3IBSA

Crystal structure of conserved hypothetical protein batb from bacteroides thetaiotaomicron
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
206
structure length
206
Chain Sequence
KGVEVIIALDISNSMLAQDVQPSRLEKAKRLISRLVDELDNDKVGMIVFAGDAFTQLPITSDYISAKMFLESISPSLISKQGTAIGEAINLATRSFTPQEGVGRAIIVITDGENHEGGAVEAAKAAAEKGIQVSVLGVGMPEGAPIPVEGTNDYRRDREGNVIVTRLNEGMCQEIAKDGKGIYVRVDNSNSAQKAISQEISKMAKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein BatB
publication title Crystal structure of conserved hypothetical protein BatB from Bacteroides thetaiotaomicron
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Structural genomics, unknown function
total genus 64
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3ibsA00
2ICAA 3TXAA 4FX5A 3K6SA 2B2XA 5BV8A 3IBSA 2NVOA 4JDUA 3FCUB 1MQ9A 3NIFB 1FNSA 1XDGA 4CN9A 1YVPA 1Q0PA 1L5GB 4WK0B 1JV2B 1FE8A 3Q3GE 1JLMA 5HDBB 1QCYA 5KYWA 4MMZB 3VI4B 3PPYA 1JEYB 1XDDA 1IDN1 2VDPB 3ZQKA 4C2AA 5E6RA 5ES4B 3EFOA 3EG9A 3ZDXB 5KYYA 5HJ2A 1JEQA 2VDOB 3HI6A 4CNBA 1BHO1 1M10A 1DZIA 4UM9D 2NUPB 3EOAI 5E6UB 2IUEA 2QTVA 4MMYB 1CQPA 3EGDB 3K72B 4BJ3A 1NA5A 1ZOOA 1ZOPA 5KYUA 1SHTX 1RD4A 3EGXA 2XWBF 1RS0A 2I6SA 1T6BY 1MF7A 1N9ZA 3T3MB 2VDMB 2ODPA 5KYXB 2XGGA 1MQAA 1PT6A 4HQLA 3HXQA 4G1EB 2I6QA 4NEHB 5E6SA 3V4PB 3EH2A 1LFAA 1MQ8B 3GXBA 4PN7A 2NUTA 1DGQA 1MHPA 5KYNA 1QC5B 4Z7OB 4UM8B 4F1JA 2X5NA 4A0QA 3EOBI 3PPVA 4NENB 4CN8A 1M2VA 4F1KA 4HQFA 3K6SB 4HQOA 2VDKB 3PPXA 1M2OA 1BHQ1 4IGIA 4UM9B 1PD0A 3TW0A 2WW8A 2ODQA 2VDNB 3E2MA 2XWJI 1PD1A 1OAKA 3ZDZB 5KYWB 4O02B 3TCXB 3BQMB 1T0PA 1AUQA 1IDOA 3VI3B 3ZE2B 3TVYA 3BQNB 1JEYA 3N2NA 3F78A 4WK4B 5E6RB 3ZE1B 1U0OC 1YVRA 3EFOB 3EG9B 1TYEB 1UEXC 4IHKA 3V4VB 1IJKA 1SHUX 3BN3A 4IXDA 5KYYB 1PCXA 3FCSB 1RTKA 2M32A 1AO3A 4WFQA 1V7PC 3M6FA 1ATZA 4MMXB 3ZE0B 3HXOA 4C2BA 1M1UA 5E6UA 2NUPA 2I91A 2VC2B 4WK2B 3EGDA 3NIGB 5LN1A 4Z7NB 4DMUB 1ZONA 5KYUB 3F74A 3RAGA 2ADFA 3EGXB 4G1MB 3QA3E 1CK4A 1U8CB 5KYXA 2VDRB 3IJEB 3T3PB 3EH1A 3PPWA 5HGJA 4Z7QB 2VDQB 1XUOA 5E6SB 3NIDB 4XW2A 1MJNA 1SQ0A 1N3YA 1RRKA 2NUTB 2VDLB 3K71B 1M1XB 2WINI 4HQKA 4HQNA 1IJBA 1QC5A 1U0NA 4WJKB 4NENA 1JEQB 1M2VB 3ZDYB 4M76B 4C29A 2O7NA 1AOXA
chains in the Genus database with same CATH superfamily
1K66A 3QE2A 4EKNB 1W44A 2OCPA 4Q03A 1Q84A 2ERXA 2O2HA 4ZVKA 3R9XA 3GRUA 2WFLB 3BSYA 3MPUA 4OO3A 3GJ0A 3LQQA 4JI3B 3ZW8A 2WQ7A 3TG8A 1M54A 1QV6A 2H7YA 3GJ6A 5FBWB 2JGDA 4FCCA 3GIWA 1N6LA 3DWIA 4JJ8A 4LYJA 5LKRA 3MWDA 1QGOA 1DV2A 5IBQA 5DF1A 3A9SA 3NHLA 4W7SA 4FYMA 3AY7A 1A8PA 5AHKA 5AM3A 5JI3E 4RLSA 2EJVA 2FQWA 3FOAA 4HXEB 2WSYB 2AOTA 1CQIA 4LXGA 4CFSA 5C5IA 3HWRA 2I9KA 2EGUA 3IJ5A 4MVJG 5JZMA 2JZOA 1CEXA 1KMNA 3AHCA 3EYAA 1FC0A 3HFRA 1Y3IA 3L0ZA 2CFOA 1U31A 3AERA 3K92A 3OICA 4IRUB 4X54A 4AP6A 1V43A 3RU9A 4KN6A 3L02A 2KBEA 2V5VA 4OHKA 2IUUA 2PKYX 1W34A 1FFDA 1NOIA 1XYVA 4BO4A 3S5JA 3JD4A 4FNAA 4HL6A 4R1LA 3RQIA 1NLUA 1W47A 4Q1FA 3JZFA 1MA3A 3CX4A 1BCRA 4PYRA 3AFMA 4ZEXA 1KJZA 2V7QD 1KEUA 2V4ZA 3DYVA 3JQBC 3V4RA 3LT1A 4P82A 2C59A 2UDPA 3GLUA 4ZOLA 2H9IA 5CTJA 1JKFA 4KEAA 3CCFA 4E03A 3QKIA 2EG9A 3R7WB 2DCMA 2ZUTA 3W9YA 4B9EA 1A27A 4C5CA 1CRWG 1UDWA 2OLJA 1AHIA 1P2FA 4TTVA 5HZKA 4GR4A 1HK7A 4PFKA 2GZDA 4IPTA 2P77A 2G0AA 2WJIA 1OXTA 3GUUA 4H7KA 1Y3HA 5L53A 4PX2A 2E4VA 4YCLA 2PR7A 1Y4SA 1MB4A 2YWRA 3KSDO 2IA5A 1JMKC 1L5ZA 4B5KA 4PYJA 1KO1A 2PJUA 3OCXA 3O9MA 1K5DA 5I6DA 1BVRA 1JJ7A 2OZEA 4G65A 4HCJA 1U2PA 3P9RA 3PYLA 3REFA 4MUHA 4GMDA 4GWKA 2Y9MB 4EJSA 2HLNA 1D6MA 1VPEA 4UMVA 5FKJA 4ERXA 1YZLA 3UENA 2GK3A 1NC1A 1VFPA 2O2YA 1DBWA 2IY8A 5F51A 1U3DA 3AR3A 2FMTA 1HE5A 1Q3TA 3B1YA 3H1GA 3NATA 4FSDA 5FUYA 4EY8A 2BYTA 4BN5A 2I33A 4KNWA 2WA1A 1OR8A 1YJ5A 3O93A 5AVQA 1WD7A 1RHUA 3SXUA 4MHTA 4XUGB 5HHTA 4IUCS 3CXRA 2X4LA 1T2CA 3Q0TA 3Q6IA 2V97A 4PLGA 3I04A 3O8CA 1OGJA 3DVSX 2ZRGA 3ANYB 4GU5A 1KZYC 4OJMX 5JAOA 3AVTA 4R1SA 4EO4A 4LDPA 1QZTA 2WA2A 5DEOA 4DIMA 1AHPA 4IOJA 1NI4B 3ON5A 3FUXA 1YXMA 3L0IB 3VAYA 1L4EA 1BA2A 1MRSA 1XZCA 1Z2NX 3ENVA 1JQ3A 1SU7A 2B8EA 4RJKA 3FCEA 4WN9B 1QK5A 1XWIA 3OQNA 1OLXB 1P4AA 4KXLA 4OHPA 3OTQA 1WNFA 3D31A 1N33B 1L4YA 4QUGA 5HFAA 1C80A 4GR5A 5BWLA 4U6NA 4GOXA 4MVJE 3IBCA 2R1TA 1X0VA 1CZRA 2CLCX 4KE8A 4Q7QA 4UDOA 1N9GB 3ZV5A 1ZGGA 2HYIC 3D6AA 4D3ZA 4C20A 1ST2A 1YT5A 3ZG6A 3WB1A 5H80A 3AL2A 5AW2A 5JO0A 4E5YA 2GLXA 3I0MA 3L7DA 4ZYTA 1JQEA 2HK8A 3AHDA 3E7PA 5CR9A 3QU2A 4NOJA 3ZCVA 4DTIA 4EB8A 3GLKA 3ZDCA 3P2IA 5FUMA 2O7VA 1V16B 3LA8A 2XNCA 1P5FA 4TUYF 2GLUA 2EFCB 2HCJB 3TEFA 1V1MB 3CF4G 2UXBB 3COVA 4IO1A 4L73A 2DB3A 4DA9A 1OYWA 2ROQA 1ONPA 3MTJA 3ADBA 5IANA 1GV0A 3H9GA 4AKHA 2B1GA 2NV2B 4MO9A 4OI1A 1T1IA 2ZAMA 1D9XA 2FEWB 1LNSA 1VZ2A 4H0FA 5FTWA 1FSPA 2R96A 5LZ8A 2SKEA 4TRJA 3GLGB 1SWWA 1EU1A 2OORC 4NZMA 4G2TA 4UUPA 4WD3A 1M72A 5DCWA 5EESA 4K3UA 3LHIA 1PGJA 1TMGE 2WNSA 2FXVA 3S1AA 1F17A 5JROA 4BKUA 3VDRA 2IXFA 1ZMTA 3WIUA 1XCMA 1M8PA 1X70A 3NP7A 2O8VA 5KJ1A 3OEYA 5PNTA 4E5NA 2BFBA 3HDGA 4N6GA 2V7WA 4F9FA 1R8YA 2CNDA 2I2CA 3AMVA 4OIMA 1KZHA 3ZJUA 1EXWA 2BFFA 3RVQA 4FR0A 4DSTA 3QKRA 4RD2A 3DOIA 3L5OA 1NXVA 2VHVA 1YJ8A 3PFWO 3OZXA 2OSBA 