3IBTA

Structure of 1h-3-hydroxy-4-oxoquinoline 2,4-dioxygenase (qdo)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
263
structure length
263
Chain Sequence
MQSLNVNGTLMTYSESGDPHAPTLFLLSGWCQDHRLFKNLAPLLARDFHVICPDWRGHDAKQTDSGDFDSQTLAQDLLAFIDAKGIRDFQMVSTSHGCWVNIDVCEQLGAARLPKTIIIDWLLQPHPGFWQQLAEGQHPTEYVAGRQSFFDEWAETTDNADVLNHLRNEMPWFHGEMWQRACREIEANYRTWGSPLDRMDSLPQKPEICHIYSQPLSQDYRQLQLEFAAGHSWFHPRHIPGRTHFPSLENPVAVAQAIREFLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for cofactor-independent dioxygenation of N-heteroaromatic compounds at the alpha/beta-hydrolase fold.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
molecule keywords 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase
total genus 80
structure length 263
sequence length 263
ec nomenclature ec 1.13.11.47: 3-hydroxy-4-oxoquinoline 2,4-dioxygenase.
pdb deposition date 2009-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.210.20 Mainly Alpha Orthogonal Bundle Uteroglobin Uteroglobin 3ibtA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ibtA01
1HPLA 3QITA 4GXNA 5C8ZA 3LLCA 3FYUB 3C6BA 4OU5A 2R8BA 4MYDA 1XKLA 2HA7A 1J06A 4ZWNA 5CT5A 2JGFA 1DX4A 5IKXA 1UK7A 4WDQA 1YAHA 2XMSA 4I19A 3PF9A 5AP9A 2C0PA 2HU7A 2PU5A 3ESBA 2PSHA 1E89A 2DCMA 2CB9A 5AH0A 1XQYA 4Q3KA 3ZV7A 4Y2SA 3JYHA 2ZSHA 1SFRA 1LNSA 5AO9A 4N5HX 3G0BA 5HFAA 4GWLA 1L7QA 3HJUA 1P0IA 4BE9A 1T4MA 3R3YA 1MNAA 3WK8A 2C58A 3F8SA 2PUJA 2WIFA 4XX1A 4DMKA 1YA4A 1D07A 4PO3X 4ARBA 2WJ6A 1QIIA 4FBLA 3GUUA 1MAHA 1FJ2A 3FBWA 5JASA 4JUIA 3G9ZA 3HLKA 4NVRA 5H3HA 1LPOA 1MNQA 2W6CX 2ZYIA 2WIDA 4X00A 3B5EA 3DNMA 5J3JA 3B12A 1YS2X 5AOCA 3F9CA 1PJAA 5IVHA 2BCEA 3WL5A 3AFIA 1U65A 3G0IA 5AI8A 2G63A 1DQYA 1C4XA 5F4ZA 1E8MA 1AGYA 4KE7A 2ONCA 3H1BA 2BKLA 4S0XA 4DTCA 4B7ZA 2CBGA 1QIEA 4CCWA 1S8OA 1A8UA 4MXDA 5EHZA 4XIIA 4DMHA 4G5XA 