3IBTA

Structure of 1h-3-hydroxy-4-oxoquinoline 2,4-dioxygenase (qdo)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
263
structure length
263
Chain Sequence
MQSLNVNGTLMTYSESGDPHAPTLFLLSGWCQDHRLFKNLAPLLARDFHVICPDWRGHDAKQTDSGDFDSQTLAQDLLAFIDAKGIRDFQMVSTSHGCWVNIDVCEQLGAARLPKTIIIDWLLQPHPGFWQQLAEGQHPTEYVAGRQSFFDEWAETTDNADVLNHLRNEMPWFHGEMWQRACREIEANYRTWGSPLDRMDSLPQKPEICHIYSQPLSQDYRQLQLEFAAGHSWFHPRHIPGRTHFPSLENPVAVAQAIREFLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase
publication title Structural basis for cofactor-independent dioxygenation of N-heteroaromatic compounds at the alpha/beta-hydrolase fold.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 80
structure length 263
sequence length 263
ec nomenclature ec 1.13.11.47: 3-hydroxy-4-oxoquinoline 2,4-dioxygenase.
pdb deposition date 2009-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.210.20 Mainly Alpha Orthogonal Bundle Uteroglobin Uteroglobin 3ibtA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ibtA01
1JFRA 4UFNA 4I4CA 1VE7A 1MNAA 3OPMA 3C6YA 4WFJA 1K4YA 1QGED 2YXPX 3MUNA 1TK3A 3DOIA 4Y2VA 5T4BA 2O7RA 4AX4A 1PJAA 4FDMA 2H7CA 2BUAA 1QTIA 1H2ZA 4KE8A 2AJDA 2VT6A 5LKRA 3L1HA 1GQRA 3H1AA 5BOVA 5K3AA 2GZRA 1QIFA 3B12A 3BXPA 4RPCA 2HFJA 2PSFA 3V9AA 3RLIA 2ZJFA 1HDEA 5CT8A 1VA4A 1H2XA 2PUJA 5FPPA 5KWJA 4ZI5A 2ACEA 1WB6A 2VJDA 2VEOA 3ILSA 2XUPA 2B9VA 4G8DA 4BE4A 2JBWA 5AHXA 3FVRA 3R3XA 1AUOA 1QIGA 3W06A 4HTAA 1E8NA 1P0PA 1K8QA 1ACJA 1K63A 3IURA 4DTCA 4ZV9A 4RE6A 3RKSA 1AKNA 1HQDA 2CZQA 4FLEA 4ARBA 1TQHA 3ZLUA 4OYYA 2G63A 5E4TA 3JYHA 4CI9A 3OM8A 1DWPA 2WU4A 4G5XA 5FV4A 3IVMA 4AZ0A 5AI9A 4MYDA 2RI6A 2Z3WA 1HPLA 4QWWA 3FSGD 4Y2JA 2WM2A 4B81A 1GXSA 3R3VA 3H2GA 3WA6A 3LCRA 2J3DA 4CCWA 4MJ3A 2PSEA 4G1FA 3WYNA 5CURA 5DLPA 4H7FA 4WY8A 4Y9SA 3H17A 5E4YA 3WK4A 3K6KA 4Q3LA 4G4GA 1U4NA 3A2LA 1CQWA 4NMWA 2OCKA 2Z3ZA 2VA9A 2OCIA 4FOLA 2XDWA 4MEAA 3VVLA 5AJHA 3FYUB 1TCAA 3A2MA 2G5TA 1LLFA 5CT6A 5ALGA 4BVJA 3IULA 2J4CA 4X7BA 2XUOA 1EXWA 2PPLA 2O2GA 4CCYB 2XUGA 4ITVA 4CFSA 5T4FA 2UZ0A 1XRLA 3DYVA 2QJRA 2I3DA 1YSCA 5E2IA 4G9EA 3AZPA 1W1IA 4X71A 2WLSA 2BCEA 3PUHA 3HC7A 5ALQA 1N5MA 2PSHA 1MTZA 3OC0A 1UT6A 3FCYA 1CUCA 3O9VA 3WKBA 1JJFA 3BWXA 2WFZA 1DQZA 5DYTA 5CBKA 4FTWA 1UXOA 3WIOA 2XUHA 1R9MA 5ALMA 3NWOA 2OXEA 3OG9A 2WHRA 1W76A 3FLBA 5JATA 1NU6A 3QBJA 4H7KA 1DQYA 5HQ3A 1LPOA 5FXMA 4ZWNA 1AMNA 4K2AA 4KAJA 3QYJA 5JAPA 2QXUA 3QMWA 3QH4A 3MVEA 3G0GA 2GYWA 1CR6A 3WYDA 2HRRA 2C7BA 3HJUA 4UUQA 1YCDA 2XMBA 3WJ1A 4MXDA 5CH3A 3ZLTA 1WHTA 3HYSA 2J3QA 4AQDA 3KSRA 4OSEA 4X95A 1X2BA 5AKIA 1S8OA 5AKZA 2ZVDA 4JNCA 1CLEA 1DWQA 1QFSA 1E3QA 2JGEA 2Y6VA 3RARA 3AINA 4LHEA 4X00A 1ETHA 1USWA 3K2IA 1EA5A 2JEYA 1QTRA 2VJAA 1CUDA 4Y2XA 3SWWA 1XRPA 4QWMA 5DTIA 1YB7A 2WFLA 5DJ5A 5EHQA 3OURA 3VJLA 3TGLA 3HXKA 3KXPA 3WKCA 5AKLA 5A62A 3W04A 1MO2A 1CUVA 2IIVA 1KEZA 1UOOA 1JMKC 3IIIA 1YASA 2Z8ZA 2ORYA 3M3DA 5ALYA 2DHEA 1W6RA 1BROA 4GEGA 2EDCA 5HF6A 4C4XA 2C58A 3IBTA 2WIFA 1MX9A 2HL6A 4AMZA 3VDXA 5ALTA 4LKOA 4KEAA 4JYMA 2C0PA 1U2EA 1C7IA 3FVTA 3IUJA 5ESRA 5CMLA 4DMCA 1ZIXA 2B4KA 1UOQA 3ESAA 4XJVA 3QPDA 5AKJA 3WWOA 4C4ZA 4A23A 3HACA 4FBMA 4HXEB 1UK6A 1LPSA 5FP0A 2XQJA 3KOOA 4N8DA 2BUCA 2ZYIA 3STYA 3G02A 3YASA 2WQZA 2PU5A 5IVIA 4QNNA 1WOMA 5AOBA 4QDOA 1DT3A 2R8BA 1EINA 1XZDA 1Q0RA 4BBZA 3M83A 2ACKA 4X91A 4A16A 3WWDA 3EF3A 5JZBA 5ALNA 1U8EA 2HA6A 4B84A 3DQZA 4PV7A 4K6HA 4IH9A 5CXXA 3ANSA 4PW0A 1E89A 4MWTA 5HFNA 5JIBA 2WG2A 2WG1A 2XE4A 4FLMA 3W2TA 1F6WA 5JYCA 2NW6A 5IH7A 1EHYA 4LIPD 3KD2A 1AC5A 3TJMA 1KU6A 3C5WP 3G9ZA 3F8SA 2CJPA 3STXA 1FFDA 1T4MA 2DCMA 2HA2A 3FBWA 2V98A 1A7UA 3BJMA 3I6MA 2IX9A 3K9BA 3WL6A 3WL8A 1L7AA 1GPKA 1XQVA 1SCKA 1X70A 4H7JA 1EB8A 3C8DA 4U2GA 1IUOA 5EHXA 3C45A 2AJLI 3WWPA 4S0XA 2C5GA 2GBFA 4JYPA 4CG3A 1LBSA 5HF8A 2OLEA 3WQHA 2HHAA 4B9AA 1G42A 3DNMA 1OILA 2OQIA 2Y2VA 3I6YA 2V96A 3D2CA 4PSDA 2JIDA 1CUIA 2WSLA 3DLTA 2PVSA 5DYYA 1CUFA 4B6GA 2I3ZA 2XMZA 4J0GA 5E4JA 1VJ5A 5AKXA 5LZ4A 1DWOA 4QDXA 1W75A 1BCSA 1FFAA 4F0JA 1LGYA 1GKLA 4A5SA 4P92A 4HZGA 2VAVA 4YPVA 5ALUA 5JARA 1BU8A 2QKYA 5EGNA 5H3HA 1BE0A 2PKYX 2XUKA 2XUIA 5K3EA 3C6XA 2DSNA 5CT4A 1ZGCA 3FCXA 1Q83A 2Y1KA 4B0OA 5D6OA 2WFMA 1GPNA 4JEIA 1I6WA 3BF8A 1VXOA 3DL7A 3PF9A 4UHFA 2XMQA 5AIAA 3DYIA 1YAJA 4UHHA 2BFNA 3AZOA 2W6CX 2O2HA 4B0PA 5HFAA 4YX9A 3HZOA 2O7VA 1ZOIA 5DTJA 4E46A 1EB9A 2BAGA 3O95A 1JJIA 2AJCA 2GYVA 3KWFA 5CRIA 5AM5A 5AI5A 4AZ3A 3AIKA 1CUAA 2B20A 4DM7A 4QDTA 4J7AA 1IZ7A 2WU3A 2OG1A 2H7YA 3H1BA 5EIAA 1UKBA 1JT2A 2C5FA 4KAAA 2VATA 2QM0A 4EY8A 5HQ3B 4OU4A 4PO3X 2QOEA 1L7QA 1ZD3A 4WDRA 3R3WA 4H77A 3VJMA 1XQWA 1ORVA 4BVLA 3HLKA 3BIXA 5ALZA 4N5IX 2XMSA 3M82A 1UFOA 3DKKA 3IUQA 5I9IA 4HAIA 3WWCA 1XKLA 4B85A 3I1IA 4Y2UA 1E66A 3I2JA 5AK4A 4LYDA 2HRQA 5AM2A 2ZJ6A 2GZSA 4H7EA 2HDWA 3LIPA 1XZJA 3L1IA 3DL4A 4J0HA 4QEKA 1VZ3A 4DMHA 3BIWA 2GBCA 2WIDA 2OCGA 1Y37A 3T52A 2Y6UA 1O6GA 2XI4A 5JZSA 1XZAA 1GQSA 1FFEA 4AXBA 4AB1A 3EQ9A 3FNBA 5KBYA 3U0VA 4V2IA 4FLFA 2WFLB 4Y7DA 4G8CA 1C4XA 1LBTA 4EY6A 3C43A 4UHDA 3X3HA 1Q0ZA 1ODSA 4U2BA 2DFPA 2PL5A 4AO7A 2AXEA 1WB4A 2D0DA 3V1LA 3V1MA 5JD5A 1GT6A 3MUOA 2Z5GA 