4GLBA 4K05A 2RBKA 4LY3A 3I1YA 4M0KA 1SQ6A 1YS2X 4F12A 2I4LA 3MRTA 3OAAD 4N7JA 2BR4A 1N2IA 4GBJA 4JI1B 3DG9A 2HMUA 5CVUA 2W70A 4B47A 4BECA 2ZE8A 3COWA 3G1WA 5ALGA 5GTDA 4A8TA 5BUQA 2XE4A 4J0GA 2AFHB 1FPQA 2AUMA 1RXWA 3QW2A 1ZQ9A 4YMIA 3LECA 3BN3A 1GR1A 2BEVB 1ZITA 2GM3A 2OL4A 1C4WA 2YUTA 5H16A 4B4OA 1E98A 4ZT3A 1G5RA 1KYXA 2GKOA 2ID8A 3E03A 1AK2A 5I9SA 3WL4A 1KJQA 4FW8A 5G2OA 4KR0A 4FHCA 3ROFA 2J7KA 4W7IA 1ORVA 4F3RA 5CYGA 4RQUA 4D0NA 1GUDA 1GKLA 5CLQA 2NU9B 2Y67A 3WYAA 3OJOA 4L9AA 2LBPA 2CMKA 2ZZKA 3HL0A 5L3SB 5FB3A 4E51A 2YNMC 2YNMD 4UARA 4WNCA 3WMWA 4D6XA 4E5MA 1DUVG 3CS3A 4JXJA 3Q5GA 1DXYA 2YJNA 2OHVA 3STXA 4ZEVA 2G9UA 3RBXA 2WKQA 2D5LA 3VC2A 1YUBA 2GO1A 3DR3A 4Z86A 2D0DA 3E3MA 1ZCJA 1E58A 1W0JA 1OW3B 2V8BA 3Q41A 3GRCA 1G41A 4RY0A 3WJ2A 1NBWB 3LY5A 4ZVRA 3PWSA 1H2EA 5IABA 2WTNA 3FY4A 3E18A 3CH6A 1T1GA 2D1RA 1N1EA 1Z25A 4LV6A 3STHA 2G36A 1Y42X 2VNAA 1II0A 3DNMA 4GEGA 4YRNA 3H6KA 3IYLW 2IYPA 4LOIA 4NNJA 3OKCA 2IH2A 2BR5A 5H7XA 5J40A 2XVAA 1GQ2A 1X3SA 4WA8A 4FGZA 2CBXA 3I6YA 4J7AA 1H4QA 4IRMA 3RIEA 1QFZA 1HTTA 1M1ZA 1ABEA 2FMIA 3W3AH 5B30A 1L7QA 1IIBA 3ICPA 3HPQA 3WC4A 2Q6VA 3ZQKA 2YHBA 3PQ7A 1IHUA 2BC9A 2BGUA 2K2WA 3QTTA 5EAIA 5FWYA 5IG2A 2WB4A 1ZHOA 4YBRA 2VDOB 4JKIA 2GN0A 4V1CI 4LWOA 4Z6KA 4PC2A 5K8IA 1QRDA 1SUFA 2NACA 3BYZA 4XGKA 3K1AA 1D2EA 4BZZA 3LCRA 4MWEA 4GL2A 3UQZA 4TMKA 5AW8A 2QD4A 2QN9A 1FP1D 2AHOA 5HCIA 4N54A 1CDEA 1KDZA 4RCVA 4WEOA 1DOAA 4HEA6 2FSHA 1W9MA 3GLFA 2X9LA 4U5XA 1NE2A 2GILA 2ISQA 3JWHA 4GM4A 2PZGA 4Z9AA 1JJVA 5FI3A 3R9KA 1V2GA 4O2LA 4CL0A 3IURA 3KFVA 2GLTA 5FWDA 3S2EA 1KAEA 4LN1A 3SQLA 2MCFA 4F71A 3AP2A 1O8BA 5JBIA 3E5HA 2BSAA 3I9FA 3TXYA 1J7JA 5E7QA 5JTTA 1GUAA 1YQEA 1VJ1A 2EARA 3HJRA 3NEAA 3SN6A 3E22B 5SYAA 4JI8B 1T6NA 4XFDA 4EARA 3FGNA 4YP7A 4J76A 3VBCA 3D5TA 3IEPA 1USVA 4ZVOA 3SKXA 2X14A 3JR7A 4LQ4A 3ZEAA 3AVWA 1RMYA 1BTOA 2C7BA 4TN5A 5IJ0A 4G0XA 3BORA 4PSAA 1WY5A 3CB4A 4LYYA 2BF7A 1BHQ1 2VI5A 4RXMA 1VE1A 1N0VC 4AQYB 4D9BA 4MW5A 1FTWA 3VGJA 3FRHA 3RR2A 3O1LA 1DWOA 2AZXA 2VP5A 1NSTA 1H2BA 1NRJB 3B5EA 3EBPA 4DCGA 1SU6A 3DOFA 3TZLA 4X97A 5DGTA 1YU9A 1DO8A 2HA0A 4IZ6A 4D9GA 2GXQA 4KOEC 1G0OA 1ISHA 4FC7A 2BFAA 3MPOA 4GSKA 3HBLA 2FN7A 3VNSA 4FE7A 4IXNA 2JGNA 1P2TA 2J46A 4MQEA 5D3QA 4YUYA 4KPUB 4ZKDA 1G7SA 1QDLB 2Y76A 4WFQA 1YFJA 1U9JA 1YI8A 3DB2A 2OO3A 1PJBA 1KH2A 4IIBA 1INLA 2XA1A 2VPQA 2FSGA 4XGRA 5GMOA 4G9EA 1W8DA 4LWQA 4CKCA 2OV6A 3ZY4A 2E4UA 3EEIA 1B3RA 1UINA 1RXSA 3IQWA 3ND7A 1ZGZA 4B3BA 1ZONA 3GQBB 3F74A 4JNCA 4WOJA 5FLEX 3RAGA 1LY1A 1Z29A 2PDAA 3W6UA 3VHLB 4OL9A 1K2WA 1OAAA 1UFKA 2YWXA 2OEPA 3VR5H 2ACWA 2SECE 2IYFA 2ZJ5A 2W6ZA 3FWHA 2YFQA 3DXXA 4BE4A 2O20A 3KWFA 5H4GA 1GPDG 3L43A 2XHEA 4TYMA 1P61B 4BWGA 1U9YA 3BF7A 4YONB 3WMFA 2Q2OA 4RVOA 3S2UA 1H66A 4BLVA 3L7OA 5AJUA 3A6ZA 2FEOA 3GJRA 1JEQB 1U8TA 3USZA 1UR5A 1P4JA 2G04A 2PMFA 4DLUA 2NPIA 4BFTA 1J22A 1KH1A 4X63A 4O08A 4RXTA 1TQ6A 3FOWA 5FI0B 3X1XA 4ZV7A 4DMHA 2JGRA 4OP3A 5BN3A 1ORIA 5I5GA 1U28C 3WZLA 2BHTA 2HJ9A 4IMRA 2FRDC 5D5HA 5KYYB 4CZ2A 2Q5FA 1R6AA 4WK0B 2EDCA 3EVTA 4IHQA 5B64A 1CR1A 1NXSA 4QL3A 2OBLA 4RMNA 5KNBH 2ZBEA 4R6XA 3P96A 1FFYA 3G2PA 2QT1A 3SF0A 1THTA 4YXFA 4L8WB 4EABA 5DGXA 3BMNB 4YDQA 1EJBA 1KY5A 3TLAA 5J2UF 4EEZA 1W36C 1N3IA 3LDHA 5EHIA 1WKVA 2CXQA 4HEHA 3AJEA 3ST7A 5MF6A 1CG6A 1PAUA 3JQ6A 1E1DA 4QLAA 4U9UA 1TOAA 4LYDA 4CLEA 1J1UA 2PE5A 3V5NA 2IKQA 1MB9A 5CNKA 2DEUA 1R5JA 3KR0A 3AWIA 4HB0A 2K5UA 1SM4A 3KEMA 3MCZA 1QGAA 3IHTA 3OUUA 4GVPA 1JEOA 2PRSA 1ZYUA 1JR4A 4J7XA 1OZHA 2FWIA 2W6OA 2YQ5A 4B3SB 1FU4A 4HN9A 5FTJA 3THWA 1XNQB 1CJKC 2JBAB 4Q1EA 4G07A 4I8XA 4P6VF 4ZGWA 4EFMA 2B5WA 2GCGA 3DMHA 4MQFB 3P9PA 4UVEA 1OBOA 1NP3A 4EI9A 3U9SA 1A88A 3DSRA 1XFDA 2ECPA 4FYWA 2CB0A 3ZW7A 2IBTA 1PK9A 5D84A 1MFZA 2PH5A 3RANA 4AJ2A 1NW8A 5MN6A 1SXGA 1G20A 2ZJBA 2RHGB 2QRVA 5BNTA 5FO0A 4I50B 1GL7A 4X71A 1FFXB 4AICA 4QFDA 4IR7A 3T6KA 4XD7D 1A7KA 1TUGA 4JLKA 3BRCA 1TVKB 1OH7A 3OCWA 4UM9B 4OHVA 1S4QA 2GN8A 2WVHA 1HDYA 3KLMX 2XDQB 1T4CA 1NZFA 2AYYA 3N2YA 2HHAA 1PT7A 1CJTC 1WMBA 4B2PA 4KCGA 5DGCA 2HO5A 5H02A 3H1AA 1LW7A 4WKGA 1JHQA 4YREA 2FKAA 3UATA 1ADYA 3N2NA 5BSRA 3LPLA 5LYJB 1IJKA 2GN4A 3LCUA 2P40A 3EXG2 1OYOA 2OUKA 2V98A 4R3WA 2RGXA 4FI3F 3HVIA 4KNYA 4I5EA 3W8RA 2FW1A 4FYKA 1CE8B 4PAMA 4PG6A 1JDPA 1B00A 1C7FA 4J0QA 1Z6GA 3VMFA 4AKEA 1VOTA 121PA 3LZ6A 3VM6A 4C03A 1OFGA 2GWRA 3OCYA 1MVNA 4HDNB 5AM4A 1R4MA 2Q3CA 2QS9A 3MNFA 2OAP1 1NV8A 3NWPA 4EHAA 3IR5A 4Q3NA 3MEQA 1EVEA 1RAIA 1U8CB 3IEKA 3UJCA 3C3PA 3IP3A 3ZWXA 2X5XA 3DM5A 3EQ7A 2HFJA 3QBVA 2HIGA 4UVHA 4QTZA 2FDCA 1C9EA 2PJRA 3KTFA 5ALFA 3QY0A 3CRVA 3QYJA 5BVHB 4LX8A 2CL5A 4WBXC 1U0NA 1IYZA 1QFJA 4WNAA 5AVJA 2IEDA 2D2VA 3EDRA 1V4NA 3THWB 1CULC 2O7NA 3QU7A 2VNKA 3BWBA 2FOLA 2WF9A 3A2LA 4BNWA 4LG1A 4C0SA 4RMIA 1N5LA 1E1MA 3MOSA 4PRZA 2G06A 4WESA 3LUBA 2QYHA 2AWOA 5ADWA 1W0KD 1LDGA 1ZOSA 3CN9A 3IAEA 5FORA 3UCEA 3U7GA 2WMNB 4FDUA 3GW8A 4YRGA 1DOHA 3P2KA 3TTTA 4DR3B 5T8KA 1QLWA 1Y9EA 3LUKA 4A2QA 1RWMA 4MMZB 1MAVA 4FIZA 4GPAA 3PPYA 4UAUA 1OTHA 1N0HA 3T5BA 1Q74A 1F3OA 2VPYA 4LVOA 4MCIA 4CUKA 2GT1A 4Q4JA 1SCQA 1U2DA 4JYPA 2YIDA 2PS9A 2NXWA 