1L7AA 3SX4A 5ISMA 5BOVA 4P92A 4AX4A 5AKEA 3O4IA 1R9NA 1H2XA 4JEIA 3D2CA 3L1JA 2DSNA 1FFDA 1TCBA 2XMGA 5FXMA 2QM0A 1XZDA 1XZJA 3WIBA 1ETHA 4Y2YA 1EH5A 2WG0A 5EIAA 2B61A 3F96A 2D5LA 2HRRA 5DLPA 2X76A 2XUJA 2I03A 1MTZA 1JJBA 5CT4A 4KJXA 5CXXA 4DSAA 1YAJA 3MUOA 3WMRA 1TCCA 5AI9A 1WOMA 5C81A 1IMJA 4JYPA 4FWBA 1W52X 2HA6A 1X2BA 1JU3A 4BVJA 3LCRA 4EY6A 2WFLB 3EF3A 2Y2VA 4J0GA 1IUPA 1YB7A 2XQKA 2XT0A 1ZJ4A 2XDWA 1MPXA 4EY7A 2QZPA 5AM2A 4F5ZA 2ZJ6A 4BDSA 4ETWA 1YB6A 4IQ4A 1BN6A 2PVSA 2WU4A 4CI9A 5YASA 2G5TA 1SCQA 1XZFA 4WFIA 4AQDA 1EDEA 4HXFB 5ALEA 2AJCA 4TVKA 3HACA 3FLAA 4BP8A 1EDDA 2HM7A 2YYSA 4EUSA 4OB6A 1LPNA 2XUFA 2HFJA 1LPMA 4QDOA 3S2ZA 4L3WA 4TPKA 1UFOA 2CJPA 3KXPA 4L9AA 3O4GA 2UZ0A 2XUGA 3D7RA 1HL7A 2WLSA 5DYWA 5ALPA 2V97A 2CMFA 1XQXA 2FUKA 5CURA 2XUHA 1QLWA 4AZ3A 5K3FA 1TRHA 4G8BA 1F6WA 3DYIA 1EK2A 1LBTA 1F0PA 3WKEA 2VEOA 2WHRA 1UWCA 3R40A 5EI5A 4BE4A 1GGVA 3A2MA 2X8BA 1GT6A 1YR2A 1CUGA 4U2GA 1EXWA 1QGED 3H2GA 4BZWA 1H23A 1XZGA 2AXEA 4Q1VA 5BV7A 2AJBA 5FPQA 2PSFA 3PF8A 3F67A 2ZVDA 2JEZA 1MU0A 4GDMA 2DQZA 1JKMA 4YASA 1IVYA 4X6YA 4AN0A 4Y9SA 3WK7A 1G66A 5IVIA 5K3FB 1Z68A 2QUBA 3FLEA 4JYMA 5HKBA 1H22A 2RHTA 2OAGA 4AN1A 4OB7A 3H04A 3FYUC 4X85A 5K3EA 5D3KA 3I2KA 3K6KA 3STTA 2XUKA 3ZLUA 5CH8A 5E4JA 5A62A 1CUCA 3F98A 4J0HA 3WJ2A 4EZIA 2I3DA 5EHNA 3STXA 1ZOIA 4U2EA 5HK9A 5AIAA 2BAGA 4GBGA 1AX9A 2VTVA 3DEAA 2HIHA 3ZPXA 4BTVA 4C87A 2C4HA 4QWMA 4UHHA 4QDTA 1XQWA 2XB6A 4BCDA 1QO7A 1B6GA 4LXHA 2GBGA 2OGTA 3TJMA 5CT9A 2VATA 3FOBA 3LIIA 3PE6A 4G8DA 3DCNA 2V98A 5LIPA 3P2MA 5HK8A 2JGJA 4Y2JA 2O7VA 4G1FA 3VISA 2JGKA 3WWCA 5SYMA 5AM1A 3G0DA 4FNGA 2VSQA 3B3QA 4BTLA 1SC9A 4Q3OA 4QDZA 3FAKA 1KU0A 3BL8A 2CUTA 1QO9A 1EI9A 3AZQA 1WM1A 4OYYA 3OC0A 5JARA 2WG1A 5JATA 4QWWA 5JZSA 4DNQA 4H7IA 4ZI5A 5ALRA 3FSGA 1JT2A 3AIMA 4BC0A 1C7JA 5AK5A 4Q34A 5JD5A 3IUMA 5K3AA 2JEYA 3I2IA 5ALYA 