3IBTA

Structure of 1h-3-hydroxy-4-oxoquinoline 2,4-dioxygenase (qdo)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
263
structure length
263
Chain Sequence
MQSLNVNGTLMTYSESGDPHAPTLFLLSGWCQDHRLFKNLAPLLARDFHVICPDWRGHDAKQTDSGDFDSQTLAQDLLAFIDAKGIRDFQMVSTSHGCWVNIDVCEQLGAARLPKTIIIDWLLQPHPGFWQQLAEGQHPTEYVAGRQSFFDEWAETTDNADVLNHLRNEMPWFHGEMWQRACREIEANYRTWGSPLDRMDSLPQKPEICHIYSQPLSQDYRQLQLEFAAGHSWFHPRHIPGRTHFPSLENPVAVAQAIREFLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for cofactor-independent dioxygenation of N-heteroaromatic compounds at the alpha/beta-hydrolase fold.
pubmed doi rcsb
molecule keywords 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase
molecule tags Oxidoreductase
source organism Pseudomonas putida
total genus 80
structure length 263
sequence length 263
ec nomenclature ec 1.13.11.47: 3-hydroxy-4-oxoquinoline 2,4-dioxygenase.
pdb deposition date 2009-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.210.20 Mainly Alpha Orthogonal Bundle Uteroglobin Uteroglobin 3ibtA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ibtA01
3G8YA 1F0NA 1CUEA 1QFSA 3Q0TA 3G7NA 3QPAA 4B7ZA 3ICVA 4X95A 3VJMA 2OGSA 2PM8A 3ANSA 3ESCA 1Q84A 3O0DA 3SWWA 1VXOA 2HL6A 5JIBA 2WFZA 3HEAA 4J0GA 5AK4A 2I78A 2OCIA 5DYTA 2HADA 1XRQA 3TGLA 4BE9A 1R9MA 1U65A 3WKBA 1VLQA 2VT6A 2GYWA 5ESRA 5AKZA 1G66A 5CH8A 3IBTA 5AKGA 1AZWA 3STTA 3FVRA 1GQSA 2ZYIA 1CR6A 1O6GA 1W1IA 3AFIA 3N0TA 4UFNA 4G5XA 1K6EA 3H17A 3WKEA 1D07A 4W1PA 1GPKA 5ALRA 3UMJA 3I6ZA 1SCIA 5K3FA 4JYPA 4CCWA 4UHDA 4G8BA 1MO2A 4U2EA 5K3FB 1YS1X 5T4EA 4ZXFA 1LNSA 2JGKA 4Y2UA 4BC1A 3C6YA 3U0VA 5AK6A 3LIIA 4UBMA 5KBYA 3HZOA 4AX4A 5CXUA 2GYUA 4HRYA 4FOLA 3IULA 4AN0A 2JEYA 2JGIA 4CG1A 4F0JA 1DWOA 2XQFA 5DNWA 3AZQA 1FFDA 1TQHA 5EIEA 2Z3WA 4QA9A 4OB7A 1WB4A 3I6MA 4OYYA 4Y2YA 4DSZA 4B81A 3FBWA 3ZI7A 4OYLA 2RAUA 2B20A 1LPSA 3NUZA 1H2WA 2PPLA 3V1LA 2QT9A 1DTEA 1QIMA 4N5IX 4L0CA 2Z5GA 3N2ZB 5C8XA 3H1AA 3WLAA 5AICA 5CH3A 3HLKA 4G9GA 4H77A 1GKLA 5LKRA 5K3EA 2ZYRA 4WY8A 1X70A 2WUFA 4A5SA 1MX1A 4CIBA 3K2IA 2CZQA 1Y37A 2WTMA 2OQIA 1UFOA 4WFKA 5HKAA 4N5HX 3PFBA 4EZIA 3WK8A 5AI9A 1MX5A 3WL5A 4B84A 2QUAA 4Y2QA 2WHQA 2HA7A 1EDEA 1OILA 4F21A 1WHSA 1VOTA 1K63A 4BRZA 3PICA 3H2IA 2VJDA 5ALHA 4HS9A 5JALA 3GELA 3H2GA 4TGLA 5A6VA 3R3YA 3VVMA 4L72A 3IUQA 3V1NA 1XZIA 4WCVA 5T4FA 1EH5A 1N5RA 3MGAA 2XDWA 2VAVA 1AMNA 3B12A 4E11A 1SCQA 2WM2A 4UBNA 4UBJA 1EDBA 4FTWA 3WL8A 3QVMA 5AM0A 1YSCA 4FHZA 5CURA 3G9UA 5AJHA 1CQZA 2B4KA 1H2YA 5AHXA 3SC2A 4X3CA 2Y2VA 3WKAA 2OCKA 5AI6A 5HQ3A 2AJ8A 3A6ZA 2WILA 2VTVA 1CV2A 2B9VA 1T4MA 4NVRA 5HQ3B 3WIBA 2HHAA 1W4LA 3S8YA 1LBSA 5D7BA 3TEJA 1WCYA 3DKKA 1P0PA 4P08A 1B6GA 4EB0A 1EX9A 1YCDA 1ZI6A 2GYVA 3QMMA 4EA6A 4X71A 4DMCA 3NOXA 2VT7A 3MUOA 1CUXA 1AKNA 1Z68A 3OURA 4GBGA 3ESDA 3QPDA 3JWEA 4KAJA 2GBFA 4QZVA 2WTNA 1DWQA 4G4JA 3A2LA 5EHNA 2RHWA 4PSUA 1SCKA 5T4HA 1CIJA 3EIOA 1CUFA 1WPXA 2JGFA 4C4XA 5AOAA 3D0KA 1UK7A 2VJAA 3I2IA 2ZJ7A 4KACA 4HTAA 1ZI9A 5DWDA 1I6WA 2XUGA 4OUKX 1UKBA 2O2IA 1CUCA 5FKJA 1NU6A 3OM8A 5AIAA 4OCZA 2VJBA 4D9JA 5LZ2A 3I2HA 1XLVA 4TVKA 1WPRA 1EK2A 2WHPA 1UXOA 3C5WP 3STXA 2H7XA 2XUQA 3BWXA 5CT5A 1VZ2A 2WSLA 1QFMA 3M82A 1XRLA 5JASA 2H9YA 4DGQA 5ISMA 3RK4A 4PNZA 1ZGCA 4W1QA 3ZPXA 3ZV7A 1VA5A 1WOMA 4G8DA 3WIOA 1E89A 1CUYA 3D2BA 3ICWA 1VJ5A 1QIEA 3HJUA 2PVSA 3C87A 1RP1A 1QOZA 5EI5A 3E1GA 3FVTA 4QDTA 4FNGA 1XZMA 3V1KA 5ALDA 1XQYA 3IA2A 4K6KA 4ZGBA 1THGA 2VF2A 2XLCA 4CCYA 2C4HA 3STVA 2HFKA 4C6HA 2BUAA 2DQZA 3BXPA 2QUBA 5AKKA 3FLAA 4ITVA 3WQHA 1FFBA 4EBBA 3QYJA 1MX9A 2QOEA 2ZYSA 2I03A 1QIGA 2OXEA 3IB3A 5AOCA 1IZ8A 3WI7A 3HYSA 3B5EA 1GPLA 4XWGA 2H1IA 4BTVA 5D3KA 1G42A 4PV7A 5K3CA 4UPDA 2OAEA 1TAHA 1CUIA 1SFRA 3BF8A 2J4CA 1F0PA 4BAUA 5AM1A 2VQ6A 4LXIA 5HF9A 3G0IA 4PF1A 5I8PA 3IUNA 5CT4A 1H2XA 3DL4A 4MYDA 1DWPA 2PSDA 3WZMA 2BAGA 3VJKA 5JYCA 2YASA 4JNCA 5JZBA 4ZREA 5ALEA 4GDMA 4KE9A 2G63A 1S8OA 5JZ9A 1UOQA 1GZ7A 4LKOA 3WK7A 3R3VA 2XI4A 3O4JA 1CEXA 4WFJA 3WK9A 5HFNA 4DMHA 4TPKA 3V9AA 1XKTA 4C87A 2XLBA 1JJFA 1F6WA 2PKYX 2WQZA 1YA8A 4J03A 2CMFA 2OGZA 5ALQA 1GXSA 1R4ZA 3O9VA 4ZV7A 2EDAA 1EDDA 2XUFA 5LZ4A 1W52X 2HA3A 4BCDA 2BGRA 5DYYA 1ZIXA 4Q3OA 3FOBA 4DNQA 4LHEA 4X97A 4AZ3A 3FSGA 4LIPD 2XUPA 4L9AA 4WJLA 1PJAA 4J0DA 4LXHA 2O7RA 5CH5A 2XQKA 5AM2A 2EDCA 4JUIA 3DL7A 2Z8XA 1QIKA 5ALWA 2ROQA 4CG3A 4UHEA 3F97A 4UHHA 2DHEA 4Q82A 3GBSA 1H23A 3GZJA 5ALJA 3H18A 4Y2SA 4CIAA 5SYNA 1E8MA 4RGYA 1CUHA 1ZI8A 1B41A 3FCXA 3HRHA 5ALXA 4J3JA 5AI5A 1HBJA 1YAHA 1MT3A 2HA6A 4E15A 3FYUC 2XQGA 3AZPA 4I4CA 2VEOA 2QXTA 2G4LA 2HA4A 4DNPA 4K6GA 3D59A 4IHAA 1DT3A 4Y2PA 2WFMA 5IVHA 3WMRA 4WDRA 2QJRA 5LYYA 3QBJA 5AM3A 2JF0A 3WWDA 1WB6A 4MQMA 1J1IA 1YR2A 3F8SA 3GUUA 4DM7A 5JARA 3D2CA 3L1IA 2HFJA 2WUDA 3WL7A 1EA5A 2ORYA 3O4IA 3W9UA 2HU7A 1K8QA 1UOOA 1LGYA 4H0CA 1IUPA 3QM1A 1XKLA 3A70A 5A7HA 4LYEA 1MNQA 4DNFA 5CT9A 5LZ5A 5I7UA 1UZAA 4A23A 2V97A 2JGJA 3OG9A 4B82A 1E8NA 5ALYA 5HF5A 2WG1A 3TJMA 1JJIA 5FV4A 4L3WA 2DHDA 1GQRA 1E8DA 1LPNA 3Q8WA 4BP8A 4AO7A 1P0IA 3UUFA 1XZHA 4BP9A 1CQWA 3WK4A 1YAJA 2HRRA 5JD5A 4EY4A 2ZJFA 2XMRA 4GHWA 4G4GA 4YASA 2PSEA 1AQLA 2W22A 2XT0A 2JIDA 3D3NA 