3I4CA 1XK6A 3KTDA 1T6YA 4QT0A 4WASA 4YIHA 5JI2E 4LMPA 1QGZA 3TECE 3GP3A 5FWAA 5C1BA 3IOCA 1HDCA 3BH6A 1EQ2A 1XCGB 4RD4A 5JSZB 2X77A 1XPOA 4MB0A 1HMYA 4YJGB 1KO5A 2H17A 2IPAB 1CW2B 2H1HA 4W5QA 2VAMA 3GCDA 3V1LA 4F46A 2YJ5A 4BUCA 1DV1A 1TKAA 2L18A 2YWGA 4PLWA 1FRVA 1RP7A 3GNQA 1X7ZA 1IATA 2C9DA 2ZCVA 3NGXA 4V0RA 1W2HA 3D3NA 1N6HA 1XNJA 2BFEA 3BWCA 3S6JA 1GNQA 1H1LA 1MQAA 9GPBA 4BFVA 5DX0A 2HUNA 5HJ5A 5JJBA 2GZ1A 1N2XA 2CSXA 5F2EA 1I3MA 1S2OA 1JT9A 1VE6A 2HWUA 1VIVA 2R8OA 3PFGA 4RAQA 4OREX 2IX3A 2V96A 5HFJA 3CZRA 4O4LF 3KB8A 4CUJA 4L8LA 2JLCA 4ZOEA 4LJ5A 2OLEA 3DMRA 3J80A 3RV4A 3PFBA 1MNQA 3QU4A 4BBZA 4EATA 1UDBA 3R6TA 4LBWA 4ETWA 1U9CA 3C85A 3NFYA 5DM60 5I7EA 1XZQA 4EPWA 2JFQA 3MBKA 1ZVKA 4F3TA 1NVDA 2G80A 5A02A 2G40A 4TLLB 2WUDA 1YBHA 3RTEA 3MWEB 5IZ4A 1WA5A 2OHHA 3BL5A 3HA3A 4ZI7F 1LF5A 3TRKA 3ZE2B 1IDOA 5BSEA 5IX8A 1N3LA 1J0XO 1R0XA 2QV0A 1SXIA 3EUEA 3K53A 2VL7A 4FTWA 4MEJA 3LGXA 4NBUA 3RHTA 1CQWA 1WETA 4OK6A 3WKDA 2WYVA 4D3DA 1UBEA 4B3GA 2VP3A 3F9IA 4DM7A 1VG8A 3IIEA 3N2ZB 4DQDA 2D1TA 4Z4IA 1DTWB 4NOLA 3STUA 4AKTA 1DC6A 2GEBA 4DCPA 2WFZA 4H1UA 4LJAA 3M5WA 2EAUA 2KLBA 3EMVA 4EUFA 1YL6A 3GDOA 2QUJA 1B4DA 1M33A 2C2HA 2QTNA 2DFLA 2COEA 3UH0A 1DJMA 2J0VA 1V96A 2VNJA 3BMCB 1NJ8A 3OSZA 5ALYA 2SKDA 4Z4CA 2WJZB 1X1DA 2WF5A 2W0SA 3MWGA 4JEMA 3VOAA 4CT5A 2GRJA 4ZEMA 3QOYA 4RL4A 4UU0A 2QUIA 4MQMA 3T3PB 5GZ1A 4RHCA 2OE2A 1COZA 1W94A 3V2HA 3WLKX 2QRHA 3GJTA 1IJEA 2PZAA 2RONA 4PQFA 5DHAA 1D7OA 2NX2A 3KAQA 2H11A 4JAVC 5HTOA 3EZNA 1W30A 4CIXA 3IA7A 1AS3A 1WE2A 5TT1A 3GHYA 2A9JA 1IIRA 2FW7A 1O4VA 4HN2A 1J8VA 4OQEA 3VR1A 2BP7B 4QFCA 1AUPA 2H9YA 2G72A 4TTSA 3CPEA 3SC4A 2GASA 2Z1NA 4HFJA 3TLGA 4DR4B 3B36A 3DNPA 2NVOA 4PPNA 4QOIA 2PUEA 4E31A 3AP1A 3D3WA 4IMJB 2P6MA 1OOEA 1J1ZA 3AVPA 1EJ0A 4I4NA 4O4HB 4CKWB 5K3OA 3BULA 5DVZA 2AEMA 2JB9A 1MTOA 1X92A 2OBNA 5IFLA 4P3YA 2OXTA 4DA8A 4MI3A 2L82A 3E4CA 3OZ7A 4X1IA 5LCXA 4NOMA 3EB9A 1Z0FA 4P3XA 5AMXA 2Z8XA 4XCQA 4RELA 1ZPDA 3SEFA 2DECA 2IU6A 3A04A 3AF2A 3E70C 1QCDA 4P9NA 1ILEA 2ODTX 1EUZA 3QE4A 3KO8A 4N5IX 3SIWA 2I2XB 3FWKA 4IQFA 3HGQA 4CKXA 4GSLA 2MYUA 1TRHA 3QWFA 3Q7TA 5B55A 1N25A 3BWVA 2LPMA 4I8IA 1QHHB 4HO1X 4EGQA 2O8DB 1GPLA 4TKLA 4UFOA 2Q1SA 1EHIA 3WLPA 4YPFA 5DTMA 4HWSA 4XB6B 4YDRA 3AB3A 1ZG3A 2IPLA 3G2JA 1HZZA 1II9A 4TYPA 2HX1A 1QVVA 2IHJA 3ADKA 1QAMA 3BICA 2Q5LA 5BSKA 4UCQA 2X7HA 3R20A 4MP8A 1WUHS 1W4RA 2DFTA 3DE6X 1Y4UA 3G8DA 1T29A 5C8YB 3F46A 1FYFA 1ORRA 4P5PA 2IYXA 2NYRA 1VA4A 5FX2A 1JR3A 1WXGA 2HJWA 3HXMA 2C4VA 4JLDA 3P1JA 3O4GA 3B20A 3TMAA 3W5HA 1TZBA 1GZ4A 3JARB 1Y3DE 1X7GA 3ORQA 2X5OA 4O8CA 4WLOA 3FMPB 5BW6B 1JTFA 4QJ3A 1ID1A 2AJBA 3NNNA 2WV9A 4LBZA 4FQ8A 1VLLA 5F52A 5ECDA 3RBAA 3R9WA 4DKJA 1SC3A 3OZWA 3ZDZB 1OLUA 1J00A 3D6HA 2ODWA 2A9VA 4A4DA 3QMPA 3HZRA 4WY2A 5EE9A 4BHTA 2AXPA 3RYIA 5AUNB 4G56A 5FNVA 1WW3A 2ZYTX 3MGAA 3CURA 2RK6A 2WWHA 2FZWA 1SRQA 4C30A 5E6RB 2OBXA 1Z3IX 2W90A 1OXVA 4RPGA 3OPYI 3UWPA 1MGOA 5EQDA 4DQ0A 4Q4LA 3K2QA 5JAIA 4K2AA 3WQHA 3M70A 4KAFA 5HIAA 3OEHD 3RVBA 4MWSA 2BE9A 1AN9A 3C4VA 3PDCA 2HCTA 4FDLA 3NBAA 4P4GA 3BXPA 2CF5A 4MKXA 4EW6A 3U3MA 3TE7A 2PSHA 5JTUA 2XOKD 1GAXA 2ZAIA 5JSQA 5KPDA 1QMPA 2HPVA 3ZZNA 3X2SA 1K4YA 1VKOA 1EUDB 3M0EA 4EF4A 2RJOA 5EWMA 3PPWA 4FEAA 3NORA 4XVCA 2ONCA 3OCZA 3RF6A 3K09C 5FL3A 3QVUA 2XXBA 1BXKA 3FYTA 1HWYA 3PA6A 4HQKA 1Y9DA 2X8JB 4KC0A 4M0LA 4MV6A 4AY5A 1KIFA 2F55A 4WJKB 3GARA 4J4TA 2E2WA 1EDDA 2XKBA 4IKOA 5GV8A 1KR5A 3ZDYB 2BGWA 3H5NA 4DDTA 1DKNA 3B60A 3O31A 4OK3A 8OHMA 1HDGO 2Q21A 2OTCA 3A05A 4RSGA 2QX8A 1SQSA 4P98A 3K7EA 4D2IA 3GT4A 2IXTA 2HMVA 4BATA 3R5FA 4BN0A 5JYEA 1NWCA 3TCNA 4ECAA 5TMBA 3RYCB 2O8BB 3G8BA 1J8QA 1SHZA 2HXSA 2PQ0A 3JQFC 5KQGA 3I1FA 2WAMA 3N1UA 3JAKA 5U4QA 4QICA 2DUMA 1NXQA 3B6JA 3C6YA 4BX8A 1Y8RB 5AKEA 3I28A 4YP1A 1SJ9A 1G2QA 4RD1A 5K6AA 1GU1A 4PLVA 1X9GA 4IVPA 2AVNA 3VR4H 1M0TA 1W35A 5EIEA 2V6JA 2ZRBA 4RHTA 3SR3A 1F5SA 3CLUD 2WI8A 1NOKA 4KE7A 3U56A 4L8GA 4N8DA 1QAQA 2X41A 2IWHA 5HYVA 5K3BA 2AR0A 3K5HA 4CNQA 3VTFA 5BSFA 1PFGA 1TPYA 3A4YA 2J3HA 4WZZA 2PRKA 2E5FA 1OX6A 3ZXIA 4KRYA 1T91A 2JGAA 4AT1A 5CCBA 3G1UA 3RC3A 4YK7A 5C37A 5FBRB 5MFZA 4NBWA 4UBMA 2HT6A 3Q7PA 1NR1A 2NUAA 2WSSD 3B1JA 4NDZA 2XVMA 3OJEA 4R68A 4BIIA 2VBFA 2A5DA 4AJNA 1YWGO 3CF2A 1HRKA 1OCEA 2PXXA 1FLDA 1DIGA 1M2WA 3BOSA 4LNUB 4FIDA 3PENA 1HE1C 1BCSA 1VMIA 1AO0A 5JAUA 4TLAA 2RCNA 4UQOA 3F71A 3HM2A 2I4IA 3DHVA 3PNVA 3WTCA 2FCRA 4JCCA 5SY6A 3QYAA 3UXEA 4TYWA 3G85A 2MINA 4BMCA 1KMMA 1J20A 4I3GA 3LUPA 4KYVA 4R9NA 4C3ZA 2VF5X 3MCAA 1RI5A 2OD2A 1T24A 3PC2A 5CLIA 3CR8A 3OKAA 4LSMA 2PH1A 1Z56C 1IJFA 1CS0A 3GCZA 5LD2C 4FLMA 4A8JB 1W6UA 2BSXA 1QNLA 2QRLA 3ACDA 1KDYA 1VLJA 4MX8A 4BVEA 4ZDIA 2JGIA 2H7VA 1EVJA 1OIVA 1OXKB 4HGOA 4XVRA 3ZUPA 4DDMA 5F9MA 5I4BA 4QELA 5JD6A 4HMOA 4EUHA 4RSMA 5DE3A 5DOVA 3FROA 3KKKA 2IIPA 4GT1A 3E9QA 4HDKA 4YJHA 4A73A 3TTVA 5KOHA 1YQQA 1MZVA 4HNUA 4R1UA 2QTWB 1FSFA 1O6BA 3LVBA 5T4EA 3TDKA 3BE6A 4N3BA 3RS4A 4FFRA 4EKEA 2VTEA 1UJBA 2Z43A 3R75A 3E05A 1TD1A 1I4TD 4AB1A 3H0CA 1E18A 3PHBE 1IB0A 4M55A 1B15A 1LBIA 1PZMA 3B3GA 1M34A 2VLBA 3I6IA 4I1IA 4JFRA 3RC1A 1E7QA 1JNYA 