3WI7A 4AMYA 3WQHA 3HXKA 1UKCA 2WIJA 3W06A 6YASA 2DHCA 2XQJA 1GPNA 3V1KA 3R3XA 2ES4A 4EA6A 4Z49A 3W04A 3WKBA 5T4HA 4WY8A 2VT6A 1BRTA 1XLWA 2J4FA 3WKDA 3QPDA 1VA4A 1XZLA 1Q0RA 3QMMA 4KRXA 4QDUA 2I3ZA 4FDMA 4B0PA 4J0CA 2ROQA 5AM4A 3U0VA 3Q0TA 1CUJA 3KOOA 1AC5A 2J3QA 3H2JA 1YCDA 5KREA 1MO2A 4BATA 1AQLA 1P0QA 4C6HA 1FFBA 3DJYA 2O2HA 5HQ3B 2AJ8A 3W9BA 3MGAA 5JZ9A 3CCBA 4BYMA 2XMDA 4HVTA 4B85A 3CXUA 2WU3A 3T52A 2ZJFA 4WFKA 4M0EA 5FKJA 3RLIA 4KYVA 4Y2UA 3L1HA 5BWBA 2VJCA 3G0GA 4O08A 2WG2A 3PUIA 3U1TA 1Y7HA 4H7EA 4OB8A 4BB0A 3UUFA 5AKGA 3I6ZA 3V1NA 1HKHA 4XJVA 1O6GA 3W2TA 3WWEA 1AURA 1H2YA 3C45A 2ACKA 2OGZA 5EGNA 1DQZA 1L7RA 5AKLA 3OTQA 4X92A 4G9GA 5K5EA 3WJ1A 5FV4A 1A7UA 2G5PA 3H2IA 3WZLA 4WY5A 3TEJA 5LZ9A 2K2QB 1CUVA 5DNWA 1E8NA 1U4NA 1XQVA 3ESAA 1UK6A 5LZ4A 2RAUA 3BIWA 4RPCA 3WL7A 1A8QA 3M81A 4KR0A 3ESDA 5ALMA 4MEAA 1GQRA 1Q84A 3WA6A 2XQIA 3M82A 1MX9A 1AKNA 4UPDA 4FBMA 3S8YA 4N8DA 4MQMA 4OCZA 4P93A 3VJLA 1MAAA 3H17A 4BCCA 5JAHA 3OOSA 3D2AA 5AM5A 4MEBA 2QKYA 2PX6A 3HRHA 2GYWA 1A8SA 2Z8ZA 3H0CA 2PUHA 5DJ5A 1GXSA 4B81A 2GBFA 2GYVA 3O9VA 4WCVA 5C8XA 3OG9A 2RIPA 4GI1A 4YPVA 1ZI6A 4I3FA 4MJ3A 1U8EA 1THTA 1GKKA 4CCYA 1QTIA 4PQEA 1R4ZA 1FFCA 1AZWA 2QR5A 2WUDA 3LP5A 1NU6A 2FJ0A 4HAIA 5AHXA 5LLSA 1P0PA 1RWQA 1K5PA 5AKXA 2PU7A 3DOHA 2VJDA 1JJIA 3GBSA 5AKKA 2HRQA 3PFBA 4X97A 5EHXA 2X5XA 2QS9A 3ZWQA 3BWXA 3CN7A 5CH3A 4BC1A 2QRUA 4HRYA 1K4YA 3VXKA 5A7FA 4TGLA 4IH4A 1LPAB 3H2HA 4DMFA 1LPPA 4UBLA 1N5MA 1OILA 2PSJA 2DQYA 2BUBA 1YASA 5DYYA 3VKFA 4OYLA 2XUIA 3IIIA 4K6KA 4C01A 4GW3A 3G0CA 4ZXFA 1ORWA 3QM1A 1LZKA 4B6GA 3QPAA 1W1IA 2RI6A 5LZ5A 4UBIA 2ZJ7A 2YXPX 3HC7A 4W63A 4X6UA 1UXOA 3WK4A 1W75A 3R3UA 3A70A 5JD6A 4X7BA 4J0JA 2CZQA 5ALXA 1QZ3A 1ZD5A 5ALFA 1E8DA 4QZVA 5DTJA 3TGLA 2BUAA 2JF0A 1MX1A 1IUOA 3C6YA 4FLMA 4ARAA 1J2EA 3IB3A 1XZCA 2GBCA 2HU5A 1FSSA 2B20A 4W1SA 3A2NA 