T9XA 3HHLB 4C3MA 1HPZA 2OHDA 1QM9A 5IOLA 1IBCB 3BQ0A 2FC8A 4AUKA 4PYAA 5J1PA 4URGA 5F8GA 2ZM6F 4DBQA 2HS3A 2ADCA 1F5BA 3VR1A 1CG2A 2UUWA 2F5GA 1ICEB 2LLZA 2WB4A 3AJDA 3QIDA 2WVEA 5D0RA 1F9EB 5EGYA 1CEZA 2N4DA 2H51B 2JEJA 2QMXA 2XYHB 1TL3A 2XS7A 3OSNA 1R27B 1RJJA 4BS2A 3WQPA 1DURA 2I5JB 3M2RA 5CH7B 3QRQA 4TY9A 1FRMA 1RT6A 2B4OA 4RW9B 1ZBTA 3F56A 2AF6A 2ALYB 5GMKa 2QIFA 4NWBA 5A8RB 4NLRA 4PPZA 4NA2A 2HLTA 5KFQA 3IG1B 2HK2A 1UJ6A 2KG1A 4UOGA 3TZYA 2G1DA 2ZOFA 2YKOA 4HACB 1DTTB 2X1GA 1FNOA 1GEHA 3NGRA 3BR9A 3KFWX 3OTOF 5L38A 4DUZF 2AHOB 2MYFA 3G2XA 1S9GA 2RD5C 1YJWS 2QTWA 4IO1A 3MFHA 1DHMA 2VKZG 1TL5A 2ZKUA 4LR7A 3IFEA 3BN4A 3H2VE 3P4UB 1Q81T 4GVLA 4RNOA 1VC0A 5T41A 3MPWA 1LKZA 3Q8UA 2YWHA 2ACYA 3SEOA 3QFWA 3KJFB 4DV7J 1EP4B 3I0RB 1P9YA 1RGVA 4KKOB 4NYOA 1EKRA 3CIMA 2DNZA 2HFOA 3IM9A 1FRLA 4DFPA 1J5OA 1Y7PA 5C5JA 5ETRA 2DHSA 1RWUA 1TKXB 5IT9Y 5LMUF 3H5XA 1PGZA 2D7SA 1BUXA 3FBBA 3MM8A 1N6QA 4JI3J 2RVJA 2HQDA 3S1TA 2BJ9A 3VALA 4F2SA 5T7LB 5E3CA 2ZZTA 3SCKE 1U1OA 3GIJA 2MQOA 3N4WA 1JXVA 3CCUS 3R1HA 3KLGB 2H65B 3HKZD 3R97A 2IAJB 3SI8A 5DDPC 2B8QA 4DV3J 3TJ9A 2OPQB 1HQUA 3L7PA 3UQSA 3CJ2A 2A3JA 1O0PA 5K9FA 3DM2B 3I31A 4CLZA 3SYZA 2J7KA 3W5XA 1M1GA 5C2CA 3CC4S 2E1CA 1UPPA 1Q8BA 3EZOA 4M8LA 4F4WA 4QU6A 3MM5A 3NL0A 4RR5A 3PEHA 4UQGA 2EC0A 2WZ1A 3M8QA 3IWLA 4QIEA 4UF4A 2XNRA 1MROB 1ZPVA 3H40A 3IGVA 4CH0S 1X4EA 2CPZA 3CB4A 4DQIA 2AIRB 4RW7B 5EUHA 2EXUA 1Q8LA 1TR0A 4B3RF 2FYXA 4WCEQ 3GMGA 3FDSA 2XSJB 2NR0A 1S6OA 4CNYA 1S6QA 3M1VB 2UVVA 4TQSA 4ED6A 5D6GA 3CDAA 3OR1A 4N8NA 1S0VA 3B54A 2BM1A 4F4XA 4K4TA 4CO4A 3Q8RB 3CJ3A 4ZHRB 3MM9A 1I94F 3MMJA 1HA1A 4K2JA 2JVRA 2RU9A 2AV5A 4DQQA 5DQGA 2K2PA 3C8YA 2ATLA 4LR8A 3L7UA 4FS2A 1RBAA 3ENQA 2D3OR 4RLEA 4LF9F 1TUWA 1CC7A 2R8JA 1C0UB 2C3MA 2V63A 1RTIA 1SQFA 1WOPA 1U8WA 4LF5J 2QMUB 2RDIA 1DY3A 3QAEA 3V5RA 2P6TA 3PR5B 4WFBQ 4DUTA 2W2NP 2CVEA 1VCTA 2HMIA 2DNPA 2OLWA 4C7QA 2NXCA 3QIPB 1SC1B 2EG2A 3X1LB 1XN9A 1VBKA 3DRYA 5FDLA 3BJYA 4O3RA 4USKA 1Q8IA 1WWHA 2V5HG 4F4ZA 2ZKTA 1G6BA 2ERRA 2OSRA 2ZE2A 2AZ1A 5LSLA 5KT4A 2E5JA 3FCHA 1E6YA 4KGMA 4JV2A 5DM7Q 4ELVA 4ZS6A 1HHTP 2CQPA 3M9MB 4OZNA 2OPPB 1H6KX 4OJHA 3M8SA 1IBKF 2GNKA 3NMAA 3U1NA 2CNKB 3ISNC 1M1KT 3UO0A 1FFWB 1CJKA 2F65A 2HGMA 1X60A 1VIOA 2JLEA 2MQ8A 3VQTA 3N6NA 2BKOA 5KG0A 4ID8A 3MR2A 3PYFA 4P75A 5F3ZA 5D4LA 1RAFB 1HBNA 3VVUA 4JI7J 2R7VA 4DV5F 2RILA 4KGKA 2EFNA 2NXNA 2J9DA 1X31C 3UFCX 4ED8A 2EK1A 4ECWA 3FGVA 2LA6A 3IMQJ 3W60A 2HK3A 4YP3A 4C9DA 4R8UA 1GMWA 3LAKA 3GSDA 1N52B 4PXDA 2P9EA 2MLZA 1YSJA 1S1UB 4LR9A 1WEYA 3W5YA 4R5PA 3T9ZA 1HNXJ 2ZZNA 1RP5A 2QN6B 4MJKA 4WFYA 3GSIA 1FRIA 1VISA 3WC0A 4QOTA 3I4HX 2EFVA 2KRBA 3MAAB 3IAS9 5KFWA 3HPOA 2XEXA 3CJ5A 3PJXA 4PYDA 2KL8A 3KDNA 4RPFA 1ACMB 1U48A 3CCES 3OUYB 3HHKA 3MXHP 4DL5A 1IKWA 2ZH5A 4TU9A 2R8HA 1Q79A 4LFAJ 5MAOA 2WVCA 3BO2A 3HVTA 3PCOB 1ZYQA 1WHWA 4RNHA 2KJWA 3Q86A 5F0WA 1C4AA 1V3SA 3H59A 5AJ3F 3KUGA 4EBDA 1BY9A 3BKFA 4ICLB 3QRPA 1FXRA 2IM0A 2JVOA 2JL9A 2VBXA 2Y1RI 3VGVA 4J90A 3WZ0A 3TVKA 2PMHA 2NXJA 2AEJA 4ZCMA 2HHUA 2GVDB 2A0FB 1VS3A 2DIVA 4NXNJ 2E5HA 4NI2A 4NMXA 4Z37A 2HPUA 4QQBA 2DHAA 5EN1A 1V3RA 3IBWA 4JI8F 3J81U 3KJVA 2WBRA 2P2CB 4I2PA 2QA4G 1RWPB 1SV5B 1QAJA 2D9PA 3NS5A 5F8JA 2YWGA 1L3UA 1APSA 3P49B 3IR5B 1K0TA 1OYEA 1VBXA 4K8RA 4DPTA 2KO1A 1MW7A 2RNEA 2RQCA 1NUEA 1U2FA 2OUGA 1H3DA 2OEMA 4OX8A 4CO0A 2L3MA 2VZ9A 3KMSA 2V2KA 1YRTA 3BS9A 2WB1D 2Q1LA 3RAXA 3MMBB 2IDLA 4Y2CA 2CFXA 1XR7A 1IR2A 4DR5F 4JV1A 3V4MA 1LXNA 2LQBA 4UZCA 3I56S 1YG0A 5HJXA 2IVYA 3K8WA 2XY7A 1TKZB 3BBCA 1G2EA 3HCXA 5J2PA 2HWTA 4HT5A 2GS8A 1N0VC 3EGNA 3C6TA 5KFYA 5ITHA 4AQYF 2W4CA 5J2QB 2PN6A 3CW2C 4LRAA 3VAMA 2HBRB 5GADI 3AA8A 1SH2A 1AA1B 3AD8C 2RE1A 3FVYA 5KFZA 1HHQA 2DB1A 4KFBA 4NX9A 3BSNA 2FVRA 2B56A 2P9CA 3RW6A 5DLGA 3KLEB 3DDKA 3PZPA 5H9EK 4QIGA 2F9JA 3EXCX 3I9ZA 3JYTA 4TU8A 3R7SB 2C2EA 3V6DB 2KU7A 3FCWA 4K2XA 4ZJLA 4DV6J 4M94A 1HR0F 2CJAA 2OTJS 2JX2A 3JTNA 1R8PA 1X5PA 4MKAA 2AGPA 4OZ1A 5JUMA 2V68A 3S6EA 4H54A 4ZOSA 4PWDB 1LK5A 1TAUA 2XMWA 1S6UA 1QJHA 1T95A 2WVDA 1KHWA 4LF6F 4OV6A 2HLUA 2XYGB 3OBIA 3MMAB 1Q82T 4OV1A 4FYXB 2XMTA 5DDQC 1S57A 2LA4A 4X66J 3CC2S 1RT3B 4A46A 1PO6A 2IA6A 1Z2LA 2EFPA 3LPYA 5C2GA 4A4JA 2M3DA 1XJWB 2H5IB 3EWGA 4FPRA 4XK8C 3GCXP 4RNMA 1FJGF 2E44A 2HNDA 1ZM3A 5IC6B 4B9VA 1U1LA 3EVWA 4Q7AA 2YX7A 2HRYA 4Y00A 4M5MA 4NL5A 2OPSA 4LF4J 2D9OA 3W2VB 3ILJA 4C97A 2KFZA 2W4PA 2ZWPA 3W66A 1B0TA 1S9EB 5HMZA 3PRDA 4A8YA 2CDQA 2ZDOA 1GTHA 2BDPA 1ROFA 3AAWB 4PAAA 4GKKJ 2YKNB 4Y65A 4X4QA 2DHXA 2R4FA 4K7QA 1DFDA 2IHR1 1MU2B 5F8HA 2AT1B 3DI6B 4CLLA 3W7BA 1RT4A 4DPYA 3PRBA 4F4AA 2M8HA 2HQFA 9ATCB 2DH8A 4LF7J 5DO2A 1R6YA 4ILRA 4MIWA 1YGYA 4CT8A 1QVFR 4DU8A 2RS2A 1IBMF 3PXGa 4ED2A 2I6WA 2BVZA 8AT1B 3DU6A 4GO7X 3VTIA 5CXTA 2VQFJ 4DV4F 2XMJA 4OX7A 4EBCA 5L39A 4ECYA 5HN0A 1R0AB 1ZS6A 2LVWA 2QYGA 1UKUA 3M2UA 2DHGA 1SUQA 1JMTA 2VF3A 2HHSA 4B3OA 1UJ4A 3KDOA 1UEVA 1JLEA 3D5MA 2M0GB 3WIUA 3KJQB 2PFDA 3KTQA 4A8MP 3FRYA 3IBFB 3CCMS 2OFGX 4PWUA 3QGPA 4NXMF 2NLWA 2K1RB 3CMAS 2MJUA 1O5JA 3MEEB 2RT3A 2KFNA 4USVA 3BSAA 4ZPDA 3J7YI 3R5DA 3DYAA 3CC7S 4OQJA 5DLFA 1GAOA 3GYXB 5KT6A 3D6FB 3GB0A 4ED0A 2RKIB 2N7YA 5DDRC 3W3SA 4WBFA 4RU9A 2CWKA 4C3KA 1MNEA 4DR1F 4ZVUB 1HWLA 1B64A 1LW0A 1RT2B 4CTAB 4JI1F 3A8EA 3CDUA 1IKVA 2NSCA 2WONA 4DLGA 2GGPB 3EGWB 2FHOB 2DNRA 4OYAA 3BYRA 3G71S 4C2MA 4W4MA 4WF9Q 1AZSB 2QLWA 2B4VA 2OIHA 2V8PA 1DTQA 2W01A 1T05B 3VGTA 5DGAA 2E7VA 3SQOP 2DNQA 2DH7A 3GPAA 1QE1B 1HHSA 1PJ5A 4X65J 3I55S 5EWEA 3HHLC 2VFVA 4DR7J 1SL0A 3N5BA 1XR5A 4K4SA 5F8NA 3TR5A 4ZA1A 4B3MJ 1YRXA 3OFHA 4FYVB 4A8XA 3EYZA 3Q0AA 1N36J 1Q8KA 1HNVA 4U95A 3AHPA 3ZTSA 1XIQA 1FKOA 1QDUB 3OHAA 3HT0A 1AW0A 3GTYX 1YZ6A 3MPUB 1HPZB 2VB6A 4DL3A 3CCJS 3N6MA 4KPYA 4DR6F 3VGSA 3DLEA 2UZAA 4MMOA 2Y1IA 1JWWA 1Q78A 2VFTA 1X4BA 2WRMA 3JQMA 3R5CA 4DUYF 4I56A 1CC8A 1SJ4P 4DV1J 1F0XA 3QGIA 5DQHA 4FF2A 1QAXA 4ZKAA 2KG0A 1NSPA 4AL6A 3DRSA 4KHRA 1TL3B 2W9AA 2YVSA 5EX3A 2BRKA 3L7OA 4NLPA 4XPEA 2CQIA 3K8VA 3M2RB 2BEFA 3C6UA 2M4MA 2D3O1 5H9FK 5DG7A 4YB6A 5HK4A 1RT6B 3IA0A 3T19A 3FK4A 1NLKL 3TUZC 2I1RA 2KH9A 4M1KA 2X1FA 3M6WA 2JLGA 2COLA 3FEZA 1LWEA 4QU7A 2W7PA 1T3NA 4ECTA 3OT9A 4HLBA 5IWAF 3CTRA 3HSGA 4ZLJA 3GP9A 5LOQA 3T6JA 1RHMB 1Y0HA 2VICA 5K5MA 3C16A 3MOZA 1VQLS 8ATCB 1B3TA 3K57A 4NCGA 2V2VA 1OSDA 4CLKA 7FDRA 3CO0P 2DGUA 2X1AA 1YWXA 1HKAA 4QWEA 1EX8A 1FEHA 2FHJA 3SBMA 3MTKA 2Q3PA 1TV6A 4JI0F 2FJWA 1BMQB 1S9GB 4X84A 2OGUA 2IA0A 4C8ZA 2VJUA 3LWMA 5KT2A 4WTYA 4XTTA 3VCDA 4ES2A 1X9MA 3OVBA 5AE3A 1CJVA 4NLUA 4EEYA 3IRXA 4PG7A 1C4CA 3TA0A 4ATNA 2GAHC 3LW5C 3C3LA 2CPYA 3FBFA 4KRWA 1VRTA 3T3FA 2WAQD 2YH1A 1IJFB 2HNZA 2Z0GA 2NREA 2KDOA 1J5OB 4HEA9 4KH0B 3ZZPA 4TYBA 3DGPA 5CQGA 1HIYA 2E9ZA 4C4WA 3MM8B 2PMWA 1N6QB 5LSRA 4IO9Q 4ES1A 2ZUAA 1M90T 4FYWB 3F41A 5FD1A 4GKJJ 4DX7A 4YDXA 3GJTB 1HQUB 4FXVA 4X64J 5IV3A 3H98A 2XZWA 3F0NA 3NGUA 4DQSA 3HK2A 2XS5A 3E3XA 5BYSA 1SKSA 2JLFA 3T41A 3KLFB 3S01A 2BJ8A 3GIIA 4V19X 4DQRA 4TXSA 1HD0A 3NGSA 3VAFA 4U7CA 4DR3F 4ED7A 4K59A 3MM5B 2XB2D 1H72C 4BC9A 2YX1A 3OD2A 5CCMA 4DWIA 2HHHF 3AJ1A 3M8QB 3PRVA 4BDPA 1S1WB 3IP0A 4DOZA 1IKYA 2HNYA 1N0UA 4ANDA 1MMLA 1C1CA 3ZTPA 3Q2TC 5CYQA 4HR2A 4FZVA 1XEZA 4ECVA 5H9EJ 5B0GA 3TVYA 5I42A 3THVA 2OO4A 1N34F 2XNQA 4C8LA 3T6BA 3IBCB 1FF2A 3PY8A 2XBPA 4IDKB 4EK2A 2B7BB 1S6QB 2HYIB 2DGSA 3VZIA 3TA2A 2MKKA 4ERDA 3MR6A 3RGIA 3OR1B 5L9XA 1GMWD 1NH8A 2KRRA 2F4VJ 1BQNB 4XDDA 3ADAC 2PEHA 2G13A 3MM9B 2DH9A 1X0PA 1U0SA 3SMZA 2UUCJ 4MKVA 4XIUA 2Q6BA 2W2OP 4LF1A 5KFHA 1TL4A 2ZH3A 1SH0A 3TZZA 3H4BA 1FO1A 4DV3F 4KTQA 1MWZA 3AH6A 1X5OA 3RR8A 1RTIB 4YOEA 4ZJQA 3G8QA 4B9TA 2LXFA 3HZEA 1VI7A 4Q0BA 5HMWA 4K0KF 4NRUA 1UVLA 2OPRA 2IM1A 2HMIB 2MY7A 1NDLA 3BBBA 4DR4F 3UN3A 1ZTWA 1V6HA 3KUEA 2MSTA 1U1PA 1PJ7A 3DNCA 4ELUA 4HHHA 5FDLB 2DNNA 4H4MA 1WTBA 2XI2A 4N8OA 4J9VA 1D9AA 4KPCA 4W98A 5FLXY 3TAMB 4HDHA 2ZE2B 3KK2A 4ECXA 1HNZJ 4U7UK 3SSQA 2XSFA 4ZVGA 4ZPWR 3IS9A 4OJ3A 3OV7A 1N32J 3QGHA 3TO8A 3L4BC 3P8BB 1UFLA 3LOUA 1OO0B 1HBOA 2OD4A 1I3OB 2QV6A 1CJKB 1JNRB 5KFKA 1FHTA 1OY6A 4OZ3A 3EVOA 4P52A 5E5NA 1RT5A 1AROP 4RW8A 2DR9A 1VQKS 1NXIA 1NZ8A 4OJGA 4LVNP 2DGOA 4AT1B 3FSYA 1IKXA 4ITSA 3KHLA 3KJNB 3BSCA 4DPUA 4U7UD 3HFVA 5IM0A 4G1QA 2C3UA 2XO7A 4WK3A 3CF5Q 3RZAA 3RRKA 3VV2B 3UWTA 4B3TF 4KHPF 2BE9B 4IG0B 4F0KA 3K5MA 4R5PB 4C6AA 1X8DA 3MD1A 3PFOA 3LTOA 1RHJB 2MQNA 3SDEB 5ETKA 2JEGA 3NNHA 1WEXA 4C8OA 2HG4A 4CT9A 1PC5A 3CPWR 5G0RA 2EBGA 3HDSA 3MM6B 1JXEA 2HHTA 2VODA 1R89A 1MWQA 3PW7A 3QWUA 1REVB 4O0IA 2LP4A 3TWZA 3VZHA 5LMNJ 1ZOTA 2N3OA 1S79A 1N88A 2OELA 1Q53A 1U2CA 4OX9J 1X4CA 1IM4A 1IKWB 2QE5A 5THWA 1KOHA 1YKWA 1WC4A 3JAMY 2RRNA 1FNXH 4CO1A 3ELHA 3HVTB 3M32A 3AD7C 2DNYA 1BQMB 3QSIA 5KG5A 1WC0A 4OYPA 1IXKA 2ILZA 4YY3J 3GG0A 3EGZA 1CS4B 4C3LA 1Y3KA 1L5UA 2UUBF 3ET6A 4WFAQ 1FRKA 1KP6A 1BD6A 4TY8A 3MR3A 3PG9A 3NBPA 3PW2A 1NPRA 4NI2B 2E5IA 2V8VA 3HX9A 1FX2A 1UFKA 2YNHA 3LP2A 3KJVB 2CADA 3TRGA 1UVNA 4RU2A 1CJUA 4KV8A 1KQSR 2ZEJA 3I87A 2XMMA 4FXWA 2J6UA 1LW2B 3HO1A 1P1TA 1W7WA 2XSJA 2QGFB 2MKHA 4J9OA 2ZH9A 3ISND 4U8YA 5ETNA 3M1VA 1RWWB 3CCLS 5HJYA 2W8LA 4J91A 2RU3A 5AXNA 3B82A 2HBYB 2GA7A 1WDTA 3DRPA 1UL3A 2GVZA 4FF1A 4FF3A 4V1Ak 4J9MA 1H98A 1VBYA 3BEGB 1P8GA 3H90A 2EK6A 3UDVA 1ITPA 1XERA 4WU3A 2XG8A 5CHCB 2BJDA 2X3GA 1FDDA 2RHQB 1UA0A 2QLJB 1RUSA 2GV1A 4FS1A 3GE9A 5J2PB 2Q79A 1C0UA 3KUHA 1P9QC 2AJ1A 3NEKA 1SVDA 3C6TB 3D6MB 3EPGA 1BQXA 3TX8A 3IR6B 4YR0A 1FEEA 2MZ1A 4USUA 1NK7A 2EKNA 2F8HA 1ULRA 4E98A 1DQ9A 3BPSP 3G6ES 1F2GA 2CYYA 4HVZA 1JNZB 3QO9A 2MJNA 2YTCA 4M5DA 2F63A 3EX7B 3GG1A 4RBUA 4KFBB 1UW9A 4DZDA 3MUMP 1HWKA 4YHHJ 3W64A 1SI9A 4CO3A 3PHTA 5KFFA 4JV5J 4LRCA 3ZZZA 4NXNF 2Z2MA 2YQ0A 3PM9A 2GMHA 3JYTB 4KQZA 2IMOA 4ZVTB 3GR0A 4ZP8A 4F02A 2OPPA 4DZ6A 4DDFA 5HVFA 3IGNA 1SJRA 2F4FA 4DV2F 2M5YA 5HVHA 3W1YC 1I6JA 3HULA 1M5SA 3A12A 3HM9A 3BREA 3HT3A 2CNLB 2H3EB 3HHDA 2RHSB 1RACB 1VC6A 2N4CA 1M5PC 4WYLA 3J7ZT 1PCAA 3PO5A 3OFGA 1CQNA 3ZXWA 1JJ2R 3VAGA 3DDNA 1VOMA 2R8IA 2EFQA 4QCLA 2YX4A 2J9EA 3RG6A 4OHYA 1RWNB 3LALA 5KFEA 