2TMDA 3HNPA 1I33A 4NQZA 2OR3A 3QVJA 1S96A 3LZDA 1ZMXA 3PZBA 9ATCA 5K0JA 2Z83A 1EWQA 2GAOA 4N3GA 4OXIA 1NC3A 5E6SB 721PA 1H3EA 4HB2A 1V71A 5DW3A 4MR7A 1GRNA 5IN5A 2NMVA 4F3NA 1GPWB 3SMVA 1F7VA 3C3EA 5AKZA 3UVEA 1R9NA 1K5GA 1P1HA 2Q46A 1MB0A 4RY2A 4AMYA 1WUKS 2DBQA 3KHUA 1JNXX 1XELA 4GP7A 1JG3A 5BNIA 2BGGA 1WL8A 1EM6A 4WSOA 1IEVA 3NHFA 5KYGA 3UHAA 1XLUA 4RUKA 3I62A 4EMBA 1JHUA 1XTKA 2RCYA 3UHJA 3JVDA 1MX9A 4MGEA 3ZD6A 3U62A 3P20A 3BMXA 5KWVA 3LY9A 1JPJA 2BEUA 3DCNA 4EFLA 2XB4A 3EVGA 4I9FA 2Z1MA 3MUNA 2LZ0A 3PXUA 2P5TB 4YRCA 2I29A 1JH8A 1QDEA 2QL7A 2ZANA 3LQFA 5FFFA 3IPCA 4GYWA 3Q88A 4AZVA 1CSEE 2ZUUA 4ZGGA 3QXHA 3VV2A 3FCCA 4DVJA 4QGFA 2OB1A 4CEJA 1NXWA 1I3CA 6NULA 4R8RA 3ABIA 4UM9D 3FGOA 2Z5GA 3WRVA 1C9MA 1RI2A 1K4KA 4QPNA 5JJCA 3OZEA 4KR7A 1FX0B 5A06A 3H9EO 3TQSA 3WBKA 5A3JA 1ZD5A 2DWCA 3R5TA 4YDHB 1IM8A 1H6CA 2GRAA 3RYTC 4MH0R 1AHNA 1VL0A 4ZZ2A 2ANBA 4M21A 1AURA 5KOIA 3D2CA 4GZLA 5GP1A 1DIAA 3ROXA 1G16A 3HRKA 3DZKA 3RJ5A 4RAOA 2FPIB 1MO5A 2HD4A 3WV5A 3DLCA 3AIOA 1WKCA 2XSZD 3H2KA 1J09A 4JQOA 2P79A 2QQEA 1NFFA 1KEZA 4JYMA 2VUHB 2XCQA 3WNCA 3NJ4A 2G4VA 1WW8A 1P7YA 1XTUA 4GICA 4E1BA 1HM5A 3PGJA 4R2WA 3H2ZA 1O5IA 1GG5A 3GRRA 3UTDA 1DO2A 3IDOA 2HR1A 2VK4A 3SICE 2A94A 4IIEA 4JU9A 3WYBA 4J7UA 1IHPA 4AUMA 4DRZA 3QIVA 1W88B 5BV0A 2O7RA 1NXXA 1YNSA 4IGIA 1ZEJA 1JVNA 3FPEA 1RWNA 1ZXLA 4OBXA 3D6NB 4PRKA 4YAEA 3FKSD 3TW0A 4B6FA 5MN5A 1EFCA 1TE2A 1TMYA 2CE2X 3C3AA 4HFRA 4LVCA 3MG9A 1D6SA 3QA9A 1C7EA 2O0HA 4BS9A 1HNWB 3RYHA 2ZPUA 4XR9A 4Z5XA 1WY7A 4YJ2A 4KRXA 4A2PA 2NSYA 3I5AA 4WLNA 5LDGA 2A1UB 3WLNA 1GL9B 1OFTA 2ZWOA 3OZSA 4J0DA 1BDJA 3EXFA 5REQB 1SXJA 1U3VA 2HMWA 4QNMA 3WFIA 4LK2A 5B6JA 3IE1A 4JB8A 4RO0A 1O57A 1K08A 4GZ5A 1DBVO 2FW0A 4B4VA 2E0IA 4XWOA 3H9QA 3UPDA 4MMXB 4YMVA 3NMUF 3AKYA 4MKGA 1M1UA 1KWKA 3UAOA 4C3OB 4KN5A 2CDBA 3LY7A 1HFKA 1HORA 2QZ4A 2QM8A 3MLAA 2VK8A 1KAGA 3GG9A 3ZWOA 4ZI2A 1WULS 1KP3A 1GXSB 2PCJA 4RK1A 3SDBA 5I3ZA 1LPAB 1SUEA 1NQVA 1MH9A 1VDZA 2QTGA 4XYEA 1Z22A 1M7GA 5G3YA 4BCCA 1E5VA 1K7XB 2I03A 1U94A 3PQ8A 4HK4A 2NTVA 3RWMB 3R6WA 3ZZ1A 1GT91 1VL6A 3U80A 1SUWA 1TVMA 2BCEA 2HQOA 1XTSA 2YHIA 4FOLA 1H4TA 3S68A 3ZWCA 1QV9A 1AKQA 2GSDA 3HU5A 1U3FA 1CUZA 1QLJA 3NKVA 3PEEA 5EE5B 1FDWA 1JI0A 1OILA 4ARAA 4E2YA 3E58A 1BA3A 2FE4A 1YONA 3UT5A 5ICGA 3MT7A 2P3SA 4PLTA 4F5DA 4I14A 3DQPA 4O4JF 1WO8A 2IF2A 2F9LA 2QNBA 5HZHA 4JVSB 4UD2A 3T35A 3EF1A 1CUHA 3C74A 1NMYA 3M5DA 1RPAA 4GL4A 3DEFA 4WZBA 3ZLTA 5B3JC 1Z0SA 2QT0A 2VTKA 3KZVA 2OSVA 3OKPA 1M5UA 2QM0A 1SZDA 4L2IB 3BCRA 3OIGA 4LOKA 3D1JA 2C5AA 2NVUA 2I55A 2MT9A 3EWNA 3OE5A 3S2GA 1ISPA 3AI2A 2DZDA 1G5PA 3A8TA 2BKVA 2W7TA 3GUVA 2YV4A 2W93A 1M8FA 3IDZA 5IBPA 1C14A 4B6QA 2YXLA 1FMJA 1DS6A 1L9KA 1TYAE 4ZU3A 4JSTA 1OH6A 3GPLA 3Q8XB 2XGSA 1ILWA 1U7HA 4LXQA 3CV3A 2CUNA 2QD1A 4MB2A 2JI8A 3I5YA 2GVDC 3IMEA 1J06A 4AXXA 3VH2A 2IYYA 2WSMA 3CXUA 5JQGB 1SXPA 3RVMA 2FPGA 3H2HA 3KNZA 1TYBE 2CUZA 2DBYA 1JA1A 2PJZA 4MUMA 2GO7A 2I7CA 3WYFA 5CDGA 5FEUA 5KYXB 4YQFA 3BZWA 2NZXA 3GA0A 2RSLA 4CIBA 4B3MB 2QRZA 4N0QA 1BHSA 3WLAA 3UPUA 1QZXA 2D5BA 1CPYA 1GTMA 4AY2A 2QHXA 3VZQA 2C84A 1L8AA 4MJ3A 1ISJA 2QVBA 2WNHA 1DDGA 1LV8A 5JSYA 4E7PA 3CSDA 3ZWPA 1O0BA 4FM9A 1FIUA 4PLCA 2NNLD 4Y7DA 1ESMA 3VRHA 1G9SA 4WFJA 1NF2A 1T8WA 3C4JA 2I8AA 2QAGB 4GLJA 3WGHA 3WLLA 1M2OA 1O77A 4UZEA 5AKIA 2WD7A 3A3YA 1RBYA 1CDDA 1ZMOA 3D0OA 1G6HA 4K6FA 4CR6A 2CN1A 3LQ2A 1NBMD 2Z95A 4RE6A 2OCDA 4UW9A 4YRDA 5BN5B 2WJAA 3MK31 4OKNA 1KNQA 4KLAA 1CY4A 4PO8A 4CMJA 4J43A 3SHVA 2P9GA 3A6HA 1DP4A 1U99A 3JQ8B 1M1YA 3IEUA 2FR1A 4FZ5A 2ADOA 3KQHA 1K8RA 2EU8A 2MR5A 1HC7A 3PNPA 4OCZA 4WA7A 3V4VB 4EF6A 3E5MA 4YV2A 4TKUB 4PVCA 2HADA 4UBLA 3I12A 1Y3AA 4WRRA 3A6JA 5JNWA 4AS3A 4HSEA 4KLCA 5B1SA 4ENWA 5KVQA 2VH2A 3RU7A 2R6JA 1NYQA 4JASB 1JJIA 3LOPA 3RC2A 4LW8A 4HGNA 1DNPA 1KJ9A 2G08A 2A35A 4CV1A 4LF7B 2J5XA 3INYA 4F6CA 2FXIA 1GPKA 2AK2A 3N39C 3UFXA 1RIIA 2QVZX 3MCVA 4FMCB 2HYDA 4TV8A 1VI2A 2AG5A 4KITB 4WBSA 3U1VA 5THQA 3NDRA 3TH5A 5EHXA 4RHYA 1Z2OX 3QLVC 3MYRA 4HQ0A 4XTRA 2DPMA 2G70A 4B76A 1M2VB 5F5XA 3TWOA 2VSFA 5KTSA 1N0UA 1XVIA 4HRAA 3U17A 4N12A 2VPZA 5IEBA 4C6TA 1O95D 4XPIB 2VSQA 4MA0A 3E2PA 1TEVA 4KJZA 4HWRA 4N76A 1FYXA 1GGJA 3SYLA 1GV1A 1OWMA 2BVNA 3QH4A 3QX8A 4NVRA 1HY3A 521PA 1R3DA 3JZAA 3MOGA 5ALIA 3VPHA 3KG2A 2Y1WA 4OB8A 1YNOA 8ABPA 3IQHX 1M0SA 2YS7A 1E6CA 1Z68A 2RHBA 2WFAA 5E3IA 4AJLA 3VKFA 4NCNA 2DWQA 3PCXA 4FWBA 2CHFA 3B6KA 4G1BA 4TVKA 4KFTA 4V3BA 4URXR 2DY0A 1KC1A 3G0OA 3PXDA 4P3PA 3EY9A 2XUAA 5FYQA 4F6RB 1OX5A 2C9ZA 3RK4A 4KR2A 4LDQA 1VSTA 4IS3A 2HV8A 3VMMA 1L5OA 3JXEA 4XKJA 2BD0A 2J1LA 4CFYA 3FFAA 1D4ZA 3CZAA 4IQ4A 3HR4A 4CKEB 1U90A 3DBLA 1G2PA 2CFSA 2XMQA 5HWSA 1DG3A 2P68A 1JDBB 2ZI5A 4NU0A 4UXJA 1ZOPA 4C4PA 5NULA 1BGVA 2Q3FA 3O4RA 1ENYA 1JFSA 1Z7EA 5IDVA 1I5OA 4DRXA 1IY9A 1C41A 5BYKA 4G1EB 3WFJA 2O5RA 2HA5A 1Y1SA 4UNIA 4YPVA 2AI3A 1JTVA 5FOQA 2WYOA 2BTEA 1Z08A 2FRVA 3Q9SA 1M6EX 2WIAA 2JCSA 4DREA 3LX8A 5G0TA 3HM9A 2JEYA 2A86A 2WWRA 5F4ZA 4GE3A 4PQGA 1UOPA 2A9QA 2HRRA 4B0OA 1C8VB 4PIMA 1TO2E 1N7JA 1DAMA 3HJGA 1ZD4A 4P93A 821PA 1E1CA 4UE3S 1XTTA 5DGDA 3JQEA 3REOA 5IJAA 