5AJHA 1CUXA 4M0FA 3VVLA 2XMQA 4N8EA 3IUNA 1CUDA 2XQGA 2IIVA 2JIDA 3NOXA 3WWPA 5CT8A 3WKCA 3I2JA 2Z8XA 5JIBA 5HKAA 1BS9A 1W6RA 2XUDA 3WL8A 3W05A 2EDAA 3R0VA 2ZYHA 1UOQA 2O2IA 2OGSA 5C8VA 3CCCA 3PICA 4KACA 4Q05A 5CRIA 3A2LA 1ZGCA 3G9XA 3I1YA 2HA2A 3QMVA 3M3DA 3RARA 1WB5A 4MYSA 4DM7A 2WHPA 1EX9A 4CG1A 4LXGA 2QXUA 1TAHA 4E14A 4J0IA 2DHDA 4NZZA 2Y2UA 4H7FA 5AIBA 1PV1A 4X91A 4UBNA 2WHPB 2XUQA 3AIKA 2VAXA 5FUMA 4PSDA 1VKHA 1EDBA 3C70A 2VAVA 5AKYA 1WPRA 3GROA 4K5QA 4UFOA 3ESCA 3OM8A 3STWA 3D3NA 5LZ2A 5EFZA 2RONA 3DQZA 2Y6UA 4QEKA 4AO6A 4IO0A 4N5IX 1ORVA 3C6XA 1XZBA 2BFNA 3C5VA 2QJRA 2GYUA 3IA2A 2VJBA 5DYTA 4GECA 2HA5A 2IITA 4NMWA 4FKBA 4U2FA 3DYVA 1A88A 4UFPA 5JZBA 4KAFA 5IVDA 5ALUA 4BCBA 3DKRA 2HU8A 1CIJA 4ZREA 1EHYA 4GLBA 5A2GA 4G4IA 3BE8A 1R9MA 5AM3A 2QVBA 4BVLA 3FVRA 4BP9A 4LIPD 2WIKA 1ZD4A 1ZIXA 1Y37A 1DINA 2AJDA 4OUKX 2HA4A 3FVTA 3AILA 1CUEA 2C5FA 2J3DA 3V9AA 1R88A 3G9UA 1ODSA 3D59A 1EB8A 1SCKA 5AKHA 3D4LA 4HTAA 4U2CA 1CUUA 2VQ6A 5FLKA 3FCYA 3O4JA 2OCKA 3K9BA 5EHQA 1J07A 5AK3A 5DNUA 3C5WP 2ACEA 3BJRA 4YX9A 3QH4A 4INZA 3EBLA 3D5EA 4EY5A 3KDAA 1DU4A 2BGNA 5AOAA 4MWTA 3RM3A 2PPLA 2XMRA 4KE9A 3G8YA 5E4YA 3V48A 2V9ZA 2WHQA 1X70A 1M33A 5C7YA 5E4TA 4ZGBA 2G4LA 1IZ8A 4CIBA 4PNZA 3WZMA 4H7KA 2PKYX 4PSCA 2OQVA 1CPYA 2QUAA 2Y1KA 3H1AA 4LKOA 1EK1A 2CKMA 3EQ9A 5JAOA 4KAAA 5A71A 3ZI7A 1G5FA 4UUQA 3DS8A 1ZD2P 5AKIA 1O6FA 2XUOA 1CQWA 1EA5A 5AOBA 3UMJA 2QJWA 2VF2A 2WJ4A 3STVA 1DT3A 3R41A 3C43A 1EINA 4Y2VA 1CUBA 1IUNA 1QIJA 4FFVA 4QA9A 2ORYA 4FNMA 5FRDA 5ALLA 1ACLA 5KWIA 4F0JA 3VJKA 5CMLA 2XE4A 1LGYA 4EHBA 2XI4A 1UT6A 1SCIA 1WHTA 3SK0A 1U2EA 4BZZA 1ZD3A 5AK6A 4B80A 2IX9A 2WM2A 4K6GA 2B9VA 3IUQA 1K8QA 2WTMA 4AZ0A 2HADA 4L0CA 1X2EA 5T4EA 4J3JA 4F60A 4Q82A 1CVLA 4ROTA 5BWCA 1R3DA 1QFMA 4B9AA 4HXGA 1XRLA 3BDVA 2FJPA 4UHDA 2Z5GA 4UHFA 3AZOA 4X94A 5HCUA 1QIHA 1AUOA 4XVCA 