4W9RA 1MPXA 4QA9A 1DT5A 2PSJA 5DNVA 5HK8A 2YASA 4EHBA 5D3KA 3QITA 2B61A 5ALDA 5LIPA 4X6UA 3IUNA 3ZWQA 5C7YA 2OQVA 2W22A 4K6GA 3GBSA 3DCNA 1ODCA 1BEZA 3WK7A 3EIOA 5IKXA 1ZIYA 5BWBA 5FOQA 3ANTA 2YYSA 3HABA 5BV7A 1F8UA 4L72A 3E0XA 5ALRA 5LYYA 5BWCA 3NUZA 5AH0A 5HKBA 3TEJA 3ZLVA 5AM0A 1XZGA 5CH5A 5ALLA 3GUUA 1HLGA 1LPBB 1VLQA 4WFIA 4OD0A 5ISMA 4GWLA 1XZEA 2WIGA 3A6ZA 4DSAA 4Y2SA 2QRUA 5C8XA 2EDAA 5JAOA 3I2GA 3LLCA 3G7NA 2RGUA 1XRQA 5ALEA 3B3QA 4M0MA 5DYWA 1JU3A 4Q82A 2CMFA 1YS1X 1DTEA 4HS9A 4OUKX 1IZ8A 5I8PA 3UUEA 4CG1A 3AIMA 5JALA 1QO9A 4BB0A 4J0IA 1W52X 4DGQA 3NOXA 4I3FA 1N8SA 1K6EA 4DNFA 3P2MA 3GROA 3AUKA 4PSUA 3VXKA 1FFCA 1TIBA 4BRSA 3DD5A 1LPPA 7YASA 4X85A 4HVTA 3W05A 4G4JA 1LPAB 4BDTA 2WUFA 5D7BA 2HA4A 1THGA 1QJ4A 2WHPA 4H7HA 5LZ2A 4U2DA 2JGFA 4MQLA 1CVLA 5AKEA 2CB9A 3IDAA 4WFKA 1DX4A 1MT3A 2DQZA 5LLSA 5SYNA 1EK1A 3H04A 5AKKA 1CUSA 2ZJ7A 1EH5A 3EQ7A 4FFWA 4H7DA 5J3JA 2QJWA 4MWSA 4HXFB 3MGAA 5AI8A 1F0NA 4BDSA 2OGSA 2OAEA 1MU0A 1XLVA 2XMRA 2RIPA 4BCBA 1BRTA 2GBGA 1XQYA 2XQIA 3ICVA 1MNQA 1XLWA 5IVDA 4W1PA 2V9ZA 1H22A 1LNSA 4RE5A 1ZI8A 5LZ8A 4Q3KA 5ALOA 5IVHA 2HM7A 3C5VA 1AURA 3FAKA 4LXIA 1BN6A 4Z49A 2WJ6A 5K3FA 2XMDA 4OCZA 2I78A 3FLEA 2JGJA 1QIEA 4WDQA 1TCBA 1E5TA 2RAUA 3FYTA 4WY5A 4BVKA 5A7FA 3O4IA 3PI6A 5CT9A 3DDUA 1XRMA 1YR2A 2EEPA 3CXUA 3ESCA 1UK7A 2X5XA 3JW8A 3STWA 4BTLA 1GKKA 2HADA 3STTA 1HKHA 4NS4A 3I2HA 5DNWA 5F4ZA 3LS2A 1GPLA 3WL7A 3I2FA 1Z68A 1EI9A 3M81A 5CW2A 4MEBA 2WJ4A 5AP9A 4H18A 1ZI9A 2WHQA 4YASA 4WJLA 4NZZA 2HIHA 4C4YA 4W1QA 4NVRA 3WZMA 4EY4A 4BZWA 3H0CA 4B7ZA 1FSSA 2BGRA 1AQLA 5LZ9A 2XB6A 2QT9A 4IH4A 4GECA 3W9BA 3G0DA 3OOSA 2ZYSA 5CH8A 1VXRA 1CEXA 4GLBA 4TVKA 2XQKA 1JJBA 5AOCA 5ALVA 2XUAA 1CUBA 4P08A 1IUPA 3HI4A 1ZD5A 4H0CA 1R9NA 1E8MA 3WIBA 3F96A 1GZ7A 2D5LA 4QDUA 3KWJA 4P9NA 4GDMA 3WK5A 4G9GA 4FKBA 4AO8A 3O4JA 4INZA 1QO7A 2HFKA 4X6YA 1HBJA 1VE6A 4QZVA 2I03A 1SC9A 2WILA 2QR5A 4U2FA 2VF2A 4UHBA 4DNQA 5EHZA 3PF8A 3BF7A 4UBNA 4EUSA 3D2BA 3D59A 2FJPA 1H2WA 4QLAA 1WPXA 3PICA 1BCRA 1IMJA 2JEZA 3D5EA 5AK3A 1LZLA 4AN0A 2WG0A 1QONA 4Q3OA 1L7RA 3AFIA 4OB7A 3GZJA 5C81A 4TPKA 3ZPXA 2XLBA 3RM3A 1AGYA 5JAUA 1DU4A 4G4IA 5JD4A 4QE3A 1ISPA 5CTAA 1P0QA 4BATA 4EZIA 2QUBA 4J0JA 3WL5A 4ZV7A 5IVKA 4PSCA 4DLNA 1ZGBA 4B83A 1QIIA 2CEKA 5EHNA 1DX6A 4LXHA 4N8SA 3V1NA 3C8HA 5FKJA 4P93A 1EK2A 3IUMA 1YA4A 4BP9A 1VZ2A 2OAGA 2PBLA 4X6XA 1R88A 1YB6A 5I7UA 3DOHA 1W4LA 1G5FA 5AOAA 4F21A 1K5PA 3D4LA 2HU8A 3A70A 4HRYA 4Y2YA 4M0EA 4X3CA 5A6VA 3QVMA 2CBGA 5K3BA 3IB3A 3GELA 1MAAA 4C87A 1ZD2P 3HEAA 2ROQA 4KAFA 4DMFA 3GA7A 1ZI6A 3R40A 5K5EA 2ECFA 1LZKA 4BAGA 5EIHA 3PFBA 3IA2A 2XLCA 4CG2A 5AM3A 2H7XA 3G0BA 2O2IA 5AKYA 2VSQA 5ALJA 4ZRDA 3STVA 5AM1A 5AK6A 5DWDA 1UWCA 3I1YA 2XMCA 1AZWA 2RHWA 2OPHA 5AIBA 1CUEA 5AKHA 1AX9A 3ESBA 4BZZA 1YAHA 3ZI7A 4DNPA 3N2ZB 4UBKA 4ETWA 4BCCA 1XZCA 3HRHA 4XVCA 5ALIA 1N1MA 3O4GA 5LZ5A 3WK8A 1Y7IA 3WKAA 4BYMA 5FUMA 5ALXA 1CPYA 1WPRA 3AIOA 1R50A 4N5HX 4BCDA 2Y2UA 1JKMA 5C8ZA 1IUNA 4EB0A 3F67A 4C88A 2WHPB 3QPAA 2WUEA 4Q05A 4UFOA 1WM1A 2WTMA 2X76A 4XWGA 3CCBA 1R4ZA 3L1JA 1PFQA 2DHDA 4KACA 3H19A 4IQ4A 4U2EA 3QMMA 1WHSA 3H2JA 3GFFA 4Q34A 4K6KA 4AMYA 1XZLA 1DINA 3QM1A 4BAZA 1ORWA 2PX6A 1RP1A 5FLKA 4BP8A 3H2KA 2K2QB 3Q0TA 1P0IA 4HRXA 2WUDA 2JGMA 3E4DA 2ZSHA 4GI1A 4W63A 1EVEA 1CUJA 4Y2TA 4JUIA 2PSDA 1H2YA 1E8DA 1P0MA 2DQYA 2WIJA 4GHWA 5LZ7A 2FX5A 4F60A 5AK5A 1U65A 5HF5A 3E1GA 3S2ZA 4FFVA 5LKAA 3H2IA 4GBGA 3PE6A 1CUWA 2XMGA 4GXNA 1R1DA 3C6ZA 5K3FB 3ZV7A 4E14A 3VISA 1EX9A 3S8YA 1O6FA 1TRHA 4W1SA 4KE6A 4UBIA 3JWEA 2HA7A 2HA3A 3WK9A 5JAHA 1THTA 1JU4A 2QVBA 4O08A 3WZLA 4KR0A 3ED1A 1QIKA 1QZ3A 1EVQA 2FUKA 1EDBA 2JF0A 1UKCA 1UOPA 2VJCA 4FWBA 5HF9A 4ROTA 2OCLA 1FFBA 4X92A 2PU7A 2BKLA 3EQ8A 1J2EA 4N8EA 1EDDA 1CFJA 4RGYA 1TKRA 4L3WA 4JH0A 2GYUA 3OTQA 2PM8A 4QDZA 4G8BA 4DMKA 5JADA 5AM4A 1QIHA 1EDEA 3D2AA 3NGMA 3PDCA 1ZD4A 1ZICA 3G8YA 4PNZA 2ES4A 4KRYA 4OB6A 1PV1A 4B9EA 2G5PA 3VKFA 4TGLA 5AO9A 1GGVA 3QMVA 2QZPA 3C87A 1ZJ5A 5ALKA 5ALPA 1JMYA 3A2NA 1BS9A 2AJBA 1XZIA 4HXGA 3PFCA 1QLWA 3D0KA 4YK7A 4IO0A 3T4UA 4J3JA 2BJHA 3D3NA 3G0IA 3BDVA 3R3ZA 2Z8XA 3FSGA 2WKWA 1H23A 4FNMA 2C4HA 4BRZA 1XQXA 1NU8A 5ALSA 3G9TA 5FRDA 2V97A 4C6HA 2IITA 2VAXA 1VKHA 4X90A 5HKAA 1UK8A 1Q84A 5D3ZA 5JASA 1D07A 3BDIA 1QFMA 4UBLA 3V1KA 3BE8A 1MX5A 4FNGA 1MAHA 1SCQA 3LIIA 4OU5A 1XZKA 5AI0A 3WA7A 4KYVA 5AI4A 1KU0A 4X97A 4BC1A 2QUAA 2R11A 1HL7A 3CN9A 3F98A 2CUTA 1G66A 4AN1A 3UUFA 4Y2QA 3AILA 3I28A 2JGKA 1VOTA 1WB5A 4UHCA 5A2GA 5YASA 1G4HA 4E15A 5ALFA 1SOMA 3F9CA 3BL8A 5JZ9A 1CQZA 1CIJA 4AO6A 2XUFA 1XZMA 2YH2A 4UFPA 3Q8WA 4LXGA 1BEEA 3E3AA 4EBBA 2QMQA 1T2NA 3N0TA 1XRNA 3SC2A 3UMJA 4IH1A 4DIUA 4EY5A 4B80A 4M0FA 1UKAA 2RONA 3CN7A 4KE9A 4X94A 3SK0A 3B5EA 4OPMA 1BN7A 4BC0A 4ARAA 2JGIA 1TAHA 5KWIA 4UBOA 1MN6A 2HU7A 3I6ZA 5LP1A 3FLAA 5ALWA 2WIKA 1C7JA 4X93A 1LPNA 2XT0A 5C8VA 3G0CA 1J07A 4MYSA 4BTVA 5CT5A 3EBLA 4Y2RA 4C89A 1ODTC 1QIDA 4LYEA 4F5ZA 3AZQA 2HU5A 2QTBA 5AKGA 2E3JA 3WLAA 1QIMA 2CKMA 2HA0A 3G9UA 2JGLA 1Y7HA 4BE9A 4KJXA 5FPQA 3DJYA 3I2KA 1XLUA 3VJKA 3DEAA 1OXMA 2FJ0A 1ACLA 5AI6A 1J1IA 3WK6A 3HSSA 3QZUA 1RYYA 4XX1A 3WI7A 1WCYA 3C6BA 