2PUJA 1CVLA 4GLBA 4M0EA 3WKCA 3R3XA 1PFQA 4E46A 4QDOA 4FBMA 4M0MA 1OCEA 5LP1A 1BE0A 4ARBA 3WYNA 1BEZA 1DINA 3DQZA 4B9EA 1LPAB 2ES4A 2D5LA 1AGYA 3FNBA 3DOHA 1DQYA 4QWMA 2ZJ6A 2ACEA 2Q0XA 5FPPA 2XMQA 1SC9A 3L1JA 3I28A 4QLOA 5LZ8A 2OCLA 2C0PA 4AN1A 2OG1A 2XUHA 1TCCA 4HXFB 3I2JA 4OD0A 2JGMA 3PI6A 1QJ4A 2DR0A 2OLEA 3QH4A 1EXWA 4X00A 5HK9A 3I1IA 4INZA 3WK6A 3IIIA 5LZ7A 5ALFA 3O9MA 1VKHA 2RONA 3H2JA 2WHRA 4DLNA 4B9AA 4BZWA 2QTBA 2IX9A 1AURA 4U2DA 2QMQA 2AJCA 1EB9A 1Y7IA 4QNNA 1G4HA 4EY7A 3EF3A 1QO9A 1XZDA 3VVLA 4FFWA 4DSAA 4KRYA 3W9BA 3WJ2A 1CUJA 5EHZA 1EINA 1XRPA 2HA0A 2ZSHA 2XUJA 1JMYA 2Y2UA 2AJBA 2RI6A 5IVIA 4EY8A 1L7AA 3BF7A 1EVQA 4ROTA 2HA2A 5CRIA 4H7EA 4FFVA 2I3DA 2WJ6A 3DDUA 3H0CA 5ALGA 5K3AA 3WA6A 1XZCA 1XZKA 1IUNA 2ECFA 3WA7A 1JI3A 1CFJA 3C70A 2FJ0A 5ALUA 1ZD3A 3EQ7A 3GFFA 1QGED 1G5FA 3EBLA 1LLFA 3DD5A 1H22A 3G02A 2WIJA 5A71A 1ISPA 3PF9A 2G5PA 2WUGA 1E3QA 1GPNA 1K5PA 5A2GA 4QDXA 2QZPA 3STYA 1C4XA 1QIDA 2WJ4A 2VJCA 1CUUA 3WKDA 1QLWA 5JANA 2GBIA 1CRLA 3BE8A 3VDXA 3FYUA 3WZLA 4BTLA 5FRDA 3F9CA 3I2FA 5D6OA 5BOVA 3WJ1A 4JH0A 1XZLA 2C7BA 3FYUB 1BS9A 3G9TA 4KAAA 4WFIA 3I2KA 1QIHA 2AJLI 1UWCA 2OAGA 3MUNA 1USWA 5ALKA 4BCCA 5HCUA 2HDWA 3JYHA 3FLBA 1JU3A 5EHQA 2J3QA 3I2GA 4UHFA 2CKMA 3H1BA 2RGUA 5LIPA 3HACA 3H04A 4GXNA 3ESBA 3IURA 1OXMA 2R11A 2XMBA 2IITA 1O6FA 3C8DA 4X90A 5SYMA 4E14A 2QVBA 1ETHA 2I3ZA 1J07A 2JBWA 2XUDA 1F8UA 1IMJA 1CLEA 1Q0ZA 1MAAA 4H7JA 5AP9A 5CMLA 2XB6A 1MJ5A 4Q34A 4EHBA 4QEKA 3ESAA 1AX9A 2ZSIA 1X2EA 5DNVA 3R3WA 1A7UA 3QMVA 3KXPA 1MTZA 3SK0A 5AKHA 4ZI5A 4MEBA 2QM0A 4OPMA 2FUKA 4UBLA 5FXMA 2YYSA 2VATA 3SX4A 3W05A 4BATA 4J7AA 1N5MA 4G8CA 2BFNA 2OCGA 3KOOA 5LLSA 3FCYA 2DQYA 5AKYA 4AMYA 1XQXA 2Z3ZA 4MQLA 1BCRA 1PV1A 3AIOA 3PE6A 3WWEA 2JGLA 1JJBA 1RWQA 4FLMA 3WYDA 1CUWA 1XLWA 5JAHA 1GT6A 5EGNA 3ZLUA 3NGMA 1W6RA 1FJ2A 4GI1A 5CW2A 2PSFA 4N8EA 5BV7A 5ALNA 2DFPA 4DNOA 2C58A 4BBZA 1XZJA 4KYVA 3RARA 4C4ZA 1CUZA 4Y2RA 2XUIA 3OOSA 1GGVA 3DNMA 4H7IA 5ALIA 4A16A 3DLTA 1U2EA 2WLSA 1MU0A 3ED1A 4GW3A 4HXEB 1R88A 3ZLVA 2DHCA 3O95A 5HF6A 2WJ3A 4DTCA 2ONCA 2QR5A 3P2MA 3M3DA 4KEAA 1ZJ5A 1ZOIA 2OQVA 5ALZA 3STUA 4G4IA 4BZZA 1K4YA 2WFLA 3V48A 4FBLA 1BROA 1XZAA 4FKBA 2WFLB 2PL5A 1LBTA 4QDUA 1U4NA 3AIMA 1ZD4A 1EK1A 4IH1A 1QIJA 2PU5A 5LZ9A 2WIGA 4YPVA 1CUVA 5HFAA 4DMKA 1BU8A 1TK3A 1DQZA 4RE5A 1FFAA 2WIKA 3D4LA 3HC7A 3AJAA 4W9RA 4MXDA 2BUCA 4NZZA 1R9NA 2RHTA 5DJ5A 2V9ZA 2RIPA 3CXUA 1TKRA 2PSHA 4KRXA 1A8UA 1XFDA 3HXKA 4GECA 1ACLA 4DIUA 4UUQA 4C89A 2XE4A 3PUHA 2BJHA 2HU8A 3H2HA 1ZICA 2HA5A 3BDVA 1CUBA 1BN7A 5K3DA 3S2ZA 4XJVA 4PSCA 3ZWQA 5IVDA 2CUTA 4U2GA 2Y1KA 4H7HA 3OTQA 4HAIA 3GA7A 3D2AA 5AO9A 2HU5A 2GBGA 1R3DA 2J3DA 1MNAA 1L7RA 3KD2A 3T4UA 3C45A 5F4ZA 4Y2JA 4PO3X 1ZGBA 3R0VA 1TCAA 4I3FA 3PF8A 4KAFA 3X3HA 3CN7A 1QIIA 4X6UA 5AM4A 2WU4A 4EY6A 4AO8A 2AJDA 4FLEA 1KU6A 3PUIA 4Y2XA 3ILSA 3W2TA 4P92A 2PBLA 4Q1VA 4WDQA 4KR0A 5FUMA 1XZFA 3CN9A 1GKKA 3E3AA 3DEAA 5AKLA 4AQDA 1IVYA 2PSJA 3A2MA 5E2IA 3O4GA 4OU4A 3BJMA 3VKFA 1J06A 4B85A 1J2EA 1NU8A 3I1YA 4MWTA 3AIKA 2ACKA 2AXEA 2GZRA 2OGTA 2C0QA 4MEAA 4BDSA 4AB1A 5AKIA 1HQDA 5AI4A 3JW8A 4AO6A 4C01A 1IZ7A 2UZ0A 1HL7A 2O2GA 4BB0A 5J3JA 1YB6A 4ARAA 2WKWA 3DYVA 2YH2A 4BDTA 2VSQA 2XMGA 3C5VA 4PSDA 2HM7A 5K3BA 3R41A 4H35A 2Z8ZA 1SOMA 3OPMA 1YA4A 4X6XA 5C8ZA 2WUEA 1HKHA 4KE6A 4X92A 2H7YA 3DJYA 5JAUA 3YASA 4DMFA 3BJRA 1DU4A 3C43A 3H2KA 5ALOA 4Y7DA 4J0HA 3IUMA 3AILA 4KE8A 1DX4A 2BKLA 5FLKA 3LIPA 4JYMA 4UHCA 1XZBA 4QLAA 4P9NA 4NS4A 3U1TA 3NWOA 1KU0A 1BRTA 2J4FA 4FWBA 4AMZA 3R3ZA 1E66A 1MN6A 1BEEA 1LPOA 1DX6A 1TCBA 1WM1A 5A7FA 4UFOA 2R8BA 5AKEA 4B83A 4X93A 5KREA 1P0MA 3LLCA 2WIFA 4U2CA 1Q0RA 1N1MA 4KE7A 5KWIA 5DLPA 4Y2VA 1DT5A 2JGEA 1TIBA 2E3JA 2HIHA 5A62A 1E5TA 4N8SA 4J0KA 5FOQA 1C7JA 5FDFA 3F67A 4QE3A 1LZLA 5ALSA 1ORVA 2PX6A 1AUOA 4HXGA 4NMWA 5CT6A 4BVKA 4V2IA 3DOIA 5KWJA 1UOPA 4RPCA 5I9IA 4MWSA 4KJXA 2PU7A 1FSSA 2XMZA 3DYIA 3ANTA 5AM5A 4BVJA 5ALPA 1WB5A 3K9BA 1T2NA 3H19A 3IDAA 4YK7A 2XQIA 1BCSA 3C6ZA 2LIPA 5AK5A 4C4YA 3M81A 5AK3A 3LP5A 2GZSA 3STWA 3G9ZA 5AKJA 4X7BA 4HVTA 5FPQA 4FDMA 3RKSA 1ODCA 2P8SA 3DKRA 5EFZA 2ZYHA 1ZD5A 2ZVDA 3M83A 1THTA 2QS9A 4UHBA 1A8QA 2WIDA 4N8DA 1XRRA 4U2BA 1ZD2P 5IKXA 4MYSA 2X76A 2QKYA 5D3ZA 5AOBA 3E4DA 3K6KA 5T4BA 5IVKA 4IQ4A 3WL6A 1QO7A 5BWBA 4J0JA 2XMSA 1KEZA 3VISA 3PFCA 4U2FA 2CEKA 1JFRA 3AZOA 5CBKA 3KWFA 4X85A 3QMWA 4FNMA 2CJPA 1A8SA 1XLUA 5JD6A 1EI9A 3MVEA 3FSGD 1EVEA 4EY5A 3CCBA 3DCNA 5DNUA 4M0FA 1IUOA 4Q3LA 3W04A 4OU5A 1CUSA 4W1RA 2XQJA 5ALLA 4DYHA 3LCRA 4S0XA 2G5TA 4C88A 5EIAA 1Q83A 2FX5A 5JAPA 2VA9A 3F96A 1CUGA 3HI4A 3E0XA 5AH0A 1LPBB 3KWJA 2Y6UA 3WWCA 2CBGA 3G9XA 1ZIYA 4XVCA 1QE3A 3I6YA 2V98A 1XROA 4HRXA 1H2ZA 3KSRA 4W1SA 3VJLA 1XZGA 1XRMA 3PDCA 5JD4A 2QXUA 3FWHA 3LS2A 4OB6A 3G0CA 3HABA 4UBOA 4UBIA 3TRDA 1R1DA 2XUOA 5JADA 4H18A 1JKMA 1FFCA 4G9EA 4F60A 3QITA 4BAGA 4ZV9A 2K2QB 2XUKA 1P0QA 1XZEA 3W06A 5ALTA 4B80A 2PUHA 4IO0A 2C5FA 3R3UA 5E4TA 1UK8A 5H3HA 2YXPX 4B0OA 4OSEA 1XQVA 1UT6A 4ETWA 4GEGA 3T52A 3D5EA 5LKAA 3D7RA 4O08A 2D0DA 4X6YA 1A88A 4BAZA 3RLIA 2WHPB 4XX1A 2V96A 4QWWA 5A7GA 1C7IA 4QDZA 4K5QA 2BGNA 4EUSA 5AIBA 2WU3A 1AC5A 2CB9A 4G1FA 5CTAA 