1JFRA 3VVMA 3ILSA 3HZOA 2OCGA 5ALKA 4DGQA 5D6OA 2XUPA 4V2IA 4H7DA 4GEGA 3GZJA 3C8HA 3DLTA 4RGYA 1ZGBA 2OXEA 4DSZA 2BUCA 1MX5A 5HFNA 2XUAA 1AMNA 2J4CA 4UHCA 3STYA 1VZ2A 3QMWA 1XZKA 5IH7A 1CUAA 3WYNA 2HA3A 2E3JA 1CRLA 1NU8A 5AI0A 3C8DA 1XKTA 3W9UA 2EDCA 1R50A 3I6YA 4B83A 4PV7A 5AM0A 1CUHA 1HLGA 1LZLA 3MVEA 4A5SA 3G7NA 1XZMA 4DYHA 5CW2A 2WIGA 1TIBA 1R1DA 3O4HA 2GZSA 4BBZA 3YASA 5HQ3A 3ICVA 4DIUA 5ALIA 2PBLA 4Q3LA 3IVMA 5D7BA 1B41A 4P08A 3PI6A 3QPCA 2PSDA 3ICWA 5DNVA 1ODCA 5ALGA 2OCIA 1XZEA 1BN7A 3FWHA 1WCYA 1TKRA 1CR6A 1E66A 2W22A 3WL6A 4UBOA 2DFPA 3TRDA 2O7RA 5JAPA 4A23A 2PL5A 4KE8A 4M0MA 3G9TA 1DTEA 5EIEA 4UBJA 3QVMA 4BDTA 1EVQA 2Z3WA 4Y2XA 1USWA 4J0KA 3GELA 4W9RA 2OPHA 2JGEA 4RNCA 1QIGA 3IBTA 4Y2QA 3SWWA 3KD2A 5CT6A 4B9EA 4JNCA 1BE0A 4CFSA 4GHWA 3WKAA 5LKRA 4CG2A 3RKSA 4AMZA 1BROA 4LHEA 1HQDA 4BRZA 3GA7A 4CCYB 1XZAA 3I2HA 4IHAA 3AINA 1OXMA 2GBIA 2VA9A 1LPBB 4W1RA 3L1IA 4PW0A 5AI4A 4CIAA 4OPMA 5T4FA 3BJMA 4I4CA 1I6WA 3HYSA 2Q0XA 3H18A 3BIXA 1VA5A 2LIPA 2HHAA 3ANSA 3WA7A 5ALSA 3ZLTA 2BGRA 4ZV7A 3FLBA 4Y7DA 4W1PA 4K2AA 3QYJA 1TQHA 4F21A 3HI4A 3WK6A 4FTWA 3WIOA 2RGUA 2WFMA 5LZ8A 2B4KA 2C7BA 3DD5A 1CUYA 3I2GA 2QTBA 3C87A 1CUZA 3D2BA 4B82A 3EQ8A 2QMQA 2HL6A 5I7UA 5ESRA 1VE6A 1JMKC 4MWSA 4PF1A 1QFSA 1EVEA 2Y6VA 3BF8A 4FHZA 2PM8A 1UOPA 4KEAA 3X3HA 3FYUA 2ZSIA 1CUIA 3D0KA 4OD0A 1J1IA 1ZIYA 3HSSA 1XLVA 3V1LA 3IULA 5AKZA 5DTIA 2JBWA 5HF5A 2WTNA 2XLBA 1SOMA 4J03A 1ODTC 1CLEA 4BRSA 1XROA 4JH0A 1IZ7A 4BAUA 4KRYA 4UHEA 5A7HA 4FMPA 1QE3A 2RHWA 2WFLA 1LBSA 1DT5A 5JALA 5K3DA 5JANA 1CFJA 3AUKA 3IURA 1XZIA 5E2IA 3BDIA 4H7JA 4EBBA 4MQLA 5ALHA 2OCLA 5ALOA 3R3WA 3QBJA 3R3ZA 5I8PA 1Y7IA 4J0DA 1BCRA 2XMCA 4QNNA 5T4BA 3F97A 1XRRA 2GZRA 2OLEA 1QIMA 1XRMA 5AI6A 4EY8A 2BJHA 1MJ5A 3FCXA 2OAEA 2YASA 4RE6A 1ZI8A 5HZGA 1VXRA 5FDFA 2I78A 4W1QA 1WB4A 4BAGA 5I9IA 4Y2PA 1C7IA 4H77A 4J7AA 