4MQMA 2BUBA 3FYUA 1YA8A 4CIBA 2VT7A 4PQEA 4UBMA 3F97A 3LP5A 1XKTA 4K5QA 5AICA 5JANA 2DR0A 1TCCA 2PUHA 1RWQA 3WWEA 1N5RA 2DHCA 5EFZA 4CCYA 1SFRA 2WUGA 1YS2X 2WTNA 2ONCA 3TRDA 4DNOA 1X2EA 2ZYHA 3DS8A 5K3CA 3WJ2A 6YASA 4H7IA 1XRRA 1NX9A 5EIEA 1IVYA 2HA5A 3O0DA 3STUA 3R3YA 2XQGA 4GW3A 5A7GA 1FJ2A 4FBLA 2OGTA 2ZYRA 3I2IA 3V48A 4B82A 2VQ6A 3FWHA 1VA5A 1MJ5A 1A8SA 2GBIA 5CXUA 4PF1A 4UHEA 4UPDA 4OB8A 4DYHA 4EA6A 4ZGBA 1QE3A 2OGZA 1A88A 2J4FA 2RHTA 4ZREA 5KREA 3DKRA 3H2HA 3U1TA 1F0PA 5T4HA 3AJAA 4KE7A 1LPMA 4ZXFA 2XQFA 4RNCA 1XZBA 1B6GA 3R0VA 2QXTA 2H1IA 3RK4A 2XUQA 4Y2PA 1QOZA 1CUZA 4QLOA 5T4EA 4E11A 3SX4A 2H9YA 3ICWA 1A8QA 4FMPA 2XUDA 4J0DA 1B41A 1XROA 1XZHA 3O9MA 4XIIA 3W9UA 1CUHA 4Q1VA 4W1RA 1QIJA 2P8SA 5FDFA 2Q0XA 4J0KA 5HK9A 3KDAA 4WCVA 4J0CA 4C01A 5EI5A 2VTVA 2AJ8A 1J06A 1CV2A 2WJ3A 3R3UA 3VVMA 1ZJ4A 1JI3A 1CUYA 5A7HA 4L9AA 1CUXA 3PUIA 3WKDA 3C70A 4J03A 4DSZA 4FHZA 1CRLA 3FYUC 4D9JA 5DNUA 3WMRA 1SCIA 1CUGA 5JD6A 4OYLA 5SYMA 2ZSIA 1OCEA 2G4LA 3ESDA 4U2CA 2VJBA 1UZAA 4L0CA 3D7RA 5HCUA 2X8BA 4I19A 1XFDA 4UBJA 1CUUA 1XZFA 2BGNA 4KRXA 2C0QA 3BJRA 3FOBA 1M33A 2XUJA 5K3DA 1R3DA 4EY7A 5A71A 5HZGA 4CIAA 3QPCA 4BAUA 3O4HA 2LIPA 4H35A 1UK9A 5ALHA 2QS9A 1MX1A 3CCCA 3G9XA 3R41A 3WKEA 3H18A 1A8UA 4IHAA
chains in the Genus database with same CATH superfamily
2C5HA 1EFKA 3PWTA 2B37A 1KAHA 4EX6A 1QE0A 3GYGA 2HJRA 1O6ZA 3AKCA 1UPFA 1HNNA 3LCUA 3NNDA 3LZCA 1ZVKA 2JGDB 1RPTA 3OPMA 1E2LA 3ZV6A 1J5PA 4WFJA 1YRAA 3CLHA 1FPMA 4BNJA 3MGCA 3AR7A 4MDHA 2HLDD 3VI4B 2BD0A 3RYTC 2YWCA 4HN2A 5I9SA 2QRQA 2YXPX 1WZEA 2HPAA 3L8CA 1RKUA 3MUNA 2GAAA 4KPEC 2J9RA 5EJEA 4KGXA 2PUEA 4C7VA 1THZA 2FK7A 4Y2VA 5T4BA 3F9IA 4CV3A 3EMVA 1QLJA 1TC2A 1H3EA 4ZDJA 1E3LA 2P4EA 2ZRAA 3DGEC 5HDQA 5DO9A 4RZ2A 2OSBA 1Q2XA 4NYMR 4R5HA 4TTAA 4YMWA 1H2ZA 2OTCA 2QUZA 3AEZA 1CZNA 4C2UA 4YI5A 5KOHA 4FDVA 4XLZA 4IRXA 1J5XA 3M9WA 3CZ4A 1JR3E 3IUBA 5JFGA 1ATZA 4M0PA 4BVAA 3EGDA 1WKVA 5K3AA 1FVXA 3AUSA 1NJ1A 2ODTX 1K2WA 1QU2A 1Z82A 4KYUA 4QRIA 3UK2A 1RC1A 1UBCA 5JNRA 1P75A 1SZCA 2PMWB 4YIHA 2ZJFA 1ECBA 2J09A 2JH3A 4BTEA 1E4YA 5TDHA 1JFSA 5A6SB 2HWYA 2R8XA 2F43A 5DI3A 4ZI5A 1PX2A 4BRWA 3ZE7A 3K9QO 1UDAA 4H60A 4IQFA 4YJGA 5JPDA 1INLA 1MC1A 4TN5A 5ED4A 3W7BA 1YD7A 4G8DA 5HIIA 2B8TA 4BE4A 1ONBA 5HHTA 3UT5B 2SHKA 3AKYA 4DCOA 3I4FA 2PUGA 4F96A 3ND7A 4ON9A 2OLKA 3PQ3A 5EIBD 3DLHA 3H87A 3UJBA 1U81A 5HZMA 4GX5A 2ONKA 4GPAA 1EZ1A 3EUAA 4D9KA 3W5AA 1RHKA 1IUKA 1F0KA 1X8LA 3QVVA 2XNCA 3VZPA 5C5IA 4S05A 4PG7A 5DEIA 1A0OA 2PGAA 1MUUA 1I32A 3N2NA 2QDKA 5FLEX 2QW8A 3H99A 3SC2B 1VRCA 5LD2C 3B9RA 5K0CA 3W5HA 2EVWX 3S2UA 1P0PA 2G76A 5KSWB 1GZUA 1U8ZA 1V1JA 3I8XA 4KX3A 3AM1A 1BDJA 1K63A 3T1HB 5U4XA 3A9SA 1G18A 2D74A 4GNRA 4M1OA 2YJ3A 4MUAA 5CK4A 1XLTA 1FDVA 2E37A 1PYDA 4EDHA 4DT1A 1AK1A 1CP2A 1IWPB 1U2DA 3PNKA 4Y9RA 5CPBA 1X1AA 3GCZA 3FGOA 3L7YA 2OHFA 3JQQA 4J16C 4KX5A 4XGQA 2MIIA 1HQDA 2IY8A 3FFTA 5ENVA 3CX4A 4W5WA 5K0NA 3RO7A 2CHQA 1U7XA 1ZH0A 1L5YA 1LI4A 1CF9A 1IATA 1SBYA 3EA0A 2BPOA 4RH3A 5FTMA 1TQHA 3ESXA 1H9CA 1YZGA 5AW9A 3K0FB 2Q5IA 3DHWC 4KXLA 1WF3A 4ENQA 2J7KA 4PFQA 2HGZA 4E88A 1WZIA 3UBMA 2VXBA 4KQ2A 5A9RA 2DFNA 2YY5A 4BNUA 2G25A 3GDOA 5EE5B 2VDVE 1NW3A 4CI9A 1DWPA 2GR9A 3CRW1 4LOHA 1EESA 2ICAA 1NT4A 1U1CA 2YHIA 2QG9A 3JQ6A 1C9NA 2QYSA 2E87A 4G5XA 3IVMA 4IIJB 4DSTA 5MGNA 2CMHA 2FPKA 3M4JA 3BOSA 4Q9IA 1MEEA 1NVDA 2DWUA 2XTMA 4MYDA 2RI6A 3RC7A 3CH7A 3QW4B 4WZ6A 1HPLA 4A4DA 4FFDA 2IYXA 3FSGD 4OK5A 1GPJA 3IDSA 2AYYA 1G8JA 2Y0DA 3ZIAD 3UMRA 1YFKA 3R3VA 5NLLA 4F4HA 4ACBA 1RI4A 4CCWA 3ZVNA 4MJ3A 2I6FA 2FPRA 3TKAA 1ZGAA 1LY1A 1WKBA 2H2HA 3JXEA 3O93A 2CL0X 2FYTA 2E4WA 1F8GA 4G1FA 4UUNA 3WYNA 8LDHA 2J0EA 4AX8A 4JLUA 5F21A 1Z4NA 3QXGA 3H7AA 4H7FA 4Y9SA 4YP6A 4BKRA 3U3RA 4Z86A 3ZH2A 4QD3A 3KEOA 3OIDA 4FB4A 3AHCA 5I9LA 3HJAA 4WHMA 5E4YA 3JZDA 3WK4A 3QJ5A 2E1PA 4IKPA 4MQEA 4DC1A 3KKNA 4G4GA 5BQPA 5ETJA 1U4NA 3H13A 5IT4A 3IQHX 4NX2A 1J97A 1G5HA 3HVIA 3NHRA 4I3GA 4MA4A 4E5MA 2WINI 4MRAA 1YJXA 2ZPUA 4C0JA 3OZFA 3B7WA 2P9HA 3UC9A 3X1KA 4WJZA 3R5FA 4MEAA 5AJHA 3VVLA 4CM1A 4ZFNA 1N7JA 3HBLA 1T8PA 1OLUB 2FEPA 2GK4A 4L75A 3FA2A 4Q4AB 4R9RA 5JO9A 1TCAA 3T7CA 5TJ9A 3RVPA 1VCOA 4N76A 4U3JA 3GOHA 3L3BA 4WKBA 1M6HA 1WETA 2DECA 1LW6E 3IULA 4IICA 2WHYA 1Z63A 3NDPA 3UHAA 1XC7A 1Q44A 3FHLA 2YRWA 4Q9JA 4UXIA 1JTFA 1H6DA 1AS3A 4C7BA 1PWYE 4X7BA 4C22A 3J80A 4AIRA 3GAAA 1E3IA 4J9VA 1OW3B 2NTVA 2PKCA 2FWNA 4RJIA 3QKRA 1XEXB 4PLPA 1JIKA 2O2GA 2WV9A 3HXPA 3R5SA 1OTHA 2ON6A 2IYVA 2OORA 3BMQA 3LL7A 3QE4A 5CHEA 4NR0A 4YNBA 3V2HA 1J7KA 1HH4A 3RSZA 3N6XA 2WUWE 1YTLA 4OHMA 4QGFA 1ZVJA 3MT7A 5ELLA 5LU8A 2B69A 4I9UA 4D1YA 5HE8A 5BR4A 1L8OA 2IZ6A 1M5TA 4JQYA 1UTGA 4TS9A 2RSLA 1XRLA 2GM5A 4FJ2A 2QJRA 2JARA 4JC4A 4KIUA 4URWR 3MB5A 2V9CA 2C83A 5EP2A 1ZD9A 5BNIA 4BLRA 4KSBA 3SYRA 1V1RB 3DZHA 3NAQA 5HPYB 3BICA 3PUHA 1J8VA 1Q57A 3WRXC 3GNLA 2F1RA 1VIYA 2ANCA 1YR6A 2N0SA 2OYSA 3OIYA 4CM4A 1N5MA 3FDZA 4PZ0A 5EJIA 2G17A 3I72A 5LYJF 5JDCA 2R5NA 2Q6VA 4K46A 4MR8B 1U9YA 3DLPX 4PFSA 2CUZA 1FNNA 1PTJA 5I7EA 4C0KA 2QPLA 5B5SA 4F2DA 1SKBA 2IXGA 3OC0A 4FP9A 3VSCA 1BE8A 2BMJA 4FOPA 2ZAMA 3ZWYA 2COUA 3CXRA 1JH9A 4QPNA 4HZUA 