5HF8A 3RM3A 4MJ3A 2X5XA 1M33A 1HDEA 3G0BA 4J0CA 1JU4A 3BIWA 1TRHA 5C7YA 1YS2X 4FLFA 1RYYA 2C5GA 2EEPA 4CFSA 4XIIA 4H7FA 4B0PA 5JZSA 5CT8A 2XMDA 3R40A 2DSNA 1UK6A 3F98A 1VA4A 4UBKA 2BCEA 1UKAA 4CCYB 4ZWNA 5C8VA 1FFEA 4H7KA 5DYWA 1R50A 4BYMA 1ORWA 1CUDA 3EQ9A 1LPMA 3AUKA 4AXBA 2FJPA 4F5ZA 3QPCA 1X2BA 2H7CA 4CI9A 1L7QA 4CG2A 5EHXA 1CPYA 1U8EA 3FAKA 5DTJA 4JEIA 3C6BA 4HZGA 5HKBA 4J0IA 1YASA 2QJWA 5AKXA 1ZJ4A 5AI8A 3IUJA 4FMPA 2XMCA 5E4JA 1QIFA 4RE6A 4RNCA 5FP0A 2B61A 4BVLA 7YASA 4I19A 3O4HA 2O7VA 2WG0A 2X8BA 3BL8A 4K6HA 5IH7A 1MAHA 5K5EA 1MPXA 3BDIA 1EHYA 3EQ8A 1VXRA 6YASA 5E4YA 1W76A 3CCCA 4LXGA 4AZ0A 5AI0A 1BN6A 1VZ3A 1JMKC 1W75A 4Q05A 1N8SA 3DS8A 1HPLA 4H7DA 4Y2TA 4BRSA 3OC0A 4OB8A 1XRNA 3B3QA 3L1HA 4PW0A 2IIVA 5JAOA 4BE4A 5HK8A 2WG2A 4K2AA 2NW6A 4UFPA 1QTRA 3G0GA 1ODTC 2OPHA 3BIXA 4IH9A 2GBCA 3A2NA 5DTIA 3WWOA 1NX9A 4BC0A 1UK9A 1CUAA 1LZKA 5ALMA 3QZUA 4IH4A 4X91A 1QONA 1HLGA 1WHTA 2JEZA 3C8HA 3C6XA 1VE7A 3WK5A 4B6GA 4W63A 3HSSA 4GWLA 4WY5A 3WWPA 4ZRDA 2VAXA 5ALVA 4X94A 1LPPA 2HRQA 5HZGA 5EIHA 1VE6A 2W6CX 3ZLTA 1JT2A 4BCBA 4Y9SA 1QZ3A 2DCMA 2XUAA 2Y6VA 3G0DA 1QTIA 4LYDA 3FLEA 4P93A 3IVMA 1EB8A 1ODSA 5JATA 1ACJA 3VXKA 2BUBA 3KDAA 1YB7A 3UUEA 5YASA 3V1MA 4PQEA 1XQWA 3FYTA 5C81A 1UKCA 4Q3KA 4YX9A 1Y7HA 4Z49A 2O2HA 2QRUA 3GROA 3AINA 5CXXA 5BWCA
chains in the Genus database with same CATH superfamily
3HJAA 2ZREA 1DEKA 3DHWC 3FPAA 2GK7A 4LF5B 1EGHA 4CF3A 3OIVA 2RG1A 1GPDG 1JQJC 1LK0A 1JLRA 2L18A 2CJFA 4D98A 1S2OA 1FTQA 1UWKA 2O9JA 1TPYA 1JT9A 3A9VA 5P21A 5P8WA 4LGVA 3VZCA 1G8HA 3W1EA 1F38A 1ZGHA 3HJTA 3ICVA 2XT9A 3V4ZA 4NQRA 3AU8A 1P60A 3WIDA 4CVNA 3AI1A 4QU9A 2IHBA 4OHMA 3N8HA 4UZFA 3X2SA 1DOAA 7REQB 1GZDA 2D00A 1QYXA 2IYNA 4WZBE 1EFCA 2PM8A 5K0EA 2I6TA 1E6LA 2AMYA 2VP3A 3PGJA 3VC3A 1PP4A 1Q84A 3EY9A 5ITZA 3WTCA 4GVPA 5JPCA 5MFZA 2HL6A 1G5TA 5LIRA 4OK5A 4ENUA 1EPUA 3A6DA 3KBBA 1P7ZA 4FFMA 3RTCA 1K7YA 2IC5A 4J0GA 1OXVA 4MV6A 4PC2A 4R8VA 1UC5B 1Z0UA 3A27A 3CE6A 3HVHA 4BWVA 5KTPA 1U3DA 4O59O 4MDHA 1Q0QA 2XUZA 3EH1A 2HSDA 3P0RA 4KR2A 3QVOA 1FX0B 1R9MA 2X14A 3S5JA 1VL1A 3UBMA 3WKBA 3VSBA 1OAKA 3FB4A 1JA1A 1ILEA 3DHEA 5JI3E 1T2CA 1KL7A 2NYVA 4GZ3A 2ET6A 3NAGA 5AKZA 1X7HA 4CT4B 4DDMA 4N5DA 5AKGA 1AZWA 1C8BA 3ABZA 3FVRA 1GQSA 2Q29A 4I9NA 4NBKA 3T9FA 1ZW1A 4B4DA 1EAMA 2HLDA 8MHTA 3SXPA 4I3GA 4GRAA 1KO1A 1W36C 1HOTA 4MIKA 2H2DA 1W1IA 3RRYA 3OY2A 4JVMA 4WXMA 4DYVA 3ZY6A 2Q3MA 3RT7A 1BOOA 1F17A 5CA1F 4C0SA 5CBPA 1W36D 8ATCA 4CEIB 1UM8A 2GFQA 3AG6A 1X1EA 4BV3A 4G5XA 3U56A 2C88A 4FM9A 4AMUA 3FETA 5JPDA 3H17A 1UP7A 3KE8A 3LT2A 3WKEA 1GPKA 2BFBA 3GT4A 2NU6B 3ER9A 2N75A 4G63A 4IGKA 2E6KA 3DMTC 3W5VA 1F4LA 4F4DA 4F4IA 5LJLA 5B7GA 4DR4B 1NN1A 5D01A 4P1ZA 4UM5A 4MTCA 2ERXA 1P2VA 3FYSA 4CCWA 1ECPA 4KSYA 1O0BA 1MQSA 4K6MA 4UHDA 4URZR 5IXSA 5FR1A 1MO2A 2IKSA 1OZ0A 5FBKA 1EK5A 5JBQA 4QM7A 4DDKA 1PKEA 4ZXFA 4YQYA 1Z0ZA 3Q87B 3PXBA 1IXKA 5EXXA 3UTDA 3C6YA 3K6SA 4HATA 1JDJA 1PZFA 3U0VA 4FEYA 1PWXA 3LIIA 5AK6A 3SICE 1RXWA 2DETA 4ESVA 2UZ1A 3AKDA 2ZW9A 4WMLA 1R4MA 1Q50A 4N0MA 5F2NA 4TYQA 5JFGA 1R0KA 5EP4A 4FOLA 2H9AA 4X85A 1M1ZA 1SHZA 4GM1A 4BFUA 5BUSA 2NGRA 3IULA 4AN0A 4YRIA 5GV8A 1GA4A 1JXAA 2C61A 4CG1A 2F90A 4F0JA 4A8TA 3F3KA 3HA5A 3DV0A 1HK7A 2IYEA 2CXNA 1BMFA 4I1VA 4MICA 2DPGA 3AU9A 2G0TA 3QSGA 4YRSA 2AW5A 5EIEA 2GH1A 2GRUA 5K6TA 1VE1A 1Q0HA 4QA9A 4JUFA 4TT3A 1F1BA 4E2ZA 4BLOA 1M0WA 2Y68A 4FYVA 1Y7PA 1XQ1A 4JENA 4NU6A 4OYYA 3FF4A 3A14A 3DA8A 4RS4A 4Y2YA 4DSZA 5KZMB 4YJ2B 4QVIA 2V65A 2OZLB 2EWVA 3C2QA 4OYLA 1RPJA 4UNRA 3JWJA 4D0RA 1QX3A 2PHZA 4UM9B 5ADWA 1OASA 4C06A 4CKZA 1NRXA 1Z2EA 3MSXA 1EFRD 3SS8A 3CNNA 3RRBA 4NZNA 1Z28A 4BQNA 4BQOA 2QT9A 1DTEA 1QIMA 1BNCA 4L0CA 2QZJA 5T67A 3TNFA 3W7BA 4F9TA 4YRKA 3GJ6A 5KIAA 4DUGA 2HRZA 3U13A 1E9EA 2ATVA 3IV9A 3RV3A 2GJ4A 3THOA 1KMCA 1N2HA 2BFCB 2IYSA 3L46A 3RVOA 3ZW7A 5KMGB 4YAJA 5EQJB 4P2GA 3WOHA 5AICA 3V4SA 4ZI7A 1J9EA 2C4UA 3HB4X 3KQLA 3HLKA 4G1VA 4H77A 4LV5B 2IPXA 3IJ5A 1Z5PA 5E3IA 2JW5A 5NULA 4BB5A 4MLDA 2F48A 4AD8A 5JCXA 3A6GA 2R1TA 2Y1EA 1DO8A 1NUPA 1U0LA 1ULSA 3EVEA 3NU1A 3PFKA 5K3EA 2ZYRA 1RVV1 3I42A 4MAMA 3BMNB 4L08A 4IOMA 3DLBA 3CVUA 3RVRA 1X70A 4OMDA 1EWTA 3EFEA 4P2BA 5DE3A 4G0ZA 3UT5A 2PKRA 3ZXXA 1UDRA 3GQBB 4OBXA 5B2EA 3LBIA 4GR5A 1Y37A 4H3VA 2GFIA 5K01A 1YVDA 2LV8A 2MMCA 3BWEA 1WSBA 3CS3A 3JQ9C 2YHIA 3KOMA 1WCWA 1VCMA 4WECA 2CFRA 1AKWA 4OJMX 1XE3A 2OFXA 3JV7A 4HGNA 1I2BA 4W6QA 1PIWA 3QE9Y 2Q6TA 4XGQA 4JJZA 2ZRKA 1E2FA 3UATA 1MX5A 1I4DD 1KDRA 1E98A 3WL5A 4B84A 4MDFA 4WN9A 4LRQA 4D3DA 1AKRA 3JAWA 2VTBA 4YBRA 4MJXA 4CM8A 1M2FA 3R2JA 4OY3A 3IBGA 3T4PA 4N5NA 3GCDA 2OFFA 3V4FA 3LY7A 4B2LA 4BRZA 2ZUSA 2JLCA 1F0KA 3SYRA 4TZ6A 3WGHA 4L4SA 2RKWA 2LWIA 3KQSA 3G8BA 4Q4JB 4CV3A 3TLBA 4W7IA 1DC8A 3WAJA 4CLOA 1CXZA 4BNKA 2VSFA 4G1BA 1IOWA 2PMDA 1OMOA 1L0BA 2NZWA 5MFPA 3LPAA 1UJNA 3GLVA 3AESB 3GELA 1VL6A 3ZNNA 3KQQA 4LX0A 4E5DA 5H59A 3IR7A 1EFDN 5A6VA 3DGEC 1S2GA 3L4JA 1Y4ZA 1QLHA 3BRQA 4NG5A 3HXTA 1ACMA 4TLCA 3G6KA 4DBLE 1RYEA 3O90A 2QRVB 3QE4A 4LBWA 4D1YA 3BBPA 1XZIA 5TJHA 1IXZA 3FMVA 3NM6B 3VPCA 1F2DA 1N9KA 2XDWA 1PTJA 5I45A 2B4YA 4E2XA 4IIBA 4TLMB 2JLUA 2QYOA 1IM5A 2BEWB 3OZIA 