1Z5GA 4F84A 3QX3A 1CR0A 1YZFA 1NIPA 2FQXA 3A4TA 4RJIA 5AW9A 4GRDA 2PGNA 5JY1A 1O9HA 1FP6A 3PNKA 4JS0A 1TIKA 3HZZA 4E3ZA 4CTOA 5I7HA 3SJAA 4QKQA 2P62A 1P7ZA 3U4QB 1FFCA 3I2KA 4BAGA 2QD5A 1RRCA 3D9QX 1A9XA 4KFCA 4S04A 3GJZA 2WU8A 1VHLA 4P81A 5KSPA 1ZN7A 2VJPA 4CG0A 5FNZA 1YB6A 3UV6A 2G1PA 1S0UA 2AMFA 3CUVA 1I30A 4C0JA 1CRPA 2AUTA 1P6QA 1GQFA 3GLHB 4CF3A 3GLIB 1SD2A 2AJ8A 7GPBA 2M6KA 1G7TA 1ZGJA 2ODAA 1VYTA 4RX1A 1T25A 1CP3A 5BOVA 1Y6FA 3V97A 4ES6A 3VJKA 3EN0A 1IU9A 1E2GA 1TT5A 4F85A 5C1OA 3HYLA 2WZQA 4ZWNA 2Y4OA 4ARVA 2WMDA 5AR1A 1XZ8A 3COSA 1R0KA 2P1DA 2VDUE 3TSAA 1H9BA 4OH1A 4WCFB 1KJNA 4DLWA 3H87A 1GYQA 1XMJA 2L42A 3F1KA 2QQ5A 1TVEA 4OLHA 2Q49A 5KYVA 4CI0B 1TPZA 3PRYA 4NIMA 5ALUA 3SBEA 3HA7A 1BYUA 3KDSE 4XUDA 5FTMA 3S2FA 3VSEA 3OZRA 2JFWA 4TVSA 1XIVA 3O8QB 4KREA 1XCJA 3Q8LA 3RC7A 4MI9A 1Z8NA 2JLQA 2R4TA 5BQPA 2J9GA 1U7XA 4PM4A 1UT8A 1L5KA 3FVVA 2O19A 1JLLB 3AEUB 3ICCA 5D3MA 5G53C 3O8NA 5KZMB 1XZBA 1KVUA 3TNLA 2ODBA 5ELXA 2UV8A 1AKNA 1RHMA 3DEYX 3GUZA 3L0SA 4BCDA 5KKCA 1ID8A 5BSUA 1VP3A 2FSVA 4FZVA 1NX6A 4IXMA 4WMLA 3T61A 5JAHA 1VTKA 3D4PA 2C5FA 3HO8A 1E2FA 3IQGX 3ZCPA 4A15A 3RSHA 3C5HA 3HDVA 5G1NA 4GDFA 3PNMA 1C3VA 2JI7A 2L17A 2IK8A 3DHYA 3RV3A 4EITA 5EZ5A 1YZGA 5CD1A 2QTCA 3U7HB 4OHMA 3NPMA 4RY9A 4C3VA 4YJ3A 2D2FA 1C3OB 3L6DA 1L3IA 3IOBA 4Q4HA 4ARBA 4GS5A 1WTCA 4V0OA 4POOA 2FP4A 3EZXA 1P4SA 2ID4A 2FMKA 2NPOA 4X6XA 2R00A 4RZUA 3RS8A 2M6SA 3T12A 1YS4A 3EGDB 3LPDA 1JZSA 4YJFB 1IBCA 1G20E 1TMKA 4XJXA 1PBTA 2C54A 1WXHA 3H5TA 3M3PA 2X40A 4RNCA 4AZWA 3HG7A 4EFKA 4XVUA 1H6DA 1E69A 4PYQA 4Z54A 1Z0IA 1UFRA 3O83A 1RNLA 1Z6PA 3LLUA 3G0HA 2F00A 1CQJA 1MPXA 4LNHA 4A8PA 2ZFUA 4G0VA 5ANRB 4X62B 3K70D 3K70C 4Y0AA 4DA4A 1W5EA 2C3MA 1XEFA 3DAFA 3G5MA 3TOVA 2JIMA 4HDOB 1V48A 3QFCA 1M6HA 1ZJYA 3PFNA 4RH0A 3U60B 1M1NB 1PFQA 1N5OX 2XYPA 3MINB 2MYNA 5CM2Z 4AM8A 4LXHA 1IQUA 4P7JA 2QN7A 3H3XA 3RRXA 4DSOA 5HSGA 421PA 2IUSA 2WFLA 4M0FA 3NT4A 3F49S 4QOEA 2ZR7A 5KCZA 4G1UC 3BG5A 4MPPA 3LK6A 1T5SA 3WK8A 5AW7A 2BKXA 1XA0A 4FZ3A 2QLLA 5HQTA 4FNGA 3EUFA 1RHQA 3OLCX 2OCGA 3MWJA 4R01A 4JKYA 4Y2HA 3GJXC 1W2GA 2AX4A 4Y9SA 3VJMA 3BXZA 1E2LA 4IG9A 5F35A 2IHYA 5C3MA 3K0SA 1DPGA 1K97A 2RKWA 4EG6A 3M6UA 4REQB 4B4WA 3RUIA 2O5CA 4OB6A 2FR0A 1H5UA 3DE5X 3VNBA 3LPAA 1JUDA 3GRYA 1L8LA 4GEKA 5YASA 1ZK3A 4DY4A 1HNXB 5GWXA 4Q1VA 4KQGA 4L0MA 4IZHA 3I5MA 3QPUA 1XU9A 4OMUA 4NZOA 2QRQA 3K8YA 1R27A 2MSWA 4ZCRA 5E3HA 2CNKA 3O75A 3LY8A 4WLUA 4FT4A 1DFHA 4AUKA 4H3HB 4N3CA 1MJNA 2JLYA 1DX4A 1RACA 1CUWA 1ADJA 1CP2A 1LX7A 4RSRA 4F0JA 2PMCA 2QTRA 1UEJA 1L1QA 1DG9A 4GNKA 4A9AA 2PBFA 4KWEA 1H85A 3R7WA 3GJYA 2BRUC 3DZIA 3QE3A 5IJ9B 4NBSA 2XTMA 4ZTUB 4OSPA 2J4CA 3RSLA 4IWXA 3NVDA 3FLEA 4AVYA 4IKEA 4HAWA 3GVXA 3HADA 2HLPA 1BAPA 4IIJA 3AH8A 3AHGA 1ZK0A 3GAMA 4M0EA 4QYIB 4XA8A 4AS2A 4RLFA 3L9XA 4S2UA 3A1EA 1ZCFA 3WP1B 4K8OA 1J6UA 4MV0A 1UM9B 5EHNA 1XP8A 2CVZA 2YX1A 4I1VA 1J21A 3GROA 1GZ7A 1XKTA 3UK7A 1XPRA 3B1FA 5KTTA 5F73A 5J5AA 4E4YA 2DU8A 2AR7A 4NMXB 2QV7A 4L6CA 4FN5A 4XDYA 3ASUA 5LB4A 1AHHA 3HI6A 4H4CA 3VO2A 3QPAA 1DZIA 1YQWA 1FNCA 1F60A 2QU7A 1JU4A 2NN3C 4CODB 2ZDQA 2JBHA 4TQAA 4EEKA 2PT5A 4PSUA 1Y6QA 2APJA 3CPHA 4RACA 4GI5A 2IUYA 4PEVA 2VT6A 3SSNA 4FX2A 5ELLA 3NWOA 3G2NA 2GARA 5JO9A 3FFWA 1K3TA 1DKQA 1QFYA 2P69A 5H81A 1D6NA 2C7PA 2OV3A 3L77A 4ASUD 4B45A 2LW7A 2B4QA 4ISBA 4DJFC 4URHA 1WXXA 1XCPA 2GKSA 3BL8A 2BKUA 2X42A 3FLBA 4UJ5A 4AJHA 3W3AD 3CVUA 5JATA 1KY2A 1NI4A 4F56A 4E13A 1RZ3A 2CD7A 3FMIA 5JCZA 1LBSA 2B8NA 2QIPA 2XUPA 4RPIA 4E07A 2QVCA 4DLYA 3Q7EA 2QMEA 4XYBA 4RZ2A 1KK0A 2ZSHA 3CG4A 4B6PA 2ID7A 3GVIA 4L9RA 4C7XA 3AETB 1FMTA 1OLXA 1ZQ1A 1J8FA 3WJ1A 4JYCA 2IHTA 1Z4OA 3JWEA 7ABPA 1B23P 1V5WA 3RS2A 4BXOB 2O5EA 2Z08A 2ZRCA 3B2EA 2I2AA 4NYJR 2GEKA 2YR0A 4GPZA 4QTUB 3V4LA 4TWAA 3E3AA 5GIPE 1TCBA 1BRMA 1L9XA 1NJ6A 1HV8A 5AVUA 5KYWB 1KTIA 3P7MA 1QOZA 1YVDA 2NIPA 4E0BA 2AQHA 3A4VA 3P8ZA 1CB0A 3HWSA 3OZAA 4D4GA 3DR5A 5TS3A 1YI1A 1LPBB 2ZI4A 4P35A 5FPTA 3TXXA 1D3AA 5HJEA 3IHKA 2NQ8A 3D7NA 4XM1A 3AP3A 3VYSB 4DYDA 2HRDA 3HE3A 1K8XB 1JIKA 3HMKA 3FOEC 3FCSB 4TL9A 3LX5A 2ZWPA 2JZNA 1E64A 1TZMA 1V16A 1VL5A 2BAGA 4E2WA 3I4LA 5A9RA 3RT7A 1Q0LA 3Q8KA 3NFRA 3LPNA 4XJVA 3Q11A 1GAJA 4YRLA 3ZK9A 3B8EA 4ZT5A 4XUCA 1V1MA 3PDUA 4K5QA 4JMLA 3USES 4YACA 3MQ2A 4M87A 3SC3A 4OSOA 2E7ZA 3DO8A 4MPRA 4OF4A 3ROZA 1VJ5A 3LOQA 1RPJA 2FSFA 4XTCS 1EBUA 2VDRB 3C14C 3FBGA 1PG0A 2G4LA 4EHIA 3GLGA 5AM0A 2ZYDA 2R8XA 2R8ZA 4MKFA 2I78A 2RGDA 4KR9A 1KNXA 1GGEA 4ALJA 5TT0A 2FEAA 1WB9A 1BKSB 3F3SA 4LC9A 1TLLA 1UWVA 1W85B 3OJWA 1KSJA 2Q2NA 3TLBA 5K7SA 4WNIA 3G8CA 2IGBA 2ZJFA 1RWVA 3L92A 4FWIB 5TIIA 2OAQ1 1DU4A 3M1IA 1OX4B 2BTQA 4MRMB 5BUZA 1HT1E 3ZCSA 2QL6A 2A9FA 1RFLA 1EG2A 3FVWA 3I01M 2HBRA 3FPBA 3OJ0A 4O5OA 4Y18A 5ENZA 4ENPA 5EGSA 3DDWA 2Y1CA 3PHGA 2YMQA 4LY6A 4MYDA 3RS5A 2I1WA 2FPUA 4PO9A 1WP4A 4CE6A 1FTGA 1Q15A 1K7EB 3VX4A 1N6NA 1LK7A 2G1UA 3DBRB 1QBKC 3IUYA 4X7RA 1VA5A 2V3CC 4KB5A 4MUKA 3D8TA 3SQDA 1TAUA 3NWJA 5CT4A 4EELA 3K4QA 1BZYA 1JG7A 3OLWA 4FS3A 1HTWA 3B9PA 4ZOCA 1J2TA 4BAZA 3O0TA 3Q0IA 3ZDXB 3PQ3A 4CDNA 1P2SA 2HBYA 2BEVA 3FSJX 4LKOA 4AKSA 1DZ3A 