1RWVA 5I7VA 4RQUA 4GQIA 3O9VA 2APJA 4HTFB 1E9VA 3QUAA 4MQBA 2O05A 4QGGA 5DBIA 2C96A 1DX9A 1DQZA 2WFZA 3ORYA 1N9GB 4G2NA 4FINA 5E8JA 2PAAA 4L4SA 4FTWA 1NTRA 5FI3A 2WKRA 5C4GB 3II6X 3KJGA 2WV7A 2UKDA 3DPSA 3MK31 4MP6A 4E0BA 3BSYA 1T2UA 4YJ2B 4D6YA 2VNSA 1MV5A 1RWNA 1ZLYA 4EL0A 1SXJE 2JAQA 2VPIA 3GRZA 4R0NA 3N8IA 4ZYVA 5LQAA 1QMPA 3NVDA 4Q9DA 3K70D 3RF7A 4ZQBA 3OG9A 1ATIA 2ENUA 4JVSB 4FWTA 2GN6A 2WHRA 3H1EA 1W76A 3FLBA 2XDAA 5EXTA 4KU4A 4XEHA 4ZV4A 3QBJA 1YCGA 1P7VA 4Z6KA 3CO0S 4NEHB 2P0AA 4H7KA 4JJKA 1HDRA 2JCXA 5CFNA 1O54A 4XAQA 4ENUA 4W9NA 4YVFA 2QG4A 5GZ6A 2JFZA 4K2AA 4G1EB 1NW8A 2BEWA 5JH7A 1YVRA 3N0VA 1FYDA 3IHKA 3SM3A 3FCEA 1W1UA 3MG9A 4N54A 3QMWA 5GGXA 2XSZD 1T6ZA 3G0GA 1CR6A 1C1DB 2NNWB 2X0JA 4JB8A 4FIZA 1E3MA 4AUMA 4E1BA 4MRSA 3HA3A 2C7BA 2O7NA 4GGOA 3PTLA 3AVVA 2LGJA 3SBEA 2A6PA 5B2ZA 3AVXA 2VAMA 3U9LA 5L3SB 3GJ6A 3WJ1A 3HCPA 2A9FA 1OIXA 4R1PA 1FX0B 1TK2A 4JXZA 1BRMA 4YAKA 3L79A 3FROA 1EEXB 2QRPA 1OX5A 1ZMTA 1XWIA 2WABA 5JMWA 2W6IA 1SKQA 4KFCA 3CF4A 4RKYA 1RPAA 3HYSA 3HSKA 4AQDA 2CV0A 4EFMA 1EFAA 5D5HA 4BP1A 5J1TB 3V8BA 5LD2B 4C21A 3ADDA 1IJKA 4MGEA 4Q03A 1GTSA 2VUHB 1QRUA 3L7IA 4RJTA 5E2AA 1X2BA 4D4IA 4WGGA 4I66A 3ZZMA 3F73A 4LMAA 4OOEA 4BWFB 2BFFA 1TUGA 4IYJA 5TE9A 3JR7A 1K5HA 1NZJA 1PV2A 3FPLA 5TEVA 3IFSA 4G09A 2WIBA 2X23A 4QIHA 1DWQA 1H8EA 6REQA 1NV8A 1QFSA 1Q74A 2EF0A 4GVLA 5IMBA 3DYBA 1VRVA 1ZQ1A 2ZRJA 2YDYA 3RARA 5AESA 2C84A 3NJ4A 1MGPA 3AINA 5I9TA 4OLAA 3MHTA 3EARA 3FTNA 4X00A 4AP5A 4BFYA 4HH4A 1AHNA 1RQXA 1G21E 2GRJA 1SXIA 1A1SA 3GHYA 4KO4S 3VKVA 2VF5X 2IT1A 2LWIA 5D87A 4A8JC 4BO7A 3ZHYA 3R9XB 2BHNA 3ZVRA 5E3HA 2GI4A 3MAGA 1EZ4A 3KJQA 4YRJA 4LF8B 4D9MA 3PHJA 3NT4A 3H16A 4GP7A 4MYRA 1SUDA 5H70A 3C3CA 3H9QA 1RBMA 2YOGA 4TX1A 5DTIA 4BQOA 1YB7A 2FWIA 5EHQA 4F4JA 1V71A 2IL1A 2VHTA 4X8LA 4MS3A 7REQB 3HXKA 1TZMA 4WAUA 1PT8A 2Q2QA 4WY2A 3WKCA 2SKEA 5CITA 2I7VA 5U4QA 3SS9X 1G9TA 3GEBA 3WBJA 5JOQA 5K03A 1RP7A 1ZJWA 4RTMA 4JXXA 3CIFA 3DVSX 4C14A 3T61A 4KQ9A 1T8RA 1YS9A 3VZRA 3T5TA 3WGOA 4DDWA 1MO2A 1Q95A 1XMPA 2IIVA 3DG9A 4FE3A 4R9VA 3A4TA 4KQHA 5IWCA 1UIMA 1RXCA 1UDBA 3S99A 3UQZA 2FFBA 3N58A 5DX0A 4BFSA 4PAOA 4YT2A 1E7SA 4CUZA 2LE0A 1HNWB 2QEQA 1L5HA 2P11A 3RSHA 3BIOA 4RHYA 5CNJA 3O4FA 4BIIA 1QQ7A 4QXQA 1TAQA 5IDXA 5A0VA 4LPKA 3KHTA 1KDRA 2AN5A 5LWQA 3INTA 3FWZA 4I6EA 4UU1A 4BMPB 3BB3A 1QF7A 3E82A 4O2RA 2V03A 2X1VA 1BJRE 5EJ5A 3LPNA 3EA5A 3KZNA 1EVZA 3N8NA 4DS3A 1RYFA 1BFUA 3I9MA 3KPUA 4BNHA 2M1XA 2GN0A 2QGFA 4Q7EA 2WMOB 4QATA 4UE2A 5KNCA 2HF9A 4N3NA 4OHPA 2BCGY 4PZEA 3DR5A 3HDJA 1EUCB 2RHBA 3GVIA 1P7PA 3MNFA 4QOFA 5L4SA 1J99A 1G20B 1QANA 3AF6A 4F6LA 2P91A 1OBOA 3QPBA 4QUDA 2V7WA 1BH6A 3SSNA 1NV9A 1ZG3A 2FSPA 1MCZA 1Y5IA 3D6MA 4B4UA 1T4CA 2XA1A 1G1MA 4L22A 1F2UB 1SM4A 1F0YA 3KM0A 3HVHA 4JP3A 4RABA 3TNJA 4WBNA 4YRNA 5J63A 1REQB 4QT0A 1NF3A 3DM9B 3MLBA 2KB0A 2ID9A 1ZM9A 3FVTA 1VKNA 5JXWA 1OWNA 2VKQA 3H7IA 2IUUA 2PFSA 2GZ1A 2RGGA 4Y1FA 3GLSA 4X64B 3P5SA 4G8JA 3U1BA 3AESA 2BTEA 1CQJB 1SULA 1ZIXA 2EX0A 3AUYA 1EE2A 3PKJA 3ZN2A 3DFMA 1EG2A 3JZIA 1A98A 5DWVA 3M2TA 4A23A 1EE9A 4FT4A 3RUDA 5ICMA 4ZT5A 3AEUB 1KETA 4HXEB 3AHGA 1OASA 3I34X 1XN1A 1TB4A 3VO8A 3NONA 3KDPA 3X1WA 5IKPA 4FBGA 1WUKS 1XDUA 1HGXA 3PZBA 5IVPA 1F8YA 3QY0A 1E96A 3CWZA 1ZK2A 1Z4LA 1ZUIA 1USVA 2D1FA 2EJVA 4AJLA 4BB6A 4CF4A 5FX2A 1R16A 1ZVVA 2KLBA 1QO0A 5HUJA 1JECA 2FUEA 3JTEA 3MJHA 1OXVA 5K8LA 5KC8A 4QNNA 2ZCJA 1IXYA 3VYRB 4HBGA 4Q4JB 2CLIB 3I01M 4OHXA 1D2EA 3VHLB 1IWOA 1DAFA 2FPPA 2VCYA 2GA9A 2X0NA 1FRFS 4CLHA 4F93B 2FFQA 4BBZA 4GOJA 2FQ1A 2HQ1A 4AF6A 3TUIC 1QYVA 4A16A 4I0WB 3KLBA 3TRKA 3EF3A 3WWDA 1Y1SA 3AB3A 2BFCA 4WINA 3UV6A 5DFAA 3IE1A 2QU7A 4DARA 2X22A 1WWKA 3WWZA 5CFOA 2NPFA 1TECE 3GVCA 4K6HA 4N3AA 4OA5A 1FC0A 1P6UA 1DEOA 2ODQA 2R48A 3QVWA 1QZZA 4HAUA 1NDHA 2AFHB 2ZB4A 4IH9A 5KHLB 3L07A 3CLKA 3D4BA 3U7EB 3GAFA 3LY8A 3D3WA 1Y9EA 4RJKA 3KQTA 3HDYA 1KQOA 1LTHR 2XE4A 2A9QA 5FL7A 1ZIOA 1QS0B 3HR4A 3IP5A 4IR7A 1JHVA 2LKDA 1F6WA 1OHHA 1GG8A 1UC5B 3ZY3A 2VF7A 3VU9B 1EHYA 5GONA 3GT4A 3TL2A 3F1KA 4LIPD 3CO5A 3UB4A 1NUTA 4JAVC 5JRJA 1HQKA 2A67A 5LJLA 3C5WP 3G9ZA 5GWXA 1BGXT 1U63A 3STXA 1NW6A 5B3JA 4B5KA 1FNBA 1ULSA 1T4MA 3T0FA 2V98A 4TXHA 3BJMA 2IX9A 3K9BA 3LRXA 2JD1A 2O8DB 1GPKA 1L5OA 1KI6A 3ONVA 4R68A 2I3AA 4RDIA 3C5EA 4AF7A 1RFGE 1RQLA 3GEHA 2OVFA 4J7CA 4QYXA 2PH3A 3MWEB 5K6AC 4H4CA 3EGWA 3VNUA 4IL5A 4I8XA 4Y0VA 3O47A 3EZFA 5EHXA 4IFBA 4L4XA 3CLRC 2HD4A 2VPWA 2QTMA 1NNLA 1IH8A 1OXTA 1UANA 4D0NA 1QHXA 3E53A 1LRJA 4DB4A 1G7TA 2I2AA 4R05A 2BTQA 5D3QA 5KSPA 3F49S 1FNCA 1HDOA 1RJGA 3P19A 5HF8A 4E51A 1W5BA 1E1YA 4K9DA 1DPFA 1GAEO 1NUSA 4ZHSA 5A4IS 3FOWA 1QDUA 2C7VA 3R9KA 1NI4B 3FR8A 2X3FA 3UTCA 1N32B 1HKUA 3UG6A 4AYXA 2NTEA 2V6MA 4X3OA 1GL7A 3EIXA 2XXAB 5AVXA 2XZPA 5EE0A 4DCVA 2CL5A 4W4TA 5HUHA 2W2KB 4NCIA 2D2VA 1UFVA 3TK1A 3AOGA 2WOJA 5E7IA 4N0EA 1JHOA 4R40A 3WGHA 2E1RA 5K0ZA 1HC7A 3D2CA 4ZU6X 2JBAA 2ZWOA 4B87A 4L02A 1VP9A 1GRVA 5IT5A 3BORA 1ILWA 2ZGVA 3CSDA 3SF8B 3OCWA 4EGFA 5KNLA 1T2VA 4ZO6A 1N1DA 1FP6A 1N2XA 5EQJB 4O4JA 4AKGA 3G79A 2IKQA 4D9BA 3UHJA 3HL0A 3LUHA 5TQVA 3PGMA 4MV0A 1U8AA 3ZDXB 3FFAA 4LUCA 4WNIA 1DWOA 3DT9A 