4YXFA 1E2QA 1Z4KA 2C5SA 4LJ8A 4EA7A 1R8JA 2BONA 2EF0A 4RHEA 4ZQGA 3O83A 3BSYA 4KKXB 4A36A 3D6JA 1EDBA 1O08A 4CT5A 1SEVA 3QVMA 5JCOC 3OCVA 5AM0A 3B60A 2NO4A 4FHZA 4GD3Q 4JN6B 2OZVA 3X1YA 3TIXB 2NXJA 2ZS8A 3CU5A 2V1XA 2IYRA 4LY0A 4Q6BA 1T43A 2UUPA 2QV0A 3UHAA 3DEJA 5AHXA 3QMPA 4X3CA 2QE7A 1NMZA 3JQAB 4XM1A 5AI6A 3CRVA 2OBFA 2WILA 4KQEA 1T1IA 3L82B 2HWXA 2XZPA 4HEA6 4C0XA 5CVDA 2WDZA 2NUTB 3I37X 4MUEA 4K26A 3PNMA 4Z7NB 1EJ0A 3WLOA 2AWNA 4KJZA 4WWHA 4EO7A 4X84A 3CZ9A 3GRAA 5KYUA 3TTWA 3L02A 1L5VA 4JOSA 4RK6A 3DEIA 1KZHA 4B09A 1IBLB 3QLJA 4EGAA 4Q5IA 1KZYC 5CLQA 1T13A 1QC5B 1T4GA 3F4KA 2ZT6A 3KVRA 4WESA 2CNKA 2RH9B 3KNZA 3N2NA 4ZHSA 2GPJA 3ACDA 4YMIA 3T9CA 3TEMA 1EESA 4OBBA 1B3BA 3HYLA 4IIEA 4KN5A 1P7YA 2VBGA 4RD2A 1KNXA 5DT9A 1P0PA 2Q2NA 4AWBA 4CLHA 1QP4A 2FMFA 4EB0A 1B6GA 3BD8A 4X45A 2ZUWA 2MIIA 2FGJA 3GF4A 4TQUS 1NQ5A 4P4SB 3TSZA 1ZA1A 2HTFA 1WCXA 4IVPA 3GCZA 4L5AA 4NBVA 4YMSA 3VO1A 4Z2AA 3DXZA 4ER7A 1SRRA 3NG1A 5COQA 1XJCA 4YDRA 1Z5NA 2FSFA 1CZUA 4X66B 2GYVA 3QMMA 2GAAA 3LCVB 3HU3A 2QI9F 2R6JA 3PC6A 4FHDA 3S5UA 4R0MA 5CLLA 1VL0A 2VT7A 4N7MA 4I9GA 4BNLA 4QBGB 1SD2A 1AKNA 4XYBA 1UEJA 3BE5A 3ETHA 3JWEA 3QPDA 4MRMA 1XCJA 5KSZA 2C7QA 2G70A 2XWSA 1W48A 2OO5C 2GBFA 3Q6IA 2PXHA 1R10A 2R6FA 3EGXA 3ESZA 4DLWA 4JHLA 4KX5A 4WKOA 4QZVA 3GEDA 1JIJA 2Y67A 1GNSA 2R00A 2WTNA 3D3WB 4G4JA 4GAEA 4LDAA 3LWBA 1XC7A 4ZEVA 3TVTA 2OGWA 1L4MA 4JP2A 5I51A 2BM1A 2PTHA 2V45A 4E1AA 2RHWA 3K0CA 3C8MA 1XP8A 2AG5A 3BMXA 3WGMA 1A8IA 1QYIA 1DB3A 1YCFA 2X3YA 4PEVA 4QICA 3KSAC 1JEQB 3VR1A 4GBED 1WPXA 2C00A 1GCAA 2NXNA 3VPXA 2QMUA 5AOAA 1B0UA 3IE1A 4Z54A 4R8MA 3HVRA 3OU2A 3L8GA 1KPHA 1W0JA 2HK8A 2XRFA 2Z6QA 4RAOA 4RM3A 3RVLA 4BP1A 5ES3A 4EQ6B 1JG2A 3TAHA 1OBCA 2O4CA 5EZSA 4PN3A 5BOSA 1STOA 1CJBA 3SGLA 4LF9B 3I3SR 4HZIA 4JELA 1HFKA 4MZDA 4PXAA 2ASVA 5LXTA 4BP3A 1UKBA 1EZ1A 2WLTA 1KZGB 1T9GS 3HXQA 2VJPA 3BMCB 1XCGB 2C9MA 3BEDA 3C98A 3H5AA 4AG3A 3U61B 3MFQA 5H80A 3FNIA 1D1SA 3GK3A 4QGSA 5AIAA 3F7OA 1GNRA 4FCTA 1LQ2A 4LZZA 4CTKA 2PRIA 2JVJA 3I2HA 1OQAA 2V9CA 4WK6A 1XLVA 1D6NA 3MGKA 2PEZA 4RJKA 4IS2A 4KWTA 2GD0A 4NDAA 4IDOA 4UDYX 5GGYA 2VLBA 2XEDA 4WA8A 4RTKA 4YRJA 1YS7A 1TZKA 4AQYB 5CNJA 4S2EA 4TYWA 3B1ZA 3STXA 2JATA 5BNTA 1J24A 3VPDA 4YRAA 2BOVA 1IOZA 2FDRA 2JLRA 2P4UA 3BWXA 3KR9A 2YFQA 1JN0A 3NDPA 4NECA 1FNNA 3PNQA 1Z34A 4MHSA 2ZJ5A 1M9NA 1OLOA 3M82A 3F6CA 1XRLA 3T1OA 3E81A 4LXXA 1FXWA 4EYKA 5LU9A 1A2QA 4DGQA 2FCAA 1DOHA 2R1UA 2V58A 3AGPA 4H0NA 5JPIA 5A9SB 2MHCA 1GPYA 1ZGCA 5BW6B 3ZPXA 1Q2UA 1WWKA 2B7LA 2JLSA 2MINB 1V7QA 1VA5A 4G8DA 3CUEF 4IDQA 3O8LA 5JYEA 4JYBA 1XU7A 3D2BA 5A9RA 2RHJA 1SB9A 1QIEA 2FG7C 2OV3A 1UMBB 5FTKA 1C5KA 2A0XA 3HSKA 1CETA 3BCUA 4JXZA 4BNJA 1QPZA 2BEJA 1AGXA 1RM3A 1RP1A 1XTVA 4EAQA 1EUYA 3E1GA 5F3WB 3SEAA 3K30A 2GPWA 3KEOA 2QRPA 4YWHA 4QATA 5DKFA 5K0LA 4CQMA 3B5JA 4RW0A 4QRIA 4O4JA 3F7NA 3L8MA 5LLDA 1U3VA 1ZCAA 3V1KA 4ISCA 3U39A 4DJAA 3GCWA 2Y1FA 2OT3B 3GFSA 4YRLA 4HUTA 2V03A 1U8AA 3EXHB 3HCEA 3F6YA 1POWA 3OQVA 5EE3A 3ZNPA 4IV8A 4AQ7A 1ZHHA 3LAWA 3LL4A 4XH9B 1THGA 1NYLA 2VF2A 4GYWA 2LPMA 1RRKA 4PS1A 1S2IA 5KYXB 4E5MA 4F2WA 5BQ5A 3STVA 1Y3IA 4LOKA 4DHWA 5A5GA 3G2HA 4LFCB 2EQ5A 4C6HA 3GFVA 2FWMX 3CEJA 4E32A 5LMZA 3FLAA 1KNQA 1JILA 3OM0A 2CXXA 4P3YA 5JW6A 3R7LA 4YMGA 3H6HA 2P6NA 2BGKA 2XIQA 2C03A 3G2IA 3PRYA 4ZAZA 1V47A 1FFBA 3W5SA 4LWQA 2LD4A 1DJPA 4EBBA 3U4AA 2FZKA 3D54D 2I03A 2VK8A 4ZIRB 1QIGA 3D4NA 3E2MA 5T8KC 1OPRA 3BTVA 1Y3BE 4PU0A 1IHYA 3L8EA 3Q3IA 3H83A 1ZINA 5DHAA 4MB0A 4QTXA 2JD1A 3R7DA 5HIIA 3A4MA 4MUHA 4O2RA 3B5EA 3ZBTA 1GPLA 4RA9A 2H1IA 5CDFA 1UXGA 5D3KA 3VOSA 3K0KA 3H1GA 4YCMA 2J09A 3NWEA 5EL0A 2X5OA 4K1LA 2A6PA 1G5QA 3UK1A 3QU7A 4QT4A 1YRBA 5DM0A 2VT3A 4WXPA 1RRMA 2BHRA 2OB1A 1XSEA 3O75A 4R6XA 2ZROA 3GZTB 4JLMA 4UPDA 1RCFA 4A2CA 4Z0TA 1H5QA 3D1JA 1H93A 4EB6B 3PPIA 1W35A 3FY4A 2J4CA 1F0PA 2G8NA 4HSGA 3MXOA 1JB1A 5BT9A 2RHOA 1WMAA 4Q66C 3G79A 4P53A 5AM1A 2XBUA 2MSKA 2DGDA 3ELYA 3OOEA 2CVZA 5IJWA 5J4VA 1FJXA 1T9BA 2GJ8A 2F3RA 3SMQA 3H2ZA 2ZAMA 2ERYA 3GN2A 1W9MA 5DHQA 3T7KA 4F4JA 5LFAA 4LXIA 2A5LA 2CE2X 2J5KA 3MIZA 4MIOA 4N0QA 5HF9A 5FWXB 2ACWA 2DEUA 4AW9A 5SV2A 4YCJA 3PT9A 4PF1A 3BFXA 5D5PA 4DG8A 1K2WA 4UVEA 5CT4A 3JYPA 2FNAA 5JSYA 1E7WA 5AJXA 4CM4A 2ZUDA 2N1BA 3GJ7A 4Q24A 5H83A 1OREA 4YALA 2WYVA 2H1CA 4TL9A 3BRWA 1VJGA 1TZBA 2HMSA 2O6LA 2HF9A 3MCWA 3V7YA 4F9FA 5JZBA 3FPCA 1FUEA 4EYOA 2PT7A 3N2KA 3CX4A 1XO1A 4C08A 1KAEA 2NWQA 5C8YB 1W5SA 2G63A 3LX5A 1JSRA 1S8OA 1QCZA 3R5HA 1UOQA 2J46A 3FB1A 3FFWA 3L7LA 4FXPA 3TLGB 4LKOA 1ORTA 1PG0A 4LY3A 1E0AA 3MGBA 2XD9A 3BFPA 1JZQA 1VCOA 5IZ4A 1LRKA 3WMGA 3E9DA 1EQUA 1W4CA 4OAOA 3TCXB 1OGYA 1NSYA 3QXGA 3R3VA 4DDTA 1UINA 3L1VA 4K9LA 3QWHA 2BZSA 3GZNB 2XI4A 4NK5A 3O4JA 4OHUA 1CEXA 1N57A 2FPPA 1CIVA 1I4TD 4Q1BA 5HFNA 3PSHA 4F6RA 1GLNA 1RLMA 4BKMA 3SI7A 3DC2A 1L2TA 4NE2A 3GMSA 3V1LA 1KRWA 3NCHA 1KO7A 2JI4A 2Z6VA 3KYBA 3S8EA 2XLBA 4JA2A 4D02A 5HGXA 3UB4A 4ZOCA 1C4WA 1I1NA 2PKYX 4TX1A 4UUAA 5J40A 3IE0A 5EWJA 2PAAA 5HMMA 1FP2A 4N82A 2BTEA 4YT5A 1MB3A 1OWLA 2BI4A 3NORA 3PHLA 4GQBA 2IH4A 1BA3A 1G7TA 1Q91A 2YFKA 2YVAA 1G98A 3F8TA 3GFPA 1G21B 1ORIA 3JALA 5A4FS 2NVUB 3QW4B 