4G8CA 1ZJ5A 4H0CA 4EY4A 4X93A 2H7YA 1XFDA 4X95A 1N5RA 3KWJA 4IH1A 1N8SA 5ALZA 1EB9A 5IVKA 5CH5A 3V1MA 5A6VA 4XWGA 1ISPA 1QIKA 5AICA 4ZV9A 3WK9A 1YSCA 4ZRDA 1GKLA 4K6HA 1UK8A 3MUNA 1XZHA 1LLFA 1H2WA 3LS2A 1UZAA 3ZLVA 4Y2RA 1YS1X 4C4ZA 1QONA 3AJAA 4WFJA 4X90A 1G42A 2PSEA 3A6ZA 4UFNA 4HS9A 4D9JA 5HF8A 2ZYSA 4LXIA 4RE5A 2QXTA 4LYDA 3RK4A 1JJFA 3FNBA 3FYTA 4QLAA 2H9YA 2XQFA 2HFKA 5SYNA 4AXBA 2YH2A 1NX9A 4C4YA 4U2BA 1MT3A 2XLCA 2XMZA 5DWDA 3O95A 2JGLA 4FOLA 3EQ7A 1HBJA 5ALJA 2VJAA 3K2IA 3EIOA 4E11A 5FP0A 4LYEA 1PFQA 2WUFA 5A7GA 4DMCA 4H7HA 4CG3A 3CN9A 2WQZA 3BXPA 5D3ZA 1N1MA 1FFEA 2CEKA 5ALTA 3HEAA 2DHEA 1JMYA 3DOIA 4IH9A 4U2DA 2OQIA 5ALQA 4B84A 4DNFA 4E46A 4BVKA 3FSGD 5EIHA 7YASA 3KWFA 5HF6A 4G9EA 1WHSA 2P8SA 1XRQA 5JD4A 3WLAA 1H2ZA 1TCAA 3VJMA 1RYYA 3JWEA 3C6ZA 4YK7A 4OSEA 5JADA 2ZYRA 4C89A 1GPLA 2WJ3A 4FFWA 5LKAA 3T4UA 1VZ3A 4HXEB 3I6MA 1G4HA 3N0TA 3LIPA 3IUJA 2JGIA 3IDAA 1F8UA 4FLEA 1QOZA 3QZUA 5HF9A 4N8SA 4NS4A 4QDXA 4KE6A 3H2KA 3UUEA 5ALDA 2HA0A 1VOTA 3I1IA 4PSUA 2H7XA 1XLUA 1UK9A 5KBYA 2WSLA 1DX6A 1JU4A 1E3QA 3WK5A 2WILA 1TK3A 2JGMA 5LYYA 2VT7A 3NUZA 4KAJA 1VE7A 4DNOA 1ZICA 3I28A 2QOEA 3PFCA 1VLQA 3GFFA 3DKKA 4WDRA 1P0MA 2FX5A 3E0XA 1THGA 2HDWA 3O0DA 4QE3A 5ALWA 3SC2A 3AIOA 5K3CA 4B0OA 1UKBA 5LP1A 1JI3A 3G02A 1BEEA 4Y2TA 1LPSA 4ITVA 1DWQA 2DR0A 3PDCA 1FFAA 5K3BA 3I2FA 3NWOA 5FOQA 3E3AA 4C88A 3BF7A 3HABA 1QIFA 1ACJA 4E15A 3Q8WA 1CUFA 2O2GA 3STUA 3WWOA 4UBMA 2WUGA 3ED1A 4X71A 5LZ7A 5FPPA 1HDEA 1GQSA 2WFZA 1VJ5A 4A16A 4OU4A 5AI5A 2C0QA 3O9MA 5AK4A 1OCEA 1UKAA 4HRXA 4P9NA 2H7CA 2XMBA 1BCSA 4AO8A 2WUEA 2AJLI 4H18A 2D0DA 1QTRA 1DWOA 4H35A 4UBKA 3WWDA 4HZGA 1QIDA 3OURA 2WKWA 3DL4A 1VXOA 4C4XA 1F0NA 1CQZA 3E1GA 4BAZA 1WB6A 1CUWA 1WPXA 3KSRA 1KU6A 1BU8A 2ECFA 2QT9A 5JYCA 4X6XA 4DLNA 1K63A 3N2ZB 1XRNA 1T2NA 1YA8A 1QJ4A 3NGMA 4FLFA 1CUSA 3DL7A 1XRPA 4WJLA 