1W75A 1E1RA 1DBRA 2H2FA 1A2KC 2HEIA 3IR5A 4I4IA 4PYNA 1FFAA 3A58B 2QW1A 3O83A 1SJ9A 1LGYA 2I2BA 3JS5A 4P92A 2VAVA 2ZJ2A 1DTWA 5ALUA 2BGMA 4BNLA 1RM3A 4MKZA 3GARA 2IXFA 1M6WA 4D9CA 2P2NA 1BE0A 3NZEA 5EG5A 521PA 2FWAA 2E6UX 2PKYX 3GPDG 1M1YB 2XUKA 1G5IA 2CV1A 1ZINA 3C15C 3Q6NA 4BWGA 5K3EA 1CCDA 2A5GA 1AS0A 2DSNA 4QJ5A 3IE2A 3FCXA 4RA6B 4EYEA 3U19A 4BY9E 1KDTA 4WV3A 1MDFA 5EIFA 3PUJA 2WFMA 1L4GA 2YMQA 4BXOA 1XDSA 4Q48A 1I6WA 2P75A 5IKEA 1VXOA 3PF9A 2B1QA 1S2LA 3M4XA 5DDIP 1P9NA 1RCUA 2FW7A 4ALJA 2XH8A 4OQNA 1V48A 2VNIA 4B76A 1M54A 3DBIA 1ZU5A 5AIAA 1T5BA 1YAJA 1O1YA 3OA0A 4OQMA 4BU1A 4BS9A 3SJAA 3I5YA 3AZOA 4INOA 4MS1B 4YCAA 2W6CX 2QTVB 3DFFA 1QQTA 1G291 3JAWA 2ZQYA 2C4KA 1RC8A 1OI4A 1U8CB 3OLCX 4NEGA 4YRSA 2D00A 5BV0A 3SLRA 1LVUA 1SB8A 1ZOIA 1BYIA 1SG0A 3QLEA 2AD5A 4E46A 2OCYC 2C9CA 3MERA 5CB8A 3B3AA 3THWA 1YR3A 2BAGA 3QI7A 3NTLA 5C1BA 3DR3A 4M2LA 3U40A 1EX1A 1F12A 3KYDB 2WF9A 1R6DA 4OP3A 3L8MA 1JJIA 2GYVA 3N05A 3VMMA 4EW1A 2PRKA 4DV3B 5KJ6A 3EZNA 2PJZA 1X74A 4Y9TA 5CRIA 4H7PA 3VH3A 3UT6A 3MMNA 3E5HA 3GJYA 5AM5A 1CG6A 4EH1A 5AI5A 3SG0A 3E18A 1JHAA 3OZGA 4AZ3A 1JXOA 3AIKA 2NX2A 2OGWA 3IKJA 5EL0A 3B70A 3NALA 1X7WB 1T5TA 1HEYA 4QDTA 4RSRA 1VPLA 3BL5A 2RGRA 4MHTA 4PRYA 1UFQA 4OTZA 2LW7A 2OQRA 2W2LD 2QSUA 4IFEA 3SY8A 3O4RA 2JCVA 4E3ZA 3T1NA 5BR7A 1UKBA 4G1VA 4IGEA 3R7AA 3A36A 3HR8A 2IE8A 5E38A 3U7RA 3LTEA 4M53A 3TVYA 4AMGA 4AUNA 1W2WB 4YJ3B 1M6EX 2C5FA 4HNSA 4KAAA 4OGKA 1G3RA 4RNDB 1QH1B 4YT4A 2VO1A 1FP4A 5HQ3B 2XRYA 4FMBB 3OT1A 4OU4A 4KLZA 3OTWA 2WK1A 3KSUA 2RGYA 2JJ1A 2PRYA 4WKOA 4Y6QA 4Z0TA 4LCJA 4C6TB 1W4BA 4CQLB 1K6XA 4OXIA 1OY1A 1EG7A 1KPIA 1A71A 4MUMA 4KK4A 1W48A 2XOXA 1AQYA 3ET5A 1TIPA 2YWJA 4UE3S 1CY1A 2JFFA 1OYWA 3CSUA 1OKKD 4IUBS 1O94A 3NM4A 4GXQA 3UK1A 1XQWA 3OPYB 1NYQA 4WTOA 3ZWDA 3DXXA 1ORDA 3V4OA 1T0IA 2R6JA 4JGGA 5KNDD 2HC9A 4S12A 1U9JA 5JW6A 2RD2A 1BGVA 4QFCA 4P4SB 3NAGA 2IPOA 2OCPA 5CLIA 4Q7KA 4CMEA 1UFOA 4HLCA 4EJSA 3Q1KA 4BV9A 1KGSA 4MUKA 4NXMB 4JC8A 4Y2UA 1GFSA 2CHVA 5CAEA 3QE9Y 1E66A 3I2JA 2D0PB 4A36A 1DAMA 1M2HA 4LYDA 5AK4A 4XDYA 4G0QA 3WTCA 4EPTA 4GPD1 2XT6A 2Y1WA 4LJ5A 3OJXA 4IRMA 1PUIA 2ZIXA 4D56A 3ZTYA 1RXUA 1XALA 3L1IA 1V3TA 3DL4A 3DOUA 3DOCA 4QEKA 3RNLA 3WNDA 4BO5A 1OBCA 4FZJA 4S1NA 4FXOA 4L27A 2CVFA 3EGCA 3QXCA 2L19A 3BIWA 3LDAA 3PCRB 2PR7A 3EN0A 1YF3A 1KFCB 1SVIA 3QTBA 3QKSB 4GWKA 1D1TA 2ZREA 4DF3A 3TZQA 4BWYA 1XMVA 3NTXA 5GIOE 4KTVE 3SFZA 3HCCA 1QGOA 4ZO9A 3T3PB 1XYGA 4OUDB 1J6UA 2AFIB 3ITEA 5FYQA 2OZEA 3L0YA 5KDDA 3W5DA 4M7OA 3NASA 1R18A 4N0PA 4GYYA 3EQ9A 5B12A 5KBYA 2XDQB 1G3QA 3OWOA 2HLDA 1LCIA 2PKRA 2R1TA 1YVUA 3TQQA 3BFVA 1PWEA 1M5UA 5F5NA 4H1WA 4RGVA 5EXSA 1MJFA 4OJNA 1FU7A 3X3HA 2VP9A 4AJJA 2J6CA 1O0SA 1E0KA 4U8HA 2W42A 4D6XA 2DFPA 4FFMA 2PL5A 1HETA 1JA0A 2HV9A 4J1TC 4Q1AA 4HGNA 1Y98A 4JGIA 3GCDA 4G85A 4R2KA 2D5BA 2M9MA 3HWWA 3OU2A 3V1LA 4A6XA 4WMLA 2Q8PA 1QWSA 1WQ4A 3ORFA 3QQPA 5BN5A 4XWWA 4B3HA 2YWRA 3WRWA 3FRJA 3PR2B 3JWHA 5ESWA 4EKGA 3FIJA 3GLFA 3DO6A 2Q3LA 5AK0A 4QA9A 2IYQA 3JQ7B 4L51A 3S2GA 2MSWA 3OJFA 1HT1E 5EGSA 3TD9A 5AVUA 3LZDA 4MWEA 3RTDA 5C8YF 5D3KA 4O4IA 1M9NA 3LHIA 3JAKB 3EWNA 5ALDA 2WNHA 5LIPA 9ATCA 4MTLA 4UM5A 3X1ZA 3PJFA 2Q7OE 2C00A 4B35A 3V8EA 3BJZA 2HJWA 1KH3A 4GT1A 2A94A 5EWMB 1JQBA 1H69A 3GBSA 1G5PA 3GBPA 4V03A 1M34A 3UJ3X 2KM1A 4CMIA 4EIWA 3NHBA 4BO8A 3K1JA 5B58C 3DCNA 1SHKA 3NAZA 3VNSA 3S2EA 3K6RA 1MDBA 2P90A 2PKXA 1V4VA 2ECQA 1E9RA 1BGWA 2A9VA 3EIOA 4JLWA 4XFKA 5IKXA 2W71A 4MKHA 1F5NA 1X86B 5BWBA 4XCXA 1DRWA 4D79A 5BV7A 5CD9A 4L72A 4CR7A 5HOEA 5ALRA 2FUG6 4R1MA 4FVTA 3T1VA 5CB4B 1QG4A 2B0JA 4O59O 4PR3A 1BYUA 5GM2A 4AY4A 3HXOA 2Y0BA 3LUBA 1HTWA 2VDJA 4QULA 2G4CA 3EGEA 2OCDA 2A5LA 3O8LA 1TT5A 3OM0A 5DNDA 2REOA 2RHMA 4AULA 3JARA 4H1HA 3ZLVA 1MRSA 4MVJP 4F9FA 5AM0A 3Q9NA 3QEBZ 4K9SA 3FTPA 3AR5A 3R74A 3NMUF 5ADHA 3C7CB 2REXB 4B17A 1E32A 5ALLA 2DF8A 2ATVA 1VFPA 5BWMA 5AW6A 3N1UA 1HLGA 1U7OA 3TTSA 5FYDA 4JS0A 2QZ9A 3RHZA 1E5DA 3BQNB 3TXAA 4QU0A 1X15A 3Q9LA 2QR3A 1F2VA 2H2AA 2IEAA 1W96A 3KKZA 2HO5A 2WTEA 1XZEA 1S0UA 2H4WA 4JLOA 1UDRA 3A6ZA 3O1IC 4JSTA 1X7XA 2F64A 3SM9A 3MCVA 4Y2SA 2W00A 2VSYA 4C89A 2P4QA 3REGA 1AKUA 4M49A 4BQNA 2VCHA 3ZV3A 2EAUA 2HAEA 1YB2A 4TMKA 3G7NA 1ANKA 3Q87B 4CCAA 3T3DA 3QLTA 3VPSA 3B52X 1JDSA 3KTAA 2FSIA 3D7SA 2B2NA 2CGEA 2I55A 2ZPTX 3AB7A 4M0MA 4D5EA 1JU3A 3FNFA 2W70A 2VUSA 2PX8A 5KYTA 3VH4A 2W9XA 4JLKA 2J31A 4HS9A 3ZIAA 3DE2X 4OQEA 3UUEA 1QGZA 2X8WA 4CG1A 5A3VA 1S6YA 3BC1A 1QO9A 4LMPA 5EUQB 3PJDA 5JALA 4KKXB 1XTQA 4J0IA 3HCOA 3SVZA 4V3BA 1NVWQ 2VZLA 2FOLA 2H08A 3NOXA 3IQWA 2H5LA 3RQSA 1XWFA 4INJA 4MRNA 2DFDA 1XAIA 3KZOA 1MH9A 4G25A 3U7QA 3Q7QA 1J8YF 1RS0A 1G8YA 1RQNA 1SXGA 2HMTA 3KT3A 4RD6A 3GROA 4TL8A 3TBFA 2ODNA 1E6WA 2YV5A 3ND9A 3GRAA 2ZDHA 3AUKA 2QM3A 1PDWA 4OMCA 1L7DA 1Z28A 2QD2A 4B74A 1Z15A 4RMGA 3Q5GA 5D1HA 4D44A 1B23P 1FFXA 4MKXA 3IDOA 2NUAB 1UZUA 3T5DA 1W4AA 1O0CA 1MPTA 1TT7A 2HDNB 1SY7A 2BGLA 2E4UA 3EVCA 3NRBA 4XPIB 5I8WA 2EKZA 1W9MA 3Q3JB 2I4TA 3HM2A 3THXB 5B4VA 2WUFA 3AHHA 1RPJA 3E9NA 4Z1MD 4X45A 5A0TA 1EK6A 1J8MF 4G0VA 2AKYA 4BECA 3EK2A 2CNWD 3U31A 5I4KA 4H7HA 5LZ2A 1H93A 2EW1A 4U2DA 4ZDIA 3OIVA 