2GESA 2FWPA 4RY0A 4RD0A 2R48A 4X3PA 2C5HA 3EVBA 2XUFA 1VYHA 3KU4A 1YUMA 4D3XA 5LUAA 4BQRA 2HA3A 4BCDA 4XR9A 2CFTA 2HXYA 2OPBA 2YYAA 3K1AB 4WLOA 1ZIXA 3A6JA 1O0CA 4DREA 4DNQA 3U7HB 2X23A 1U6JA 2ZGVA 4RQBA 1KI9A 4YCAA 2W6IA 2PH7A 1E32A 5HBGA 1QGUA 1AS0A 4L9AA 1G6HA 4WJLA 4JI0B 2PIDA 1NNUA 4AZ3B 1GG9A 1U7XA 2WIAA 3HXPA 3KFVA 1OE0A 3REQB 3DF7A 2HMWA 3PDUA 2F6RA 4TWRA 2X5NA 3DDZX 4JSRA 3EULA 1E96A 2O7RA 3HCCA 1YRYE 2X1HA 2XQKA 3LPCA 3T3GA 2ZUEA 4G84A 8ABPA 1H94A 4F5EA 3DL7A 4LS3A 2PKXA 3TM4A 2Z8XA 4LRWA 1FW8A 1JQ3A 4JOCA 2ROQA 4PYOA 5ALWA 2PT5A 1A27A 1WXEA 1Z0FA 3ZK7A 2FJUA 5TQVA 1NW5A 2FZ4A 2XDYA 4UHHA 3G82C 3GBSA 5ICMA 1J49A 5DX1A 2QK4A 3B6EA 3GZJA 4Y2SA 1U80A 3LLVA 2UYCA 2W0SA 3ZH9B 4DIEA 4M6WB 1DTWB 1E8MA 2H4ZA 3RNLA 3HQ4O 1HNNA 3NUQA 1ZI8A 2G3YA 4BV8A 3A6KA 3BK2A 1ID1A 3PS9A 4J4BA 4Z9BA 2HRBA 3HRHA 2ZPAA 3NAMA 5ALXA 1C1YA 1K7EB 3ZTYA 3K9CA 3MSCA 2M6RA 4N03A 3CE9A 3JVIA 4GKAA 4E15A 1NT4A 3E35A 2E9SA 3KYDA 1NQAO 1C9YA 2BN4A 2ODPA 4FYKA 4JIGA 2PUEA 2XQGA 3UOAB 4D4MA 2C2YA 3PXUA 4FDTA 5LP6C 4LZWA 3IT3A 4QFBA 4H1TA 3E23A 3KJNA 1ONBA 3W4KA 2IEIA 4DNPA 2DKOA 1DQNA 4MW9A 3I5YA 1FRZA 1TYCA 4G86A 2B7CA 4EJSA 1Q44A 3R77A 4A5OA 3LVBA 1U8FO 3CPEA 2P30A 3T38A 2HNAA 3D1VA 2P9FA 4Y1EA 2QJRA 3A31A 3VH3A 4PYLA 5K3SA 5I8WA 1NI4B 1Y1PA 1JQ5A 4MGHA 4RZQA 3V7FA 5BV0A 1EFKA 3MLAA 3UXYA 3TE7A 3WWDA 1NUAA 2OFWA 5LQRA 1M1NB 1NFQA 3FPLA 1J1IA 1G6OA 1W8DA 2YIVX 1YR2A 2Q5CA 2YJGA 4W5JA 5TEVA 3GUUA 2GHQA 1E79D 4CLXA 5C4MA 7REQA 1WU8A 2OLKA 5DM60 5JCPA 4DV4B 1ZESA 2YL2A 2ZJOA 1C4OA 4MCHA 4TVSA 5DWQA 4F06A 2HFJA 4JLSA 3MK31 3LFTA 1CCDA 2A1TR 3FMOB 4TOIA 4YAFA 1EA5A 4JOBA 5ESXA 4GVLA 5DCWA 3SSMA 3UXHA 3L0BA 4WRRA 2FWJA 3KXKA 4XUGB 1AK9A 2DF8A 5F33A 2F3SA 2QTVA 4KWHA 5EIXA 2NTVA 1CZRA 4DGSA 2Y3IA 5CYPA 2HU7A 4ZDKA 3UB3A 2R8ZA 4GP7A 5AXBA 5HBRA 1V11B 1UKVY 1T8WA 2HCBA 4YFYA 5A3RA 1ICIA 4EX7A 1D2EA 3WLNA 3PR1A 2FMUA 3O8CA 1TMGE 1FX0A 2QYHA 4U8HA 4NTZA 3IAEA 3NM4A 3BIOA 4KIJA 1F4PA 3S55A 2EIHA 2ZIZA 4M21A 4BV2A 2Q2OA 4EGSA 4IFTA 3RH0A 3OOHA 4R1UA 2PH1A 3BWYA 8OHMA 4PGGA 1R6AA 1H2FA 3OM9A 3Q8KA 4M0KA 3WYCA 3OU7A 1HNXB 4FHEA 3HB0A 3R09A 1MNQA 3R23A 4IV5A 4LJ4A 4CTNA 2O19A 1T36B 3O9ZA 1E2LA 1SUBA 1ZGZA 2ZRPA 4GI2A 5LZ5A 4A23A 5BUZA 4ZTUB 3DDCA 2X9QA 4Y9DA 2V97A 2JGJA 3AV0B 3MPOA 3VMMA 1FLDA 3DO5A 3OE7D 3KVNA 4RPLA 3SYNA 2QBYB 1VPVA 3TJMA 4CEIA 4Q39A 2J6HA 5K4AA 3GPCA 1ZUHA 1R66A 2X4LA 1GQRA 4M8IA 5DRTA 5EERA 4DCCA 2CDBA 2FFQA 1QBKC 1BC5A 1YI0A 4JNKA 3HBLA 2BJVA 2KPOA 1KJWA 2H2FA 1U9ZA 3T7IA 4E07A 2IS2A 5AK0A 2I9KA 2VUIB 1XZHA 4EL0A 5KVSA 3H05A 4D81A 2IHVA 1PWHA 1X1TA 4XD7D 2R5FA 1N4AA 1DKRA 1F9EA 2I80A 4XARA 4R3WA 1TZ2A 4CYMA 4DLSA 1YAJA 1G8PA 4KDRA 2RKOA 1C2YA 1IQPA 2HRRA 1QRAA 3Q10A 1MT0A 4RVDA 5JD5A 3UV6A 3WJ7A 1F7UA 6PFKA 2BL4A 5SZKB 3UJNA 1SXGA 2XMRA 4JDPA 1JA0A 4GHWA 5BN3A 4YASA 1W46A 4K2HA 5TQ2B 4F6CA 1NUQA 4XKJA 1VLVA 2VCHA 5LQUA 2CE7A 1AQLA 2W22A 4ARCA 2XNDD 5B55A 5TT1A 4XEUA 1CVLA 1BVRA 1XTZA 2E55A 4IQ8A 4WNCA 1ZCJA 2SICE 4IDEA 3DNPA 3ZXUB 2ZYUX 3FIJA 4NIMA 1A7AA 1QVVA 3VZPA 3FOAA 3IHTA 4K9NA 3TXXA 2AGVA 3A1SA 4L7QA 2IODA 5KTSA 1P5FA 1E62A 1PSZA 2PGOA 3F6BX 3IKVA 4YIKA 4LJRA 1TMYA 2WV9A 1PJ3A 2ZIGA 4C0QC 5CIYA 2ZU6A 1ZONA 2DWQA 5KNCA 3HWRA 5HE9A 1O58A 4L78A 2B69A 1IY8A 4YLYA 3H8SA 5KQPA 1N8KA 1BGXT 1F06A 2YRXA 2OZLA 4Z4EA 2D5LA 4HNRA 1FYXA 1AGYA 4RH0A 2PR2A 1UT8A 1IC6A 4HX5A 1NXTA 1F2UB 1DQYA 3PFFA 2WWTA 3JQQA 4Y3UA 1EHIA 1ISSA 3DFFA 1O6ZA 4Y30A 3BGWA 4M55A 5I48A 2ACEA 2YWCA 2HYDA 4PFSA 2I4RA 4NNJA 3BGOS 5BQXA 5CGZA 4GI5A 2EW1A 1VL5A 2VKTA 4Q7MB 5IN5A 3RYHB 4CKWB 5IM4A 2BFCA 1HL3A 5K03A 5KMGA 1EUDB 4JBXA 1XN4A 2A2ZA 2WKRA 3P9YA 2AN1A 4RFSB 4FNOA 3R8XA 3IEIA 2GYYA 3MFYA 5AW2A 4Z9XA 1G59A 1VIVA 1LLDA 1M83A 4TZ0A 1FMLA 3EGIA 2HSEA 3BYZA 3O3OB 3W6UA 5ITSA 1BQ4A 4MGYR 1Y8ZA 1GL7A 3TL3A 5LL6P 3DAOA 3R0XA 1B0ZA 3BMNA 5TQ0A 3I5XA 1Q1BA 3VHXA 3CH6A 1G4UR 2JFXA 4WOPA 1Q6YA 1NYQA 5GVRA 5K3OA 1B93A 5FT9A 5H0IA 2A5FA 2I8CA 3GLHA 1DC3A 4KMRA 2P69A 3OSUA 5GQSA 2DQKA 5BNIA 5IAGA 1KI3A 4YY3B 2RH4A 2IYTA 4AS3A 1SQ6A 1PDVA 1PL0A 5FI3A 5AW5A 1IEWA 1VKOA 4ARSA 1NGSA 4W8HA 2EJCA 2CZCA 3ENQA 3VR5H 4E31A 4EPTA 3LRPA 2PGNA 5ALFA 1DIAA 1MB0A 2OSBA 3M6UA 2RK3A 4BO4A 3X1KA 4FQ7A 2QD3A 4LVOA 2JCXA 3H2JA 4YROA 2WHRA 3TZLA 2PRKA 4RL6A 2B4AA 2IX9A 1AURA 3N39C 4IUCS 4LJYA 2O5VA 4U2DA 4RVUA 4EUHA 1O94A 3R76A 1HDYA 1V2HE 2DQ4A 3DFIA 1YK0A 2DKFA 1ZK2A 1LTKA 3NV9A 3T7AA 5C37A 1P19A 5EJ8A 5IUJC 3WLHA 2R65A 1NDQA 3FWPA 3AEYA 3QVLA 4EDFA 3P5SA 4JR2A 2B5OA 4RF3A 4RBNA 4KRYA 4Q4JA 3P20A 3WLSA 1BHQ1 1NPDA 1PFKA 1B8VA 1ND5A 2DBVO 3DHYA 3RS5A 1CVIA 5EHZA 3L4KA 1EINA 1M74A 4QIHA 4F3YA 5HX7A 2WABA 2ZSHA 2DY0A 2I6GA 5JHHB 1H4TA 4X6LA 1Z07A 2O7QA 1YR7A 2UUAB 2Y2UA 2OHFA 1GITA 3CKKA 1I0IA 2WJYA 4F92B 5J1SB 1E9CA 3OEED 3CR8A 3LA8A 4RPGA 2ZKIA 2VSYA 1HZJA 2IDZA 5B5SA 4MUGA 3C7DB 1DEHA 1PYOA 2HA2A 4NYIR 4Y0AA 2WICA 4LHXA 1PI3A 5CRIA 2O8FB 1XOIA 1IH8A 2SKCA 3RVMA 4FFVA 3DULA 3HDQA 1Q0UA 2MT9A 2BEWA 5AFSA 1H6BA 1WTCA 1ZXXA 1X86B 2PY6A 1F5SA 1EBUA 1XKQA 3HGMA 1ORHA 3NHUA 2P9EA 5FBHA 1WX1A 1M5RA 4DC9A 1CHNA 2CXPA 2ZDHA 5C18A 1OIWA 1IQ0A 3H0CA 3MC1A 1Y81A 5ALGA 4F91B 2W7TA 2HD4A 