4DLSA 3CNHA 3IC5A 4E5VA 2QAGC 3H7AA 1O3YA 3VNVA 4R5HA 2JFVA 2PGLA 2C7GA 4AG5A 2ZITA 4MVJP 5JASA 2B4YA 2OZKA 2NYUA 2EJWA 1R9MA 3B1ZA 4QGGA 5EFZA 5EXXA 5LQRA 2B37A 1HX7A 4DNFA 1JR3E 3KAJA 1KFCB 3JY6A 3BGSA 3NUGA 1G8KA 4K3VA 1ZJ4A 3Q85A 1JLKA 2PH7A 4MRRA 1R0SA 5HDQA 5IXYA 5L3SA 2H0AA 7YASA 1F06A 2CNNA 1D09A 1C9NA 2IS1A 4OMFG 1J5EB 2Q4EA 2FV8A 3KXDA 1K2VN 5E4TA 4V24A 3G68A 5F77A 4MROA 3V3TA 5AKGA 1OFUA 3B3QA 4KACA 1DCMA 1PDOA 3GMDA 5AOVA 4DCVA 1UDAA 1QIIA 2GBCA 1YASA 3QKSB 5IRCD 2F8SA 1PQUA 2HU8A 4HN4B 1TFUA 3DMGA 4DSNA 2VSOA 4HGZA 2NO4A 3PTAA 5AOCA 1Q22A 4CMHA 4KDFA 2LCFA 4KSYA 1SRRA 2D1FA 2RGWA 2BIFA 2GJKA 1EFHA 2ZI3A 2NVWA 4KZPA 4LFCB 3ASZA 3HJHA 1NUTA 1OAOA 2TYSB 2YJ3A 1Z0JA 4Y1EA 2CL6X 1PT8A 1PX2A 3PXAA 4HWOA 5JSKA 3MSXA 4QDJA 4F3CA 3JQ9A 1GHTA 1NLFA 1Y8QB 3K0EA 3FR8A 2ZJ4A 3GU3A 1LWNA 1B0ZA 2JLBA 4F3KA 5EWJA 1W1UA 4KGXA 3JRNA 4IHKA 4JX8A 4K81B 4UFNA 1L5SA 3RM3A 2P2CA 4MGHA 1MRNA 2H2GA 2BHLA 2YWHA 3BTSA 4K88A 4RGYA 1CJSA 1ZH2A 2E5LB 2XVZA 1GY8A 3LHKA 1NW5A 3WLJA 1OF1A 1A9PA 3ZDEA 2W2XA 4NJOA 2E4WA 3ECAA 4YRFA 3DLIA 2IWRA 2VH1A 2YKGA 2EX4A 4H1VA 3UUGA 1EM8B 1AKUA 2XVYA 4JSYA 3WOVA 1SVSA 4KV9A 2J3JA 3UK0A 3UJ7A 2JIRA 4WADA 4NG4A 1Z6YA 3LRTA 3TTSA 4W7HA 4R1NA 1PLKA 3KAPA 4ZODA 1TCCA 3MMXA 3TTXA 1V7ZA 2F1JA 3SVTA 4JUBA 5BN4B 4B7XA 2PUBA 1XSEA 5EE1A 2IV3A 5DM4A 3IALA 4RPLA 4ZI5A 2GM5A 5DIZA 3T5GA 1P1RA 1QYWA 1NI5A 2GBLC 2I2FA 2EW2A 3CW8X 3S3TA 3VUFA 1SMKA 3E22A 4OYYA 2GHRA 3A25A 5HOEA 3B48A 3Q3VA 3W9UA 1A4RA 1P1IA 1IPHA 5KSYA 1C0LA 1JDSA 1JEEA 2IRWA 1GCUA 3IAS6 4ZQCB 3PT5A 5DEIA 1EVYA 1YBAA 1Y34E 3KJEA 4OXYA 3TW6A 1AA9A 3DZHA 2GPWA 2X1LA 3KTAB 4HDMB 2D54A 1JAYA 4EY6A 3ETJA 1BD3A 3HFSA 1T34A 3QX9A 4DUGA 3A3OA 2B1IA 3KX2A 4FMDF 3WGJA 4E1AA 5EJEA 1G3IA 3EHEA 1VCNA 4H7DA 3R7NA 2ERCA 3QMVA 4UHJA 5JLJA 2YYSA 3AKZA 3TTYA 1V8OA 3WG9A 4IY1A 2RMKA 2QR2A 1IZ0A 1PV2A 2GCNA 5SZHB 2WB2A 3BWMA 1E3MA 2L2QA 3DBVO 4KPUA 3C3WA 4CBVA 3QU5A 3S1LA 3HKEB 2EBHX 2Y68A 3UXYA 2JFNA 3L7LA 4QUHA 1QPBA 2G28A 1R6TA 1HDZA 1PKEA 3H7IA 3STYA 1N5MA 3D1VA 3IPXA 3L0DA 3GQBA 4UUQA 1KZ9A 5C3UA 3G8AA 4X6LA 5JFTA 5KOYA 3D64A 4JT2A 4X6YA 1QWSA 2YCLA 2DH6A 1UC9A 2GRUA 3KT3A 3C3CA 2HZBA 3GFQA 3W90A 3ZS8A 4BNTA 3W5AA 4W1SA 1EFUA 1YA6A 2Y1OA 2HRBA 4OPMA 1ZIXA 5AI8A 3A0RB 2Y92A 1ZISA 2EKZA 3RCBA 2GZ3A 4F86A 4XCVA 4A91A 4YAFA 3AF6A 2BLNA 3KUCA 5CA1B 1Y5MA 4TLEA 4MS3B 3ZLBA 3C3JA 3DPSA 1GWNA 2P91A 4XVQA 1KJ8A 1WU8A 4IOMA 4ZIRB 3FPGA 3WYEA 4PG7A 1WXIA 1ZH6A 4GFDA 5JADA 1RR6A 1JA0A 1Z47A 2CMHA 1FLNA 2I7DA 3IHWA 5F2OA 3UAVA 2D5AA 3U9TA 3AIMA 2ZU0C 1HH4A 1JW9B 1SN7A 1VG0B 2HK7A 2YVQA 4OP1A 2JHGA 4RD0A 1GPBA 3TTUA 3HH8A 4LTDA 4GKVA 3H1BA 4P80A 1M34E 3A9CA 3ZE1B 2P3QA 4RK6A 4LI3X 4BLWA 4I6JA 5JHGB 2A58A 3PQFA 1WBDA 3BMNA 1R10A 1RJ9B 2OVBA 4IJ6A 4M36A 4CEHB 2A2ZA 2REOA 2C2KA 4G89A 5KVSA 4YMWA 1R4ZA 4ZQGA 2FJ0A 1ATZA 2C1ZA 4KKXB 4RPKA 4C7JA 1AG9A 1QJ4A 2FDXA 4UEJA 3D4OA 3KE8A 1SKMA 3BJMA 3QOFA 2IS2A 4MWZA 2VP4A 3ZU6A 3LI2A 4NWIA 1PVVA 4X20B 2QJRA 1UXJA 3ROKA 3ZHQA 4CI9A 2C42A 5FUWA 1VGVA 2C2GA 1J39A 2RGNA 3AO0B 1EK0A 3RVNA 3NBYC 1T6ZA 3RGWS 2ZJ7A 1KU0A 3AILA 3FUWA 3WSTA 5HQ3A 2TMGA 1TLTA 3CRQA 4MWGA 3W5VA 4MQFA 4G5YA 5JZSA 2G4CA 2B69A 4NHEA 1K3UB 3UJ3X 2ZR9A 3IBGA 1M73E 4Q3KA 4YTEA 4KSCA 1BJTA 1FRQA 1ULHA 5JYDA 1K6MA 1UXGA 3ESDA 4B75A 2FTKE 4E5DA 1FFXA 1KSHA 4JLJA 2VKQA 1FDOA 3TBKA 4D4MA 3GGCA 4ESEA 5BV8A 2JKVA 3IT3A 3JYPA 4YCAA 2B34A 5TARA 1YDEA 2DBRA 2Q1XA 3Q9NA 1XT6A 5BSVA 2XDQA 4U00A 3N0TA 1I01A 2FZCA 4UC0A 3ZU4A 1US8B 3QJGA 5A5GA 4G37A 1ZM2A 1UMBB 1CEEA 2V1UA 4ZO7A 1QFSA 3EZ2A 3VVMA 1F8XA 4H77A 4D98A 4ZHSA 4BFYA 4MUYA 1CZHA 1XV5A 1QGYA 3VR0A 3WGKA 3WXMA 3ZE9A 1J2UA 2D59A 2I2WA 4C4RA 4EW1A 1VECA 4ZO4A 5LYJA 5D8DA 4EDFA 4AC9A 1XAJA 1GNVA 1RVDA 3WK7A 1WCIB 5CRIA 1F7UA 3A3KA 4K1LA 4FVTA 4ED9A 1V4BA 4BJ6A 3EQZA 5BWNA 4QOHA 2C7RA 1CE8A 3NDIA 1XTIA 3PRKE 3R3SA 3RBZA 4BNLA 1UKCA 5JG7A 5F9HA 5T67A 4HDNA 2ZBFA 3PDJA 3TZEA 1CWUA 1SUSA 4RMGA 3SSAA 1E9AA 3UGKA 3ZIAD 2ZWIA 3ICVA 4B2IA 1L7MA 3HBNA 3KDPA 4QRHA 3T54A 3AVVA 1NV9A 3HP4A 5CYOA 4MVJI 1EGQA 3NBXX 4NFYA 2BHRA 2GZ2A 3D7LA 4LVNA 5AOBA 5C34B 5AW4A 4JOSA 4OGFA 4EA7A 4NMHA 1ZIDA 3P9NA 4X64B 3ESYA 3A1CA 3OPXA 1PNQA 1VKRA 2QU8A 3BXGA 1VKNA 3E3OA 2GZSA 2CCGA 2VYFA 2Z04A 4R2XA 1W1IA 5EZYB 5BVHA 2WT4A 2HN9A 1WD5A 4V2UA 2BFCB 4PTYA 1U0EA 3ACBA 2HJSA 2O0KA 2XQJA 5FXMA 5A0FA 4AQDA 1JLSA 1ZK4A 5JW6A 3S1SA 2CUKA 3EGVA 4MUJA 4RMJA 2RHCA 4BNIA 3LVQE 1GCIA 2AG6A 2W2MA 1X8LA 1IY1A 2WE8A 1U0FA 1WZEA 3KLOA 3QWIA 3CVYA 3DLHA 4OA5A 5FFMA 2H07A 2XE7A 3W2HA 2YJ6A 4F8YA 1G9XA 5I7OA 1DJQA 1TTQB 2YOGA 1T0PA 5ALDA 3UW3A 1PJ4A 3U37A 2CB9A 2E4ZA 2W43A 3VTAA 1JQDA 3MWYW 2CXHA 3HR8A 4RWEA 1WTAA 1TT7A 3GELA 1B6RA 1W4CA 1S02A 2EL7A 4BMYA 4OMCA 3TQTA 5LA6B 2PQ2A 3ESXA 4BV9A 3TNYA 2H1IA 3I73A 4JXKA 2NU7B 5JSZA 3JZIA 3QIAA 4YJGA 1LBHA 1GUZA 2RH9B 4MRAA 3WL3A 3KKMA 5IT4A 1I7LA 2PD4A 2ONJA 4YQZA 5A6SA 2AJTA 4KO4S 4PIPA 4LJSA 1KZGB 2W2PA 3JQGB 3QVTA 4YGXB 5EMNA 5C53B 2XB9A 4QG7A 1GGHA 4MYTA 3Q72A 1M7BA 1ZGHA 1EEXB 1N6RA 5ALHA 4QEDA 4EKGA 4YHHB 3MJRA 1K27A 3BMOB 3O3CA 2PTGA 4INPA 4BC1A 3PQEA 3CLTD 1E89A 