5ES4B 1GTZA 1Y6RA 4TLAA 5AKEA 1E58A 2RGAA 4Q19A 2AMJA 1U4SA 1JSLA 1NM5C 3A6DA 4WFKA 2NO5A 1DX4A 1MT3A 1PGQA 5E2BA 5LLSA 4A10A 4AKIA 2Q3HA 5JG7A 3K53A 1KVSA 1BJKA 2JLYA 2JH8A 1PK7A 2BFDA 2ZTMA 1G8FA 2WJIA 1AQ6A 1LK7A 1PK9A 2NSYA 5DBFA 2IEIA 1FE8A 4NCAA 3AVYA 1YB1A 1W5EA 1OWMA 2H5EA 2K2WA 2ADOA 2AKAB 2V55B 2I7CA 4JJ7A 4ZVRA 2P9QA 3WRYA 3EQ7A 3SJUA 2ZRFA 4H7DA 4MWSA 1C0PA 5IP5A 1OLSB 1DC3A 4JU8A 1ARZA 4RPIA 1T6YA 3MGAA 5AI8A 3RS2A 3WLKX 4BGEA 2NVBA 3T3GA 4EHNA 1FP1D 2OOSA 4QBIA 2INGX 1QCYA 4RY0A 1N4AA 1VJGA 4D7AA 3QFSA 1SRRA 1U2TA 1C9YA 2H92A 2X8JB 4WNYA 3KVVA 3PUKA 1DIOB 2GEFA 2GVDC 2XMRA 4QG3A 3GVXA 4IV5A 1E98A 2HJVA 5MF6A 1M0TA 1JKJA 2A4MA 2BIFA 3OE4A 1U8YA 3IIEA 1P33A 2Q1TA 1BRTA 1XMXA 3JVIA 1E99A 1FS5A 3ICVA 2XIJA 1XLWA 4HFMA 2AA3A 1E7WA 4OXXA 4TROA 2TYSB 3RVMA 3D3EA 5IVDA 1LB1B 4P3NA 1JWLA 1KAEA 4HB0A 4LVUA 5F2NA 3FWYA 2VJMB 2WZBA 4F91B 5EJ4A 3PTAA 3ZDCA 4FZ5A 4FSDA 4F8JA 1XVTA 4Q9LA 2HM7A 3TOCA 4PN3A 4RGBA 2XKKA 1LD3A 3D0RA 4X0EA 3U9SA 4E21A 1T1SA 2K7ZA 3NAMA 3KSZO 4U4AA 4BVBA 5BQOA 3NJRA 1BN6A 3SIPA 3W8DA 3OP4A 4IIBA 4XTRA 2XTNA 3G59A 3KB6A 3E9QA 3NGLA 3OQJA 2QN6A 2I78A 4JITA 1QVRA 4ARIA 3G5TA 3Q3HA 1TVCA 4BKQA 2ZVPX 2VBIA 3SDSA 4EFKA 3A26A 2RAFA 3B85A 3NEJA 5TGTA 1N5JA 4IM7A 4EABA 3HQ4O 3UENA 3DXYA 1UP4A 1ICEA 3E27A 4WY5A 4PHFA 3UC5A 4BVKA 4JSRA 1HMYA 4YP0A 2FRXA 5TJHA 5KNBA 1QVZA 1YMQA 3PI6A 1EM8B 3U49A 1FVFA 3WGQA 2F4VB 1GPBA 3JYNA 2GD2A 4WECA 5EKSA 4ZJUA 2IV2X 4YPOA 3NVKI 5IJ9B 1TQDA 3JX9A 1U0SY 2EEPA 3PQEA 3ESCA 1UK7A 2X5XA 3JW8A 3MJRA 5LDGA 4DJJA 4LJ8A 1Z74A 4YJHA 4BTLA 3P52A 1C7RA 1XEWY 1X1BA 4CM3A 1JIIA 2CJYA 4UXJA 2AQKA 2G1KA 3GUYA 3WL7A 2XSZA 5KYNA 3I2FA 1A9YA 1GGMA 2BEUB 3D8NA 4DDTA 1EI9A 4OJTA 3ZW9A 4Q3NA 4YR9A 3IEVA 1PZGA 1WIWA 3KRTA 5EPEA 1GY8A 4HC4A 1GEGA 4H18A 3TZHA 5JJCA 5I7WA 2CL7X 2EFYA 2XR1A 4IJMA 4QBFA 4W1QA 1TM3E 2LCQA 3WZMA 4EELA 2X7HA 5JQGF 5K01A 2I3BA 1AK2A 1Z06A 4J0QA 5IC4A 5EE3A 1MC5A 1T0JB 4ZCPA 4GI3A 1LBHA 1Z7BA 1YRYE 2H59A 1PFKA 2CEAA 2HQRA 2QP3A 2FMXA 5E7MA 3ABRB 3OX1A 4E70A 2EERA 4ZYLA 5KINB 1G8MA 3M8KA 3U6KA 2JLVA 2GFQA 3G0DA 4PYMA 2X58A 4AKSA 1HNXB 4LZJA 2WFAA 4OQLA 5ECGC 4YCSA 1ZGJA 2CZCA 4AD8A 4DYVA 1JB1A 1KQ3A 1ML4A 1WUTA 3L4BC 4BASA 4EA7A 1L6RA 3C39A 4ND4A 1CS0A 1D4ZA 3CLSD 5G4KA 1G8KA 5JVDA 4R3NA 4F3YA 2CBZA 4QXPA 3GFRA 5DOZA 1QUFA 2Z9BA 2I6SA 4ZEXA 1P73A 1RZRD 5C1IA 2O1EA 1JG3A 1XDDA 4TSKA 4E2YA 2H48A 1ZR4A 3E2PA 4EG0A 1FQJA 2C3UA 3NHJA 3TH5A 1Y80A 3H5VA 4TOIA 1CUBA 4P08A 3KVRA 3HI4A 3NEYA 4G4SP 5AOAA 2JD2A 3T1TA 2ZRQA 3G2HA 1ZO8A 2CLFB 3REQA 3NBXX 2IQ5A 2DC1A 1UBNA 4MTCA 3DV9A 2DWOA 2VZ9A 4LC9A 1VBNA 5H3CA 3OCYA 3H65A 3KWJA 1CDZA 2IC5A 1QHIA 3K35A 2D1RA 2NLOA 4P9NA 4L5CA 4R8MA 4URHA 1DRJA 1G7SA 4DA7A 4ZOLA 1RLIA 5ADWA 4JLAA 4LDRA 2GF0A 1U8UA 4FKBA 1E1KA 1K08A 3MLEA 4K9MA 1RPNA 1NI5A 3ROEA 1LDGA 3O4JA 3UPUA 1F20A 4X6YA 3RFUA 2ZRMA 2I03A 4HYEA 3KE8A 2WILA 3BTUA 4D0LB 4EB3A 5K8JB 2ZYDA 1L8LA 2L0XA 4GBED 5LQNA 4IOKA 2OM6A 4G2TA 5KJ1A 4M9QA 1T4GA 1QC5B 2IY7A 3E6AA 2LV8A 4EYGA 1NMSA 5E9JA 3PF8A 2Z4RA 3LRTA 4WNAB 4KFTA 3NB0A 4R2MA 3AY7A 1EBUA 2P0EA 1WXXA 4TSFD 2YOFA 3QUTA 1PJSA 1EBFA 1N5OX 2P7HA 2R85A 3MJVA 1R4NB 1ONPA 2TS1A 2IYAA 4GNKA 221PA 2BC9A 3P94A 1R4MA 4WL0A 5L8VA 2PKWA 4GI7A 5IK2D 4UDXX 1I5OA 4AK9A 1I30A 1DEKA 4PC6A 1BCRA 1BMTA 5K9ZA 4JX8A 2H63A 4G36A 3DAFA 1QH8B 2HIGA 4KVZA 2FRVA 4MVJH 1TF7A 1VKZA 3BIJA 3Q0EA 3IOBA 1KNQA 2JHCA 2ZM6B 2DX7A 3GL9A 1EJ2A 2O23A 3L46A 1RI1A 4LZPA 4ER3A 3FRIA 2FR1A 4XGRA 1JR2A 5H83A 2ZUTA 1XD8A 2NO7A 3N2EA 3C24A 5AW0A 3OKAA 4TPKA 2DHRA 3JQ8A 4F1WA 2ATCA 2NG1A 2XLBA 3I5UA 2IRWA 2H0AA 3HA2A 3KEFA 4HZIA 3Q8LA 3QVGB 1YQTA 2UZIR 5JD4A 3VRHA 2IOHA 3A1VA 4UEKA 1RYEA 3ANYB 3F9RA 2XF2A 2ZE7A 1W85B 5PGMA 3T5CA 5CTAA 3KO8A 3CRZA 5IXSA 4KR2A 1LDYA 3WDKA 4BATA 1SKMA 3O1HB 1C4OA 1ISJA 1VG1A 3R1IA 4J0JA 2AG0A 1DG1G 1E79D 3CINA 3MBKA 3RUPA 3SMVA 4RORA 4ZALA 1R5NA 4O2AA 3UG7A 2GJ8A 2RB5A 1KEEB 3TI9A 5JEEA 3NHKA 5IVKA 1USGA 1A4IA 1PJ3A 3TNDA 1QZUA 3H3FA 5CXSA 1ISMA 1T8TA 4E32A 5FLXA 3GLHE 2ECKA 4IG4A 1NVUQ 4MQ5A 2XUZA 1PQ4A 1IQPA 1DG3A 2JDID 3EVDA 5DCLA 4DLNA 3I6BA 3ZXIA 3HKBB 1IEXA 4RK6A 1Y48E 4NXNB 1D4FA 1KAQA 2A0WA 1T0PA 2JHAA 3CNOA 1UMDB 2REQA 4RADA 4LECA 3KUKA 3AUUA 3WIDA 1EP3B 3FMIA 5EP3A 1YQXA 1EK2A 2H5IA 2N1BA 3OD5A 4NFYA 2XVAA 1NRIA 1L4MA 2FSUA 2A35A 2DH5A 4ZI7A 1YZLA 4RTQA 1KL7A 1E9FA 4FFLA 4U8GA 2OQ2A 5DLQC 4CMJA 3MQ4A 2IGBA 2XHZA 2QORA 3PQ5A 2GX6A 4QXAA 2RGBA 2UXBB 1IJFA 4P5EA 1A5SB 1MVOA 5KYUB 5JBQA 4LC1A 2VDWB 4K8OA 1W4LA 2Z2XA 2FFAA 4M1WA 1Q16A 2Q9BA 4XB1A 5CDTA 2HU8A 4QTXA 4HMPA 3OVMA 2CJWA 2P6OA 2ZYTX 4YV2A 4ZCMA 1USIA 3H9CA 1T2FA 4X3CA 3D0QA 4II7A 4L2IA 2BR4A 1T25A 3L8YA 3FWPA 4GXTA 1DKOA 3BXOA 4X8MA 3TN7A 1DQNA 1EUZA 3RG8A 2GHIA 4JKOA 4ND8B 1QB8A 4YUAA 2XCUA 4ZMBA 3O3CA 4KXNA 3TFQA 2FSVC 4G5OA 5IEJA 3AY0A 4WRRA 1ZD2P 2DBYA 4KAFA 5EP1A 3DPUA 4EYOA 1MO5A 3SDBA 4DMFA 2PX5A 3CUVA 3Q3EA 4M1SA 4Y1RA 1EQAA 3GN1A 4QAQA 3EXG1 4YP1A 3MGBA 4PANA 4HH3C 3CW9A 4PZYA 1GU1A 1XU7A 3AUFA 3PDUA 4XDGA 5BSWA 3HEMA 2ZAGA 2ZP1A 3EA4A 4KQMA 1T10A 3MAJA 1HURA 3BCUA 3IA2A 1PNOA 2XIQA 3DB1A 1L7BA 3FWNA 4XR4A 4YCMA 5D01A 4QARA 1JPUA 