3LANA 2H1YA 3EE3A 4G6VB 2AEFA 1CBKA 2B4PA 2OKQA 2HVEA 3W8GA 4D3HA 5K20B 2HNDB 3AA9A 4MT1A 5K8PA 2WVFA 1H7XA 3FBEA 1S4EA 3OSPA 3AFGA 3VGUA 2WSEC 4QWBA 3PR4A 3P5TL 3FJ2A 2OPSB 1Y00A 2GJ2A 3CGIA 5ETLA 1ZA2B 2GHWA 5HANA 3OJUA 4WJBA 3KNAA 4UUWA 4ED3A 4NOHA 2FJEB 1V5IB 2H48B 3BGFA 2WW8A 1SQEA 1RYRA 5I3UA 3O5TB 3O8WA 3D2WA 2Y1JA 3UD3P 2CQBA 2IJRA 3TI0A 3EXYA 2XTJP 1UA1A 5KT7A 1KS2A 1RT4B 1S6PA 2CA9A 2R7UA 3W63A 2V9WA 2W9CA 4TKTA 4MK8A 3PYDA 2QA2A 2R7RA 2UXCJ 1FA0A 2X3DA 2KHDA 5E33A 3CJQA 2GVDA 4CLUA 1OIAA 4K5SA 3K0JA 1Y5IB 1QSLA 2CPFA 1TTHB 2RAQA 2MQMA 2KN4A 4I1TA 2XYPB 2LCWA 4NEZA 3ENWA 4C8MA 3MUVP 3M2UB 3GQCA 3VHQA 2HZVA 4JOUA 3M2VA 4DFJA 1SUQB 2B7CB 1N5QA 4F3MA 1YZ7A 4Q8EA 1DAXA 4J37A 2PMZD 1JLEB 3Q8YA 3HMJG 2VG7A 4L74A 1GXUA 2DHHA 2VBWA 4N5SA 1YJ7A 1TMJA 3MEGA 2XWXA 2P6SA 4GVBB 1VQYA 2DEIA 2HKEA 1TKDA 4DLEA 3CDWA 2CJBA 2ZNZA 1N33F 3DYAB 3V81A 2HURA 1W25A 1S10A 2OP5A 1I5OB 2XMAA 1B7YB 2BRLA 4I0WA 5M2PA 3BPDA 1Q95G 3C14B 4WE1A 3FC9A 3IC1A 1RXOB 4HH1A 4A8QA 4ES3A 2PEBA 3JQJA 2YPZA 3I0SA 2VDIA 2ATCB 2HVDA 4FKYA 4PABA 4H4KA 5E0OA 1LW0B 3T9NA 1RDRA 1UVJA 4IOBA 2WONB 4GKKF 3D68A 1R8AA 1X4AA 2FHJD 2IFXA 2ZHBA 3SCLE 1D9DA 3I96A 2E9RX 3OL9A 3V4IA 1QAYA 4WZMA 2ABYA 1DTQB 1GTEA 2X7IA 2GFFA 3FQKA 2Z30B 3MR5A 3FCVA 2DRBA 4E8UA 1NU4A 5IT9U 2MZQA 3BGRA 3KLEA 3DHWC 3FSXA 5AE1A 4CLFA 3OTDA 1GMVA 1AXQA 4F0MA 3V6DA 3C2PA 1ZETA 1FKOB 2VQFF 4LFBJ 1SQGA 4DL7A 4WP9A 4LREA 2CQ3A 5I3QA 3BGOP 3DLEB 4LF8J 1PILA 1U24A 2CPJA 3NGTA 3GIKA 1RAIB 3HJFA 3UPFA 2DISA 5BYRA 4PQUA 3ILOA 2PFFB 1XNQF 1EZZB 3LP1A 2PI4A 4XDCA 4QR0A 1DJ0A 3TUPA 5J2NA 3MMAA 2A2CA 4DR2F 3D28A 1B0PA 4HDGA 3VWSA 4I7FA 2BW7A 1B0VA 3T1YF 2K06A 1RT3A 1WG4A 5LXYA 1NSKL 4CM2A 1H73A 3C6UB 1R0CB 1PAUB 4RNNA 4ECUA 3LH2S 2LXUA 1VQNS 1LWEB 2IJFA 1KQFB 1KDNA 2AJQA 3ZC4A 2VL1A 3DLKA 2R2RA 2VHGA 1S0NA 2UU9F 2UP1A 3DGVA 4PG5A 2ZM6J 2IBKA 4ZCIA 1U45A 4NCGB 2C1EB 3T1HF 1WHXA 5LT5A 3M9NB 4GC7A 4M95A 1VMBA 3MEKA 2CJQA 1XMBA 3DRXA 2FLNA 1QAIA 3Q8QB 1YK9A 4ZVHA 1T8EA 1TV6B 4L76A 1YJRA 2EFGA 3I4PA 4G1PA 2JOQA 2QLFB 1QSYA 3TQ1A 2AMCB 4ENOA 4ZPBA 3GLJA 5A8KB 3JB9k 3L9ZA 2RDJA 3EM1A 3R8YA 3FQLA 1N5TA 3NNAA 1JKHA 1VLYA 2H4WB 1CJVB 1JLFA 2WSFC 3IRXB 4DPXA 4B3SF 4FVCA 5DM6Q 4P7TA 5CA5A 4ECSA 3HFKA 3N5FA 1RTJA 1NK6A 2BANB 1OQ6A 1OSCA 1VRTB 2RRBA 1X7VA 2HSEB 3CIZA 2HNZB 5HSPA 3GJQB 2C3OA 2QLXA 3OTOJ 2ZOGA 2FUG9 3GIRA 4DUZJ 3Q8PB 5EDWA 1S97A 4J9PA 3DGPB 4YMEA 4PRFA 1VRQC 2BYCA 2OEJA 5KFRA 1JIHA 1T94A 2CPEA 3PKYA 3AXKA 2JSXA 4MK7A 4P74A 4F4YA 2H5EA 2A18A 3AXMA 5ETOA 2UVRA 1YRUA 2QO3A 3I5AA 4I68A 4UT4A 5T14A 4JI4F 1YHQS 3K5PA 4A8WA 4DFKA 3TW0A 1NK0A 4DL2A 1HWUA 2UXBF 2DGTA 3ULHA 2B6AA 2IPOB 2R7SA 4O0NA 5JVHQ 4ZVPB 2RKIA 4LIRA 4Q2MA 4DMZA 3H42A 3H20A 1V5VA 1KTQA 2B9XA 2XZTB 2PDAA 5LMUJ 1SJ1A 2HGLA 1GH8A 3R2CJ 4A8SA 3QNWB 2RRAA 2D3ZA 2B8PA 3IO1A 2DRAA 3BGLA 4Q45A 1NAQA 2ZITA 2J76E 1IKYB 2VUGA 1LFPA 2H4YB 1T05A 2HS0A 1C1CB 4CH1A 5C25A 2WBMA 3DOLA 5CYQB 2DK2A 5ETTA 4URSA 2ROPA 2L08A 5I42B 4LRDA 2QC3A 5KFCA 1XMOJ 2VONA 3RTVA 5HBMA 4JV0A 3MCOA 5BYQA 2V4JA 2JH3A 1FKPB 4RWXA 4NLVA 3NAIA 3UCGA 3QT6A 1HYSA 1PIEA 3RAQA 3I5CA 2VASA 4ZVEA 1WSVA 1FFSB 5KT5A 4C8KA 5HL7Q 2ZOMA 5CD4A 4N56A 5HLFB 1WELA 1EETB 1LQ9A 4DV0F 2CQ1A 2R9LA 2DNOA 2C42A 2AWZA 2WCXA 4ZIWA 2XGQA 4C0HA 3D4JA 4B3RJ 4UY8T 1T11A 1FESA 4X64F 4DS5A 1ZA1B 3TA1A 1HARA 5H1SV 4Q0BB 2V8HA 2JC1A 2OPRB 1RABB 1CULA 2GIRA 5BR8F 1SC3B 1R31A 3D54A 4RX6A 4F8RA 4H4MB 5F8MA 4Y34A 5DETA 1I94J 4ANEA 4QIFA 3UN2A 1R8CA 3KK2B 3KK3A 5F0UA 3CJ4A 4R25A 3JSYA 1NJIT 3D6HB 3OR2A 3IS9B 4I67A 1NZAA 2HFSA 3RRGA 3ZNUA 1JK9B 5I4MA 3OL6A 3Q8SB 2VG6A 1HBOB 4RBVA 4M5IA 2EBEA 4QYRA 1RWKB 4ZJOA 4ZVRB 1KFDA 4UOFA 4HTIA 1ZZFA 4L72B 2ZJPQ 1NM2A 1RT5B 4RW8B 4X4TA 5B7WA 3N01A 3MWBA 1CJTB 2BA9A 5DDOC 2HQCA 2Z2ZA 2MHEA 2XULA 2KXFA 1IKXB 1F9HA 3H4DA 4OYBA 2F4VF 3QT7A 3RYLA 5IM0B 4G1QB 3G9CA 3WX4A 5K8MA 2DXDA 2O3DA 1K73T 5D4OA 3FSIA 2DNGA 2LU1A 4DG1A 1AB8A 2UUCF 4P72A 2YQ1A 1GT8A 4I2QA 5D3GA 4OJ1A 1G3OA 2ZD1A 4P10A 1IBKJ 1T0TV 1BWVA 2MTLA 4AL7A 3NCPA 4IQMA 5B0BA 3CCRS 4I6AA 1L3TA 5G0RB 1R6VA 1WC6A 2ZBCA 4DSEA 4KAIA 4KJIA 2VPYB 2LDYA 3UE2A 5KFTA 3GV8B 2GQQA 4MYTA 2HFVA 4DL4A 3NS7B 1S72S 2E5GA 2MGZA 4DV5J 4K50A 2DR7A 1OPZA 3DRRA 4LSNB 2VC1A 4A47A 1FCAA 2DO0A 1BWEA 1QTMA 4USWA 1EQMA 4OX6A 3BB5A 1VHFA 1MWYA 4HHUA 1RAGB 4WFZA 3KLHA 2HVHA 2JHEA 4Y0FA 3HVWA 2Y8WA 4B9LA 1U6ZA 2Z57B 4PXEA 4UY85 3M32B 2LECA 3KLFA 3Q22A 1N56A 4C98A 4TLRA 3WX8A 4ZITA 2R8GA 4DU7A 5A6PA 1VC5A 1KN6A 2WHOA 2J6TA 3MPVA 1UZDA 3BDEA 5CD4H 2Z2YB 4WFNQ 1B70B 4DN0A 5LJ5Y 4MYUA 2AZ3A 2HHPA 1SIZA 3T5HA 3ET6B 2CUYA 3T5LA 1YBUA 4TY8B 3NBPB 1RAHB 5F9NA 1U1KA 1S1WA 2ZH4A 2EVZA 2A2DA 1FK9B 2ACMA 2YNHB 3LP2B 4CM0A 3QATA 3AJ2A 2B9EA 2DJWA 1CJUB 4KV8B 5HVGA 1ZM9A 4NLWA 3R27A 2AU0A 5HATA 2ZH2A 2BM0A 1VRUA 1FD8A 3TEGA 2QEXS 5J2MA 1TKTA 1XBWA 4FKXA 4BWMA 1JLQA 4IR9A 1YQHA 2JRSA 4IDKA 1NJXA 3QJPA 3IWNC 3NP5A 1WEZA 3UI3A 3PW5A 3IM8A 2F7VA 2MKJA 5AJ3J 2RF2A 2XHCA 4ZPCA 1Y3JA 3D9BA 4NA3A 2ZC3A 3LO3A 2GIQA 1BQNA 4YR3A 1A9NB 3DRPB 4ILMA 5K14B 2GVZB 4P2SA 2V69A 4DN9A 5GAHI 1HWIA 4O23A 1ZM4A 2HGNA 1JJHA 1RKJA 1RA7A 2BZ2A 5CZVA 4JI8J 3CD6S 4I6YA 1RQ0A 4ZVFA 3PEJA 3QJJA 2C2NA 4AD6A 3OJSA 4DF4A 3BDPA 2I38A 5GMEA 2V8GA 1TL7A 4NLOA 3TUJC 2RSQA 1UTAA 1C2PA 4X62F 1IJEB 3IWXA 4DL0C 4NYPA 1WKLA 1SKRA 4IOCQ 2EC2A 4DX5A 3SCJE 2NS1B 2JNJA 3TAPA 4BHQA 3QO9B 6FDRA 1YDLA 2XLKA 1VR6A 4M5DB 2RDDA 4TNOA 4X2BA 3TARA 3DN9A 2UVUA 4KIAA 3TX0A 2B9YA 4M5NA 2UUTA 3TAMA 2Y0SD 1H38A 5SUHA 4Z7CA 2YWEA 3QBCA 3DLHA 1LFWA 1GXLA 4F36A 2VH7A 4OL8A 3SFUA 4J9KA 2MB0B 4KGVB 4A8FA 2FTRA 1HI0P 2E1PA 4FDFA 2ASJA 4AQYJ 2O67A 2XWYA 2BX6A 3I82A 2U1AA 2H54B 1QTNB 2JJ4D 4NZ0A 2NPFA 1B4SA 4YN3B 2FLOA 3L09A 2ALZA 1KBRA 1LWCA 1RT1A 1TMMA 1WF2A 1WACA 1JLCA 4OI3A 3PTWA 2V4QA 2Z58B 1S4FA 3J7AN 1A6LA 2FJVA 2R42A 1WF0A 1KVKA 2FZKB 2W4DA 2ZH1A 2FB0A 3N9UC 4AXJA 1UW4A 4IG0A 3EPIA 3C15A 1U02A 3BN7A 1HR0J 4IKAA 3SDEA 3ZZTA 2HHVA 2R2SA 3W2WA 1RK8A 1FRJA 3MM6A 3EZ5A 4FBUA 2CRLA 3BQ1A 4MKBA 5I3PA 2NZCA 4K4YA 1REVA 2QMWA 2CZVC 4F2RA 3KHRA 4RUCA 3NOCA 3K89A 4LF6J 2KVIA 2P8IA 5CYMA 3DOMB 2DXFA 1T9WA 1S77D 5A2QU 4J9QA 2FHMA 5I3UB 3ITHA 5KT3A 4OYMA 4WP3A 4X4NA 3RRHA 1EQ0A 1BQMA 2DNHA 1RAOA 2XZDB 4PUOB 1WC3A 1S6PB 3CJSA 4CDIA 1AT1B 3A8IA 8RUCA 2YWKA 2Q66A 4NASA 1FJGJ 1CS4A 2F8MA 3LA0A 2W9CB 2V4RA 2DXEA 1WKJA 2ZFHA 3H8YA 2VPWB 2CNNB 1IM6A 2IM3A 2VKRA 3PFEA 1FTCA 4QR1A 2AQ4A 3DHXA 5ADZA 4K4ZA 2BKNA 3PX0A 1SIWB 1LW2A 5EWGA 5F41A 3M2VB 3QZ7A 3G6YA 2J9CA 1NPKA 4CH7A 1FX4A 4OZ5A 2VJVA 1T9VA 3SFGA 2VG7B 2AYEA 2PGCA 3R6GB 2PD1A 1UVIA 2VIHA 4B08A 3MEGB 2X1BA 4L75A 1IBMJ 3U27A 3V81B 4MH8A 3M05A 3LP0A 2ZVIA 3OPKA 1WNEA 4G1IA 5AT1B 3BYPA 4DV4J 4WE1B 4M5HA 3I0SB 4Z7YA 1OY8A 3TYTA 4FNIA 1KONA 3W5ZA 2PIIA 4PZVA 2C2OB 1XNRF 2NUUG 2ZUGA 3HSDA 1LV5A 1TU0B 4DSJA 2CQCA 1HQ2A 5KG7A 4NPOA 2HVZA 3TAQA 1N5YA 2Y8YA 1FI4A 2Q43A 2XMUA 3MAHA 5K8NA 5B0EA 3V4IB 4Y6IA 4EZ9A 3ZZYA 2V34A 4QPTA 4USHA 1D0EA 2V50A 5KFIA 2V2QA 4PXCA 2FC9A 1CSJA 3V6HA 2AEMA 3PIOQ 3POTA 5HQMA 2BACA 1CQMA 4FN5A 4XPCA 4QYZK 1FERA 2MZTA 1GX6A 2A6MA 3BGRB 1GK8A 4CQ1A 2W25A 3HXMA 3VAIA 2IYIA 1F3VA 1Z1ZA 1XQIA 2CWXA 1C0TB 3BO3A 4DR1J 4KO0B 3C19A 2VA2A 3QT5A 4LFCJ 2LFVA 4JI1J 4CRJA 1TK0A 2OMLA 5J1NA 1NB7A 2ZHOA 3A4TA 2DGWA 1P1LA 1HW9A 1S48A 1FKAF 3VAKA 4ZLLA 2FJBB 4NLQA 2BJ7A 4QIWD 3ZTOA 3TQEA 2PI5A 5KFMA 3DMJA 3MUTP 4PQUB 3A3PB 4NA1A 4K4WA 1Y9OA 3LP1B 4V19J 3TJ8A 1TP7A 5DGBA 2XQCA 5J2NB 3DLGA 2GMJA 2QA1A 3SZ2A 3JS9A 1ZZNA 3OFFA 2ZZMA 4I7FB 2VU5A 4Q5VA 3P6YC 5KFUA 1Y4ZB 3M6VA 3M30A 2GC8A 4OLOA 1SL1A 2JFKA 6AT1B 2V2ZA 1YIJS 1HNWJ 4FYYB 3CMES 2VQEF 3OTCA 2V94A 3NCRA 2UXDF 5RUBA 3FZBA 2B5JA 4DR6J 3UVJB 2LQ9A 3DLKB 2XI3A 2ZC4A 3UDEA 4DSKA 3KWMA 4NLYA 2V0NA 5B0AA 2XMVA 1RLCL 2M9KA 4HKQA 5KFVA 2WVBA 2HS4A 5GAGU 2EWHA 2VG5A 3NGDA 3CCTA 1Y11A 5KG2A 2EPIA 4KBIA 1LXJA 5A76A 3DC2A 5CZXA 1K47A 3RB6A 5KFBA 3HHEA 1U4BA 2ZJQQ 5HP1B 4CLSA 1VQ6S 1EHWA 4KGXB 1KLMA 3NNCA 1WC5A 2CJ9A 3ZNJ1 4N47A 4QZVB 1JKHB 2ZBIA 2XCAA 4RNFA 1W26A 1FDAA 2RH3A 1JLFB 5IWAJ 4LFBF 2DVIA 3SSSA 1VGYA 5KG1A 2PE8A 3QQCD 1M5VC 1QLNA 5A6WA 3O3LA 4U67Q 4X4UA 4O4GA 1RTJB 3V6JA 4LF8F 2P5VA 3QT8A 3MGJA 1VJWA 3LGHA 3DCAA 2F40A 4RO0A 3MCSA 1FWPA 1JLAB 2VC0A 4ETZA 2KT5A 1NNDA 5GVQA 5IS2A 4E2FB 1S7IA 3CD5A 4JI0J 2W2QP 2CKWA 2Z56B 1WF1A 3PJWA 1UEKA 1OJ4A 1UVMA 2XHWA 5IFMA 5CABA 2VFSA 1TUVA 1KEKA 3QWPA 5FLXU 1F1BB 2JC0A 1RAJA 1RSCA 3K58A 4WZQA 1EKSA 1R8BA 4J9SA 1SKWA 1AUSL 4G3IA 3UCZP 5L8RC 4KGZB 4QWDA 1U09A 4GVBA 1U1QA 3ZZOA 1KC8T 1GX5A 4TLQA 1JJ4A 2DY1A 2ILYA 2B6AB 1HQEA 1NK4A 3R2DJ 1FJCA 1TZ0A 3HP6A 2ZNYA 3KHHA 3C14A 3GWCA 2EFOA 4MKYA 2EW9A 1Q5VA 2NQPA 2V6AA 3ZZRA 4PXBA 1RAAB 4C11A 3RB0A 4ECQA 4MIBA 4YUDA 1LWXA 1FWKA 5GAEU 2E7XA 1MMDA 1FD2A 3DXSX 5KG3A 1R43A 1I51B 2DTJA 3M8YA 1Q4RA 3A8JA 3W61A 4FP9A 1VK8A 4N77A 4DCOB 3RUBL 5GMDA 1X4FA 4BWJA 2NPIA 5C25B 4P73A 2DR8A 2QFIA 2CQ4A 5E3RA 3DOLB 1RWMB 2RQKA 2AD9A 3JQKA 5L1KA 2J0QD 5HMXA 5KOXA 1G1XA 2R8KA 3CD7A 5HBMB 3H0PA 2V4JB 3DLLQ 2E5LJ 3GZ7A 1MN7A 5B09A 4ZVQB 1U1NA 3FNNA 1HYSB 3TOQA 2PA3A 4DR3J 4IFVB 4IRCA 2RJZA 4DQPA 3P3DA 4CCHA 1HLWA 3O1LA 2HHHJ 3HVRA 1WKKA 3M8RA 3JAMU 7AT1B 4DCJB 2BOPA 3DLBA 9RUBA 2IVMA 1T9YA 3VVTA 3M8PB 2AYGA 2F1FA 3U1MA 4QIVA 4X4OA 1T03B 3RBZA 3J80U 4PQAA 1FNMA 4TU7A 2BV3A 2FY1A 1J5EF 4NLGA 1N34J 1C1BB 1OS5A 3L3CA 5DJBA 2UV8A 1SJ3P 3TZXA 1RLDA 3KG1A 1E6VB 3MHYA 1VK3A 1CULB 4R0EA 1LEOA 4PEOA 2DPJA 1QVGR 1A0OB 2BR0A 1Q7LB 3DXBA 4TN2A 2AP6A 2B9WA 1O8BA 2R7QA 1H74A 3DFEA 2UUAF 2DR6A 3PX6A 2QRRA 3KK3B 2DO4A 1D8YA 1L3KA 3OR2B 1PYOB 2N3LA 1BXNA 4ECRA 2XLIA 1UJ5A 1T9UA 4J9NA 2L41A 2ASLA 2VG6B 2YNIA 2DNMA 4LQ3A 2WSCC 4K0KJ 2PC6A 5A8KA 5AE2A 1XMOF 4JYAF 3WIVA 2AYBA 3EZUA 4DR4J 5F8IA 1UWBB 2DEJA 4LJMA 1HI8A 4JI6J 2J7UA 2N7CA 3X3UA 3WBZA 3GJSB 3OLBA 4B02A 2L9NA 2A10A 2HEKA 5KG4A 3PYEA 4QW9A 1RTHA 1SC6A 2IJNA 2OJ3A 4NMLA 2MDAA 3DLJA 1JXLA 2BANA 1GXTA 1K8AT 4R0JA 2LQ5A 2IC3A 4PKDB 1FRHA 2J7WA 4DG1B 2ZH8A 4I2QB 4RZRA 5E3PA 5D3GB 3US5A 2ZD1B 3KHGA 2DKOB 2MQLA 