4EB0A 3WYDA 3OPMA 2EEPA 4QLOA 4UHBA 5AKJA 2NW6A 2R11A 1CEXA 2H1IA 5ALVA 1RP1A 3VDXA 3DDUA 4AB1A 1W4LA 4DNPA 5CBKA 5KWJA 1UOOA 3M83A 3JW8A 5CXUA 5CTAA 1GZ7A 2C5GA 1MN6A 4X3CA 3ANTA 4L72A 3R3VA 5ALNA 4AO7A 1E5TA 1K6EA 1W76A 3H19A 1KEZA 1DWPA 1Q0ZA 1CV2A 1ZI9A 1Q83A 3AZPA 1GPKA 3E4DA 2OG1A 3PUHA 2V96A 1BEZA 4G4JA 5JAUA 2Z3ZA 4G4GA
chains in the Genus database with same CATH superfamily
2NQ2C 3TXYA 5H8WA 1V96A 3QITA 5FWDA 3LLCA 1LBIA 4D4LA 4BO7A 4AKHA 1ZMRA 2OCPA 4R40A 4R6WA 4RMGA 1XNQB 5CFLA 2RCNA 3K1AA 3FYUB 1BE6A 4IXWA 1A98A 5LR6A 4KNYA 4ENVA 1U1CA 4M9ZA 2FFAA 3FNEA 4MYDA 5ENDA 3BYZA 3SY8A 2CMKA 1MZVA 5CVUA 1XKLA 1GARA 2HA7A 4HWRA 4PLVA 4QXPA 3KPVA 1OI4A 4KWIA 1U28C 3EXAA 3PI7A 2CV1A 5J43A 4CM4B 2JCYA 2PZEA 4CNQA 5AVQA 3T5GA 2IPOA 2R44A 2C82A 2CNOA 5CT5A 4K9OA 3WOHA 1TQ8A 2H0RA 2NQTA 5HEKA 3WE7A 4YV0A 3THWB 4Y1GA 5CR9A 3KV1A 4JLNA 1KI6A 4AF6A 3WFJA 1XJQA 1YAHA 4NZ9A 1G38A 4OM8A 4PZDA 2BHTA 2UZAA 4RFSB 3VO2A 3ESBA 3EHDA 1C3VA 1NXTA 4TTTS 5M29A 5AH0A 3ZDAA 3AETA 1XQ6A 4Q3KA 2O3QA 3HYCA 5A4IS 1IZZA 2JJ8A 1WMFA 2V03A 4U7HA 3GT4A 1Z6AA 3B6KA 3ADDA 1JR3D 4KQJA 3CTMA 2ZSHA 3K09A 3N7TA 3AUSA 3NDBB 4Z9AA 2H54A 3ICCA 1Q50A 1NN5A 2OBXA 2NUTB 2HTEA 2YJ4A 3EGCA 4PGMA 5AVJA 1ZUWA 3ZXUB 4R1QA 5CEJA 3P2IA 4UEOA 1D8TA 2EWMA 4BNMA 3JARB 1T4MA 2FEAA 3R3YA 1MNAA 1DDIA 4JGBA 4NG4A 2GN9A 1ZZEA 4UXHA 2CYAA 2MMGA 5FI3A 4D8YA 1F8YA 1K5HA 4ZEOA 1KK0A 1AKEA 3F8SA 2ZZNA 2J67A 3H11A 1CVIA 3N87A 1DKUA 4UVDA 3KOXA 5DW3A 4ZYTA 2F8TA 1YA4A 5F1YA 1UIRA 4ILEA 2F1KA 4A1FA 2DLDA 2OBLA 3O8OB 2OUKA 4ARBA 4EHDA 2WJ6A 3TGPA 1SXPA 1F7VA 4NU5A 2VDOB 1KJQA 3EFHA 3OTHA 4MPPA 4MR8A 4TSRA 3WICA 3RAEC 1XMQB 3OA2A 4OGWA 4K8OA 1BDIA 3QUQA 3CB4A 4F1JA 3FBWA 2I9KA 3GN1A 4TYPA 2YW2A 2NG1A 2BDTA 5JASA 3EGDA 5KINB 3P0HA 1SA0B 1XVUA 4EYKA 1ICIA 4DIEA 4LF5B 2IY7A 2J85A 3DDNA 1VLMA 2VR1A 1LPOA 3KTFA 1JFFB 