1E77A 3BF8A 3M2PA 4KWTA 2G1JA 3AJ8A 4BQPA 2GJ8A 5F23A 2Y05A 2ZB4A 4DUYB 2OO5C 4WZBE 4S35A 2C4UA 3S0JA 4O3FA 2JLRA 4HQNA 5I7AA 1PNTA 2CJWB 2XEDA 1L5WA 5HM8A 3MTIA 3ZHBA 1WF6A 2JGKA 1YHYA 1BXZA 5CJPA 3NV9A 4LSWA 2VYND 4P7BA 4V02A 4BEVA 4YCSA 4H7EA 4CLHA 1A9YA 2XB6A 3F98A 4UNPA 4ABTA 3WLTA 5A4FS 3K9NA 3DMPA 3JVIA 1BU5A 4LDNA 1D8AA 1NVVR 3PGVA 2H4ZA 1NQUA 3IQFA 4H1HA 3N07A 5TEWA 3EXIB 4DLLA 5T4FA 1PWZA 4LJ4A 3ORHA 4OFBA 2WHXA 3INNA 1B1AA 3G1TA 3ND6A 2ID9A 4NMWA 1VB5A 5GM2A 1ND6A 1NTOA 5G1PA 1F0NA 2GCEA 3K2IA 1EHCA 2X6RA 1P4HA 2EFGA 4GX1A 2HBZA 2J6HA 1WM1A 4QDKA 1DTWA 4MICA 2AJCA 3JYNA 2GPYA 3AEZA 3TLMA 3DNFA 2EP5A 1Z2EA 4NR0A 4COOA 1XZIA 1WAMA 3DAOA 3FFTA 9ABPA 3FXAA 1DT3A 4H7FA 1O89A 1PW5A 3A7DA 4URZR 3INRA 4FEYA 3BMCA 1M2JA 3TK1A 1ZJWA 3K5IA 4PLZA 4MAFA 3ZV3A 3SJBA 5JECA 1AT1A 1NPTO 3VR6D 1YDGA 1W8IA 1Y7HA 2VDMB 3VDQA 1WXQA 3A1TA 3I4FA 3K15A 4R7TA 1Z6TA 1C50A 3UCFA 3Q9UA 1NBEA 3GCXA 4B32A 3DEHA 3DTTA 1NBMA 4QJ5A 3IERA 4KQCA 4PBRA 4ZVMA 1TXGA 1QH8B 1BX1A 1N0WA 2H2DA 3FD8A 2HLDD 3PP8A 1Z33A 2PWZA 4AYXA 1GFWA 3HDYA 1M1YE 4KN8A 1E5DA 2I8CA 5JS2A 4JK3A 4KQEA 3J81k 2BP7A 1PO7A 1QAOA 3VR4D 4BNHA 5B1EA 4MCJA 5C18A 4ZVUA 5HCUA 2FJPA 1V41E 4C89A 1V6CA 3M82A 9LDTA 3LP6A 2CVQA 1QQ5A 1ACJA 3LW7A 2UAGA 3IAM1 4IS2A 2D13A 4MGIR 2OT3B 4O4HA 5IP5A 3S40A 1JZTA 5LFAA 3UAGA 2G88A 2HREA 3LW8A 3I1IA 1XEWX 2A9PA 3EULA 2Z8YM 4HOYA 2XOEA 3RD5A 4K8RB 1MFPA 1ISFA 3M6WA 1VI5A 3ZC3A 3IXMA 4H7HA 1HO3A 1P1JA 1E7MA 1G8PA 1NJSA 2F3TA 3EDOA 4OAOA 5K3DA 4WJLA 2PNJA 3ROPA 1UADA 4HADA 1QCCA 1Y81A 2V3WA 1AZLA 3CU5A 1ELOA 2CVPA 3HCAA 1DX9A 3CMMA 6ABPA 5CFLA 2OGWA 3WLOA 2O8DA 3G79A 1TJ5A 4AECA 3MUFA 1LRJA 1JSZA 2FG6C 1O95A 2ZS9A 5FYDA 4LYGA 4AN1A 4IF4A 1BX3A 1XRSB 2LGJA 2KMLA 4EG0A 3E61A 1YJQA 3RH0A 5F3RA 5C8YA 3IODA 1XVAA 4BMXA 2EOAA 3V8QA 4TVBA 1YC2A 2CVOA 4KN9S 1ONNA 1IFXA 2NXNA 3PU6A 3UJAA 3ZV7A 3N2GB 3N70A 1ESDA 3CC8A 2X3UA 4C29A 1LKZA 1F5NA 4ME6A 5DO9A 1M2NA 1FP7A 2LUOA 4R81A 1IBSA 1ODJA 3JARA 5TGZA 3UCXA 4G0OA 5LZ4A 3OFSA 4EF5A 1QS0B 2YASA 3U0BA 1VIYA 1NQOA 1PFVA 2QUHA 1SUAA 3AW9A 3QHAA 3TQIA 3UH1A 4TUYB 4BQSA 1ONOA 2QN8A 3Q12A 1S1CA 3DWEX 3HHPA 2FFHA 2OLKA 2WNIA 4KO1S 3T3DA 3UA4A 5JRZA 3TKLA 1OMOA 3BC1A 3CVWA 4RA9B 3CVOA 2O14A 3G8YA 1L7PA 4MWOA 3AZOA 2B83A 3PXCX 1YDHA 2BDEA 2VJCA 3MT0A 4FGUA 4G5FA 1PR1A 3WLQA 4C2TA 5E6RA 4F4IA 2IXDA 1NP6A 3TIIA 4DTCA 4EPXA 4YJKA 5FJIA 1XE3A 5LLSA 1E9FA 5HA5A 4KYTA 4YRMA 4DCMA 2VKTA 4GMGA 4R84A 1H22A 3HXLA 4RY8A 3ZWMA 1K8YB 3QFSA 2Q4RA 4GI3A 5EQTA 1ZC4A 2NQ2C 1XEAA 5IAEA 4LHZA 1O0CA 2ZTSA 1XZPA 2PIDA 4LX0A 4NAUA 4EFDA 3I58A 5EJGA 1CY0A 2B4KA 5ALEA 3KWMA 5KHAA 1D9ZA 4QBIA 1GTRA 1EUDA 4IDFA 3S7ZA 3OQBA 4H7IA 4RVCA 3SKVA 2OG1A 3TR0A 4C7VA 2DUUA 2FW9A 4EM6A 2XQKA 4HTFB 3IV6A 3L4KA 2F8MA 4KRFA 3VYUB 4Q9NA 2JGLA 3SYKA 1M8GA 2X8JA 2VP9A 2OPHA 4ZA2A 4NS4A 1EVZA 3ZH2A 3P19A 4X8MA 3GB9A 4OJTA 1XNRB 4X3OA 3VOBA 3OD5A 3ADCA 3URMA 1PP4A 3WWZA 1N9KA 4TVOA 3I83A 2FFAA 2YZ2A 5CYFA 1YZQA 3T1QA 2XJ4A 1MMFB 4WK6A 4I2NA 4Z0PA 1FUYB 2COUA 3Q3IA 3S2YA 3IR6A 1L4NA 2RAUA 3VZCA 2LTAA 1GRRA 3JWPA 4ZO6A 3QLEA 4F2GA 1W0CA 3GUHA 3RYCA 1GCAA 5FJJA 3O21A 2ZRDA 2HWWA 2O8BA 3ZHOA 2UUPA 4KQ9A 3HABA 4TN1A 3F78A 2CV1A 1OV6A 1QRTA 2EX1A 1J9EA 3NHRA 5ER6A 2MU1A 5IW8A 1Y8RA 3AB7A 2BMFA 2VYVD 3C7DB 1OI3A 1GZHB 3RHFA 1Y7PA 3D8NA 3OZFA 4KQMA 4KTTE 4PTZA 1OD6A 2ORIA 4RHUA 2ZB3A 1J24A 1G3MA 3DFIA 4W5TA 1SGWA 2WR8A 1Q12A 5JMWA 1GKIA 4H27A 3EC2A 2A88A 3OQIB 3OY7A 4BMNA 4DJJA 4DJ5X 4MHOA 4HAOA 1RZRD 4MNTA 3ZCXA 1SZCA 3B5JA 3FHJA 4IOLA 5NLLA 3THRA 4Q01A 4HX2A 4L7VA 5CCXA 3JWIA 2QLMA 2BJWA 2ACKA 3HCOA 2AQKA 3X1YA 2I0FA 1WEHA 3GAAA 3JATB 5HBGA 2C2ZA 3TTWA 3U7EB 1A7AA 5JVDF 3WYDA 5AI0A 2MSEB 1Z2PX 1MA0A 4GUDA 1G3RA 2YRXA 1Z4IA 2ZIEA 4ZYZA 1I2BA 1X15A 1OBVA 5EIBC 1L3CA 2R48A 4Q3OA 1JEJA 1H8HA 1T4MA 4UM8B 4LNUA 2Q4BA 4MO2A 2G63A 1NUAA 5BNWA 1YS6A 3G2IA 1RYHA 1P60A 1TX4B 3A9TA 5E1DA 1TTPB 1QE0A 4PYIA 2PN1A 4C6RA 2RKOA 1TKBA 2ZI9A 1SKYB 2OO7A 4JD5A 1DRUA 1QFMA 3SC2B 4M1MA 3FKJA 2AFVA 1B8OA 1TK2A 2BGRA 2GF0A 2DPGA 4C0XA 3PTLA 2QG4A 3UAZA 1E79D 1VKZA 1TIBA 3TJMA 2I7TA 3WK9A 2JIPA 4QFBA 3ESBA 3KE9A 5TRTA 1F12A 1V39A 1O6CA 3U0VA 1EA7A 1FW8A 4A8JA 1XYGA 2A0UA 2C58A 2IITA 3KYBA 4KXXA 3S28A 5KJCA 3Q87B 1PEAA 3Q5EA 1U3GA 4QG3A 1LVHA 4R98A 4TM8A 4C0LA 4WCDA 1MGPA 1N36B 2FR8C 2PMBA 3I3SR 5J9FA 4CGYA 4DLKA 3DEAA 3MT9A 2W9XA 3R23A 4R0VA 1PJAA 4I1UA 2ENWA 4U7JA 2OCIA 2AK3A 3N2KB 2C7OA 1C0KA 4O8ZA 4OXRA 5L6MB 3EDYA 3VZPA 2NG1A 1XC7A 1EUYA 4PZ0A 3DDZX 1EWVA 2I22A 2VJLA 1MC8A 1TU4A 2ZETA 1G55A 1UEIA 2ZS7A 4W1PA 4MV9A 2PUVA 5DNEA 1UANA 1UZLA 2Z3VA 1NF9A 2YMPA 3PJEA 4TTTS 5C7OO 5E6SA 3QQPA 2ZXUA 2YYYA 2QORA 1TIPA 4TRNA 3D8SA 1AUXA 4Z2YA 4M1EA 4UBKA 3LE8A 2OFWA 1TQDA 5BN1A 1LZKA 1KKLA 3O7MA 4W9MC 2DLCX 2FGKA 3Q4GA 5F1PA 5E7IA 4B2YA 4TTJA 3OCVA 3GDHA 3PC6A 2V6FA 3AM3A 4BLPA 5HK8A 1H94A 4P0TA 1DC5A 3U7RA 4TQUS 4EO7A 3I92A 5AK6A 3LM8A 3G89A 2WU1A 5FNVF 4B1FA 2XZTA 5KTNA 3OE7D 2XMPA 2KI5A 3L8FA 3A1WA 2W22A 2P9JA 4JLVA 1QB8A 3EQ2A 2GZHA 3HCRA 3IO3A 3G6KA 4X41A 5TQVA 5B7QA 2PKQP 4LFBB 1KYZA 4X66B 3NDBB 2O8NA 1B8PA 4DOMA 4UBIA 5DI3B 1DG1G 