1H2TZ 2KT3A 1R8HA 3GU0A 2YNFA 3QSYB 4L3NA 2OMOA 3HSJA 1RB0A 4HTJA 2BOAA 3ZFVA 2EI5A 3CJKA 1RU2A 1H7WA 3GR1A 2HHWA 2E9TA 3MOJB 2MGZB 3DRRB 2BQUA 2XO6A 5LL6d 3VF0B 3JSRA 4ZIVA 4UOHA 1QUPA 1NKBA 5MLCV 4NRTA 2RMLA 3KLHB 3Q89A 3UNGC 4PWWA 3B8HA 1K44A 4N76A 1RWVB 2G0CA 4WU2A 3J81j 1LWFB 3BH6B 4B3TJ 4KHPJ 1EJ7L 4LSLB 3UR0A 4WWSA 2HZAA 1JQGA 2W9BA 4IYQA 4B9SA 4DFMA 1GQEA 1HNIA 4P7VA 2FJXA 2ZJRQ 2L9DA 3RBDA 1RTZA 3LPEA 4QWAA 2KVQE 3CUNA 5E41A 2IBOA 3K7RA 4ZLNA 1PSDA 3S7RA 3JTPA 4ED5A 1R7IA 4QYZJ 3NXZA 4LRBA 1S76D 1U7LA 4HI2A 1HL6A 3HFZB 2ZHAA 2QZ8A 3MCNA 3G82A 4FPIA 1NSQA 4WXWA 1VRUB 1Q86T 3PIPQ 5J2MB 4DV7F 1TKTB 3BV8A 3PVXA 2EG1A 2GJIA 1JLQB 5D0EA 1FKPA 1PYSB 3N0VA 5LSOA 2RF2B 4KH1B 2HRUA 1KVIA 4IH5A 2UUBJ 1LOUA 5LM7E 4C8NA 5HLFA 1EETA 3CSKA 3P5BP 4JI3F 1K1QA 3W9HA 2C22A 1JLGA 3M8ZA 1LK7A 2HIYA 4RWWA 3ISZA 2NXUA 4BLGA 1H0HB 5JVGQ 2QA4S 1F9FA 5A0YA 4NZ6A 3MM7A 2FZCB 3PDNA 2HQ3A 2VFUA 4Y2KA 1TL7B 4OZ2A 4WXOA 4PG8A 1PBUA 3WDOA 3B78A 5A8WA 4CYUA 4B9UA 4EO8A 1NB2A 4EWTA 3R9LA 2MQQA 1YJ9S 1FWLA 4IH6A 2NZ4A 2LEPA 2FZGB 4X4RA 2K7KA 3ONQA 4WIIA 4DS4A 4PPDA 1W2BR 4ZPAA 1FFGB 5KFLA 1YJNS 4O44B 3JXOA 4N41A 4O3SA 3E01A 3TNVA 4ETXA 4RUHA 1K9MT 3K17A 4HI1A 1OYDA 5HO4A 1K0VA 4ZP6A 3MFIA 4HYKA 2GZOA 1V3ZA 1YX2A 1WUUA 4QBUA 1S1XA 2QG9B 4C48A 4WKRA 4M5LA 2YH0A 1T3OA 2BE7D 4WKYA 1PKUA 2K8GA 2Z8QA 4RL1A 2KJVA 1U0HA 3D66A 2CDRB 2LKZA 3EGVA 4NEYA 1CJTA 3G8SA 1LWCB 2CPIA 4YFUA 1RT1B 4K4UA 2PT0A 3LQVA 2YPYA 1JLCB 3ICLA 4F3QA 2MZSA 1VLOA 2Q6CA 2BQ3A 2DBBA 5E3QA 1KRPA 2MXYA 2FD2A 4ELTA 5AXMA 1LNQA 2DCUB 2HAFA 4N7TA 1XTZA 3OW2R 3GIMA 2FHKA 5IT4A 1TL1B 3ILLA 2AJFE 3TEHB 4RW6B 1AFIA 2HQIA 1TUGB 4OZJA 3C15B 5DRKA 3VAHA 3CMQA 1P6TA 5L46A 1FJ7A 2F9DA 4DV2J 4KC5A 3A3OB 3W2WB 1TELA 3RU0A 1S49A 4LF5F 5D78A 1NPPA 3U02A 2B0GA 2GO8A 2MQPA 4ZK7M 2CPXA 4LSNA 5JJBA 4AXIA 5KFDA 5CYMB 3LWLA 3CJTA 2CZ4A 5KFAA 3QGGA 3D1HA 5JMNA 1N5VA 1DLOB 3ITHB 3W8PA 1HMVB 4H4OA 1NJWA 4USTA 2UVWA 4K4VA 3G8TA 3FEXB 3M6XA 1Z4UA 3Q8VA 2WOMA 1UPMB 3G86A 4LBHA 2E1AA 3DOKB 3ZO7A 4JI5J 2YKMA 3BH7B 2CVIA 2HBQB 2HRTA 1WG5A 4Y2AA 4AE5A 1VIXA 4ZN1A 1OMSA 1T02A 4Y3CA 1RAEB 4WP8A 3F44A 1S1TA 5L1JA 2LXIA 4IG3A 1FK9A 3UCUP 1X9SA 4JI7F 2KXNB 2P9GA 4Y2IA 3MCMA 2CIMA 2I2YA 3FUYA 3AOCA 1VQOS 3NCQA 3H7HB 2FGCA 1U6BA 2VV5A 2MZRA 2B3TB 2OSQA 4U6PA 3KK1A 3CDBA 3BF4A 4CLPA 1Q5YA 4GC6A 4ZCLA 1QUVA 4DXLA 2JDJA 1KFSA 2D41A 1YLXA 2HWHA 3HF5A 2QT7A 4KE5A 2AKWB 1VBZA 1HNXF 5FJ4A 2RIJA 4H4KC 5K14A 3TJAA 2DGXA 2BABA 4HH0A 1MG7A 3CCVS 3ZTQA 1Z2ZA 2UV8G 3LP0B 1S59A 3PJ9A 3OXFA 1IUJA 5F3TA 5B08A 1RADB 5LJ3Y 1KTVA 1B99A 4DJBA 2HBZB 1UEUA 5J1EA 2HIQA 3CJ8A 5H9FJ 1HBUA 3AB4B 4EUVA 2AGQA 4ZMMA 2YKAA 2Y9HA 2LQ8A 4TVAB 2LQJA 1N5YB 4KSEB 1UFWA 4LFAF 5JXSA 4QPXA 2G2YA 4DX8H 1H2UX 3OQ2A 2FVSA 4L6V3 3POTB 4ECZA 3FKBA 1N33J 1IR0A 3M8WA 5EWFA 1OY9A 3KG4A 2NCKL 5HROB 3B4DA 1KWMA 2W8KA 5C42A 2G9OA 3EJMA 2RQMA 4EYHB 1GMUA 4W90B 3V2UC 4OYWA 2FJDB 3RB4A 5U47A 2OTLS 3R5AA 1FT8A 2NSBA 1NO8A 4FYDA 1BC6A 4OI2A 4LBPA 2ZBQA 3QRRA 2J0SD 3H25A 2KZZA 4MFBA 2LU2A 1NEEA 3UNYA 1F6TA 2BKPA 3CT9A 2NYHA 3DMJB 4UQTA 4J9LA 2DY9A 4WFXA 2DPIA 3DLGB 6FD1A 3FFIA 1FVSA 3FMBA 2GQ2A 2VPZB 4DSLA 3D6TB 1XC9A 1ELOA 1YITS 1ZTTA 3D3BJ 1F5AA 3M30B 2D1CA 4DSIA 1FE4A 4BBYA 2IYGA 2G0JA 2XY5A 4ID5A 3GCWP 3LF0A 2M88A 3TVZA 4DI6A 3KNGA 3R6LB 2W24A 2F8EX 1WORA 2B5JB 4ANCA 3ENVA 3PHEA 2N82B 3H5YA 2KKHA 3G96A 3G6VA 3T5JA 1Q7YT 1ZH5A 3Q2SC 1NJZA 3B4MA 2BBEA 3SQGA 4DSFA 2WTFA 1XNQJ 4JI2J 2E66A 1UP1A 2VG5B 2JWNA 7FD1A 1NCLA 2XC9A 2DR5A 3DOMA 2MPUA 4WK1A 1WOSA 4RW4A 3AB2B 3MECA 5IQ6A 4DR2J 5IT0A 2J0WA 4LUBA 2C2DA 3T1YJ 3OVAA 1WC1A 2KI2A 4J5OA 2HHXA 2CAJA 1XMQJ 4GO5X 2K3KA 4PUOA 1KLMB 4CIOA 3PNIA 2BE2A 1IBLJ 4F26A 3RB3A 3K5OA 5AXKA 3RBXA 3CCSS 2CG8A 2D74B 1D1UA 1VDHA 4QWCA 4DV6F 3MAQA 1UETA 4LFCF 1S1VA 4EBEA 3R7NB 1O51A 1YBTA 2UU9J 3D3CJ 4USIA 4O4GB 2YNGB 3PW4A 2L9WA 3T1HJ 2MSSA 1VQ5S 1S0OA 4OI4A 3QFHA 3S8SA 3SIPB 2XM3A 4O3PA 1HBMB 1N4LA 1RTDA 5GAHU 2QJ3A 1J27A 3NOGA 4EFAC 4X66F 2HAIA 5D15A 3THTA 4CLTA 4LF2A 3E8OA 2DGVA 2J5AA 4QW8A 2KXHA 1AUDA 1URRA 3D0IE 4B3SJ 5A2QY 1UAWA 1HNWF 4IFYB 1SJQA 2W7AA 2QSFA 3ZZ0A 2X51A 1HQEB 4NLDA 3PO4A 2MKIA 4Z2XA 3R7BB 1N48A 2C2KB 3AQOA 3A8KA 3AOBA 3K2YA 4LF4F 1ZAWA 2R7OA 4JP8A 3R5JB 1UWAA 4C11B 4KT0C 1HW8A 3N6LA 3MMCA 3OVSA 4EGLA 4FBTA 1HFEL 3W65A 1RT7A 1NSAA 2C3PA 3UD5A 2G4BA 3FZ2A 5IC4B 5G4DA 4DCPB 1Q1KA 3IAM9 1VYAA 1MMNA 4C0OC 4O3OA 2KT2A 3J81Y 5CCLA 4JI4J 5FIIA 5E2QA 4WTOB 1VQSA 3HJVA 1Y5LB 1UCNA 2GHVC 4P2FA 2UXBJ 2FVQA 4LF7F 2XMKA 2XLJA 2OH2A 3AY0A 4F50A 1Q0NA 4FF4A 2J0XA 1ZAVA 2HQGA 1C0TA 4OI1A 2ZDPA 1M5OC 5ETMA 4KO0A 3EVMA 4OI0A 2H9ZA 4E0DA 4KYZA 3QJLA 3D1QA 2MMYA 1CLFA 4YQWA 1A7GE 4UUXA 3KG0A 3HLUA 1SXLA 3D0HE 2JZ5A 2ASYA 1NKEA 1TVRA 2FQQB 2DIUA 3SSRA 2AGOA 3OL8A 1KNZA 2CNOB 4X4VA 3L95X 2MZJA 4LT6A 3KLIA 2IMWP 5F9LA 2AW0A 5EHHA 2K7JA 2KTQA 2JFDA 4A8KA 5DZ7A 2CJYB 2O01C 4ZVSB 4IQXA 4P6QA 1U49A 3P96A 2BW2A 2ZH7A 4XAKA 2A1BA 3KMQA 2KFYA 3CULA 4I64A 2AX0A 1UVKA 3NMRA 5HAOA 3BR8A 1U1RA 3G4SS 3ETOA 4USJC 1VQMS 1D3WA 3HZGA 4C8YA 1RU1A 1Y10A 2KB2A 2G0IA 3UVJA 1FDBA 4RBTA 1OPIA 1VHIA 4CI0B 4DV0J 3JSMA 1SBRA 1UMJA 3IRWP 3GYGA 1DARA 2KHCA 1X5TA 4KB7A 2AX1A 5C24A 3HI9A 2ZBPA 2KM8B 1YJTA 1OWXA 2XGPA 4X65F 1FJEB 4K5RA 2YNIB 5HP1A 2AJ2A 4DR7F 3QLHA 4B3MF 4ZDNA 5KTQA 3BZQA 3LGNA 1S0MA 3HHNB 2PA8D 4LSZB 1NK5A 3R5BA 1S99A 2VBZA 1N36F 2E5LF 5BR8J 3MEDA 4IH7A 3Q23A 2O5DA 5DS7A 3E51A 2VDHA 2ADBA 1RTHB 2E1RA 1H2VZ 4P2XA 4F7VA 1BHNA 1QSSA 3NWRA 1T9TA 4BCAA 2IC3B 4ED4A 4QJVA 5ETSA 2YWWA 5DG8A 2W2PP 1TAQA 2DYAA 1L3VA 5KOWA 1JLAA 3AQPA 3UDCA 4DV1F 1RCXB 2FPHX 4ZLPA 3Q83A 2V8DA 1WTFA 3RR7A 2Y0BB 3CCQS 3VQSA 4YB7A 3G6XA 3JTOA 3W62A 2YNFB 3HKWA 3CJKB 3LAMA 1FXDA 4URQU 2AJ4A 4XO0A 4JBCA 1RHKB 4BC7A 1SJFA 1JLBA 2LEAA 2GW8A 3GONA 3LGMA 5L1IA 4U96A 3HHLA 3Q24A 3DKDA 2OD6A 1IQZA 4NYZA 2D3UA 1RI7A 2J6SA 5B0DA 5GADU 1DZ5A 2W9BB 5KFGA 1HD1A 2M7SA 1HNIB 3JSBA 1FRXA 1F5CA 2DRDA 3SV4A 1PBAA 1WI6A 2I5JA 4JUZA 5KFSA 1SC4B 4C0BA 1SL2A 3GV5B 1NK8A 2QSWA 4M5KA 5IV4A 4RW9A 3D67A 4JI6F 4P9SA 3CCWA 3TUIC 4NCAA 1X4HA 4NLTA 3G82B 2Z2LA 2VOOA 4IR1A 5A8RA 4DHVA 3UDLA 1T7PA 1RCOB 3IG1A 3V6KA 3AODA 1MSWD 2R7TA 4OLPA 2DNLA 4DPWA 5LXRA 1HI1A 1IN0A 2QX0A 4HACA 1DTTA 1E6YB 4NZ7A 4IFVA 1SB6A 5CYJA 2EEYA 2DT9A 2B51A 4RUAA 3CD0A 4HL9A 1HWJA 1V9OA 2H5JB 2YKPA 3CJRA 4OHXA 1NKCA 4B9NA 2HFNA 3M8PA 1IWGA 1F2HA 1M5HA 1JLGB 1U6FA 1RBLA 1T03A 1HBNB 4PR6A 2C3YA 1TQLA 3MR7A 1S7HA 2HZCA 2GAGC 1M5KC 4GKJF 5L1LA 1X9WA 5A0YB 1DQAA 2O66A 3MM7B 1C1BA 4U8VA 2Z4PA 1EP4A 3I0RA 4AL5A 4KKOA 5ETQA 3UD4P 5A8WB 4CYUB 1PC4A 4R8UB 1E6VA 3LUYA 4Q8FA 1IR1A 5BJRA 3KLVA 4NE9C 3AT1B 5D0GA 3BKTA 3M6UA 4DX6A 1SPBP 1NMEB 1JX4A 2M2BA 3D7SB 3H2LA 1U25A 1TKXA 1Q16B 2PSZA 2GIFA 2QL7B 2CPDA 5M2UA 4OHWA 3FBCA 3T1AA 3MPDA 3BSOA 3I9V9 5T7LA 2E29A 2RUSA 3E01B 1PAEX 4LF9J 2I0XA 2R2UA 3KLGA 3M7VA 3VAJA 2CZ9A 1NK9A 1VQ9S 2IAJA 1YI2S 3THPA 1DQ8A 2OPQA 2M52A 1S1XB 4IUFA 3QAUA 3OL7A 1GNKA 4LVOP 4Y2MA 4X62J 2FY8A 1NDKA 3DM2A 1YJVA 1U0HB 2IRXA 4CLWA 2QFJA 2BJ1A 2R2TA 1UWBA 4HT7A 1X5SA 4MTPA 2MLYA 1G7CB 4TQRA 2I8EA 5ETVA 2VPXB 5GAGI 3J80Y 1FDNA 1VFJA 3MZIA 2FDNA 1WI8A 1OQ3A 5D0HA 2HWIA 1KQKA 4CLYA 1KSPA 5KAKA 2D69A 1RHRB 4EO6A 3PV8A 2DD8S 2CJKA 1Y5NB 4YDDB 1N5SA 1MROA 3CNQP 5M2RA 4I2PB 2IRYA 3QZ8A 1NHUA 4OYIA 1RISA 2YY3A 2ASDA 2CG4A 4RUBA 3EICA 4GRSA 4RW7A 4YS2A 1U1MA 3J7YU 1XR6A 4J9UE 2VA3A 3R1LA 1RHUB 1WD6A 3UW1A 1WSRA 1KKHA 3BM7A 2CQ0A 1R0BG 4OYOA 4EZ6A 4F3OA 3EDRB 1RE1B 3MPYA 2LEBA 4L73A 5E3AA 1M1HA 3ZZUA 3QYYA 3CJ0A 2OAUA 4M63A 2YWFA 4Y28C 4H4OB 3B6BA 1RYSA 3U7JA 3RBEA 3CEDA 4ZHRA 2O1PA 2R3VA 3U1LA 2CQHA 2WOMB 1LWFA 2CQDA 4OYZA 4LSLA 2M8DB 1HNZF 1KR4A 2QYCA 5L9NA 2LYVA 2YKMB 4LBIA 1K1SA 3N79A 1N32F 1X4GA 2DGQA 1FXLA 2RUGA 1YJUA 1S1TB 3NRBA 2GCFA 2RS8A 4IG3B 3RAMA 1RHQB 4A8OA 3H5UA 2KYZA 3QIPA 2J8SA 1VQPS 2XS2A 1D8ZA 5GAEI 1SH3A 3OLAA 4F0HA 2G2ZA 1U2RA 4D3GA 2GMLA 4EU0A 3RW7A 1S9FA 3KK1B 1FTRA 3TP2A 2VFRA 4KY3A 1RA6A 2U2FA 3BKUA 2RQ4A 4I4BA 3UR3C 2AJ0A 3C66A 4Q44A 2OI2A 3CVKA 4GMKA 3K5NA 1RWXB 3CWJA 1NJYA 1ZAXA 3NWGA 5K8OA 4WYWA 2G2OA 3AD9C 4X4SA 4B17A 2DNKA 2ROGA 2K3IA 3BBFA 1UZHA 1WHVA 4ZPVR 5LMNF 4DF8A 4ZN3A 3O44A 5J1EB 4OFZA 1HBUB 4OX9F 2ZH6A 3T5KA 1MLAA 4CP5A 5KG6A 2M70A 5CAAA 3EUNA 4WPAA 3HVAA 1L3SA 4TYAA 2WW4A 4PG4A 1S1UA 4ALZA 2FGOA 3MD3A 2GHPA 1QY7A 3NY0A 1S12A 3BQ2A 4YY3F 4JI5F 4DR5J 1KQGB 1SCJB 3J7A1 3P45B 1D09B 1XK8A 1NH7A 3EMTA 3ILIA 4YR2A 4O44A 3MAAA 2FVCA 5C42B 5F8LA 2GX8A 2NUHA 2NYIA 4ZVOB 3AOAA 1F3FA 3W9JA 2LMIA 2GO9A 2CPHA 1PJ6A 2BQRA 1SKUB 1EB0A 2YKQA 4ED1A 4EYIB 3OUYA 1XNRJ 1QD1A 4ZP9A 2MKYA 4DPOA 2MKSA 2OEKA 2DCLA 3TZWA 1WDDA 1WOOA 4O3NA 5ETPA 1WG1A 2APOA 3MF5A 1CVJA 4MFBB 2FIUA 2PO4A 4I6WA 2C28A 4ILLA 2AYMA 3OTBA 4OMFG 4O4RA 5D4NA 4F4KA 3KOAA 1YVFA 3EDQB 2IIHA 3UN5A 1IQTA 4J9RA 4ICLA 5DG9A 3GV7B 3FFIB 4W92B 2CQ2A 3SCIE 4F04B 5SZTA 4OIXA 3M4XA 2IRUA 2WK4A 1TL1A 2C2RA 1NHVA 4ID5B 4RW6A 2CXEA 2DITA 1KOOA 2XCPA 2POKA 1JJCB 2BUNA 4IRKA 1SV5A 2NXEA 2W2MP 3GFZA 1NBEB 2L48A 1KHVA 5BXIA 4F25A 4CO5A 2IM2A 3HSZA 4RKUC 3D1OA 4OYXA 4YB1P 4P2MA 5D8HB 4B9MA 4K4XA 4M5GA 3NS6A 4B3OB 1CPZA 2FLLA 4M5JA 4OHVA 3FMWA 2QLBB 4MK9A 3SQGB 3WC2A 1TK5A 4IRDA 3PYGA 3RJMB 1M0SA 2G1HA 1J2VA 3OTEA 4NCBA 4RW4B 4UTGA 1NHKL 3MECB 2VD3A 3MMBA 1DLOA 1HMVA 3J7Z5 2BJ3A 3NLCA 4AYBD 1RWOB 1YTYA 1IWAA 3O2IA 1O6XA 2F3JA 4YHHF 3GYNA 4RJVA 3MDFA 2IVFB 3CCZA 3DOKA 4JV5F 2BE2B 1TKZA 4FXDA 2VQEJ 2JEIA 3A3NB 3NAHA 3PKMA 2UXDJ 1RKIA 2V67A 3CO9A 2E1MC 2QL5B 3SXLA 1S1VB 4PG6A 3O6QA 3BO4A 1IKVB 2QL9B 1VQ4S 3HD2A 5KFPA 5J2QA 3MTJA 4O3QA 2ZBRA 3G87A 3I6PA 3IN5A 2HVIA 3ENAA 1WHYA 2HHQA 3I32A 4ZCKA 2KZMA 3KYLA 4KR0B 3W9IA 1RTDB 1ZPWX 1KLNA 3GFYA 3KXDA 2V9KA 3A1YG 4NLXA 2I9SA 2HFZA 3NG8A 4LQ9A 3QPIA 4HHJA 4F67A 2GJFA 1HNVB 4WIQA 1KD1T 3ZTRA 2ZVSA 4P71A 1AFJA 4Q43A 3HD1A 4ZP7A
chains in the Genus database with same CATH topology