1VPEA 3HNOA 2D62A 2AG8A 4MP6A 1BD4A 1U0HC 1WVIA 1T6YA 1XZCA 2AOTB 3G2NA 4EVRA 1XZKA 2YFHA 1PAUA 3DL0A 1IUNA 2ECFA 2IS1A 3U0BA 1OT3A 3ZWMA 1E3WB 2GN0A 3C70A 4JYZA 1NVMB 3TH5A 2P3QA 3ND5A 3OJFA 4IRUB 3JQAA 2DT5A 3EUWA 5I9SA 4CKCB 1GKIA 4RTQA 1T6ZA 1Z82A 2IQ5A 1G5FA 4Y2GA 1I0LA 3U4HA 2PZEA 1SUCA 3DBLA 4U2KA 1J2UA 1LLFA 1Y6GA 4ENQA 3Q11A 3NDBB 1A5ZA 1H22A 3UMYA 2OK7A 4AJ2A 3G02A 3FPBA 1VE5A 5B1DA 4NONA 1E0JA 3BWDD 1GEGA 3RT9A 2HQ1A 4I81A 2V7VA 2ATEA 1GPNA 5IDQA 5KJFA 5EXDA 3JVDA 3EPKA 1S8AA 1G4AE 1LSJA 4C0BA 1QC5A 4FP9A 1C7ZA 3IR6A 2VC2B 4P7KA 4PQGA 2QG9A 3IAM6 3NQ41 2X8LA 2VJCA 1CUUA 3CO0S 1WXXA 4OHVA 4PYKA 3K0SA 2OGUA 2H06A 3QRWA 1WQ1R 5K8IA 2E37A 4ZI3A 3DSRA 1AHIA 1BU5A 1QVWA 4K0RA 1XELA 2HOQA 3UJCA 5EQTA 4P4SA 2GBIA 2FFRA 1CRLA 3IP3A 2P6UA 1E1LA 5KO2A 1KVUA 2CNNA 4Z86A 1XVVA 1VL2A 4P3OA 2GSWA 4HQOA 2QZSA 1F20A 4AWXA 6REQB 2QDXA 4JAVC 3I2FA 1YJXA 1UKYA 3DZGA 4XB6B 1URPA 3K73O 4PQRA 4WJKB 1HNZB 4FB5A 4PWYA 2IZ7A 4ZVNA 5L4LA 2LW7A 3RD5A 4NU0A 2GXSA 2M32A 1WUJS 2HJWA 4PRZA 1KOGA 5FUYA 4HBZA 1G5PA 5HIJA 1G1MA 3AERA 1FNMA 3A4VA 2ON6A 1DC4A 2SKEA 4GGOA 3TIIA 2FX3A 4E1BA 1KPIA 1QIHA 3ZE9A 2ZAYA 4MVJF 3JAKA 3D3WA 1E6CA 2CK3D 1WZIA 5CG1A 4MYHA 3MUNA 1USWA 2WF7A 4ZJYA 4KPEC 2HK7A 2G8LA 2J0VA 4HQ6A 1OI7A 4O63O 4BCCA 5JHGB 2H1OA 3FLBA 1JU3A 2QGNA 5DHRA 1QYVA 1M6HA 5FNVF 2CKMA 3RHSA 5GAJA 4DLLA 5JCJD 5TMPA 5DNDA 2ZBDA 2RGUA 3LQYA 4XQEA 1Y9EA 5LIPA 3VBCA 2FPKA 3TR6A 4D8TA 3KSBC 2B6HA 2CMHA 1NPTO 2FK7A 4PHFA 2FN9A 1P8AA 3HACA 3ZCTA 1EDZA 4M98A 2NNLD 4GXNA 3A1NA 5IC6A 3IURA 1M1UA 1MAVA 1QHYA 2O3RA 4EQZA 4P6VF 2R85A 5PNTA 3PIIA 2VXYA 4AS2A 4HGQA 1I7DA 1YDGA 4PLPA 2GM5A 1QGYA 2R6ZA 1ZEMA 3KPUA 4U1RA 3C8DA 1R8SA 3LVRE 1X6VA 3RTDA 3DF9A 2OMEA 4MOWA 4DV2B 5KJEA 4DDUA 1X3LA 1ETHA 1R6XA 3U48A 4REMA 4NDZA 3LUKA 2I3ZA 3FM9A 4I6JA 4F5WA 5EZ6B 1WUYA 4EW2A 1DJLA 3OCJA 1PNRA 2J0UB 3R7FA 4WUVA 3EGDB 4IFEA 4KWCA 1DIBA 1J8VA 4FJ1A 1B43A 1T5SA 2B2NA 3EZ7A 2XB6A 1MJ5A 2VZ9A 4K8OA 2NVWA 2QE6A 2X4GA 3B3GA 3I6IA 4MV4A 4LC0A 4V2UA 2IXFA 4N6NA 4WY2A 1ZM9A 4DCOA 3CV3A 4JCOA 1WKBA 2JLBA 2NZ8A 3ESAA 2JFQA 3ET4A 3AEUA 2CF6A 2XVAA 4CNQA 2NV0A 4MINA 5DNVA 1TCUA 5AR1A 4EB8A 1NX6A 1W581 1C3VA 3R3WA 4PTZA 4AUMA 4XRRA 4PLFA 5KHLB 3SNHA 3R7WA 2AG1A 1MTZA 3ZV6A 3HCFA 1H6AA 5F12A 1GQOA 4UW9A 2G6TA 3RVNA 2D5IA 3VH4A 2IPLA 2P2CA 3HWSA 2ALJA 1Y7LA 4OPMA 1DCFA 2TS1A 4QO8A 2MINA 3B38A 2YYSA 2VATA 2CVHA 4UBLA 4ZOEA 5DBIA 3Q85A 4EJFA 1Y3FE 4BATA 1X7WA 2PTGA 1N8TA 1KQFA 5DGCA 4PYJA 1K0UA 1VI6A 1G8JA 1UMBA 4G8CA 1YR8A 2PX4A 2VYCA 2CB0A 1SUFA 2F9LA 3QX9A 3JVUA 3K70B 5CVEA 2XEXA 3PE4A 1E7YA 4AMYA 1M2HA 1XQXA 1C1XB 2FQWA 3N6VA 4K9PA 4XZ3A 3KXIA 1MEOA 1BGVA 1RKBA 4IVQA 3X1WA 3LW7A 3G1UA 3IQEA 1ORDA 1OV6A 1T3LA 2H31A 4LN1A 3EARA 1LDNA 1RWQA 3EXHA 4HEQA 5JDIA 1N0IA 1BX0A 2ZYWX 4KBFA 3ZN2A 1Y3AA 4UD2A 5DVZA 1DBVO 5HNKA 1BCRB 3IVGA 3V33A 2R5WA 2MOKA 3BXEA 4JD5A 4DSNA 1ISGA 3GPIA 2WVJA 1IEVA 5G0TA 4CBVA 5A2QA 3ZLUA 4QKQA 4C3VA 1G8FA 4HS4A 2O0MA 3QBEA 3CINA 3L40A 3NGMA 3A4LA 4UM7A 3DV2A 4HHEA 1NJ6A 4BQFA 5GM2A 2NO5A 3KU1A 4PLTA 1NRWA 2ST1A 1Z15A 5BV7A 1JHPA 2YBEA 1IY1A 1ZMXA 5JBIA 5K0SA 4LE0A 4BFLA 2PD3A 3EGEA 2QU7A 3NJ4A 4QREA 4RTOA 2AWOA 4R2WA 4L15A 4ZIRA 1XZJA 2X8WA 4PLGA 4WPGA 5HJEA 3C3PA 1BSVA 1H6CA 2PGAA 2ZE5A 1HDRA 3RARA 2QT0A 1E2DA 5JS7A 1VMEA 4BIMA 4TMYA 2DTEA 4Q3DA 4C2TA 4M60A 4KQKA 1TYAE 2P6MA 3B6JA 2G07A 2X6TA 3OCWA 5EIFA 3SF8B 4E12A 3OFND 2R6CA 2EGGA 1E1MA 1EFAA 2YWDA 3DE7X 1QU3A 4AJIA 1G0OA 5BSTA 4IM7A 4HAUA 2JVIA 1RDFA 1U2EA 3HDJA 2DSTA 3RW9A 3ED1A 1UMCA 3HGTA 2AOVA 2VIIA 1OHHA 1UXJA 2D5BA 3ODGA 4I4TF 4U02A 1UDBA 2ZBQA 3B6KA 2FN8A 3NLLA 2FSGA 3DXFA 2ZIVB 1AB6A 2NLOA 3DFKA 4LFAB 2IELA 3GG2A 5FWXA 2H18A 2I2CA 3MD9A 5TGDA 3ZZUA 3NDIA 4DTCA 4J1SA 5H9WA 2QR5A 3QE0A 3DMDA 4U39A 1KSJA 1ZJ5A 1M7GA 5ESWA 4C4PA 2OQVA 5BR8B 2FSPA 4G4IA 4ZFNA 1THZA 4J7XA 3KVOA 5TVKA 4FZVA 1XYYA 2UYGA 2IEAA 1A2KC 3PXXA 1N2CA 3WLFA 1I2ZA 5K8UA 2Z30A 3RO7A 2RSLA 3LHKA 2JLAA 4FBLA 3SR4A 2R25B 3DEYX 3L0OA 3HYNA 4FKBA 4F2GA 5EYPB 1LBTA 4QDUA 3CLRC 4FBGA 3WTBA 4G8JA 1U4NA 4MUMA 4CMEA 3EEFA 1ZD4A 2MSNA 1NJ1A 1X7ZB 4O1MA 4L5IA 3E3LA 1KQPA 5CEJA 3IUEA 1P4AA 2A59A 2WIGA 3CLRD 2JBAB 4RGBA 4TSFA 1CUVA 1JPJA 3VNAA 1KZ6A 3K8YA 4R7ZA 2EYQA 1TW3A 3G89A 1M8PA 2XVMA 3IPAA 3GZNA 3T3PB 1U4SA 4FDUA 1RQ7A 2N46A 2IYVA 3E9YA 4MQFB 4ZCIA 3RWMB 5EKXA 1W49A 3D4LA 1V25A 1OU4A 3OPVA 4W9RA 5TY0A 2V6MA 4FGUA 4QUHA 1O9HA 3MJFA 2G72A 3W5AA 3PNOA 2QL6A 3TN7A 3AHEA 3UIEA 2WYWA 2W6JD 2I2DA 4TTAA 1R9NA 5BYJA 2G0NA 2GN2A 3ZHXA 1QB7A 1RQGA 4B3GA 2IPNA 3T4XA 3TXAA 3U1BA 3QOFA 3K1ZA 2RIPA 3HGQA 2W58A 4QXOA 1G21A 4ZZ3A 2B5VA 2GF0A 3PL1A 3VZDA 3CXUA 3HYTA 1N2IA 2O20A 1ZZEA 2ZJ0A 3JQFA 4GYJA 1FXUA 2C9BA 2VHTA 1IJFA 4YP7A 4XVHA 2CXQA 2X0KA 2VPPA 3K1AA 3N8GA 1SG6A 1GA1A 1ACLA 3O8OA 1UANA 3O92A 3TTTA 4EHLA 5HKKA 2NSHA 5IT4A 4ZQBA 5IZCC 1EFPA 1SVSA 4KYTA 4CT0A 4Q18A 4J76A 3S99A 2FR8A 3CSSA 3DE2X 4PZUA 2CXSA 5E2BA 4JC4A 3DDNA 5GADl 1G8SA 5EXSA 1RC0A 4FD2A 4HL6A 1C3OB 5F76A 3R24A 2RGNA 5L3SB 5IVDA 4RJTA 4O4IB 4OEHA 2IEZA 1O95C 2J4DA 2OCBA 4Z0HO 4KR6A 4L9SA 1TUIA 3CEHA 2WSIA 4D80A 2EVWX 2JB9A 3KZKA 2POQX 3ZHRA 4J9VA 2ZBVA 4HGPA 