3F8TA 5GOTA 2PKQO 3P4YA 5IAJA 2H7XA 3KZ1E 1HTBA 1I2MA 2PJDA 1MXHA 3PFNA 4XE5A 2NACA 3ORRA 4LNUA 2PS1A 5G41A 1AKYA 5K4AA 3S29A 3EHDA 3V32A 4CETA 1EAMA 1S3FA 3PWKA 4OGFA 1E62A 4M0CA 5ALJA 5DSZA 3NHYA 1PJCA 1P5RA 4JC0A 1XL0A 4ZRDA 4DIDA 5BQFA 1O0BA 1Q3KA 3IRUA 3ZVLA 5LOVB 1JFFB 4P3OA 5AK6A 5LQRA 4ZZ0A 1RJEA 4OXQA 4MWOA 2P9ZA 3WY9A 1RWMA 1TF2A 4B75A 3QX3A 2HXGA 4LX0A 2ZBUA 4UTXA 2P3SA 2P68A 3K4PA 3O7WA 4AJEA 5AIBA 5ICSA 3EEOA 3CEHA 4RH0A 1JG1A 3R44A 4H08A 3RW9A 2QN7A 2JHFA 1R0CA 4G41A 1USUA 4HLUA 3IXMA 3N2ZB 4O29A 4ETWA 4GWGA 1JFLA 3ZZ1A 1QE5A 2YS6A 4HDRA 1KO8A 1NN1A 4REQA 2WSMA 4CKBB 4EG3A 7AT1A 3VC7A 3K0SA 4JBXA 1WPQA 2HTFA 2ERCA 1B3BA 3CYFA 1GZ5A 3GBVA 4V2UA 2IELA 1N1MA 3QE2A 4AYTA 1PG5A 2VAPA 3DFIA 5FULA 1Y7IA 2B98A 2G9QA 3N86A 4HEA1 4J75A 5DKFA 3ESZA 3VNVA 1RXEA 5JAZA 4GBMA 1ZN7A 1T5IA 1XVVA 3PITA 2C54A 4AKHA 1UWVA 2D1YA 4A2QA 4GKAA 3RQIA 3NC1C 1NJ8A 2UVDA 3O1LA 1SUEA 3LF2A 4Q15A 2GFIA 3ZY2A 4ASUD 2BGTA 2CK3D 2Q1WA 3EHEA 3THOA 1JKMA 4ZAZA 4GSYA 4MW9A 3D1JA 4HAWA 4HQOA 3HA5A 4NENA 5EJ2A 5JH7F 1TA0A 3GFSA 1KMHA 3BQMB 4RHEA 3M4YA 2BGJA 5HGJA 1WP4A 2XBMA 3F67A 4C88A 4ZU3A 5B6JA 2WHPB 3H97A 3ER6A 4Q05A 2PH7A 4DV4B 2YJ5A 4I4TA 2BEVB 2XZLA 2QVYX 3EMKA 3I3OA 3I45A 5EJFA 1I3LA 4YWJA 4DDKA 2RKWA 3CCBA 1I6LA 1R4ZA 1ZGGA 2B6NA 4R1QA 3SJCA 3U13A 4B3SB 2AW5A 1PFQA 2DHDA 2X9QA 2ZS7A 4I1UA 4MLCA 5EWLB 4C20A 1WUJS 3A1CA 2QZSA 1WHSA 3MA0A 1Z2OX 4K6KA 4AMYA 3E5RA 2AOVA 1DINA 4JEHA 1BX0A 5KQRA 3QM1A 4IZHA 1V47A 4P2GA 1NW5A 1JSRA 1KRHA 4UTNA 1N2CA 2FEXA 1AH2A 3RIEA 1LRLA 5CNIA 2P2LA 2PWYA 3OIGA 3Q0TA 4MP8A 1P0IA 3FCCA 1EFTA 1SA0A 3M5DA 4HRXA 4Q1DA 3ZW8A 2WUDA 2JGMA 4CMAA 1OB2A 2X9NA 3H5IA 3E4DA 3GLVA 3L82B 1VSTA 4AP9A 4W63A 3ETHA 1ONNA 1XTZA 3DOOA 3MGGA 3QIVA 1XD2A 5JHHB 3KQKA 5DBGA 2VL7A 1AGPA 3PR3A 3WJAA 1EJBA 4IMPA 4Y2TA 5EXXA 3LYHA 1ZWLA 3SQLA 1O9BA 4D4LA 2O0LA 3E23A 6AT1A 4CL0A 4S2UA 4QNMA 3EC7A 1FX1A 3FY4A 2H4XA 4PTYA 4Q12A 3BE5A 4WZBA 3DONA 3Q5DA 3I61A 5AK5A 5I7SA 4QGHA 4HMQA 4U1RA 5C7IO 2FWPA 4BN4A 1P2SA 5FFFA 1DCKA 4YXFA 2RJ3A 4LBVA 3C0KA 2NM0A 3M1YA 2YVKA 3Q7EA 4GBGA 4DLBA 4WCDA 4QO8A 4ZMSA 1RKQA 2WJGA 1MT0A 2XMGA 3IT1A 2XE7A 4F45A 4E08A 4GXNA 4BMXA 1PR9A 4MVJE 4HEJA 2BOVA 1GR0A 3C6ZA 3VR3D 1DBSA 2ZUVA 1F2DA 1JEQB 1K7CA 1NG1A 2OBMA 4DCTA 4MVJG 4DA4A 3OIFA 5HE9A 3T7RA 3TXYA 3KFVA 2JIOA 4HGPA 4O2LA 4QHSA 4UJ3A 3AKZA 3F5QA 3PHGA 1Q12A 2PT9A 3IX7A 2Q6OA 4LWZA 4RETA 4GVPA 2VBCA 5IAEA 2JIZD 2H6EA 2F1KA 4YQYA 5DHUA 3BVPA 1M2EA 4LRYA 1FCJA 4UU0A 2GEDA 3EVEA 4YC7A 1TRHA 4W1SA 1W34A 4FQ5A 4EZEA 5L95A 2C5LA 4OAQA 3ADBA 2CVQA 3HBJA 3GH3A 1FJHA 4PZZA 4UM9B 4TWBA 1G3IA 2EFGA 1KZ1A 4UAGA 5JAHA 2FPUA 1JU4A 1YDHA 2QVBA 4C5CA 2ZT8A 4HK4A 4O08A 2RGCA 5ESXA 3GNTA 2H4YA 3EUFA 1F4PA 2YWXA 1PGNA 3VKUA 3CQ9A 1QZ3A 3IUYA 5C4MA 1KEPA 4RF5A 2O7QA 3RJTA 4UEJA 1F3LA 3K4QA 1L1EA 4LDZA 5AW7A 2XXBA 1UOPA 2ZSUA 4HXYA 2VJCA 5CIYA 2P9CA 4Q66C 4DZZA 5FAKA 3ZNOA 5HF9A 4IX1A 4ROTA 1FFBA 4RWZA 2X2FA 4X92A 4Z3KA 3T9AA 4Q4LA 1TTQB 3K9WA 1M3SA 2C2MA 3CFYA 3EQ8A 4N8EA 4R2IA 5C9ZA 1K1EA 5KNDA 2OCBA 3WZ2A 5KYWA 2EYQA 1XKQA 5EZYB 2UU9B 4L3WA 4JH0A 2GYUA 3OTQA 2PM8A 3ITKA 4PGMA 4QDZA 3D6JA 4JN6B 4DPKA 4WBNF 4I1OA 3HM9A 2Z6QA 2HLPA 5LL6P 3QHAA 2XNHA 5EJAA 1XTJA 1QIHA 3IAS6 2PT6A 1EDEA 5J2TA 1OLXA 2AZ4A 4OI0A 1UJBA 1MZPA 3PWZA 4B79A 3EWSA 4JJ4A 4TTIA 1IJBA 3GQBB 3AQ4A 3L7MA 3ZV5A 1DMSA 3QF4B 3SIWA 4QRDA 4BJHB 1YUMA 5ED0A 1UM8A 1LTQA 4ZC8A 1RE1A 4DZTA 1P2FA 4ML3A 2DY0A 4MQFA 4WK4B 3R5JA 1G21B 4OB6A 1KEWA 1PV1A 4RDCA 1RYNA 2YIVX 5EZ5A 3TW8B 1XX6A 2FZ4A 1S2GA 3K8YA 3OOHA 5SZKB 1UWLA 3K31A 2C2GA 2J32A 2CYCA 3EDRA 4PHCA 1MX3A 4TTVA 1AQUA 1NMEA 3V55A 3ZJ5A 4B6OA 1SIUA 2FDRA 1Z38A 2B4RO 1OWLA 4FOOA 4R9NA 3ZHVA 1MAUA 1SQFA 3DWGA 4B43A 1R5OA 3DMPA 2V6JA 2O2JA 2NMVA 3RWBA 1OA1A 2P69A 3BH6A 2HGSA 2VH2A 1U80A 2QA5A 5B37A 1VRWA 3RVBA 3UMGA 2R7NA 1YDEA 3P0IA 3HZZA 3AL2A 1CY6A 4LPSA 1O87A 4KWTA 5D6NA 2AE2A 4I50A 1QG2A 5LNK1 1XZIA 4HXGA 3RVNA 1MO3A 1N5DA 4WOBA 4QYTA 3EBOA 1VTKA 1YK0A 4YK7A 4IO0A 3OAAA 4WEQA 3CZ9A 1BIFA 3HSYA 2P2GA 2BJHA 3B3GA 3EH1A 4RS3A 3RYFA 2DPYA 4NH4A 2JGRA 1KFJB 5TQJA 4HDMA 1TCVA 4HYQA 3Q98A 4M21A 5L7YA 5HX7A 3R3ZA 3LWNA 4IGIA 1VMAA 1QHHB 2P41A 2Z8XA 3RYIA 4FM9A 4C29A 4AG3A 2WKWA 1NYRA 1YZHA 3SKXA 1H23A 3AF4A 3C98A 4FNMA 4NBSA 4WXRA 5ITZA 1R74A 4NAVA 4V24A 3OQIB 1KJJA 2A30A 4ZICA 5A05A 3BMOB 4XX0A 3TSZA 1ECGA 1L9XA 4U7HA 1OREA 3CE6A 1SBTA 2XODA 4YJKA 1FPQA 5FRDA 1XT6A 3T9CA 3RSGA 1HY3A 1FVOA 2IITA 4BNYA 4EW3A 2VAXA 1DAGA 3ANNA 1MIOA 1TF5A 3V5NA 2ZVQX 1Q84A 3E70C 3BRQA 3G2PA 4JOSA 5D3ZA 3QA3E 1E4VA 2WZCA 1RRCA 1I2ZA 3LD9A 3GLIB 3AR3A 3OBIA 1ADGA 1RHMA 5C3UA 4KNVA 1NWCA 3CLRD 4N6NA 4F85A 1ZITA 4GPZA 2CFSA 3F78A 3MT8A 3TVTA 4X1OA 1A1VA 1MAHA 3K0CA 3PUYA 4YO7A 2Q4RA 1FIUA 3UIEA 3O2NA 1U2ZA 3S44A 3QXSA 5ADUS 5K05A 3K20A 4ONEA 4UNSA 2OYRA 2NUBA 3JYLA 3PR1A 3A10A 3SAJA 3VPCA 3MD9A 2RHHA 3Q41A 4PO8A 3ZLBA 4NC9A 4BBPA 2CMDA 4NABA 1JA9A 2ODEA 4PG5A 1GAQA 2AI3A 2HJHA 2RH5A 1U8TA 1DBQA 1UBOS 4WLUA 3PC7A 2TMGA 4LHWA 3SQNA 3TNFA 4ERNA 3GX1A 2PRJA 1XLTC 3BWBA 3CF0A 1HL7A 3F98A 3AK4A 1VL2A 3PCTA 4NICA 5LCXA 1W93A 2PMCA 4NF2A 1GKYA 2C9ZA 4JLSA 3W7AA 