2QLFB 2H54B 2XYGB 2HBQB 1QDUB 1RHUB 3KJFB 4DCJB 2HBYB 2C2MB 1QTNB 1GFWB 2HBRB 3R6GB 3D6FB 4ZVTB 2H5JB 2XYPB 3KJNB 2H4WB 2HBZB 1I51B 2CNKB 3EDRB 1RE1B 4JB8B 2QL5B 4ZVPB 2XZDB 2H5IB 2QL9B 3D6HB 4ZVUB 4DCOB 1PYOB 3GJSB 3IBCB 1RWVB 3P45B 1BMQB 2XZTB 2CNLB 1PAUB 3NS7B 2QLJB 2H48B 2Y0BB 3GJTB 1RWMB 5IC6B 1SC4B 3R7SB 3R7BB 1RWXB 1RWKB 1RHJB 4ZVRB 2CNNB 2C2KB 2CJXB 4ZVOB 3QNWB 1IBCB 3GJQB 3D6MB 3R5JB 3R7NB 2C2OB 2QLBB 2Y1LB 1SC1B 2H65B 1RHRB 2FQQB 2CNOB 3RJMB 1NMEB 2C1EB 2H4YB 3R6LB 2CDRB 4ZVQB 1RHKB 1ICEB 2C2ZB 1RWNB 2DKOB 1F9EB 3KJQB 5IC4B 2QL7B 3IBFB 3P4UB 1I3OB 4LSZB 4DCPB 2H51B 3GJRB 2XYHB 1RWWB 3SIPB 1RHQB 2CJYB 1RWOB 2P2CB 1SC3B 4ZVSB 1RWPB 1RHMB 5K20B 3EDQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QLF B;  2H54 B;  2XYG B;  2HBQ B;  1QDU B;  1RHU B;  3KJF B;  4DCJ B;  2HBY B;  2C2M B;  1QTN B;  1GFW B;  2HBR B;  3R6G B;  3D6F B;  4ZVT B;  2H5J B;  2XYP B;  3KJN B;  2H4W B;  2HBZ B;  1I51 B;  2CNK B;  3EDR B;  1RE1 B;  4JB8 B;  2QL5 B;  4ZVP B;  2XZD B;  2H5I B;  2QL9 B;  3D6H B;  4ZVU B;  4DCO B;  1PYO B;  3GJS B;  3IBC B;  1RWV B;  3P45 B;  1BMQ B;  2XZT B;  2CNL B;  1PAU B;  3NS7 B;  2QLJ B;  2H48 B;  2Y0B B;  3GJT B;  1RWM B;  5IC6 B;  1SC4 B;  3R7S B;  3R7B B;  1RWX B;  1RWK B;  1RHJ B;  4ZVR B;  2CNN B;  2C2K B;  2CJX B;  4ZVO B;  3QNW B;  1IBC B;  3GJQ B;  3D6M B;  3R5J B;  3R7N B;  2C2O B;  2QLB B;  2Y1L B;  1SC1 B;  2H65 B;  1RHR B;  2FQQ B;  2CNO B;  3RJM B;  1NME B;  2C1E B;  2H4Y B;  3R6L B;  2CDR B;  4ZVQ B;  1RHK B;  1ICE B;  2C2Z B;  1RWN B;  2DKO B;  1F9E B;  3KJQ B;  5IC4 B;  2QL7 B;  3IBF B;  3P4U B;  1I3O B;  4LSZ B;  4DCP B;  2H51 B;  3GJR B;  2XYH B;  1RWW B;  3SIP B;  1RHQ B;  2CJY B;  1RWO B;  2P2C B;  1SC3 B;  4ZVS B;  1RWP B;  1RHM B;  5K20 B;  3EDQ B; 
#chains in the Genus database with same CATH topology
 5C7P A;  3A13 A;  5KFO A;  4CWB A;  1G4C A;  3OXL A;  3FRZ A;  5HQL A;  1B7F A;  1EAR A;  1DBD A;  4EI2 A;  4PWD A;  1PG5 B;  4CNZ A;  4ER8 A;  1S5Z A;  3K5L A;  5IZH A;  3IXQ A;  3PAC A;  4JI2 F;  3MMC B;  1IVZ A;  1RT7 B;  4CZC A;  3DRS B;  1RZM A;  3N28 A;  4ZPT R;  2KYX A;  5AXL A;  3MI7 X;  2HW3 A;  3ETM A;  5D4P A;  3OHB A;  3H2U B;  5B0F A;  1I1G A;  1FE0 A;  1XMQ F;  4AFF A;  3E2E A;  1D9F A;  4NXM J;  2Y1L B;  1R3N A;  1IBL F;  1KVJ A;  2SXL A;  3QMQ A;  2UXC F;  2A6O A;  3D0G E;  2MKC A;  3SV3 A;  2OFH X;  5EX0 A;  3OXG A;  2JEF A;  3OFE A;  3DU5 A;  3GJR B;  5HRO A;  3C16 B;  3CDE A;  4Q2L A;  4CO2 A;  3W2V A;  1MN9 A;  5HQ8 A;  1S9E A;  4LMZ A;  3MUR P;  1BLU A;  2YKN A;  5HMY A;  4JB8 B;  2FLP A;  2Y3Y A;  2R7W A;  1YBA A;  2VBY A;  1TVR B;  2W7O A;  4G65 A;  1MU2 A;  2MY8 A;  4LIW A;  3DI6 A;  3TAN A;  1EAY C;  2VOP A;  5KFX A;  4A48 A;  3CE8 A;  4NLS A;  3KLI B;  1P27 B;  4S0M A;  2CJX B;  2BJE A;  1REG X;  5IQQ A;  3BGU A;  3PW0 A;  5DZ6 A;  5D77 A;  4OZL A;  3GIL A;  2J8A A;  3DDI A;  1F60 B;  2MHN A;  3NGK A;  1NDC A;  4YB5 A;  3HHL D;  1WJ9 A;  1ZM2 A;  3WHI A;  2C2Z B;  5IXU A;  4OI6 A;  4QR2 A;  2EKY A;  1VQ7 S;  1R0A A;  4MAK A;  3GFH A;  2KM8 C;  3KKF A;  1TFY A;  5KFN A;  1FVQ A;  1X0F A;  1W2I A;  2IDE A;  5B0C A;  2B43 A;  4YEA A;  1NRK A;  3M9O B;  4L3K A;  3JSM B;  1BGX T;  2YQ3 A;  2C2M B;  2ROE A;  1GFW B;  2HFU A;  4DUY J;  1EIY B;  3IR7 B;  3F73 A;  1JB0 C;  2MEW A;  2E7W A;  5C24 B;  3CXC R;  4FNH A;  4FVM A;  4USM A;  3H5S A;  3FEY B;  1J5E J;  4J7C A;  2YXL A;  2K1R A;  4UW2 A;  4X4P A;  3MEE A;  2LDI A;  4LRF A;  4KHM A;  3R5G A;  3NKY A;  1TK8 A;  3QLH B;  1VJQ A;  1VQ8 S;  3I5B A;  4UZB A;  2YBV A;  2BMB A;  3MED B;  2RB7 A;  4I69 A;  1TFW A;  1RT2 A;  1U47 A;  4CTA A;  2W1B A;  1U26 A;  2GGP A;  2XY6 A;  1NDP A;  1DRZ A;  5KFJ A;  2YNG A;  2UUA J;  1AZS A;  4PCQ A;  3K59 A;  2ZWO A;  1X4D A;  4DEZ A;  2HNY B;  2CQG A;  2BXJ A;  3C46 A;  5DQI A;  5HI7 A;  3R3T A;  4IOA Q;  2IY5 B;  1AYE A;  4OHZ A;  1QE1 A;  1HBM A;  1XWL A;  1RBO B;  4MIA A;  2FVP A;  1N8R T;  4OZ0 A;  4JYA J;  4EMD A;  3GFX A;  5E7O B;  4U9R A;  2J9D E;  4UOC A;  3PX4 A;  2MLX A;  1URN A;  2B4U A;  4DL6 A;  1N54 B;  1PYT A;  1BE4 A;  2R7X A;  1JLB B;  2FJA B;  1U8S A;  2GQC A;  4IFY A;  1T9X A;  3HHL B;  4C3M A;  1HPZ A;  2OHD A;  1QM9 A;  5IOL A;  1IBC B;  3BQ0 A;  2FC8 A;  4AUK A;  4PYA A;  5J1P A;  4URG A;  5F8G A;  2ZM6 F;  4DBQ A;  2HS3 A;  2ADC A;  1F5B A;  3VR1 A;  1CG2 A;  2UUW A;  2F5G A;  1ICE B;  2LLZ A;  2WB4 A;  3AJD A;  3QID A;  2WVE A;  5D0R A;  1F9E B;  5EGY A;  1CEZ A;  2N4D A;  2H51 B;  2JEJ A;  2QMX A;  2XYH B;  1TL3 A;  2XS7 A;  3OSN A;  1R27 B;  1RJJ A;  4BS2 A;  3WQP A;  1DUR A;  2I5J B;  3M2R A;  5CH7 B;  3QRQ A;  4TY9 A;  1FRM A;  1RT6 A;  2B4O A;  4RW9 B;  1ZBT A;  3F56 A;  2AF6 A;  2ALY B;  5GMK a;  2QIF A;  4NWB A;  5A8R B;  4NLR A;  4PPZ A;  4NA2 A;  2HLT A;  5KFQ A;  3IG1 B;  2HK2 A;  1UJ6 A;  2KG1 A;  4UOG A;  3TZY A;  2G1D A;  2ZOF A;  2YKO A;  4HAC B;  1DTT B;  2X1G A;  1FNO A;  1GEH A;  3NGR A;  3BR9 A;  3KFW X;  3OTO F;  5L38 A;  4DUZ F;  2AHO B;  2MYF A;  3G2X A;  1S9G A;  2RD5 C;  1YJW S;  2QTW A;  4IO1 A;  3MFH A;  1DHM A;  2VKZ G;  1TL5 A;  2ZKU A;  4LR7 A;  3IFE A;  3BN4 A;  3H2V E;  3P4U B;  1Q81 T;  4GVL A;  4RNO A;  1VC0 A;  5T41 A;  3MPW A;  1LKZ A;  3Q8U A;  2YWH A;  2ACY A;  3SEO A;  3QFW A;  3KJF B;  4DV7 J;  1EP4 B;  3I0R B;  1P9Y A;  1RGV A;  4KKO B;  4NYO A;  1EKR A;  3CIM A;  2DNZ A;  2HFO A;  3IM9 A;  1FRL A;  4DFP A;  1J5O A;  1Y7P A;  5C5J A;  5ETR A;  2DHS A;  1RWU A;  1TKX B;  5IT9 Y;  5LMU F;  3H5X A;  1PGZ A;  2D7S A;  1BUX A;  3FBB A;  3MM8 A;  1N6Q A;  4JI3 J;  2RVJ A;  2HQD A;  3S1T A;  2BJ9 A;  3VAL A;  4F2S A;  5T7L B;  5E3C A;  2ZZT A;  3SCK E;  1U1O A;  3GIJ A;  2MQO A;  3N4W A;  1JXV A;  3CCU S;  3R1H A;  3KLG B;  2H65 B;  3HKZ D;  3R97 A;  2IAJ B;  3SI8 A;  5DDP C;  2B8Q A;  4DV3 J;  3TJ9 A;  2OPQ B;  1HQU A;  3L7P A;  3UQS A;  3CJ2 A;  2A3J A;  1O0P A;  5K9F A;  3DM2 B;  3I31 A;  4CLZ A;  3SYZ A;  2J7K A;  3W5X A;  1M1G A;  5C2C A;  3CC4 S;  2E1C A;  1UPP A;  1Q8B A;  3EZO A;  4M8L A;  4F4W A;  4QU6 A;  3MM5 A;  3NL0 A;  4RR5 A;  3PEH A;  4UQG A;  2EC0 A;  2WZ1 A;  3M8Q A;  3IWL A;  4QIE A;  4UF4 A;  2XNR A;  1MRO B;  1ZPV A;  3H40 A;  3IGV A;  4CH0 S;  1X4E A;  2CPZ A;  3CB4 A;  4DQI A;  2AIR B;  4RW7 B;  5EUH A;  2EXU A;  1Q8L A;  1TR0 A;  4B3R F;  2FYX A;  4WCE Q;  3GMG A;  3FDS A;  2XSJ B;  2NR0 A;  1S6O A;  4CNY A;  1S6Q A;  3M1V B;  2UVV A;  4TQS A;  4ED6 A;  5D6G A;  3CDA A;  3OR1 A;  4N8N A;  1S0V A;  3B54 A;  2BM1 A;  4F4X A;  4K4T A;  4CO4 A;  3Q8R B;  3CJ3 A;  4ZHR B;  3MM9 A;  1I94 F;  3MMJ A;  1HA1 A;  4K2J A;  2JVR A;  2RU9 A;  2AV5 A;  4DQQ A;  5DQG A;  2K2P A;  3C8Y A;  2ATL A;  4LR8 A;  3L7U A;  4FS2 A;  1RBA A;  3ENQ A;  2D3O R;  4RLE A;  4LF9 F;  1TUW A;  1CC7 A;  2R8J A;  1C0U B;  2C3M A;  2V63 A;  1RTI A;  1SQF A;  1WOP A;  1U8W A;  4LF5 J;  2QMU B;  2RDI A;  1DY3 A;  3QAE A;  3V5R A;  2P6T A;  3PR5 B;  4WFB Q;  4DUT A;  2W2N P;  2CVE A;  1VCT A;  2HMI A;  2DNP A;  2OLW A;  4C7Q A;  2NXC A;  3QIP B;  1SC1 B;  2EG2 A;  3X1L B;  1XN9 A;  1VBK A;  3DRY A;  5FDL A;  3BJY A;  4O3R A;  4USK A;  1Q8I A;  1WWH A;  2V5H G;  4F4Z A;  2ZKT A;  1G6B A;  2ERR A;  2OSR A;  2ZE2 A;  2AZ1 A;  5LSL A;  5KT4 A;  2E5J A;  3FCH A;  1E6Y A;  4KGM A;  4JV2 A;  5DM7 Q;  4ELV A;  4ZS6 A;  1HHT P;  2CQP A;  3M9M B;  4OZN A;  2OPP B;  1H6K X;  4OJH A;  3M8S A;  1IBK F;  2GNK A;  3NMA A;  3U1N A;  2CNK B;  3ISN C;  1M1K T;  3UO0 A;  1FFW B;  1CJK A;  2F65 A;  2HGM A;  1X60 A;  1VIO A;  2JLE A;  2MQ8 A;  3VQT A;  3N6N A;  2BKO A;  5KG0 A;  4ID8 A;  3MR2 A;  3PYF A;  4P75 A;  5F3Z A;  5D4L A;  1RAF B;  1HBN A;  3VVU A;  4JI7 J;  2R7V A;  4DV5 F;  2RIL A;  4KGK A;  2EFN A;  2NXN A;  2J9D A;  1X31 C;  3UFC X;  4ED8 A;  2EK1 A;  4ECW A;  3FGV A;  2LA6 A;  3IMQ J;  3W60 A;  2HK3 A;  4YP3 A;  4C9D A;  4R8U A;  1GMW A;  3LAK A;  3GSD A;  1N52 B;  4PXD A;  2P9E A;  2MLZ A;  1YSJ A;  1S1U B;  4LR9 A;  1WEY A;  3W5Y A;  4R5P A;  3T9Z A;  1HNX J;  2ZZN A;  1RP5 A;  2QN6 B;  4MJK A;  4WFY A;  3GSI A;  1FRI A;  1VIS A;  3WC0 A;  4QOT A;  3I4H X;  2EFV A;  2KRB A;  3MAA B;  3IAS 9;  5KFW A;  3HPO A;  2XEX A;  3CJ5 A;  3PJX A;  4PYD A;  2KL8 A;  3KDN A;  4RPF A;  1ACM B;  1U48 A;  3CCE S;  3OUY B;  3HHK A;  3MXH P;  4DL5 A;  1IKW A;  2ZH5 A;  4TU9 A;  2R8H A;  1Q79 A;  4LFA J;  5MAO A;  2WVC A;  3BO2 A;  3HVT A;  3PCO B;  1ZYQ A;  1WHW A;  4RNH A;  2KJW A;  3Q86 A;  5F0W A;  1C4A A;  1V3S A;  3H59 A;  5AJ3 F;  3KUG A;  4EBD A;  1BY9 A;  3BKF A;  4ICL B;  3QRP A;  1FXR A;  2IM0 A;  2JVO A;  2JL9 A;  2VBX A;  2Y1R I;  3VGV A;  4J90 A;  3WZ0 A;  3TVK A;  2PMH A;  2NXJ A;  2AEJ A;  4ZCM A;  2HHU A;  2GVD B;  2A0F B;  1VS3 A;  2DIV A;  4NXN J;  2E5H A;  4NI2 A;  4NMX A;  4Z37 A;  2HPU A;  4QQB A;  2DHA A;  5EN1 A;  1V3R A;  3IBW A;  4JI8 F;  3J81 U;  3KJV A;  2WBR A;  2P2C B;  4I2P A;  2QA4 G;  1RWP B;  1SV5 B;  1QAJ A;  2D9P A;  3NS5 A;  5F8J A;  2YWG A;  1L3U A;  1APS A;  3P49 B;  3IR5 B;  1K0T A;  1OYE A;  1VBX A;  4K8R A;  4DPT A;  2KO1 A;  1MW7 A;  2RNE A;  2RQC A;  1NUE A;  1U2F A;  2OUG A;  1H3D A;  2OEM A;  4OX8 A;  4CO0 A;  2L3M A;  2VZ9 A;  3KMS A;  2V2K A;  1YRT A;  3BS9 A;  2WB1 D;  2Q1L A;  3RAX A;  3MMB B;  2IDL A;  4Y2C A;  2CFX A;  1XR7 A;  1IR2 A;  4DR5 F;  4JV1 A;  3V4M A;  1LXN A;  2LQB A;  4UZC A;  3I56 S;  1YG0 A;  5HJX A;  2IVY A;  3K8W A;  2XY7 A;  1TKZ B;  3BBC A;  1G2E A;  3HCX A;  5J2P A;  2HWT A;  4HT5 A;  2GS8 A;  1N0V C;  3EGN A;  3C6T A;  5KFY A;  5ITH A;  4AQY F;  2W4C A;  5J2Q B;  2PN6 A;  3CW2 C;  4LRA A;  3VAM A;  2HBR B;  5GAD I;  3AA8 A;  1SH2 A;  1AA1 B;  3AD8 C;  2RE1 A;  3FVY A;  5KFZ A;  1HHQ A;  2DB1 A;  4KFB A;  4NX9 A;  3BSN A;  2FVR A;  2B56 A;  2P9C A;  3RW6 A;  5DLG A;  3KLE B;  3DDK A;  3PZP A;  5H9E K;  4QIG A;  2F9J A;  3EXC X;  3I9Z A;  3JYT A;  4TU8 A;  3R7S B;  2C2E A;  3V6D B;  2KU7 A;  3FCW A;  4K2X A;  4ZJL A;  4DV6 J;  4M94 A;  1HR0 F;  2CJA A;  2OTJ S;  2JX2 A;  