1O95D 4CMIA 2ZKLA 4LECA 5LP6F 5DLDA 3OTQA 2CV1A 1M6YA 2C95A 2CZGA 2JGDB 4GE0A 1CJCA 1RXIA 4JVNA 4JA0A 2ZSFA 3HTXA 1U99A 2HNBA 2GBGA 4NEQA 3A32A 3V80A 1C3JA 2J3DA 2RHGB 3MILA 4WLFA 2GO7A 4M6WA 4D6XA 3KD2A 3DLHA 4TRJA 3T4UA 1KKMA 2JZCA 1R0CA 3MEQA 3ZZNA 1QK5A 3ICOA 3JTEA 4PO3X 1Z17A 4FJ0A 1MA3A 3BD6A 4JGBA 2YIDA 1NZDA 4ZT7A 3ZCXA 1QRRA 1XNGA 1ZM2A 4LYAA 3R0VA 4R69A 2BMAA 3PF8A 1T9AA 1KP9A 2O5CA 1KP3A 1ZS9A 1IZ9A 2Q7OE 2QM7A 1EVJA 1V7ZA 2JLWA 4BZQA 5AVYA 2RK4A 5SZIA 3B13B 3P2OA 3PQCA 3BTSA 3UJDA 2H57A 2PUDA 1XCBA 3KLBA 4MS3A 3OA2A 4OHWA 4OKIA 2PQ0A 3E6AA 3H5WA 2W2TA 2PDAA 3MXTA 4I55B 1Q1NA 1L1RA 2KWIA 1EG2A 4QOEA 4KQMA 4TWZA 3CC8A 2BFDB 3IEMA 3KPWA 1KU6A 3PUIA 3SIWA 3HUFA 1QHHA 3ILSA 4MHTA 2XADA 1NI4A 2EFCB 3SOZA 3HUUA 1E2BA 1J20A 1M2OB 2IIBA 5TXGA 5B3JC 4DR6B 1D6MA 4G26A 1Y8QB 3TOZA 1M1NA 1I2DA 3CN9A 5F9MA 2BJWA 5DGIA 5AW0A 3DL2A 3KKKA 5FIUA 4AQDA 1TK9A 4YAEA 3A2MA 2UZ4A 2J3KA 2QUIA 4RIGA 1AXRA 2YWFA 3FSRA 1XVIA 1P81A 3IPRA 2MMGA 5FO1A 4C04A 3MJVA 1I01A 2W2OA 1LEHA 3PSAA 5GZ1A 4J3NA 5CPBA 3IFSA 4MWTA 1LUAA 3W6OA 3AIKA 1P7CA 3FCEA 4YIHA 3NHBA 2FETA 1XXLA 1Z3CA 3O6VA 3THYB 3TNJA 1RHQA 3S28A 4MEAA 2CYBA 3SYLA 2HMUA 4BFXA 3UJBA 4AB1A 3AI2A 3I62A 1O3YA 2V0NA 4C7KA 1TE2A 5JXGA 5AI4A 5AXCA 4AO6A 3CEPB 2WMOB 1RABA 4AU1A 3P0HA 1HL7A 3N7UA 2CT8A 2O2GA 5L3ZA 1JKIA 4EZEA 1ZQ9A 3A6HA 4BB0A 2Q0SA 3RVJA 4AY5A 2PYIA 5E95A 3O2SB 2H29A 3TZKA 4M22A 4KQ6A 4ARAA 5C80A 5K99A 3H9GA 3UV7A 5LQJA 3DYVA 4B33A 4JJ6A 1TLFA 3IKJA 3D8NA 2QBYA 4I4NA 4MJLA 2N1MA 1WXDA 1CG6A 4L76A 2VSQA 4MPDA 3C5VA 3IALA 3BICA 2FEOA 1YZLA 4IYJA 4L8GA 4URHA 5C51B 5WRFA 5LZ8A 2M98A 4MAAA 1W29A 1QHGA 1H8HD 1LSSA 2EQAA 2QQEA 1VQ1A 3ED5A 4Q4AA 4X24A 2O1WA 4TUYA 1A1SA 2W8BB 4NKRA 1M2JA 5CA1A 3GP8A 1NVGA 1A0OA 1K4KA 3RFCA 3TTXA 3VAZA 3MT8A 2OBLA 3GDWA 4X6XA 5FBWB 2QP4A 3G13A 2WUEA 1YWGO 5I9MA 5BP7A 5JXJA 3WGLA 4QVKA 5A7GA 2ORWA 4CIVA 4GDFA 1Z45A 3U9LA 1IBMB 1TU4A 3QKSB 5FBLB 2OORC 1QQ6A 2X9LA 2IEDA 3M4XA 4KC0A 4NC9A 4OA5A 4K6OA 5ESDA 2H7YA 5G2OA 3DJYA 3K9HA 3PHGA 2UVDA 5JNSA 1B7GO 1RXYA 4S1TA 4M88A 2G9ZA 2R7NA 3PQ6A 4CCSA 3TW0A 3ANYB 5ALOA 3UCXA 1D1PA 4OYRA 4Y7DA 2P0AA 3IUMA 3JY6A 5EJMA 1II8A 1CEQA 1UMDB 3H3JA 5G1OA 3FNGA 4G36A 2NACA 4EENA 1EGVB 2FHPA 4KN9S 1T9HA 2AS0A 3I76A 1XZBA 3H75A 3ZKWB 2JJ1D 1D2GA 3FPFA 3KKLA 3U4MA 2E4AA 4Z51A 1C30A 3H6GA 4OLHA 3O31A 5DDIP 3TUJC 5LD2B 4B4VA 1BRTA 3BCHA 2PX0A 2ZAIA 4OBEA 1ABBA 2J4FA 2REQB 4LXUA 2CVOA 1C9KA 4CDNA 3R3ZA 2F8SA 1HY3A 4Y9TA 3C3DA 1T8YA 3BB1A 3GJ0A 5B4TA 1I3NA 4CM1A 1F2UA 1GUBA 1ODFA 1O5TA 3IP1A 4ND5A 2CLSA 3GEIA 3EIFA 1JHYA 4ENTA 2ZJYA 2HIGA 1DHRA 2WIFA 2I91A 5HXAA 2C2HA 1KORA 2C77A 3RS0A 1C9MA 1JAXA 2C92A 2ZRAA 4HUQA 2XJ4A 3D8SA 4QDKA 4YJDA 1XDZA 5BW4A 4RFSA 1KJYA 5THXA 3W5DA 1GZ6A 4L2IA 4YI5A 1PZGA 3RF6A 3VA7A 2P77A 2PXAA 2ANBA 4LV8B 1GAWA 2Q8NA 5KQGA 2YOFA 3GRRA 5EAIA 3V1YA 3ZE6A 1P4JA 3TPCA 3U16A 3L01A 5FWAA 1KJNA 1XYVA 5LA6B 5C5CA 3IO3A 3M6FA 2YY6A 2NU9B 3KYCA 4RULA 4AK9A 1LSOA 1ZISA 2J9GA 5JSZB 4QE3A 1LZLA 4YBZA 5ALSA 1M73E 1ZX1A 3N6RA 5IDVA 4RMJA 3FZQA 3VAYA 3ZDXB 2WMYA 3AB7A 2O8BB 1JEDA 2O0KA 2Q4BA 1KDPA 3K05A 1DO0A 3H5RA 1ZSYA 2OD2A 3DAYA 3EWSA 5FOXA 2GOYA 1I4OA 1KAOA 3AWIA 3NWJA 3E7XA 1ZGJA 4QBKA 1ZOLA 2LIVA 3HHPA 3PE3A 5CXQA 1GNTA 1BDMA 3L7OA 1Y89A 3L77A 3J7TA 4PFJA 1TEXA 4BVKA 2QGFA 3P4XA 3LBAA 1QCYA 2A5GA 1W0KA 1Z75A 4TQAA 4ED9A 4WBSA 3QU9A 2QVCA 4ZANA 2CCKA 3BFVA 5CLFA 4UUNA 4YMTA 4M46A 3AEQB 5KHOC 3G7SA 3AM4A 4J2OA 3RQIA 2V6FA 1L5WA 1UOPA 3C1UA 2DFDA 3H0EA 4RPCA 1S89A 2NT3A 3ROZA 5I7OA 4HDCA 4MWSA 4DLVA 4NHOA 4EHJA 1Y98A 1JAIA 5C7OO 2GAFA 1XAHA 3B2EA 3OD5A 4IIJB 1XMVA 3TQRA 1X15A 5KVCA 1NMQA 3TUIC 3EN0A 3NS7A 1PJSA 1U7UA 3F3YA 3JQCA 1BHSA 1D2RA 1T2NA 3DKPA 1QUEA 3H19A 1V35A 3IDAA 3KSMA 4LJKA 4V0NA 4YK7A 5SY6A 2XCRB 3GIWA 2MCFA 4ZI2A 3HVKA 1EIZA 2FRDA 3NBFA 3OP4A 4TXHA 3M81A 1P91A 3SIRA 4C4YA 4N0EA 4Z5XA 1MJNA 4DCJA 3EC7A 2O8FA 2XIJA 1KE1A 7MHTA 3INGA 2YV2A 4ND3A 4UPEA 3V2GA 4R2LA 2F59A 4DDWA 2B5WA 3RKSA 3VR5A 2H59A 1RZRD 3U60B 1M0TA 1V3QE 3BAZA 4TKVB 2ECPA 2IA5A 1T0HB 2XRYA 3OQ1A 3K72B 2Y93A 3B5IA 3B1WA 2AVNA 2C9DA 3EGWA 2XSZA 2AOTA 1X8XA 3P9NA 3R9WA 4HDRB 2DUMA 2VHXA 2XZTA 1ZU5A 2W6ZA 2I6XA 1L5GB 2VPXA 5DBFA 1A8QA 1E3WA 4A0RA 2GGSA 3V7WA 3KWLA 1EGQA 5TMDA 1QVRA 3EZYA 2HV9A 1DPFA 5A0FA 3BXFA 1NVEA 3G23A 3FCSB 1XZ8A 1ZMTA 2QTGA 5BYKA 3B8HA 3CNEA 3ILYA 3LJKA 3QTBA 2WPDD 1W96A 5D3ZA 1W34A 5I4KA 3K6KA 3EXG2 4CUJA 3GT0A 4M1EA 2GT1A 2IYAA 1PFVA 3RSHA 1DCMA 1QO7A 3QVJA 4J0JA 1G5HA 4BBJA 1CULC 4WZAA 1DKNA 2CJYA 2V5UA 2DHQA 3VISA 5HJ5A 5BWLA 2Q5LA 3L43A 2CMKA 1DVRA 1V8FA 2V6BA 3CY6A 2JCYA 1CS0B 4KOEC 3SJCA 5IU6A 2QTHA 1E3DA 3ME5A 2W4IA 4EM6A 1OX6A 3CF6R 3PGVA 3QVWA 4RADA 4ZK2A 5A02A 4OQLA 2PQ6A 3EIQA 3QMWA 4DIDA 5ARBA 4WOJA 4HDOB 3NEPX 2A86A 4J0QA 4L22A 4FFNA 1L3IA 2JRLA 1OX4B 3KLOA 2D13A 1E9BA 3IP5A 3CZ4A 2JFNA 2Q27A 3F1LA 1P62B 4HN9A 4PZCA 4AF8A 4C20A 3EEOA 5JC8A 2RH5A 3DZBA 2LUOA 3P94A 2VP6A 1X1RA 3S2FA 4MYTA 2G9VA 3KG2A 5JD6A 5IWAB 2JLZA 3PPYA 1LDEA 1LVHA 3BWMA 4P5DA 2WTBA 1LBIA 1WOYA 3B1XA 3IP9A 4P8RA 2ZSEA 1YL7A 2J31A 3LX8A 2IXAA 3EFHA 4M76B 3SQXA 4HMPA 4QASA 1HMPA 3DCNA 4ISBA 5DNUA 