4B34A 1O6ZA 4EGAA 4CTKA 5HEKA 5J4YA 1W4BA 2NO9A 2BL4A 1E8NA 4DY6A 3KL2A 4ZZ1A 1PV4A 5HJ7A 3ZHYA 2O59A 1VXRA 3CIFA 5AI5A 3H17A 2R11A 1O03A 1QIFA 1LFDB 5EXSA 1UUFA 3DVRX 5KS2A 1VYHA 3D8RA 1ODLA 1FX0A 5AH0A 4QPDA 1B0AA 5JC8A 5GVSA 2XI4A 1YAJA 2RGYA 1EX7A 3CSSA 3KJHA 4L07A 4BFWA 4RF4A 1P2DA 2YHSA 3B51X 3WMEA 3BD8A 4MLPA 4KHPB 1I1OA 2FPIA 2WK1A 1D2CA 1FDVA 1XF9A 1HDOA 2GA9A 1HEUA 1V3TA 2J07A 1NQAO 2RHHA 3NNDA 4GI7A 1NBOA 1M1XB 1ICIA 3F4KA 3N8IA 1IZ8A 1ES9A 1F48A 1ULSA 4JBHA 5HCNA 1YR8A 2Q3LA 2R8YA 1C30B 2MMCA 1G2OA 3AIKA 1KFJB 3P71T 5KQSA 1HTBA 5C0OE 3AY6A 3GMIA 3LG2A 4WDRA 5LQCA 2I80A 4ZZ3A 4UNSA 5J2UB 1LDMA 4I3HA 3UB4A 2PQ6A 2B2XA 2EYQA 2PSDA 4ARIA 1F8YA 4LDAA 4OI2A 1XMIA 2QTFA 4MK4A 3OIWA 5F1YA 4ACAA 1W88A 1YR1A 1XZHA 1QHFA 3Q40A 7REQB 2YXEA 1YVPA 4Y6OA 3NZEA 4MQBA 3ZHRA 1HKHA 2D00A 5T3UA 4N5MA 5K8JB 2RI1A 5AJYA 2OM2A 1THMA 5HTKA 5AP9A 3GMTA 3DB1A 5FWXB 5CK5A 5CPBA 2XNKA 3OZDA 1AKTA 3LWDA 4Q9LA 2A1UA 1H2WA 2OK8A 4JA2A 1M5TA 4XX0B 5REQA 4Z1MD 1A0OA 2G82A 1CU1A 2HMAA 1KJIA 1V4VA 2HQ1A 3C3YA 5KU7A 2G76A 3UIEA 3VBEA 2IE0A 2XRFA 1WHTB 1MOPA 2DHCA 2SHKA 3O84A 4V0QA 1T0BA 2O4CA 3B7GA 3CBQA 4MQ4A 3COJA 1C7RA 2WG0A 4CMGA 4WL0A 2M1XA 4HV4A 2QLTA 3REGA 4CIAA 4DWJA 3JSXA 1IONA 4IIYA 1S3GA 2XWBF 5DSXA 1ECJA 5KWSA 2MWMA 1GXSA 4F5ZA 5H68A 2POCA 3VSBA 1GCOA 4QQRA 4DAOA 2CK3A 1IZYA 1N5IA 2GESA 3IQIX 4YR9A 3WJAA 3WWPA 4B6JA 4RIEA 2DXIA 1SELA 1LSJA 3ZLVA 4KDCA 1UBUS 2O1SA 3LQ1A 3G2MA 4CLOB 1Z0AA 1EP3B 2O3JA 3CE6A 3RWBA 4JP1A 5KYKA 1KZ4A 3DBIA 4L0DA 1I6LA 4U9IS 4MQ5A 1SB9A 1CFJA 2PLFA 3E15A 1C4XA 2ZJOA 4BVJA 4YCDA 3GFTA 3PUZA 3FJ1A 5BMVB 2W6IA 1I7QB 2OHGA 4QJBA 3CZ9A 3SEZA 4XGQA 1A2QA 2QZZA 4QOSA 3EIUA 3GHHA 4DN6A 1KQNA 3RTAA 4GX2A 5JR3A 4ML3A 2NPFA 3H2GA 4PS1A 2EW8A 4O02B 4QBFA 1V37A 1POXA 4L2IA 1UC8A 3NAQA 4DC0A 3DP7A 3EIWA 2COKA 2HH9A 1GDTA 1U0OC 1XVVA 3FETA 3GFVA 4K9NA 2ZUCA 4ZJYA 3GLGE 1PFWA 3T9AA 3K0AB 2H65A 2YVLA 1ZD1A 2NZ2A 4JJIA 4BTLA 5BNZA 2B9VA 3GNSA 1I14A 5HG0A 3JTEA 4M7RA 1TZKA 3REQB 3RS0A 4A2WA 3TAXA 4D25A 2R6FA 3LXUX 5JQGA 3LZCA 3C0KA 1K8ZB 4E5PA 1GGFA 4XI9A 2J5KA 8LDHA 3NC4A 5EKTA 5K8LA 5CA0B 1NNEA 3OETA 3EMDA 5KYXA 1BS9A 2YH2A 5FCDA 2GS9A 1PTJA 1NNUA 4LRSB 4U7TB 5H9VA 4G5XA 4JFAA 3RTCA 3B8HA 4JENA 3VNQA 3NIDB 3T0IA 4EG8A 2QSZA 2F8LA 3M6MD 6REQB 3VGPA 3VTZA 5K3FA 5I7VA 5J23A 2Q9AA 4YX9A 4EJ2A 1AA6A 1P2UA 5EINA 1YIAA 1WSWA 4HFNA 5FL7D 4KK4A 1OROA 3VR5A 5TGTA 4YMLA 3PR1A 2WWYA 1EFRD 1COWA 1PGNA 2D2IA 2AFHE 1CS4C 2P2NA 4Y1FA 3ZHVA 3EMBA 1AXRA 1BVYF 3HB0A 3M83A 4NULA 5CVJA 5JZBA 2O23A 4EG4A 1R15A 1RSZA 1IVYA 1U8FO 1XDWA 1YB5A 4HNQA 2AFIB 2WJGA 5TVGA 4ER7A 4NS1A 3QWAA 4OIFA 4DCTA 3RRYA 4BO1A 4L7QA 4BO7A 3FPFA 4Z4HA 2QQ0A 1K68A 13PKA 4QOJA 3MF4A 4RTQA 3SLGA 2PUAA 3OQJA 2NTEA 1I32A 3JQ8A 4ZVNA 4KW7A 4N18A 2F4VB 3LTEA 3R7DA 3W79A 3EZYA 1THZA 2QKYA 3HFJA 1W5TA 5JDCA 5D1NA 1NDHA 4TKUA 1U7WA 5MN4A 4UMFA 2V65A 1WW2A 5KNBA 3F3KA 2XUJA 5B3KA 2O06A 4O4LB 4M98A 4BWVA 1V45E 5B1DA 1OBFO 2XAAA 3GQVA 2DH5A 1EUCB 5BUSA 5CUQA 3WKBA 1S5PA 3LQKA 3IKTA 2QG9A 4TLMB 2ZQ5A 2WV7A 2CL7X 5DCUA 4ZXFA 3W9SA 4EHNA 2A5JA 5FQNA 1Y6GA 2CVHA 4X90A 5ALQA 1YB2A 3LV8A 3TQRA 3NVKI 4ZV9A 2HPAA 2A5LA 2PG3A 3TZ6A 9MHTA 2AL7A 4RHEA 1RJDA 4L0QA 2IYEA 3HB1A 2X22A 3L6RA 4B43A 5SYMA 4K9DA 1MC5A 1QWOA 5FTKA 1RJWA 4ZI7B 3DGFC 3IUEA 1PRYA 2P4QA 2JFHA 4U2FA 1BWSA 1MT0A 2BMAA 3F9CA 3BEOA 2PUDA 4QDOA 1UMCB 1M2VA 2JASA 3NQ41 5AHXA 1EX6A 1IZZA 6CHYA 2QG6A 1D2AA 1KOLA 5ALMA 4KO8A 2XLBA 4ZU6X 5L3QB 2A30A 1XWFA 2A57A 4HQOA 2GN9A 3RTDA 5CDTA 4YCCA 1FB5A 4OHBA 2JI6A 1AF4A 5KJ6A 3J81A 3ZDQA 2CHUA 2NO1A 1V7QA 4FLFA 4MR8B 3S4YA 3F4BA 4N7BA 4DR1B 5DXJA 3BIFA 2RC6A 4LF6B 1G5IA 3EEQA 3ZBTA 2GFIA 5D86A 2GF9A 4QSHA 1WDMA 3F3MA 3ZUGA 5JDIA 1ODSA 4MVJM 4Q4CA 3H9BA 1UJMA 4KBYA 1T10A 3FPHA 3UWSA 1IC6A 4R4JA 5BT8A 4JUDX 3Q3EA 1A5AB 2FPWA 3HJTA 4FILA 3AM1A 3IO5A 4IDGA 1XMSA 1K92A 1CTQA 4KXVA 2CYAA 1CNEA 2OOSA 4F6RA 3CINA 4YV0A 2VHCA 4ANFA 4L8VA 3AGPA 4XFKA 1OJ7A 4MLCA 4PCVA 2J0QA 4YRSA 4QPCA 1LLDA 2HA6A 4CKEA 3X1ZA 3I2IA 1SCAA 1JRLA 1ORWA 2N3ZA 4W8HA 3PHLA 3I0ZA 1XZNA 4I19A 1KRWA 4EH1A 5LP6C 1ZJ6A 4PYMA 5CBKA 4PE5B 4E46A 1J2RA 5CT6A 2HU2A 3HYRA 2ECOA 2FZLA 3AFGA 4NRDA 4LNAA 5T4HA 2HAEA 2PHZA 4Y6SA 2QBYB 2J45A 1OPXA 3RIGA 2AZ4A 1NXTA 4LAFA 1EJ6A 3NBQA 2Q2WA 1F2VA 1NMSA 4PHTA 6AT1A 2BUBA 3BAZA 1FFAA 1USIA 4X1OA 4ZT4A 4EPVA 1MN6A 1C3EA 2QA5A 2W6JA 5CLJA 1ANKA 1UP4A 2W8BA 3WL6A 1NUHA 4PS0A 3VV3A 4ZFNA 5IVKA 1NF3A 1KQGA 1BDHA 1RCTE 2H3HA 2XMZA 3CE9A 2WP0A 2J6BA 3HBFA 4LOLA 4X45A 1IOZA 1T3HA 2I2BA 5FUVA 5B1IA 1QF9A 4GPD1 5IVIA 3LC0A 3NDJA 1N4AA 5FTLA 1U63A 4QUEA 1R4NB 2WTMA 1HPLA 4D3FA 3A6DA 2PX8A 1YDFA 4IEIA 4MQ6A 1E3QA 1OTXA 1YTLA 2DVMA 3ESRA 3EOZA 4YXWD 3U4QA 3AWDA 2RE8A 1L7XA 1CQXA 2VK1A 4PPQA 1EXVA 2H57A 2O6HA 4I66A 1DCKA 6Q21A 3U40A 5ICFA 2CXRA 2H16A 3HP7A 1BHO1 4C2UA 1AK1A 2PU7A 1XMPA 1P39A 3HDHA 3LIIA 3WKEA 2L0XA 5DYNA 1GFSA 1ZMBA 1PZFA 3CCCA 3GLIA 3A7EA 4Q7JB 2Q5EA 3KXLA 3OPQA 5CM8B 1PFUA 3E53A 2XPCA 3ELUA 4ZJUA 5A0VA 4ISCA 1D8TA 1PWXA 1P75A 1L5HB 4MARA 1QQ7A 1C2TA 1CR4A 1A5BB 1ZNXA 2I6SA 3NEPX 3FSGA 3FTNA 2AJLI 4P7FA 3T7JA 4N6OA