3JTN A;  1R8P A;  1X5P A;  4MKA A;  2AGP A;  4OZ1 A;  5JUM A;  2V68 A;  3S6E A;  4H54 A;  4ZOS A;  4PWD B;  1LK5 A;  1TAU A;  2XMW A;  1S6U A;  1QJH A;  1T95 A;  2WVD A;  1KHW A;  4LF6 F;  4OV6 A;  2HLU A;  2XYG B;  3OBI A;  3MMA B;  1Q82 T;  4OV1 A;  4FYX B;  2XMT A;  5DDQ C;  1S57 A;  2LA4 A;  4X66 J;  3CC2 S;  1RT3 B;  4A46 A;  1PO6 A;  2IA6 A;  1Z2L A;  2EFP A;  3LPY A;  5C2G A;  4A4J A;  2M3D A;  1XJW B;  2H5I B;  3EWG A;  4FPR A;  4XK8 C;  3GCX P;  4RNM A;  1FJG F;  2E44 A;  2HND A;  1ZM3 A;  5IC6 B;  4B9V A;  1U1L A;  3EVW A;  4Q7A A;  2YX7 A;  2HRY A;  4Y00 A;  4M5M A;  4NL5 A;  2OPS A;  4LF4 J;  2D9O A;  3W2V B;  3ILJ A;  4C97 A;  2KFZ A;  2W4P A;  2ZWP A;  3W66 A;  1B0T A;  1S9E B;  5HMZ A;  3PRD A;  4A8Y A;  2CDQ A;  2ZDO A;  1GTH A;  2BDP A;  1ROF A;  3AAW B;  4PAA A;  4GKK J;  2YKN B;  4Y65 A;  4X4Q A;  2DHX A;  2R4F A;  4K7Q A;  1DFD A;  2IHR 1;  1MU2 B;  5F8H A;  2AT1 B;  3DI6 B;  4CLL A;  3W7B A;  1RT4 A;  4DPY A;  3PRB A;  4F4A A;  2M8H A;  2HQF A;  9ATC B;  2DH8 A;  4LF7 J;  5DO2 A;  1R6Y A;  4ILR A;  4MIW A;  1YGY A;  4CT8 A;  1QVF R;  4DU8 A;  2RS2 A;  1IBM F;  3PXG a;  4ED2 A;  2I6W A;  2BVZ A;  8AT1 B;  3DU6 A;  4GO7 X;  3VTI A;  5CXT A;  2VQF J;  4DV4 F;  2XMJ A;  4OX7 A;  4EBC A;  5L39 A;  4ECY A;  5HN0 A;  1R0A B;  1ZS6 A;  2LVW A;  2QYG A;  1UKU A;  3M2U A;  2DHG A;  1SUQ A;  1JMT A;  2VF3 A;  2HHS A;  4B3O A;  1UJ4 A;  3KDO A;  1UEV A;  1JLE A;  3D5M A;  2M0G B;  3WIU A;  3KJQ B;  2PFD A;  3KTQ A;  4A8M P;  3FRY A;  3IBF B;  3CCM S;  2OFG X;  4PWU A;  3QGP A;  4NXM F;  2NLW A;  2K1R B;  3CMA S;  2MJU A;  1O5J A;  3MEE B;  2RT3 A;  2KFN A;  4USV A;  3BSA A;  4ZPD A;  3J7Y I;  3R5D A;  3DYA A;  3CC7 S;  4OQJ A;  5DLF A;  1GAO A;  3GYX B;  5KT6 A;  3D6F B;  3GB0 A;  4ED0 A;  2RKI B;  2N7Y A;  5DDR C;  3W3S A;  4WBF A;  4RU9 A;  2CWK A;  4C3K A;  1MNE A;  4DR1 F;  4ZVU B;  1HWL A;  1B64 A;  1LW0 A;  1RT2 B;  4CTA B;  4JI1 F;  3A8E A;  3CDU A;  1IKV A;  2NSC A;  2WON A;  4DLG A;  2GGP B;  3EGW B;  2FHO B;  2DNR A;  4OYA A;  3BYR A;  3G71 S;  4C2M A;  4W4M A;  4WF9 Q;  1AZS B;  2QLW A;  2B4V A;  2OIH A;  2V8P A;  1DTQ A;  2W01 A;  1T05 B;  3VGT A;  5DGA A;  2E7V A;  3SQO P;  2DNQ A;  2DH7 A;  3GPA A;  1QE1 B;  1HHS A;  1PJ5 A;  4X65 J;  3I55 S;  5EWE A;  3HHL C;  2VFV A;  4DR7 J;  1SL0 A;  3N5B A;  1XR5 A;  4K4S A;  5F8N A;  3TR5 A;  4ZA1 A;  4B3M J;  1YRX A;  3OFH A;  4FYV B;  4A8X A;  3EYZ A;  3Q0A A;  1N36 J;  1Q8K A;  1HNV A;  4U95 A;  3AHP A;  3ZTS A;  1XIQ A;  1FKO A;  1QDU B;  3OHA A;  3HT0 A;  1AW0 A;  3GTY X;  1YZ6 A;  3MPU B;  1HPZ B;  2VB6 A;  4DL3 A;  3CCJ S;  3N6M A;  4KPY A;  4DR6 F;  3VGS A;  3DLE A;  2UZA A;  4MMO A;  2Y1I A;  1JWW A;  1Q78 A;  2VFT A;  1X4B A;  2WRM A;  3JQM A;  3R5C A;  4DUY F;  4I56 A;  1CC8 A;  1SJ4 P;  4DV1 J;  1F0X A;  3QGI A;  5DQH A;  4FF2 A;  1QAX A;  4ZKA A;  2KG0 A;  1NSP A;  4AL6 A;  3DRS A;  4KHR A;  1TL3 B;  2W9A A;  2YVS A;  5EX3 A;  2BRK A;  3L7O A;  4NLP A;  4XPE A;  2CQI A;  3K8V A;  3M2R B;  2BEF A;  3C6U A;  2M4M A;  2D3O 1;  5H9F K;  5DG7 A;  4YB6 A;  5HK4 A;  1RT6 B;  3IA0 A;  3T19 A;  3FK4 A;  1NLK L;  3TUZ C;  2I1R A;  2KH9 A;  4M1K A;  2X1F A;  3M6W A;  2JLG A;  2COL A;  3FEZ A;  1LWE A;  4QU7 A;  2W7P A;  1T3N A;  4ECT A;  3OT9 A;  4HLB A;  5IWA F;  3CTR A;  3HSG A;  4ZLJ A;  3GP9 A;  5LOQ A;  3T6J A;  1RHM B;  1Y0H A;  2VIC A;  5K5M A;  3C16 A;  3MOZ A;  1VQL S;  8ATC B;  1B3T A;  3K57 A;  4NCG A;  2V2V A;  1OSD A;  4CLK A;  7FDR A;  3CO0 P;  2DGU A;  2X1A A;  1YWX A;  1HKA A;  4QWE A;  1EX8 A;  1FEH A;  2FHJ A;  3SBM A;  3MTK A;  2Q3P A;  1TV6 A;  4JI0 F;  2FJW A;  1BMQ B;  1S9G B;  4X84 A;  2OGU A;  2IA0 A;  4C8Z A;  2VJU A;  3LWM A;  5KT2 A;  4WTY A;  4XTT A;  3VCD A;  4ES2 A;  1X9M A;  3OVB A;  5AE3 A;  1CJV A;  4NLU A;  4EEY A;  3IRX A;  4PG7 A;  1C4C A;  3TA0 A;  4ATN A;  2GAH C;  3LW5 C;  3C3L A;  2CPY A;  3FBF A;  4KRW A;  1VRT A;  3T3F A;  2WAQ D;  2YH1 A;  1IJF B;  2HNZ A;  2Z0G A;  2NRE A;  2KDO A;  1J5O B;  4HEA 9;  4KH0 B;  3ZZP A;  4TYB A;  3DGP A;  5CQG A;  1HIY A;  2E9Z A;  4C4W A;  3MM8 B;  2PMW A;  1N6Q B;  5LSR A;  4IO9 Q;  4ES1 A;  2ZUA A;  1M90 T;  4FYW B;  3F41 A;  5FD1 A;  4GKJ J;  4DX7 A;  4YDX A;  3GJT B;  1HQU B;  4FXV A;  4X64 J;  5IV3 A;  3H98 A;  2XZW A;  3F0N A;  3NGU A;  4DQS A;  3HK2 A;  2XS5 A;  3E3X A;  5BYS A;  1SKS A;  2JLF A;  3T41 A;  3KLF B;  3S01 A;  2BJ8 A;  3GII A;  4V19 X;  4DQR A;  4TXS A;  1HD0 A;  3NGS A;  3VAF A;  4U7C A;  4DR3 F;  4ED7 A;  4K59 A;  3MM5 B;  2XB2 D;  1H72 C;  4BC9 A;  2YX1 A;  3OD2 A;  5CCM A;  4DWI A;  2HHH F;  3AJ1 A;  3M8Q B;  3PRV A;  4BDP A;  1S1W B;  3IP0 A;  4DOZ A;  1IKY A;  2HNY A;  1N0U A;  4AND A;  1MML A;  1C1C A;  3ZTP A;  3Q2T C;  5CYQ A;  4HR2 A;  4FZV A;  1XEZ A;  4ECV A;  5H9E J;  5B0G A;  3TVY A;  5I42 A;  3THV A;  2OO4 A;  1N34 F;  2XNQ A;  4C8L A;  3T6B A;  3IBC B;  1FF2 A;  3PY8 A;  2XBP A;  4IDK B;  4EK2 A;  2B7B B;  1S6Q B;  2HYI B;  2DGS A;  3VZI A;  3TA2 A;  2MKK A;  4ERD A;  3MR6 A;  3RGI A;  3OR1 B;  5L9X A;  1GMW D;  1NH8 A;  2KRR A;  2F4V J;  1BQN B;  4XDD A;  3ADA C;  2PEH A;  2G13 A;  3MM9 B;  2DH9 A;  1X0P A;  1U0S A;  3SMZ A;  2UUC J;  4MKV A;  4XIU A;  2Q6B A;  2W2O P;  4LF1 A;  5KFH A;  1TL4 A;  2ZH3 A;  1SH0 A;  3TZZ A;  3H4B A;  1FO1 A;  4DV3 F;  4KTQ A;  1MWZ A;  3AH6 A;  1X5O A;  3RR8 A;  1RTI B;  4YOE A;  4ZJQ A;  3G8Q A;  4B9T A;  2LXF A;  3HZE A;  1VI7 A;  4Q0B A;  5HMW A;  4K0K F;  4NRU A;  1UVL A;  2OPR A;  2IM1 A;  2HMI B;  2MY7 A;  1NDL A;  3BBB A;  4DR4 F;  3UN3 A;  1ZTW A;  1V6H A;  3KUE A;  2MST A;  1U1P A;  1PJ7 A;  3DNC A;  4ELU A;  4HHH A;  5FDL B;  2DNN A;  4H4M A;  1WTB A;  2XI2 A;  4N8O A;  4J9V A;  1D9A A;  4KPC A;  4W98 A;  5FLX Y;  3TAM B;  4HDH A;  2ZE2 B;  3KK2 A;  4ECX A;  1HNZ J;  4U7U K;  3SSQ A;  2XSF A;  4ZVG A;  4ZPW R;  3IS9 A;  4OJ3 A;  3OV7 A;  1N32 J;  3QGH A;  3TO8 A;  3L4B C;  3P8B B;  1UFL A;  3LOU A;  1OO0 B;  1HBO A;  2OD4 A;  1I3O B;  2QV6 A;  1CJK B;  1JNR B;  5KFK A;  1FHT A;  1OY6 A;  4OZ3 A;  3EVO A;  4P52 A;  5E5N A;  1RT5 A;  1ARO P;  4RW8 A;  2DR9 A;  1VQK S;  1NXI A;  1NZ8 A;  4OJG A;  4LVN P;  2DGO A;  4AT1 B;  3FSY A;  1IKX A;  4ITS A;  3KHL A;  3KJN B;  3BSC A;  4DPU A;  4U7U D;  3HFV A;  5IM0 A;  4G1Q A;  2C3U A;  2XO7 A;  4WK3 A;  3CF5 Q;  3RZA A;  3RRK A;  3VV2 B;  3UWT A;  4B3T F;  4KHP F;  2BE9 B;  4IG0 B;  4F0K A;  3K5M A;  4R5P B;  4C6A A;  1X8D A;  3MD1 A;  3PFO A;  3LTO A;  1RHJ B;  2MQN A;  3SDE B;  5ETK A;  2JEG A;  3NNH A;  1WEX A;  4C8O A;  2HG4 A;  4CT9 A;  1PC5 A;  3CPW R;  5G0R A;  2EBG A;  3HDS A;  3MM6 B;  1JXE A;  2HHT A;  2VOD A;  1R89 A;  1MWQ A;  3PW7 A;  3QWU A;  1REV B;  4O0I A;  2LP4 A;  3TWZ A;  3VZH A;  5LMN J;  1ZOT A;  2N3O A;  1S79 A;  1N88 A;  2OEL A;  1Q53 A;  1U2C A;  4OX9 J;  1X4C A;  1IM4 A;  1IKW B;  2QE5 A;  5THW A;  1KOH A;  1YKW A;  1WC4 A;  3JAM Y;  2RRN A;  1FNX H;  4CO1 A;  3ELH A;  3HVT B;  3M32 A;  3AD7 C;  2DNY A;  1BQM B;  3QSI A;  5KG5 A;  1WC0 A;  4OYP A;  1IXK A;  2ILZ A;  4YY3 J;  3GG0 A;  3EGZ A;  1CS4 B;  4C3L A;  1Y3K A;  1L5U A;  2UUB F;  3ET6 A;  4WFA Q;  1FRK A;  1KP6 A;  1BD6 A;  4TY8 A;  3MR3 A;  3PG9 A;  3NBP A;  3PW2 A;  1NPR A;  4NI2 B;  2E5I A;  2V8V A;  3HX9 A;  1FX2 A;  1UFK A;  2YNH A;  3LP2 A;  3KJV B;  2CAD A;  3TRG A;  1UVN A;  4RU2 A;  1CJU A;  4KV8 A;  1KQS R;  2ZEJ A;  3I87 A;  2XMM A;  4FXW A;  2J6U A;  1LW2 B;  3HO1 A;  1P1T A;  1W7W A;  2XSJ A;  2QGF B;  2MKH A;  4J9O A;  2ZH9 A;  3ISN D;  4U8Y A;  5ETN A;  3M1V A;  1RWW B;  3CCL S;  5HJY A;  2W8L A;  4J91 A;  2RU3 A;  5AXN A;  3B82 A;  2HBY B;  2GA7 A;  1WDT A;  3DRP A;  1UL3 A;  2GVZ A;  4FF1 A;  4FF3 A;  4V1A k;  4J9M A;  1H98 A;  1VBY A;  3BEG B;  1P8G A;  3H90 A;  2EK6 A;  3UDV A;  1ITP A;  1XER A;  4WU3 A;  2XG8 A;  5CHC B;  2BJD A;  2X3G A;  1FDD A;  2RHQ B;  1UA0 A;  2QLJ B;  1RUS A;  2GV1 A;  4FS1 A;  3GE9 A;  5J2P B;  2Q79 A;  1C0U A;  3KUH A;  1P9Q C;  2AJ1 A;  3NEK A;  1SVD A;  3C6T B;  3D6M B;  3EPG A;  1BQX A;  3TX8 A;  3IR6 B;  4YR0 A;  1FEE A;  2MZ1 A;  4USU A;  1NK7 A;  2EKN A;  2F8H A;  1ULR A;  4E98 A;  1DQ9 A;  3BPS P;  3G6E S;  1F2G A;  2CYY A;  4HVZ A;  1JNZ B;  3QO9 A;  2MJN A;  2YTC A;  4M5D A;  2F63 A;  3EX7 B;  3GG1 A;  4RBU A;  4KFB B;  1UW9 A;  4DZD A;  3MUM P;  1HWK A;  4YHH J;  3W64 A;  1SI9 A;  4CO3 A;  3PHT A;  5KFF A;  4JV5 J;  4LRC A;  3ZZZ A;  4NXN F;  2Z2M A;  2YQ0 A;  3PM9 A;  2GMH A;  3JYT B;  4KQZ A;  2IMO A;  4ZVT B;  3GR0 A;  4ZP8 A;  4F02 A;  2OPP A;  4DZ6 A;  4DDF A;  5HVF A;  3IGN A;  1SJR A;  2F4F A;  4DV2 F;  2M5Y A;  5HVH A;  3W1Y C;  1I6J A;  3HUL A;  1M5S A;  3A12 A;  3HM9 A;  3BRE A;  3HT3 A;  2CNL B;  2H3E B;  3HHD A;  2RHS B;  1RAC B;  1VC6 A;  2N4C A;  1M5P C;  4WYL A;  3J7Z T;  1PCA A;  3PO5 A;  3OFG A;  1CQN A;  3ZXW A;  1JJ2 R;  3VAG A;  3DDN A;  1VOM A;  2R8I A;  2EFQ A;  4QCL A;  2YX4 A;  2J9E A;  3RG6 A;  4OHY A;  1RWN B;  3LAL A;  5KFE A;  3LAN A;  2H1Y A;  3EE3 A;  4G6V B;  2AEF A;  1CBK A;  2B4P A;  2OKQ A;  2HVE A;  3W8G A;  4D3H A;  5K20 B;  2HND B;  3AA9 A;  4MT1 A;  5K8P A;  2WVF A;  1H7X A;  3FBE A;  1S4E A;  3OSP A;  3AFG A;  3VGU A;  2WSE C;  4QWB A;  3PR4 A;  3P5T L;  3FJ2 A;  2OPS B;  1Y00 A;  2GJ2 A;  3CGI A;  5ETL A;  1ZA2 B;  2GHW A;  5HAN A;  3OJU A;  4WJB A;  3KNA A;  4UUW A;  4ED3 A;  4NOH A;  2FJE B;  1V5I B;  2H48 B;  3BGF A;  2WW8 A;  1SQE A;  1RYR A;  5I3U A;  3O5T B;  3O8W A;  3D2W A;  2Y1J A;  3UD3 P;  2CQB A;  2IJR A;  3TI0 A;  3EXY A;  2XTJ P;  1UA1 A;  5KT7 A;  1KS2 A;  1RT4 B;  1S6P A;  2CA9 A;  2R7U A;  3W63 A;  2V9W A;  2W9C A;  4TKT A;  4MK8 A;  3PYD A;  2QA2 A;  2R7R A;  2UXC J;  1FA0 A;  2X3D A;  2KHD A;  5E33 A;  3CJQ A;  2GVD A;  4CLU A;  1OIA A;  4K5S A;  3K0J A;  1Y5I B;  1QSL A;  2CPF A;  1TTH B;  2RAQ A;  2MQM A;  2KN4 A;  4I1T A;  