2QAJA 2V4ZA 1Q7GA 1VIYA 2JGNA 2F55A 5JDCC 1C7QA 3KQWA 1VDZA 3VHQA 1U1EA 2BRUC 4OU5A 1GSIA 1L4YA 3CGWA 1O5IA 1CE8B 2Y9MB 2Z57A 2XQJA 3R6TA 3U7RA 3L79A 2AFIA 2W83A 2ODEA 4P3KA 3MT0A 4I08A 4YAOA 3WLRA 4DG5A 1I1OA 1V1MB 3QNUA 1ZM4A 2CXRA 1NBOA 2ERCA 2IPMA 4C88A 2Q6KA 4X62B 2VN8A 1RZUA 5DLYA 4DM4A 5KU7A 1ZKMA 3O1IC 4A1FA 3DWGA 3DVRX 4JC5A 3KD3A 2JEOA 4F93B 4BMYA 3I1JA 5JAPA 3LPNA 1GL9B 1IFXA 3PTLA 1LQUA 2Q46A 3X44A 1J0XO 3SHTA 2EXXA 5K6AA 4DWOA 2OXFA 4HTFB 5KCMA 1UPUA 5FNVB 3SR0A 3PUXA 2EL7A 3BD9A 3TNDA 4CFYA 4MPTA 3KL2A 4YN3A 1J5EB 3NDJA 1TOAA 1G3IA 2AOWA 1E20A 3F90A 2ZIWB 3CRRA 4EG1A 5DXFA 2CCJA 3V4VB 1GCIA 2YXLA 1UXKA 1DAPA 3I6YA 2JAWA 4TZKA 1YMQA 2EFEB 5H5JA 5BVHB 3IQZA 3GCGA 3B7WA 3WRWA 1O6BA 2W9XA 1XTQA 5CLJA 5GZ3A 4TYMA 1Z4IA 4YAUA 4WZZA 4CIDA 2M6SA 5A05A 1FDOA 2OKGA 4FOPA 5DZSA 4FGKA 3HDTA 1HE4A 2J0UA 4CEHB 1N32B 3BFJA 3EGDA 3K6RA 3KJQA 3LX4A 2Q4EA 4B6EA 4W9NC 2IHJA 1X7XA 4DRZA 1GZVA 3EAFA 3ELBA 5EUMA 1GGMA 4IIVA 4ZCMA 1KRHA 1N9ZA 2REOA 2JKZA 4PX3A 3PK0A 3TI7A 3UY4A 5LLTA 1ATIA 4UBIA 4ZVLA 5L3VA 4A9AA 3TRDA 2D8MA 5F98A 1GZSA 3QELA 2HBRA 2C8KA 3K53A 3TLAA 4CM3A 3OLQA 4DHEA 3EHDA 2OOSA 4XDHA 4B3FX 3GFGA 4EGQA 4AJ1A 3ACCA 1N8NA 3VGPA 3DUFB 5EMHA 3FMIA 4IZIA 4B40A 3IXMA 4F60A 3GB9A 1XD9A 3KPYA 4KR3A 4BL5A 5LYJF 4O8CA 3N9IA 4BAGA 2Z2JA 4PZYA 1P1BA 5CIWA 2YVLA 3IHLA 3VTZA 1T2EA 2XUKA 3VTAA 3QEBZ 2G5GX 2JJYA 3NJ8A 3ZY3A 1JR6A 2GILA 1NNI1 5ALTA 4B80A 4GKVA 1XEFA 2LE0A 5TIIA 5T41A 1BA2A 3CHYA 3EA5A 5B7NA 2C5LA 4LVCA 5E4TA 2YXPX 1TA0A 5HKOA 4DBVO 1M34B 1ICEA 4FGLA 4OSEA 1RWNA 3QEMB 4RGQA 3SJBA 4E2WA 1SCUB 1XQVA 4DF3A 5LDHA 3I32A 4BJ1A 4ABYA 4EFDA 4NZMA 4JSTA 4V1CB 1NVBA 3IMKA 1TKAA 2VZ8A 3WBKA 1ZK1A 2XNJA 3ZDYB 2OB2A 1JDZA 3ZIDA 1MVLA 4O08A 1XL1A 3WLLA 4D3FA 1FFXA 5EUCA 3RQSA 2ZTVA 2O3UA 2D0DA 3USCS 1UPTA 3RLIA 2WHPB 4KK3A 4AMVA 3AHIA 2PV0A 3IHKA 2E7ZA 4JBHA 2ZUVA 1Z7GA 3TE6A 3AH8A 1A7JA 2XDQA 4QDZA 3S0JA 3PKJA 4RNDB 3IX7A 4DLXA 2WWIA 4JITA 4TMWA 1HE1C 3WC4A 4XWKA 4CIYA 3HY6A 4FDVA 4IMRA 4QBHA 4B8WA 1LNQA 5AIBA 4DA4A 1AC5A 2CB9A 3T8YA 4HWSA 3FDXA 3W1VA 5A4MS 1Y63A 3OX2A 3I9V1 3IKMB 3S2GA 5BYAA 5KPDA 3IVRA 1T2UA 4XOIA 1J09A 1HDEA 3RTBA 4J0CA 4WADA 3LU1A 1LTHR 4CLRA 1QK3A 1TRHA 1P2SA 3L6EA 3QBTA 3BIFA 3NNSA 3PQ3A 4XDYA 1ZKDA 1YS2X 2ZRMA 3C3YA 1OF1A 3NKFA 3OO1A 4US1R 3ZHCA 1N2XA 1PHPA 4BO7A 3OFJA 2G9NA 3SF8A 4ZCRA 3ZGOA 4NYJQ 3CUVA 2WT4A 4CFSA 4HNGA 4RVFA 1NI3A 2AYYA 1ZRNA 2BTQB 3GAMA 4MW2A 3BN3A 2BDTA 1OLUB 3UAOA 3NNNA 3RYIA 4B0PA 4WKPA 3ZR4B 1KH3A 1W44A 2XMDA 1NW7A 5ECGC 1UBNA 4MMXB 2DSNA 3HH8A 1Z74A 4QPJC 2AK3A 1IOLA 3E27A 4KHZA 3Q7IA 2OM2A 1RU3A 3F98A 1VA4A 4DCNA 1V8BA 2BCEA 4OQEA 4AUNA 2VNKA 4JI2B 3N0VA 1FS4A 2OE2A 2YQ4A 5F1PA 3ISVA 4CCYB 4EUNA 2G76A 2C8LA 4Q3CA 2JNWA 4ZWNA 2RFLA 1AT1A 4MARA 1XLTA 2D54A 1X0VA 2F1RA 2I71A 3COZA 3D9QX 4I4TB 4RKQA 5FF9A 4KWIA 5JJIA 4S1WA 5TS3A 5KQSA 4BYMA 2IZ1A 2RJ3A 4ACAA 3M1IA 1ORWA 4B4WA 4YRPA 3L4BA 2ZLBA 1YJAA 1SIUA 3E7FA 2BYTA 2J0EA 4AXBA 4PICA 2FPWA 2FJPA 2PKWA 1BMFD 3DW3X 3GPBA 2YV5A 3QPCA 4MVJE 5EYPA 1IOVA 5M7EA 4RXTA 1SBHA 2WTUA 1LVGA 2O0HA 4TT3D 1K06A 5A3VA 5DYNA 2GS9A 3OJWA 4OHKA 4W7HA 4TLAA 4DUZB 2C4KA 2BIFA 2X0EA 1A71A 3DTNA 4IXDA 4LOAA 3GDOA 1H2RS 3RSCA 4EPWA 2KBEA 5LQAA 1R0LA 1SUPA 2ZAGA 1MLDA 2ZSBA 4J0IA 2XTZA 4MVWA 4MQFA 5GY7A 3UHOA 4BLPA 2H8GA 4JMLA 5AKXA 1WCV1 5AI8A 3T9EA 5F7XA 3IUJA 1MAWA 5FNZA 4FMPA 4DILA 2HU2A 4MHOA 4E6PA 1E59A 1JDBC 3H1FA 1XAGA 1V45E 3ETEA 3PNPA 1BG6A 4UHKA 1H42A 1QANA 4DUGD 4OIMA 1I3KA 1Y4SA 2A84A 4K0KB 3AETB 5GIOE 2X6RA 4M0DA 4I9HA 2P3SA 4D8WA 4AT1A 5HZKA 3IDOA 3ZQKA 5EE0A 7YASA 2PCJA 5F7ZA 4RMIA 1Y9JA 2X40A 2OHHA 4K7JA 3T5PA 3LUAA 3UQZA 2H4HA 4ZALA 4LKRA 2VZEA 3Q5GA 2WG0A 3WE7A 3IIEA 3ASYA 3QEJA 2X8AA 3PHHA 5CR9A 1WY7A 4FINA 2QIOA 4K6HA 2MWMA 4RVNA 3PX2A 5BWMA 3LP8A 4BFZA 1MAHA 2AI1A 1YB5A 5BNFA 5E2AA 5JFTA 5K5EA 1IK4A 1EHYA 3EQ8A 1T3TA 1SIWA 2RAFA 3KQMA 4WQMA 5E9WA 5H16A 3ZE7A 3ZK9A 1VXRA 3O2QB 4NH4A 4RDIA 5A3SA 3H42B 3BL6A 5E4YA 2ZRNA 3X1XA 2O8EA 1NF2A 2LCQA 3R6WA 1W76A 4EJMA 1HE5A 3KKZA 4JJKA 3UKJA 1M7BA 1IHPA 4AKTA 4RANA 4MYCA 5AVXA 1D3AA 1XU9A 1Y48E 1BN6A 5I9BA 1GU1A 2BY4A 2IWRA 1JMKC 3ROPA 2O4UX 5L3SA 1NN5A 4BJ3A 1N8SA 1LDGA 5DW0A 1TT5A 3ILHA 1MB4A 4ON9A 3DS8A 1H65A 2J9FB 2W2KB 4Y2TA 3DE1X 3RTGA 4AZ0B 1EKXA 4IJVA 2GETA 2R4TA 5JNLA 4QHYA 5ER9A 1R6UA 1SVOA 1J1UA 2C3YA 3AHDA 4P36A 5AUNB 3ISTA 4OB8A 4DQLA 3L1HA 5KQLA 5MN5A 1E3IA 2GARA 5HK8A 1NBMA 4PG8A 2VDVE 7GPBA 5KSOA 3TSAA 2ZT7A 5FOSA 4Q47A 4NQZA 3QWIA 4COOA 4B87A 2FW9A 3CKLA 3IERA 4KQFA 3S2EA 3BIXA 3G17A 3GJTA 5LP6B 4X1KA 1G8GA 5JNUA 2I5PO 4IH9A 1FJGB 4QG7A 3C1TA 3WWOA 1PTJC 1TW2A 1II0A 2B0JA 1N6NA 2FZEA 1ZOOA 4YI3A 3GVHA 2R60A 3I30X 2AD1A 2E4ZA 1BQ3A 2QB5A 3AIIA 3E1SA 5KAPA 3ZXSA 4ETMA 1FVXA 2QROA 1RCTE 4Q9IA 3H1TA 1YHZA 4YRRA 5I47A 1K2VN 4P32A 3I6BA 2Q0HA 4MMZB 4Q9KA 4W5WA 1QONA 4QOHA 5CGQB 721PA 1SQ5A 1U4OA 3EOAI 1XMIA 2C4WA 4UNIA 4LJ7A 3UAXA 3K71B 3FYHA 4HY3A 4OQZA 2M6LA 1E60A 3RFUA 4B6GA 1IM8A 3BXHA 4IDNA 4W63A 4URVR 4ZYYA 2C54A 3GX1A 1DHTA 1DRWA 1DMRA 2PVPA 2R751 3GEPA 4CQNA 1XHFA 4D25A 3MTAA 1LC0A 5DHSA 1CR2A 4IDGA 3AOEA 2QE7D 4WEOA 2OYCA 1ZOPA 3H2SA 1FRQA 4IV0A