5JC8A 4Y2QA 1S7GA 4KPUB 2Q2WA 2Q50A 2IPNA 1VOTA 3BXZA 3OESA 1JDUA 4R98A 4EYKA 5AFSA 4HQRA 1NR5A 3GT3A 3KJFA 3C41J 3BZBA 3KT8A 5YASA 2AQ8A 3AUJB 3I76A 2F9LA 2C4UA 2ZXEA 5DHAA 3V2UA 5KSZA 3T95A 3BL8A 4MIYA 4O33A 1N34B 2FW9A 1KKMA 2OKGA 4QBKA 2RBGA 4D6PA 3P2IA 1CQZA 4KVAA 4D9NA 4AO6A 5A6SA 1JYFA 5C1DA 2XUFA 1IIBA 3TIGA 5FOXA 4UHJA 4BMNA 4F4CA 1J0XO 4O4JF 5TXGA 1B00A 2C8JA 1CYEA 4I9FA 2C7RA 4LXGA 3UT5A 5BNFA 5B7PA 5ITSA 1WMFA 3TIIA 2H1LA 3Q6IA 1OI2A 1YKFA 1S1MA 5H82A 2GZDA 2J0SA 4EBBA 1YONA 3ODPA 2GPSA 3N2LA 4UMVA 4L8WB 5BQ5A 2QMQA 4A5OA 1GITA 1OZGA 4TS4A 4J3FA 3REOA 3N0TA 1KY4A 1YJ8A 2MSNA 3SC2A 3V1UA 2VJPA 5SV2A 4BBJA 2IUSA 3A3PA 1PR1A 1GPAA 4GG1A 3DOJA 1T91A 3AR2A 4ZT6A 3EPLA 1R6TA 3FNRA 4ZAFA 5ERYA 5JNUA 3L8EA 2Y1EA 2BFBB 1V2HE 2YJNA 5CGZA 3VR1A 2PUFA 1FUYB 3ICOA 5IJAA 2FP4B 3G5AA 4FQ7A 1RM4A 1ZH8A 5MFZA 3SK0A 4MQ4A 3H8SA 4DRXB 1GILA 2D3TA 1BN7A 1A27A 2V7QD 3NTQA 2O8EA 5H8WA 1KMQA 2JGIA 4DVGA 3DPIA 4ZOCA 3LFHA 3ILHA 3K0FA 3KLNA 3FRHA 4JASB 3J7TA 4AL4A 4LGVA 4G4SO 1MC4A 2AMYA 2DE0X 2WJAA 4UZSA 2WKPA 1UEXC 5EQDA 4AROA 1YHZA 4PYKA 2Q3BA 4AJOA 4CQJA 9ABPA 3GWGA 4KMRA 1UPAA 1C3OB 1LU9A 1U9CA 4IIJA 4IVRA 4II2A 4CF7A 1CZRA 2RARA 4H4EA 4CBVA 3CNQS 1DIBA 2NZWA 2FZ5A 4OY3A 3DC7A 4Q9AA 4BPRA 3V46A 4IF6A 4I1IA 4KQKA 5MGBA 5DP1A 1G6OA 2XT0A 4FGZA 4EP1A 4GBJA 4S24A 2IODA 5ICFA 3FLMA 4Q1EA 2V5AA 1CRZA 3PC6A 4WVFA 3IEPA 3K4HA 5CT5A 3CKLA 4Y2RA 4A91A 2WE7A 1ZBQA 4TQGA 5EJMA 1OFIA 1QIDA 5I3CA 3SIRA 5TT1A 2ACWA 4D96A 3DXFA 4RK1A 2NZYA 2OORC 2RKBA 2FY8A 5DASA 4MR9B 2HMWA 2QTBA 2WZQA 5AKGA 4ZYYA 3LY9A 3PS9A 3H6HA 1IBCA 1K5DA 3QVLA 3VR2A 1RKVA 4K86A 2ZI5A 1M73E 2HA0A 3ZXUB 2E7ZA 2QUHA 3B8HA 4MGHA 3R5XA 3V3TA 5CPFA 1TU3A 2QLLA 1Z7EA 2GARA 2VF8A 5J2UB 1NAIA 2NT3A 3HYCA 1OXMA 4QPJC 3GXBA 4MZXA 4X9XA 5DIFA 4DLVA 4EG5A 4RV9A 5AI6A 4KOEC 5FPTA 3ZX4A 2CSUA 4G97A 1X9IA 1RHJA 1RWXA 1Z0DA 2OYCA 3U48A 4I8DA 4TRRA 1U4OA 3KXKA 3O8DA 4GZ3A 5JQGB 3MJFA 2G9NA 3SIXA 3DBOB 1TIKA 4S1TA 5JDCC 3WI7A 1J9ZA 1WCYA 2P5SA 3I0ZA 3RGWS 3IOYA 4MS4B 1YQQA 4MQMA 1DAOA 1DUIA 1K92A 1MG5A 1OLUA 1YA8A 2HCJB 4Y2HA 3LXRA 4Q4AA 4UBMA 5F73A 3F97A 2GAOA 5TV2A 4ZEVA 2GD1O 4XDHA 5IUJC 1U7HA 2J3LA 3T41A 5FWXB 5KYGA 1NG9A 3U3MA 2B92A 1B2RA 4PCUA 4W5RA 2K87A 5FTLA 4M88A 4KW7A 4OXNA 3UUWA 5CA1F 1YZYA 5H5JA 3T0IA 1EFPB 1N9KA 1XMJA 3KKMA 1RR6A 4YIKA 3UJDA 5JANA 1IMOA 3G2MA 1F7UA 3SYKA 5BOSB 1WMSA 2Q3CA 1T9CA 4UMDA 1Y1KE 2OO5A 3MRXA 1T9KA 2GCOB 2XYQA 3KZCA 4J94A 4YLGA 3A14A 3GJXC 5DLEA 1O9GA 4P4UA 1S2DA 1XEXA 2DHCA 5TLSA 4GL2A 1DI0A 3FKSD 3PVZA 1SGWA 4IJ5A 2J3JA 1M6NA 2HK8A 2IVZA 3ZUGA 2PQMA 3V4SA 2O8EB 1M74A 5G1PA 2Z6UA 3R6TA 3MFYA 2R7MA 3X1XA 2ONCA 3A9RA 4DCPA 2RK6A 3W34A 1NXOA 5JYBA 3IKMB 3DTYA 1B0AA 3MTQA 4K9KA 2X0DA 4EAAA 2C3YA 4ID3A 1XP8A 4O63O 3DS8A 3HJBA 4R7GA 1FS6A 1ODFA 1U7PA 1CU1A 1N6KA 1V1RA 3C85A 4W9NC 5F64A 3PD7A 5K3CA 3V1TC 3OJEA 4IMIB 4PAGA 4JJAA 1HDIA 2LTAA 1TYZA 2ZEJA 1L5GB 1NX6A 1ADBA 1FTGA 2X1LA 5AJUA 1NP6A 5AW3A 4MR8A 1JIQA 1IVYA 1BWSA 2JS7A 2ORVA 1Q1ZA 1AQJA 3KSBC 3DEIA 1JXQA 3H1FA 3LGSA 1XKXA 3ZU2A 1U90A 1FP7A 3EQZA 3LJKA 3STUA 1HLDA 1KOJA 2FCAA 1VSVA 4P8RA 5IKMA 2ZSBA 4PBSA 1Q7EA 1O8BA 4YDSA 3RC2A 4QOHA 3VZSA 1VLMA 2XYRA 3DDOA 4HTFA 1DLJA 2D7DA 1FMCA 2I4OA 1H94A 3JSXA 1N9GA 2WNSA 3SQMA 8GPBA 4I2NA 4E7OA 1GL3A 1M8KA 2OGTA 4QGAA 3RI3A 4NJOA 1X80B 4UNPA 3I5AA 4ZKEA 3DZGA 2QGNA 4U5XA 2VQ6A 3FWHA 1XCLA 5F1PA 4YJ2A 5ICGA 1DRUA 1MJ5A 1HA3A 1HT0A 3VR6H 2VDKB 3OECA 3VGPA 3JATB 1I36A 1RTKA 4ZGBA 5DTRA 2J9YB 4G0UA 3R3JA 2OGZA 1KYWA 1NHWA 4TWJA 3WP1B 4C03A 4ZREA 4Z4QA 2WWGA 5IH3A 3U1TA 3H4IA 1QDLB 1RZRA 2IWRA 1F0PA 3ZY5A 3AJAA 1Y1RA 4QGBA 1LPMA 2VKTA 4JLMA 4DCGA 2X6QA 1M1XB 2YL2A 3NIFB 4GXRA 5LLTA 4O4IF 4IP0A 1P1IA 4NOKA 1XE3A 3H1TA 3I1JA 2IHJA 1ND6A 3QJYA 4LISA 4C3UA 1QHEA 5F5XA 1C1DA 5CEFA 2OR3A 3R77A 1FQWA 1K9VF 4TMFA 1GZHB 2XUQA 5L51A 4Q7LA 4M1MA 1VL8A 4RIHA 4BMZA 4CTMA 1YBFA 1RYDA 4U7WA 3FMOB 4DUGD 3QRWA 1I1QB 1OAOA 1IPFA 1FX0A 2JFWA 4XUCA 2BGWA 1TUIA 3PGKA 4LGCA 1AIPA 4E11A 4GC5A 1CEQA 3BUSA 1A8QA 4M38A 1U0EA 1T5LA 2IZZA 1OJLA 2LXNA 2OV8A 2QMZA 1TLTA 2Z57A 4RA9B 4XPZA 2UVPB 2PL1A 4DILA 1O96B 2ATXA 3DSRA 4ZZ1A 1CUHA 2IIQA 1VDZA 3I53A 4FS3A 1QIJA 3KBOA 1VLJA 2O6LA 2Q0XA 2WTXA 1JDNA 4E13A 4BFWA 3TM4A 2YIMA 3IUEA 1COWD 1Y8ZA 2YY7A 3KQMA 2VPTA 3PPIA 4J0CA 3H83A 1LXCA 2Q62A 1EK0A 1OU0A 3IAM6 5K0EA 1ZIDA 5KC9A 3IRVA 3L0PA 3P2JA 4CKEB 4F5YA 4K1XA 1LF0A 3LWZA 1G19A 1L4BA 3VVMA 5HRAA 4FONA 1KPGA 4KN6A 1ZJ4A 1T9BA 5GY7A 5AQ1A 2DY1A 1L2TA 3KB2A 4DPMA 2JLWA 3QV1A 1ZRSA 2II6A 1CB7A 3AW9A 4AW9A 1ORTA 1SC3A 3FPJA 3HGMA 4NHEA 3PUIA 3WKDA 2H51A 3C70A 3VYWA 3I12A 5HA5A 3DMFA 1R0ZA 4MW6A 2H9IA 4Z3DA 4DSZA 4KQCA 3TSYA 3OJLA 3R9XA 2XZOA 1KVRA 1QX3A 2OE2A 4KUHA 4RJJA 3AI3A 3RT7A 1E3SA 3Q7PA 3VOSA 3WGNA 5EE9A 4D9FA 2NN3C 4W6ZA 1XAJA 5TR9A 1HLFA 4U7PB 3GEGA 4FHZA 1BO6A 3DEJA 4KLRA 4OGLA 2JAWA 7REQA 2E48A 3SSAA 3TMKA 3WMRA 1CUGA 5SYMA 1YNOA 5FLYA 4Q4DA 2FZEA 3P32A 3KSAC 2QRZA 4FJ0A 3ESDA 3I32A 3KHSA 721PA 2YWHA 1ZCJA 3I37X 1NRWA 4HGYA 5IZCA 1KWKA 1T4DA 2VJBA 3BSFA 1PNQA 1UZAA 4BJ5A 2PLRA 1QGDA 1PT6A 3FNIA 3KS9A 2MSLA 1E79A 4I19A 3K0BA 5AW2A 1L3IA 1POXA 3L02A