2XYP B;  2LCW A;  4NEZ A;  3ENW A;  4C8M A;  3MUV P;  3M2U B;  3GQC A;  3VHQ A;  2HZV A;  4JOU A;  3M2V A;  4DFJ A;  1SUQ B;  2B7C B;  1N5Q A;  4F3M A;  1YZ7 A;  4Q8E A;  1DAX A;  4J37 A;  2PMZ D;  1JLE B;  3Q8Y A;  3HMJ G;  2VG7 A;  4L74 A;  1GXU A;  2DHH A;  2VBW A;  4N5S A;  1YJ7 A;  1TMJ A;  3MEG A;  2XWX A;  2P6S A;  4GVB B;  1VQY A;  2DEI A;  2HKE A;  1TKD A;  4DLE A;  3CDW A;  2CJB A;  2ZNZ A;  1N33 F;  3DYA B;  3V81 A;  2HUR A;  1W25 A;  1S10 A;  2OP5 A;  1I5O B;  2XMA A;  1B7Y B;  2BRL A;  4I0W A;  5M2P A;  3BPD A;  1Q95 G;  3C14 B;  4WE1 A;  3FC9 A;  3IC1 A;  1RXO B;  4HH1 A;  4A8Q A;  4ES3 A;  2PEB A;  3JQJ A;  2YPZ A;  3I0S A;  2VDI A;  2ATC B;  2HVD A;  4FKY A;  4PAB A;  4H4K A;  5E0O A;  1LW0 B;  3T9N A;  1RDR A;  1UVJ A;  4IOB A;  2WON B;  4GKK F;  3D68 A;  1R8A A;  1X4A A;  2FHJ D;  2IFX A;  2ZHB A;  3SCL E;  1D9D A;  3I96 A;  2E9R X;  3OL9 A;  3V4I A;  1QAY A;  4WZM A;  2ABY A;  1DTQ B;  1GTE A;  2X7I A;  2GFF A;  3FQK A;  2Z30 B;  3MR5 A;  3FCV A;  2DRB A;  4E8U A;  1NU4 A;  5IT9 U;  2MZQ A;  3BGR A;  3KLE A;  3DHW C;  3FSX A;  5AE1 A;  4CLF A;  3OTD A;  1GMV A;  1AXQ A;  4F0M A;  3V6D A;  3C2P A;  1ZET A;  1FKO B;  2VQF F;  4LFB J;  1SQG A;  4DL7 A;  4WP9 A;  4LRE A;  2CQ3 A;  5I3Q A;  3BGO P;  3DLE B;  4LF8 J;  1PIL A;  1U24 A;  2CPJ A;  3NGT A;  3GIK A;  1RAI B;  3HJF A;  3UPF A;  2DIS A;  5BYR A;  4PQU A;  3ILO A;  2PFF B;  1XNQ F;  1EZZ B;  3LP1 A;  2PI4 A;  4XDC A;  4QR0 A;  1DJ0 A;  3TUP A;  5J2N A;  3MMA A;  2A2C A;  4DR2 F;  3D28 A;  1B0P A;  4HDG A;  3VWS A;  4I7F A;  2BW7 A;  1B0V A;  3T1Y F;  2K06 A;  1RT3 A;  1WG4 A;  5LXY A;  1NSK L;  4CM2 A;  1H73 A;  3C6U B;  1R0C B;  1PAU B;  4RNN A;  4ECU A;  3LH2 S;  2LXU A;  1VQN S;  1LWE B;  2IJF A;  1KQF B;  1KDN A;  2AJQ A;  3ZC4 A;  2VL1 A;  3DLK A;  2R2R A;  2VHG A;  1S0N A;  2UU9 F;  2UP1 A;  3DGV A;  4PG5 A;  2ZM6 J;  2IBK A;  4ZCI A;  1U45 A;  4NCG B;  2C1E B;  3T1H F;  1WHX A;  5LT5 A;  3M9N B;  4GC7 A;  4M95 A;  1VMB A;  3MEK A;  2CJQ A;  1XMB A;  3DRX A;  2FLN A;  1QAI A;  3Q8Q B;  1YK9 A;  4ZVH A;  1T8E A;  1TV6 B;  4L76 A;  1YJR A;  2EFG A;  3I4P A;  4G1P A;  2JOQ A;  2QLF B;  1QSY A;  3TQ1 A;  2AMC B;  4ENO A;  4ZPB A;  3GLJ A;  5A8K B;  3JB9 k;  3L9Z A;  2RDJ A;  3EM1 A;  3R8Y A;  3FQL A;  1N5T A;  3NNA A;  1JKH A;  1VLY A;  2H4W B;  1CJV B;  1JLF A;  2WSF C;  3IRX B;  4DPX A;  4B3S F;  4FVC A;  5DM6 Q;  4P7T A;  5CA5 A;  4ECS A;  3HFK A;  3N5F A;  1RTJ A;  1NK6 A;  2BAN B;  1OQ6 A;  1OSC A;  1VRT B;  2RRB A;  1X7V A;  2HSE B;  3CIZ A;  2HNZ B;  5HSP A;  3GJQ B;  2C3O A;  2QLX A;  3OTO J;  2ZOG A;  2FUG 9;  3GIR A;  4DUZ J;  3Q8P B;  5EDW A;  1S97 A;  4J9P A;  3DGP B;  4YME A;  4PRF A;  1VRQ C;  2BYC A;  2OEJ A;  5KFR A;  1JIH A;  1T94 A;  2CPE A;  3PKY A;  3AXK A;  2JSX A;  4MK7 A;  4P74 A;  4F4Y A;  2H5E A;  2A18 A;  3AXM A;  5ETO A;  2UVR A;  1YRU A;  2QO3 A;  3I5A A;  4I68 A;  4UT4 A;  5T14 A;  4JI4 F;  1YHQ S;  3K5P A;  4A8W A;  4DFK A;  3TW0 A;  1NK0 A;  4DL2 A;  1HWU A;  2UXB F;  2DGT A;  3ULH A;  2B6A A;  2IPO B;  2R7S A;  4O0N A;  5JVH Q;  4ZVP B;  2RKI A;  4LIR A;  4Q2M A;  4DMZ A;  3H42 A;  3H20 A;  1V5V A;  1KTQ A;  2B9X A;  2XZT B;  2PDA A;  5LMU J;  1SJ1 A;  2HGL A;  1GH8 A;  3R2C J;  4A8S A;  3QNW B;  2RRA A;  2D3Z A;  2B8P A;  3IO1 A;  2DRA A;  3BGL A;  4Q45 A;  1NAQ A;  2ZIT A;  2J76 E;  1IKY B;  2VUG A;  1LFP A;  2H4Y B;  1T05 A;  2HS0 A;  1C1C B;  4CH1 A;  5C25 A;  2WBM A;  3DOL A;  5CYQ B;  2DK2 A;  5ETT A;  4URS A;  2ROP A;  2L08 A;  5I42 B;  4LRD A;  2QC3 A;  5KFC A;  1XMO J;  2VON A;  3RTV A;  5HBM A;  4JV0 A;  3MCO A;  5BYQ A;  2V4J A;  2JH3 A;  1FKP B;  4RWX A;  4NLV A;  3NAI A;  3UCG A;  3QT6 A;  1HYS A;  1PIE A;  3RAQ A;  3I5C A;  2VAS A;  4ZVE A;  1WSV A;  1FFS B;  5KT5 A;  4C8K A;  5HL7 Q;  2ZOM A;  5CD4 A;  4N56 A;  5HLF B;  1WEL A;  1EET B;  1LQ9 A;  4DV0 F;  2CQ1 A;  2R9L A;  2DNO A;  2C42 A;  2AWZ A;  2WCX A;  4ZIW A;  2XGQ A;  4C0H A;  3D4J A;  4B3R J;  4UY8 T;  1T11 A;  1FES A;  4X64 F;  4DS5 A;  1ZA1 B;  3TA1 A;  1HAR A;  5H1S V;  4Q0B B;  2V8H A;  2JC1 A;  2OPR B;  1RAB B;  1CUL A;  2GIR A;  5BR8 F;  1SC3 B;  1R31 A;  3D54 A;  4RX6 A;  4F8R A;  4H4M B;  5F8M A;  4Y34 A;  5DET A;  1I94 J;  4ANE A;  4QIF A;  3UN2 A;  1R8C A;  3KK2 B;  3KK3 A;  5F0U A;  3CJ4 A;  4R25 A;  3JSY A;  1NJI T;  3D6H B;  3OR2 A;  3IS9 B;  4I67 A;  1NZA A;  2HFS A;  3RRG A;  3ZNU A;  1JK9 B;  5I4M A;  3OL6 A;  3Q8S B;  2VG6 A;  1HBO B;  4RBV A;  4M5I A;  2EBE A;  4QYR A;  1RWK B;  4ZJO A;  4ZVR B;  1KFD A;  4UOF A;  4HTI A;  1ZZF A;  4L72 B;  2ZJP Q;  1NM2 A;  1RT5 B;  4RW8 B;  4X4T A;  5B7W A;  3N01 A;  3MWB A;  1CJT B;  2BA9 A;  5DDO C;  2HQC A;  2Z2Z A;  2MHE A;  2XUL A;  2KXF A;  1IKX B;  1F9H A;  3H4D A;  4OYB A;  2F4V F;  3QT7 A;  3RYL A;  5IM0 B;  4G1Q B;  3G9C A;  3WX4 A;  5K8M A;  2DXD A;  2O3D A;  1K73 T;  5D4O A;  3FSI A;  2DNG A;  2LU1 A;  4DG1 A;  1AB8 A;  2UUC F;  4P72 A;  2YQ1 A;  1GT8 A;  4I2Q A;  5D3G A;  4OJ1 A;  1G3O A;  2ZD1 A;  4P10 A;  1IBK J;  1T0T V;  1BWV A;  2MTL A;  4AL7 A;  3NCP A;  4IQM A;  5B0B A;  3CCR S;  4I6A A;  1L3T A;  5G0R B;  1R6V A;  1WC6 A;  2ZBC A;  4DSE A;  4KAI A;  4KJI A;  2VPY B;  2LDY A;  3UE2 A;  5KFT A;  3GV8 B;  2GQQ A;  4MYT A;  2HFV A;  4DL4 A;  3NS7 B;  1S72 S;  2E5G A;  2MGZ A;  4DV5 J;  4K50 A;  2DR7 A;  1OPZ A;  3DRR A;  4LSN B;  2VC1 A;  4A47 A;  1FCA A;  2DO0 A;  1BWE A;  1QTM A;  4USW A;  1EQM A;  4OX6 A;  3BB5 A;  1VHF A;  1MWY A;  4HHU A;  1RAG B;  4WFZ A;  3KLH A;  2HVH A;  2JHE A;  4Y0F A;  3HVW A;  2Y8W A;  4B9L A;  1U6Z A;  2Z57 B;  4PXE A;  4UY8 5;  3M32 B;  2LEC A;  3KLF A;  3Q22 A;  1N56 A;  4C98 A;  4TLR A;  3WX8 A;  4ZIT A;  2R8G A;  4DU7 A;  5A6P A;  1VC5 A;  1KN6 A;  2WHO A;  2J6T A;  3MPV A;  1UZD A;  3BDE A;  5CD4 H;  2Z2Y B;  4WFN Q;  1B70 B;  4DN0 A;  5LJ5 Y;  4MYU A;  2AZ3 A;  2HHP A;  1SIZ A;  3T5H A;  3ET6 B;  2CUY A;  3T5L A;  1YBU A;  4TY8 B;  3NBP B;  1RAH B;  5F9N A;  1U1K A;  1S1W A;  2ZH4 A;  2EVZ A;  2A2D A;  1FK9 B;  2ACM A;  2YNH B;  3LP2 B;  4CM0 A;  3QAT A;  3AJ2 A;  2B9E A;  2DJW A;  1CJU B;  4KV8 B;  5HVG A;  1ZM9 A;  4NLW A;  3R27 A;  2AU0 A;  5HAT A;  2ZH2 A;  2BM0 A;  1VRU A;  1FD8 A;  3TEG A;  2QEX S;  5J2M A;  1TKT A;  1XBW A;  4FKX A;  4BWM A;  1JLQ A;  4IR9 A;  1YQH A;  2JRS A;  4IDK A;  1NJX A;  3QJP A;  3IWN C;  3NP5 A;  1WEZ A;  3UI3 A;  3PW5 A;  3IM8 A;  2F7V A;  2MKJ A;  5AJ3 J;  2RF2 A;  2XHC A;  4ZPC A;  1Y3J A;  3D9B A;  4NA3 A;  2ZC3 A;  3LO3 A;  2GIQ A;  1BQN A;  4YR3 A;  1A9N B;  3DRP B;  4ILM A;  5K14 B;  2GVZ B;  4P2S A;  2V69 A;  4DN9 A;  5GAH I;  1HWI A;  4O23 A;  1ZM4 A;  2HGN A;  1JJH A;  1RKJ A;  1RA7 A;  2BZ2 A;  5CZV A;  4JI8 J;  3CD6 S;  4I6Y A;  1RQ0 A;  4ZVF A;  3PEJ A;  3QJJ A;  2C2N A;  4AD6 A;  3OJS A;  4DF4 A;  3BDP A;  2I38 A;  5GME A;  2V8G A;  1TL7 A;  4NLO A;  3TUJ C;  2RSQ A;  1UTA A;  1C2P A;  4X62 F;  1IJE B;  3IWX A;  4DL0 C;  4NYP A;  1WKL A;  1SKR A;  4IOC Q;  2EC2 A;  4DX5 A;  3SCJ E;  2NS1 B;  2JNJ A;  3TAP A;  4BHQ A;  3QO9 B;  6FDR A;  1YDL A;  2XLK A;  1VR6 A;  4M5D B;  2RDD A;  4TNO A;  4X2B A;  3TAR A;  3DN9 A;  2UVU A;  4KIA A;  3TX0 A;  2B9Y A;  4M5N A;  2UUT A;  3TAM A;  2Y0S D;  1H38 A;  5SUH A;  4Z7C A;  2YWE A;  3QBC A;  3DLH A;  1LFW A;  1GXL A;  4F36 A;  2VH7 A;  4OL8 A;  3SFU A;  4J9K A;  2MB0 B;  4KGV B;  4A8F A;  2FTR A;  1HI0 P;  2E1P A;  4FDF A;  2ASJ A;  4AQY J;  2O67 A;  2XWY A;  2BX6 A;  3I82 A;  2U1A A;  2H54 B;  1QTN B;  2JJ4 D;  4NZ0 A;  2NPF A;  1B4S A;  4YN3 B;  2FLO A;  3L09 A;  2ALZ A;  1KBR A;  1LWC A;  1RT1 A;  1TMM A;  1WF2 A;  1WAC A;  1JLC A;  4OI3 A;  3PTW A;  2V4Q A;  2Z58 B;  1S4F A;  3J7A N;  1A6L A;  2FJV A;  2R42 A;  1WF0 A;  1KVK A;  2FZK B;  2W4D A;  2ZH1 A;  2FB0 A;  3N9U C;  4AXJ A;  1UW4 A;  4IG0 A;  3EPI A;  3C15 A;  1U02 A;  3BN7 A;  1HR0 J;  4IKA A;  3SDE A;  3ZZT A;  2HHV A;  2R2S A;  3W2W A;  1RK8 A;  1FRJ A;  3MM6 A;  3EZ5 A;  4FBU A;  2CRL A;  3BQ1 A;  4MKB A;  5I3P A;  2NZC A;  4K4Y A;  1REV A;  2QMW A;  2CZV C;  4F2R A;  3KHR A;  4RUC A;  3NOC A;  3K89 A;  4LF6 J;  2KVI A;  2P8I A;  5CYM A;  3DOM B;  2DXF A;  1T9W A;  1S77 D;  5A2Q U;  4J9Q A;  2FHM A;  5I3U B;  3ITH A;  5KT3 A;  4OYM A;  4WP3 A;  4X4N A;  3RRH A;  1EQ0 A;  1BQM A;  2DNH A;  1RAO A;  2XZD B;  4PUO B;  1WC3 A;  1S6P B;  3CJS A;  4CDI A;  1AT1 B;  3A8I A;  8RUC A;  2YWK A;  2Q66 A;  4NAS A;  1FJG J;  1CS4 A;  2F8M A;  3LA0 A;  2W9C B;  2V4R A;  2DXE A;  1WKJ A;  2ZFH A;  3H8Y A;  2VPW B;  2CNN B;  1IM6 A;  2IM3 A;  2VKR A;  3PFE A;  1FTC A;  4QR1 A;  2AQ4 A;  3DHX A;  5ADZ A;  4K4Z A;  2BKN A;  3PX0 A;  1SIW B;  1LW2 A;  5EWG A;  5F41 A;  3M2V B;  3QZ7 A;  3G6Y A;  2J9C A;  1NPK A;  4CH7 A;  1FX4 A;  4OZ5 A;  2VJV A;  1T9V A;  3SFG A;  2VG7 B;  2AYE A;  2PGC A;  3R6G B;  2PD1 A;  1UVI A;  2VIH A;  4B08 A;  3MEG B;  2X1B A;  4L75 A;  1IBM J;  3U27 A;  3V81 B;  4MH8 A;  3M05 A;  3LP0 A;  2ZVI A;  3OPK A;  1WNE A;  4G1I A;  5AT1 B;  3BYP A;  4DV4 J;  4WE1 B;  4M5H A;  3I0S B;  4Z7Y A;  1OY8 A;  3TYT A;  4FNI A;  1KON A;  3W5Z A;  2PII A;  4PZV A;  2C2O B;  1XNR F;  2NUU G;  2ZUG A;  3HSD A;  1LV5 A;  1TU0 B;  4DSJ A;  2CQC A;  1HQ2 A;  5KG7 A;  4NPO A;  2HVZ A;  3TAQ A;  1N5Y A;  2Y8Y A;  1FI4 A;  2Q43 A;  2XMU A;  3MAH A;  5K8N A;  5B0E A;  3V4I B;  4Y6I A;  4EZ9 A;  3ZZY A;  2V34 A;  4QPT A;  4USH A;  1D0E A;  2V50 A;  5KFI A;  2V2Q A;  4PXC A;  2FC9 A;  1CSJ A;  3V6H A;  2AEM A;  3PIO Q;  3POT A;  5HQM A;  2BAC A;  1CQM A;  4FN5 A;  4XPC A;  4QYZ K;  1FER A;  2MZT A;  1GX6 A;  2A6M A;  3BGR B;  1GK8 A;  4CQ1 A;  2W25 A;  3HXM A;  3VAI A;  2IYI A;  1F3V A;  1Z1Z A;  1XQI A;  2CWX A;  1C0T B;  3BO3 A;  4DR1 J;  4KO0 B;  3C19 A;  2VA2 A;  3QT5 A;  4LFC J;  2LFV A;  4JI1 J;  4CRJ A;  1TK0 A;  2OML A;  5J1N A;  1NB7 A;  2ZHO A;  3A4T A;  2DGW A;  1P1L A;  1HW9 A;  1S48 A;  1FKA F;  3VAK A;  4ZLL A;  2FJB B;  4NLQ A;  2BJ7 A;  4QIW D;  3ZTO A;  3TQE A;  2PI5 A;  5KFM A;  3DMJ A;  3MUT P;  4PQU B;  3A3P B;  4NA1 A;  4K4W A;  1Y9O A;  3LP1 B;  4V19 J;  3TJ8 A;  1TP7 A;  5DGB A;  2XQC A;  5J2N B;  3DLG A;  2GMJ A;  2QA1 A;  3SZ2 A;  3JS9 A;  1ZZN A;  3OFF A;  2ZZM A;  4I7F B;  2VU5 A;  4Q5V A;  3P6Y C;  5KFU A;  1Y4Z B;  3M6V A;  3M30 A;  2GC8 A;  4OLO A;  1SL1 A;  2JFK A;  6AT1 B;  2V2Z A;  1YIJ S;  1HNW J;  4FYY B;  3CME S;  2VQE F;  3OTC A;  2V94 A;  3NCR A;  2UXD F;  5RUB A;  3FZB A;  2B5J A;  4DR6 J;  3UVJ B;  2LQ9 A;  3DLK B;  2XI3 A;  2ZC4 A;  3UDE A;  4DSK A;  3KWM A;  4NLY A;  2V0N A;  5B0A A;  2XMV A;  1RLC L;  2M9K A;  4HKQ A;  5KFV A;  2WVB A;  2HS4 A;  5GAG U;  2EWH A;  2VG5 A;  3NGD A;  3CCT A;  1Y11 A;  5KG2 A;  2EPI A;  4KBI A;  1LXJ A;  5A76 A;  3DC2 A;  5CZX A;  1K47 A;  3RB6 A;  5KFB A;  3HHE A;  1U4B A;  2ZJQ Q;  5HP1 B;  4CLS A;  1VQ6 S;  1EHW A;  4KGX B;  1KLM A;  3NNC A;  1WC5 A;  2CJ9 A;  3ZNJ 1;  4N47 A;  4QZV B;  1JKH B;  2ZBI A;  2XCA A;  4RNF A;  1W26 A;  1FDA A;  2RH3 A;  1JLF B;  5IWA J;  4LFB F;  2DVI A;  3SSS A;  1VGY A;  5KG1 A;  2PE8 A;  3QQC D;  1M5V C;  1QLN A;  5A6W A;  3O3L A;  4U67 Q;  4X4U A;  4O4G A;  1RTJ B;  3V6J A;  4LF8 F;  2P5V A;  3QT8 A;  3MGJ A;  1VJW A;  3LGH A;  3DCA A;  2F40 A;  4RO0 A;  3MCS A;  1FWP A;  1JLA B;  2VC0 A;  4ETZ A;  2KT5 A;  1NND A;  5GVQ A;  5IS2 A;  4E2F B;  1S7I A;  3CD5 A;  4JI0 J;  2W2Q P;  2CKW A;  2Z56 B;  1WF1 A;  3PJW A;  1UEK A;  1OJ4 A;  1UVM A;  2XHW A;  5IFM A;  5CAB A;  2VFS A;  1TUV A;  1KEK A;  3QWP A;  5FLX U;  1F1B B;  2JC0 A;  1RAJ A;  1RSC A;  3K58 A;  4WZQ A;  1EKS A;  1R8B A;  4J9S A;  1SKW A;  1AUS L;  4G3I A;  3UCZ P;  5L8R C;  4KGZ B;  4QWD A;  1U09 A;  4GVB A;  1U1Q A;  3ZZO A;  1KC8 T;  1GX5 A;  4TLQ A;  1JJ4 A;  2DY1 A;  2ILY A;  2B6A B;  1HQE A;  1NK4 A;  3R2D J;  1FJC A;  1TZ0 A;  3HP6 A;  2ZNY A;  3KHH A;  3C14 A;  3GWC A;  2EFO A;  4MKY A;  2EW9 A;  1Q5V A;  2NQP A;  2V6A A;  3ZZR A;  4PXB A;  1RAA B;  4C11 A;  3RB0 A;  4ECQ A;  4MIB A;  4YUD A;  1LWX A;  1FWK A;  5GAE U;  2E7X A;  1MMD A;  1FD2 A;  3DXS X;  5KG3 A;  1R43 A;  1I51 B;  2DTJ A;  3M8Y A;  1Q4R A;  3A8J A;  3W61 A;  4FP9 A;  1VK8 A;  4N77 A;  4DCO B;  3RUB L;  5GMD A;  1X4F A;  4BWJ A;  2NPI A;  5C25 B;  4P73 A;  2DR8 A;  2QFI A;  2CQ4 A;  5E3R A;  3DOL B;  1RWM B;  2RQK A;  2AD9 A;  3JQK A;  5L1K A;  2J0Q D;  5HMX A;  5KOX A;  1G1X A;  2R8K A;  3CD7 A;  5HBM B;  3H0P A;  2V4J B;  3DLL Q;  2E5L J;  3GZ7 A;  1MN7 A;  5B09 A;  4ZVQ B;  1U1N A;  3FNN A;  1HYS B;  3TOQ A;  2PA3 A;  4DR3 J;  4IFV B;  4IRC A;  2RJZ A;  4DQP A;  3P3D A;  4CCH A;  1HLW A;  3O1L A;  2HHH J;  3HVR A;  1WKK A;  3M8R A;  3JAM U;  7AT1 B;  4DCJ B;  2BOP A;  3DLB A;  9RUB A;  2IVM A;  1T9Y A;  3VVT A;  3M8P B;  2AYG A;  2F1F A;  3U1M A;  4QIV A;  4X4O A;  1T03 B;  3RBZ A;  3J80 U;  4PQA A;  1FNM A;  4TU7 A;  2BV3 A;  2FY1 A;  1J5E F;  4NLG A;  1N34 J;  1C1B B;  1OS5 A;  3L3C A;  5DJB A;  2UV8 A;  1SJ3 P;  3TZX A;  1RLD A;  3KG1 A;  1E6V B;  3MHY A;  1VK3 A;  1CUL B;  4R0E A;  1LEO A;  4PEO A;  2DPJ A;  1QVG R;  1A0O B;  2BR0 A;  1Q7L B;  3DXB A;  4TN2 A;  2AP6 A;  2B9W A;  1O8B A;  2R7Q A;  1H74 A;  3DFE A;  2UUA F;  2DR6 A;  3PX6 A;  2QRR A;  3KK3 B;  2DO4 A;  1D8Y A;  1L3K A;  3OR2 B;  1PYO B;  2N3L A;  1BXN A;  4ECR A;  2XLI A;  1UJ5 A;  1T9U A;  4J9N A;  2L41 A;  2ASL A;  2VG6 B;  2YNI A;  2DNM A;  4LQ3 A;  2WSC C;  4K0K J;  2PC6 A;  5A8K A;  5AE2 A;  1XMO F;  4JYA F;  3WIV A;  2AYB A;  3EZU A;  4DR4 J;  5F8I A;  1UWB B;  2DEJ A;  4LJM A;  1HI8 A;  4JI6 J;  2J7U A;  2N7C A;  3X3U A;  3WBZ A;  3GJS B;  3OLB A;  4B02 A;  2L9N A;  2A10 A;  2HEK A;  5KG4 A;  3PYE A;  4QW9 A;  1RTH A;  1SC6 A;  2IJN A;  2OJ3 A;  4NML A;  2MDA A;  3DLJ A;  1JXL A;  2BAN A;  1GXT A;  1K8A T;  4R0J A;  2LQ5 A;  2IC3 A;  4PKD B;  1FRH A;  2J7W A;  4DG1 B;  2ZH8 A;  4I2Q B;  4RZR A;  5E3P A;  5D3G B;  3US5 A;  2ZD1 B;  3KHG A;  2DKO B;  2MQL A;  1H2T Z;  2KT3 A;  1R8H A;  3GU0 A;  2YNF A;  3QSY B;  4L3N A;  2OMO A;  3HSJ A;  1RB0 A;  4HTJ A;  2BOA A;  3ZFV A;  2EI5 A;  3CJK A;  1RU2 A;  1H7W A;  3GR1 A;  2HHW A;  2E9T A;  3MOJ B;  2MGZ B;  3DRR B;  2BQU A;  2XO6 A;  5LL6 d;  3VF0 B;  3JSR A;  4ZIV A;  4UOH A;  1QUP A;  1NKB A;  5MLC V;  4NRT A;  2RML A;  3KLH B;  3Q89 A;  3UNG C;  4PWW A;  3B8H A;  1K44 A;  4N76 A;  1RWV B;  2G0C A;  4WU2 A;  3J81 j;  1LWF B;  3BH6 B;  4B3T J;  4KHP J;  1EJ7 L;  4LSL B;  3UR0 A;  4WWS A;  2HZA A;  1JQG A;  2W9B A;  4IYQ A;  4B9S A;  4DFM A;  1GQE A;  1HNI A;  4P7V A;  2FJX A;  2ZJR Q;  2L9D A;  3RBD A;  1RTZ A;  3LPE A;  4QWA A;  2KVQ E;  3CUN A;  5E41 A;  2IBO A;  3K7R A;  4ZLN A;  1PSD A;  3S7R A;  3JTP A;  4ED5 A;  1R7I A;  4QYZ J;  3NXZ A;  4LRB A;  1S76 D;  1U7L A;  4HI2 A;  1HL6 A;  3HFZ B;  2ZHA A;  2QZ8 A;  3MCN A;  3G82 A;  4FPI A;  1NSQ A;  4WXW A;  1VRU B;  1Q86 T;  3PIP Q;  5J2M B;  4DV7 F;  1TKT B;  3BV8 A;  3PVX A;  2EG1 A;  2GJI A;  1JLQ B;  5D0E A;  1FKP A;  1PYS B;  3N0V A;  5LSO A;  2RF2 B;  4KH1 B;  2HRU A;  1KVI A;  4IH5 A;  2UUB J;  1LOU A;  5LM7 E;  4C8N A;  5HLF A;  1EET A;  3CSK A;  3P5B P;  4JI3 F;  1K1Q A;  3W9H A;  2C22 A;  1JLG A;  3M8Z A;  1LK7 A;  2HIY A;  4RWW A;  3ISZ A;  2NXU A;  4BLG A;  1H0H B;  5JVG Q;  2QA4 S;  1F9F A;  5A0Y A;  4NZ6 A;  3MM7 A;  2FZC B;  3PDN A;  2HQ3 A;  2VFU A;  4Y2K A;  1TL7 B;  4OZ2 A;  4WXO A;  4PG8 A;  1PBU A;  3WDO A;  3B78 A;  5A8W A;  4CYU A;  4B9U A;  4EO8 A;  1NB2 A;  4EWT A;  3R9L A;  2MQQ A;  1YJ9 S;  1FWL A;  4IH6 A;  2NZ4 A;  2LEP A;  2FZG B;  4X4R A;  2K7K A;  3ONQ A;  4WII A;  4DS4 A;  4PPD A;  1W2B R;  4ZPA A;  1FFG B;  5KFL A;  1YJN S;  4O44 B;  3JXO A;  4N41 A;  4O3S A;  3E01 A;  3TNV A;  4ETX A;  4RUH A;  1K9M T;  3K17 A;  4HI1 A;  1OYD A;  5HO4 A;  1K0V A;  4ZP6 A;  3MFI A;  4HYK A;  2GZO A;  1V3Z A;  1YX2 A;  1WUU A;  4QBU A;  1S1X A;  2QG9 B;  4C48 A;  4WKR A;  4M5L A;  2YH0 A;  1T3O A;  2BE7 D;  4WKY A;  1PKU A;  2K8G A;  2Z8Q A;  4RL1 A;  2KJV A;  1U0H A;  3D66 A;  2CDR B;  2LKZ A;  3EGV A;  4NEY A;  1CJT A;  3G8S A;  1LWC B;  2CPI A;  4YFU A;  1RT1 B;  4K4U A;  2PT0 A;  3LQV A;  2YPY A;  1JLC B;  3ICL A;  4F3Q A;  2MZS A;  1VLO A;  2Q6C A;  2BQ3 A;  2DBB A;  5E3Q A;  1KRP A;  2MXY A;  2FD2 A;  4ELT A;  5AXM A;  1LNQ A;  2DCU B;  2HAF A;  4N7T A;  1XTZ A;  3OW2 R;  3GIM A;  2FHK A;  5IT4 A;  1TL1 B;  3ILL A;  2AJF E;  3TEH B;  4RW6 B;  1AFI A;  2HQI A;  1TUG B;  4OZJ A;  3C15 B;  5DRK A;  3VAH A;  3CMQ A;  1P6T A;  5L46 A;  1FJ7 A;  2F9D A;  4DV2 J;  4KC5 A;  3A3O B;  3W2W B;  1TEL A;  3RU0 A;  1S49 A;  4LF5 F;  5D78 A;  1NPP A;  3U02 A;  2B0G A;  2GO8 A;  2MQP A;  4ZK7 M;  2CPX A;  4LSN A;  5JJB A;  4AXI A;  5KFD A;  5CYM B;  3LWL A;  3CJT A;  2CZ4 A;  5KFA A;  3QGG A;  3D1H A;  5JMN A;  1N5V A;  1DLO B;  3ITH B;  3W8P A;  1HMV B;  4H4O A;  1NJW A;  4UST A;  2UVW A;  4K4V A;  3G8T A;  3FEX B;  3M6X A;  1Z4U A;  3Q8V A;  2WOM A;  1UPM B;  3G86 A;  4LBH A;  2E1A A;  3DOK B;  3ZO7 A;  4JI5 J;  2YKM A;  3BH7 B;  2CVI A;  2HBQ B;  2HRT A;  1WG5 A;  4Y2A A;  4AE5 A;  1VIX A;  4ZN1 A;  1OMS A;  1T02 A;  4Y3C A;  1RAE B;  4WP8 A;  3F44 A;  1S1T A;  5L1J A;  2LXI A;  4IG3 A;  1FK9 A;  3UCU P;  1X9S A;  4JI7 F;  2KXN B;  2P9G A;  4Y2I A;  3MCM A;  2CIM A;  2I2Y A;  3FUY A;  3AOC A;  1VQO S;  3NCQ A;  3H7H B;  2FGC A;  1U6B A;  2VV5 A;  2MZR A;  2B3T B;  2OSQ A;  4U6P A;  3KK1 A;  3CDB A;  3BF4 A;  4CLP A;  1Q5Y A;  4GC6 A;  4ZCL A;  1QUV A;  4DXL A;  2JDJ A;  1KFS A;  2D41 A;  1YLX A;  2HWH A;  3HF5 A;  2QT7 A;  4KE5 A;  2AKW B;  1VBZ A;  1HNX F;  5FJ4 A;  2RIJ A;  4H4K C;  5K14 A;  3TJA A;  2DGX A;  2BAB A;  4HH0 A;  1MG7 A;  3CCV S;  3ZTQ A;  1Z2Z A;  2UV8 G;  3LP0 B;  1S59 A;  3PJ9 A;  3OXF A;  1IUJ A;  5F3T A;  5B08 A;  1RAD B;  5LJ3 Y;  1KTV A;  1B99 A;  4DJB A;  2HBZ B;  1UEU A;  5J1E A;  2HIQ A;  3CJ8 A;  5H9F J;  1HBU A;  3AB4 B;  4EUV A;  2AGQ A;  4ZMM A;  2YKA A;  2Y9H A;  2LQ8 A;  4TVA B;  2LQJ A;  1N5Y B;  4KSE B;  1UFW A;  4LFA F;  5JXS A;  4QPX A;  2G2Y A;  4DX8 H;  1H2U X;  3OQ2 A;  2FVS A;  4L6V 3;  3POT B;  4ECZ A;  3FKB A;  1N33 J;  1IR0 A;  3M8W A;  5EWF A;  1OY9 A;  3KG4 A;  2NCK L;  5HRO B;  3B4D A;  1KWM A;  2W8K A;  5C42 A;  2G9O A;  3EJM A;  2RQM A;  4EYH B;  1GMU A;  4W90 B;  3V2U C;  4OYW A;  2FJD B;  3RB4 A;  5U47 A;  2OTL S;  3R5A A;  1FT8 A;  2NSB A;  1NO8 A;  4FYD A;  1BC6 A;  4OI2 A;  4LBP A;  2ZBQ A;  3QRR A;  2J0S D;  3H25 A;  2KZZ A;  4MFB A;  2LU2 A;  1NEE A;  3UNY A;  1F6T A;  2BKP A;  3CT9 A;  2NYH A;  3DMJ B;  4UQT A;  4J9L A;  2DY9 A;  4WFX A;  2DPI A;  3DLG B;  6FD1 A;  3FFI A;  1FVS A;  3FMB A;  2GQ2 A;  2VPZ B;  4DSL A;  3D6T B;  1XC9 A;  1ELO A;  1YIT S;  1ZTT A;  3D3B J;  1F5A A;  3M30 B;  2D1C A;  4DSI A;  1FE4 A;  4BBY A;  2IYG A;  2G0J A;  2XY5 A;  4ID5 A;  3GCW P;  3LF0 A;  2M88 A;  3TVZ A;  4DI6 A;  3KNG A;  3R6L B;  2W24 A;  2F8E X;  1WOR A;  2B5J B;  4ANC A;  3ENV A;  3PHE A;  2N82 B;  3H5Y A;  2KKH A;  3G96 A;  3G6V A;  3T5J A;  1Q7Y T;  1ZH5 A;  3Q2S C;  1NJZ A;  3B4M A;  2BBE A;  3SQG A;  4DSF A;  2WTF A;  1XNQ J;  4JI2 J;  2E66 A;  1UP1 A;  2VG5 B;  2JWN A;  7FD1 A;  1NCL A;  2XC9 A;  2DR5 A;  3DOM A;  2MPU A;  4WK1 A;  1WOS A;  4RW4 A;  3AB2 B;  3MEC A;  5IQ6 A;  4DR2 J;  5IT0 A;  2J0W A;  4LUB A;  2C2D A;  3T1Y J;  3OVA A;  1WC1 A;  2KI2 A;  4J5O A;  2HHX A;  2CAJ A;  1XMQ J;  4GO5 X;  2K3K A;  4PUO A;  1KLM B;  4CIO A;  3PNI A;  2BE2 A;  1IBL J;  4F26 A;  3RB3 A;  3K5O A;  5AXK A;  3RBX A;  3CCS S;  2CG8 A;  2D74 B;  1D1U A;  1VDH A;  4QWC A;  4DV6 F;  3MAQ A;  1UET A;  4LFC F;  1S1V A;  4EBE A;  3R7N B;  1O51 A;  1YBT A;  2UU9 J;  3D3C J;  4USI A;  4O4G B;  2YNG B;  3PW4 A;  2L9W A;  3T1H J;  2MSS A;  1VQ5 S;  1S0O A;  4OI4 A;  3QFH A;  3S8S A;  3SIP B;  2XM3 A;  4O3P A;  1HBM B;  1N4L A;  1RTD A;  5GAH U;  2QJ3 A;  1J27 A;  3NOG A;  4EFA C;  4X66 F;  2HAI A;  5D15 A;  3THT A;  4CLT A;  4LF2 A;  3E8O A;  2DGV A;  2J5A A;  4QW8 A;  2KXH A;  1AUD A;  1URR A;  3D0I E;  4B3S J;  5A2Q Y;  1UAW A;  1HNW F;  4IFY B;  1SJQ A;  2W7A A;  2QSF A;  3ZZ0 A;  2X51 A;  1HQE B;  4NLD A;  3PO4 A;  2MKI A;  4Z2X A;  3R7B B;  1N48 A;  2C2K B;  3AQO A;  3A8K A;  3AOB A;  3K2Y A;  4LF4 F;  1ZAW A;  2R7O A;  4JP8 A;  3R5J B;  1UWA A;  4C11 B;  4KT0 C;  1HW8 A;  3N6L A;  3MMC A;  3OVS A;  4EGL A;  4FBT A;  1HFE L;  3W65 A;  1RT7 A;  1NSA A;  2C3P A;  3UD5 A;  2G4B A;  3FZ2 A;  5IC4 B;  5G4D A;  4DCP B;  1Q1K A;  3IAM 9;  1VYA A;  1MMN A;  4C0O C;  4O3O A;  2KT2 A;  3J81 Y;  5CCL A;  4JI4 J;  5FII A;  5E2Q A;  4WTO B;  1VQS A;  3HJV A;  1Y5L B;  1UCN A;  2GHV C;  4P2F A;  2UXB J;  2FVQ A;  4LF7 F;  2XMK A;  2XLJ A;  2OH2 A;  3AY0 A;  4F50 A;  1Q0N A;  4FF4 A;  2J0X A;  1ZAV A;  2HQG A;  1C0T A;  4OI1 A;  2ZDP A;  1M5O C;  5ETM A;  4KO0 A;  3EVM A;  4OI0 A;  2H9Z A;  4E0D A;  4KYZ A;  3QJL A;  3D1Q A;  2MMY A;  1CLF A;  4YQW A;  1A7G E;  4UUX A;  3KG0 A;  3HLU A;  1SXL A;  3D0H E;  2JZ5 A;  2ASY A;  1NKE A;  1TVR A;  2FQQ B;  2DIU A;  3SSR A;  2AGO A;  3OL8 A;  1KNZ A;  2CNO B;  4X4V A;  3L95 X;  2MZJ A;  4LT6 A;  3KLI A;  2IMW P;  5F9L A;  2AW0 A;  5EHH A;  2K7J A;  2KTQ A;  2JFD A;  4A8K A;  5DZ7 A;  2CJY B;  2O01 C;  4ZVS B;  4IQX A;  4P6Q A;  1U49 A;  3P96 A;  2BW2 A;  2ZH7 A;  4XAK A;  2A1B A;  3KMQ A;  2KFY A;  3CUL A;  4I64 A;  2AX0 A;  1UVK A;  3NMR A;  5HAO A;  3BR8 A;  1U1R A;  3G4S S;  3ETO A;  4USJ C;  1VQM S;  1D3W A;  3HZG A;  4C8Y A;  1RU1 A;  1Y10 A;  2KB2 A;  2G0I A;  3UVJ A;  1FDB A;  4RBT A;  1OPI A;  1VHI A;  4CI0 B;  4DV0 J;  3JSM A;  1SBR A;  1UMJ A;  3IRW P;  3GYG A;  1DAR A;  2KHC A;  1X5T A;  4KB7 A;  2AX1 A;  5C24 A;  3HI9 A;  2ZBP A;  2KM8 B;  1YJT A;  1OWX A;  2XGP A;  4X65 F;  1FJE B;  4K5R A;  2YNI B;  5HP1 A;  2AJ2 A;  4DR7 F;  3QLH A;  4B3M F;  4ZDN A;  5KTQ A;  3BZQ A;  3LGN A;  1S0M A;  3HHN B;  2PA8 D;  4LSZ B;  1NK5 A;  3R5B A;  1S99 A;  2VBZ A;  1N36 F;  2E5L F;  5BR8 J;  3MED A;  4IH7 A;  3Q23 A;  2O5D A;  5DS7 A;  3E51 A;  2VDH A;  2ADB A;  1RTH B;  2E1R A;  1H2V Z;  4P2X A;  4F7V A;  1BHN A;  1QSS A;  3NWR A;  1T9T A;  4BCA A;  2IC3 B;  4ED4 A;  4QJV A;  5ETS A;  2YWW A;  5DG8 A;  2W2P P;  1TAQ A;  2DYA A;  1L3V A;  5KOW A;  1JLA A;  3AQP A;  3UDC A;  4DV1 F;  1RCX B;  2FPH X;  4ZLP A;  3Q83 A;  2V8D A;  1WTF A;  3RR7 A;  2Y0B B;  3CCQ S;  3VQS A;  4YB7 A;  3G6X A;  3JTO A;  3W62 A;  2YNF B;  3HKW A;  3CJK B;  3LAM A;  1FXD A;  4URQ U;  2AJ4 A;  4XO0 A;  4JBC A;  1RHK B;  4BC7 A;  1SJF A;  1JLB A;  2LEA A;  2GW8 A;  3GON A;  3LGM A;  5L1I A;  4U96 A;  3HHL A;  3Q24 A;  3DKD A;  2OD6 A;  1IQZ A;  4NYZ A;  2D3U A;  1RI7 A;  2J6S A;  5B0D A;  5GAD U;  1DZ5 A;  2W9B B;  5KFG A;  1HD1 A;  2M7S A;  1HNI B;  3JSB A;  1FRX A;  1F5C A;  2DRD A;  3SV4 A;  1PBA A;  1WI6 A;  2I5J A;  4JUZ A;  5KFS A;  1SC4 B;  4C0B A;  1SL2 A;  3GV5 B;  1NK8 A;  2QSW A;  4M5K A;  5IV4 A;  4RW9 A;  3D67 A;  4JI6 F;  4P9S A;  3CCW A;  3TUI C;  4NCA A;  1X4H A;  4NLT A;  3G82 B;  2Z2L A;  2VOO A;  4IR1 A;  5A8R A;  4DHV A;  3UDL A;  1T7P A;  1RCO B;  3IG1 A;  3V6K A;  3AOD A;  1MSW D;  2R7T A;  4OLP A;  2DNL A;  4DPW A;  5LXR A;  1HI1 A;  1IN0 A;  2QX0 A;  4HAC A;  1DTT A;  1E6Y B;  4NZ7 A;  4IFV A;  1SB6 A;  5CYJ A;  2EEY A;  2DT9 A;  2B51 A;  4RUA A;  3CD0 A;  4HL9 A;  1HWJ A;  1V9O A;  2H5J B;  2YKP A;  3CJR A;  4OHX A;  1NKC A;  4B9N A;  2HFN A;  3M8P A;  1IWG A;  1F2H A;  1M5H A;  1JLG B;  1U6F A;  1RBL A;  1T03 A;  1HBN B;  4PR6 A;  2C3Y A;  1TQL A;  3MR7 A;  1S7H A;  2HZC A;  2GAG C;  1M5K C;  4GKJ F;  5L1L A;  1X9W A;  5A0Y B;  1DQA A;  2O66 A;  3MM7 B;  1C1B A;  4U8V A;  2Z4P A;  1EP4 A;  3I0R A;  4AL5 A;  4KKO A;  5ETQ A;  3UD4 P;  5A8W B;  4CYU B;  1PC4 A;  4R8U B;  1E6V A;  3LUY A;  4Q8F A;  1IR1 A;  5BJR A;  3KLV A;  4NE9 C;  3AT1 B;  5D0G A;  3BKT A;  3M6U A;  4DX6 A;  1SPB P;  1NME B;  1JX4 A;  2M2B A;  3D7S B;  3H2L A;  1U25 A;  1TKX A;  1Q16 B;  2PSZ A;  2GIF A;  2QL7 B;  2CPD A;  5M2U A;  4OHW A;  3FBC A;  3T1A A;  3MPD A;  3BSO A;  3I9V 9;  5T7L A;  2E29 A;  2RUS A;  3E01 B;  1PAE X;  4LF9 J;  2I0X A;  2R2U A;  3KLG A;  3M7V A;  3VAJ A;  2CZ9 A;  1NK9 A;  1VQ9 S;  2IAJ A;  1YI2 S;  3THP A;  1DQ8 A;  2OPQ A;  2M52 A;  1S1X B;  4IUF A;  3QAU A;  3OL7 A;  1GNK A;  4LVO P;  4Y2M A;  4X62 J;  2FY8 A;  1NDK A;  3DM2 A;  1YJV A;  1U0H B;  2IRX A;  4CLW A;  2QFJ A;  2BJ1 A;  2R2T A;  1UWB A;  4HT7 A;  1X5S A;  4MTP A;  2MLY A;  1G7C B;  4TQR A;  2I8E A;  5ETV A;  2VPX B;  5GAG I;  3J80 Y;  1FDN A;  1VFJ A;  3MZI A;  2FDN A;  1WI8 A;  1OQ3 A;  5D0H A;  2HWI A;  1KQK A;  4CLY A;  1KSP A;  5KAK A;  2D69 A;  1RHR B;  4EO6 A;  3PV8 A;  2DD8 S;  2CJK A;  1Y5N B;  4YDD B;  1N5S A;  1MRO A;  3CNQ P;  5M2R A;  4I2P B;  2IRY A;  3QZ8 A;  1NHU A;  4OYI A;  1RIS A;  2YY3 A;  2ASD A;  2CG4 A;  4RUB A;  3EIC A;  4GRS A;  4RW7 A;  4YS2 A;  1U1M A;  3J7Y U;  1XR6 A;  4J9U E;  2VA3 A;  3R1L A;  1RHU B;  1WD6 A;  3UW1 A;  1WSR A;  1KKH A;  3BM7 A;  2CQ0 A;  1R0B G;  4OYO A;  4EZ6 A;  4F3O A;  3EDR B;  1RE1 B;  3MPY A;  2LEB A;  4L73 A;  5E3A A;  1M1H A;  3ZZU A;  3QYY A;  3CJ0 A;  2OAU A;  4M63 A;  2YWF A;  4Y28 C;  4H4O B;  3B6B A;  1RYS A;  3U7J A;  3RBE A;  3CED A;  4ZHR A;  2O1P A;  2R3V A;  3U1L A;  2CQH A;  2WOM B;  1LWF A;  2CQD A;  4OYZ A;  4LSL A;  2M8D B;  1HNZ F;  1KR4 A;  2QYC A;  5L9N A;  2LYV A;  2YKM B;  4LBI A;  1K1S A;  3N79 A;  1N32 F;  1X4G A;  2DGQ A;  1FXL A;  2RUG A;  1YJU A;  1S1T B;  3NRB A;  2GCF A;  2RS8 A;  4IG3 B;  3RAM A;  1RHQ B;  4A8O A;  3H5U A;  2KYZ A;  3QIP A;  2J8S A;  1VQP S;  2XS2 A;  1D8Z A;  5GAE I;  1SH3 A;  3OLA A;  4F0H A;  2G2Z A;  1U2R A;  4D3G A;  2GML A;  4EU0 A;  3RW7 A;  1S9F A;  3KK1 B;  1FTR A;  3TP2 A;  2VFR A;  4KY3 A;  1RA6 A;  2U2F A;  3BKU A;  2RQ4 A;  4I4B A;  3UR3 C;  2AJ0 A;  3C66 A;  4Q44 A;  2OI2 A;  3CVK A;  4GMK A;  3K5N A;  1RWX B;  3CWJ A;  1NJY A;  1ZAX A;  3NWG A;  5K8O A;  4WYW A;  2G2O A;  3AD9 C;  4X4S A;  4B17 A;  2DNK A;  2ROG A;  2K3I A;  3BBF A;  1UZH A;  1WHV A;  4ZPV R;  5LMN F;  4DF8 A;  4ZN3 A;  3O44 A;  5J1E B;  4OFZ A;  1HBU B;  4OX9 F;  2ZH6 A;  3T5K A;  1MLA A;  4CP5 A;  5KG6 A;  2M70 A;  5CAA A;  3EUN A;  4WPA A;  3HVA A;  1L3S A;  4TYA A;  2WW4 A;  4PG4 A;  1S1U A;  4ALZ A;  2FGO A;  3MD3 A;  2GHP A;  1QY7 A;  3NY0 A;  1S12 A;  3BQ2 A;  4YY3 F;  4JI5 F;  4DR5 J;  1KQG B;  1SCJ B;  3J7A 1;  3P45 B;  1D09 B;  1XK8 A;  1NH7 A;  3EMT A;  3ILI A;  4YR2 A;  4O44 A;  3MAA A;  2FVC A;  5C42 B;  5F8L A;  2GX8 A;  2NUH A;  2NYI A;  4ZVO B;  3AOA A;  1F3F A;  3W9J A;  2LMI A;  2GO9 A;  2CPH A;  1PJ6 A;  2BQR A;  1SKU B;  1EB0 A;  2YKQ A;  4ED1 A;  4EYI B;  3OUY A;  1XNR J;  1QD1 A;  4ZP9 A;  2MKY A;  4DPO A;  2MKS A;  2OEK A;  2DCL A;  3TZW A;  1WDD A;  1WOO A;  4O3N A;  5ETP A;  1WG1 A;  2APO A;  3MF5 A;  1CVJ A;  4MFB B;  2FIU A;  2PO4 A;  4I6W A;  2C28 A;  4ILL A;  2AYM A;  3OTB A;  4OMF G;  4O4R A;  5D4N A;  4F4K A;  3KOA A;  1YVF A;  3EDQ B;  2IIH A;  3UN5 A;  1IQT A;  4J9R A;  4ICL A;  5DG9 A;  3GV7 B;  3FFI B;  4W92 B;  2CQ2 A;  3SCI E;  4F04 B;  5SZT A;  4OIX A;  3M4X A;  2IRU A;  2WK4 A;  1TL1 A;  2C2R A;  1NHV A;  4ID5 B;  4RW6 A;  2CXE A;  2DIT A;  1KOO A;  2XCP A;  2POK A;  1JJC B;  2BUN A;  4IRK A;  1SV5 A;  2NXE A;  2W2M P;  3GFZ A;  1NBE B;  2L48 A;  1KHV A;  5BXI A;  4F25 A;  4CO5 A;  2IM2 A;  3HSZ A;  4RKU C;  3D1O A;  4OYX A;  4YB1 P;  4P2M A;  5D8H B;  4B9M A;  4K4X A;  4M5G A;  3NS6 A;  4B3O B;  1CPZ A;  2FLL A;  4M5J A;  4OHV A;  3FMW A;  2QLB B;  4MK9 A;  3SQG B;  3WC2 A;  1TK5 A;  4IRD A;  3PYG A;  3RJM B;  1M0S A;  2G1H A;  1J2V A;  3OTE A;  4NCB A;  4RW4 B;  4UTG A;  1NHK L;  3MEC B;  2VD3 A;  3MMB A;  1DLO A;  1HMV A;  3J7Z 5;  2BJ3 A;  3NLC A;  4AYB D;  1RWO B;  1YTY A;  1IWA A;  3O2I A;  1O6X A;  2F3J A;  4YHH F;  3GYN A;  4RJV A;  3MDF A;  2IVF B;  3CCZ A;  3DOK A;  4JV5 F;  2BE2 B;  1TKZ A;  4FXD A;  2VQE J;  2JEI A;  3A3N B;  3NAH A;  3PKM A;  2UXD J;  1RKI A;  2V67 A;  3CO9 A;  2E1M C;  2QL5 B;  3SXL A;  1S1V B;  4PG6 A;  3O6Q A;  3BO4 A;  1IKV B;  2QL9 B;  1VQ4 S;  3HD2 A;  5KFP A;  5J2Q A;  3MTJ A;  4O3Q A;  2ZBR A;  3G87 A;  3I6P A;  3IN5 A;  2HVI A;  3ENA A;  1WHY A;  2HHQ A;  3I32 A;  4ZCK A;  2KZM A;  3KYL A;  4KR0 B;  3W9I A;  1RTD B;  1ZPW X;  1KLN A;  3GFY A;  3KXD A;  2V9K A;  3A1Y G;  4NLX A;  2I9S A;  2HFZ A;  3NG8 A;  4LQ9 A;  3QPI A;  4HHJ A;  4F67 A;  2GJF A;  1HNV B;  4WIQ A;  1KD1 T;  3ZTR A;  2ZVS A;  4P71 A;  1AFJ A;  4Q43 A;  3HD1 A;  4ZP7 A; 
#chains in the Genus database with same CATH homology
 2QLF B;  2H54 B;  2XYG B;  2HBQ B;  1QDU B;  1RHU B;  3KJF B;  4DCJ B;  2HBY B;  2C2M B;  1QTN B;  1GFW B;  2HBR B;  3R6G B;  3D6F B;  4ZVT B;  2H5J B;  2XYP B;  3KJN B;  2H4W B;  2HBZ B;  1I51 B;  2CNK B;  3EDR B;  1RE1 B;  4JB8 B;  2QL5 B;  4ZVP B;  2XZD B;  2H5I B;  2QL9 B;  3D6H B;  4ZVU B;  4DCO B;  1PYO B;  3GJS B;  3IBC B;  1RWV B;  3P45 B;  1BMQ B;  2XZT B;  2CNL B;  1PAU B;  3NS7 B;  2QLJ B;  2H48 B;  2Y0B B;  3GJT B;  1RWM B;  5IC6 B;  1SC4 B;  3R7S B;  3R7B B;  1RWX B;  1RWK B;  1RHJ B;  4ZVR B;  2CNN B;  2C2K B;  2CJX B;  4ZVO B;  3QNW B;  1IBC B;  3GJQ B;  3D6M B;  3R5J B;  3R7N B;  2C2O B;  2QLB B;  2Y1L B;  1SC1 B;  2H65 B;  1RHR B;  2FQQ B;  2CNO B;  3RJM B;  1NME B;  2C1E B;  2H4Y B;  3R6L B;  2CDR B;  4ZVQ B;  1RHK B;  1ICE B;  2C2Z B;  1RWN B;  2DKO B;  1F9E B;  3KJQ B;  5IC4 B;  2QL7 B;  3IBF B;  3P4U B;  1I3O B;  4LSZ B;  4DCP B;  2H51 B;  3GJR B;  2XYH B;  1RWW B;  3SIP B;  1RHQ B;  2CJY B;  1RWO B;  2P2C B;  1SC3 B;  4ZVS B;  1RWP B;  1RHM B;  5K20 B;  3EDQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...