5LP6C 1KK2A 3OEHA 4B35A 2VOJA 2HD4A 1NLYA 2MINB 2ZYIA 3QVWA 2WIDA 3GEMA 4J29A 4GYYA 1FYEA 1JALA 1E7QA 2ZRAA 5H1YA 3ZIUA 2DUMA 3IHLA 2C96A 3NNNA 2XD9A 5K45A 5IUKC 1QYCA 5ELMA 1YR1A 5HWSA 1W4BA 3BGIA 3F9CA 4AFNA 1EPUA 4HLDA 3OZGA 3N6RA 4QD3A 1A9XA 1HFJA 1Z2PX 1E9FA 1VJCA 2XB9A 3DVLA 2WWFA 4QFBA 5TGTA 4EFNA 1M1YA 5KTOA 2R6GA 4CDRA 2X2OA 3G0IA 5C5IA 1CZNA 1A9TA 1D4OA 4K7JA 2BFAA 1B74A 2EWVA 2YV3A 1DQSA 4P80A 5AI8A 3T06B 2YDYA 5IEJA 1THZA 2WJYA 3K0BA 3SIWA 2OEPA 2XTJA 1GZ6A 3F78A 3G9QA 3LXXA 2XEDA 3WMXA 4BLUA 5D3QA 4U0JA 2Y0DA 1YZFA 3DMHA 3G23A 4Q1DA 2B2CA 2K5UA 2BKLA 1A9ZA 3E4CA 2EJCA 4URXR 1FDWA 1QIEA 2BH9A 2NT4A 1J25A 1SCDA 4CCWA 2G0AA 4DDHA 1TIKA 4B33A 1S8OA 2LUOA 2XWSA 3LHDA 4IX9A 4MXDA 421PA 5EHZA 3GCDA 3OM0A 2IS1A 2H85A 1EX6A 3ZQ6A 1QHHB 3EUFA 2X41A 1L4KA 3LE8A 4RJIA 1XHFA 2KLHA 4UQLA 2QX8A 4PINA 1VLLA 4X91A 4MHTA 2DY1A 1KAOA 4MO9A 3AEUB 3EVFA 4QICA 4UEJA 5BPHA 1YMQA 2C5HA 3PDIB 2CFIA 3B38A 2PKWA 5CX1A 1U2RA 3PGVA 4CETA 1U5BB 2HMAA 1GTMA 3IUYA 5EJ2A 3KFVA 2A35A 3D4OA 1D9ZA 2PH3A 4AMVA 3KBOA 3QELA 1RC1A 1TCBA 1YQGA 1VFNA 3GARA 4JAVC 2QM0A 4I5EA 5FXMA 5EJ6A 3A05A 3EUAA 3WGGA 5EIAA 2B61A 2JKZA 2IBMA 2VYFA 3O2SB 5CYFA 3WNVA 3BIJA 1XD9A 4OQMA 2HRRA 3WLTA 1SC6A 3PBKA 2I03A 2QRJA 3GFSA 4JLVA 3UH1A 4KK4A 4PHTA 4YFYA 3NOQA 4GI7A 2ZSBA 1UEJA 4KN5A 3UCFA 3GGSA 5KKAA 3I2YX 2ZRMA 1AIPA 3LCJA 1V2GA 4KJXA 4K9NA 3HGTA 1YAJA 4LRWA 4DSAA 4GRDA 3MUOA 4WOPA 4FNAA 1E3DA 1KP9A 1SHJA 4HN2A 5AI9A 2A4KA 1WOMA 1KDVA 2MWMA 4KXQA 4EVIA 2AI1A 5J4KA 4FWBA 2D54A 5A3VA 3HCAA 1W52X 4XGRA 3SX0A 1YOBA 5JJBA 3NIWA 1ZR2A 5KYYA 1FCJA 1WETA 3QA9A 1N2EA 1ONSA 4DVGA 2ZJYA 4RGVA 1QPGA 3L7KA 2PYZA 3REQB 2P62A 3M6LA 4YT5A 4TYNA 2NUPA 4HNVA 2RB4A 4KXFB 1P5JA 1UR5A 2H2AA 2XQKA 3DWEX 1NBWB 1X19A 3JQAA 3OCXA 5DMHA 5FH9A 1V0JA 1N2HA 1E62A 2CJXA 2XT0A 2YFYA 3JQ7A 2JCVA 4REQB 3OKCA 4V39A 2XX3A 1ZJ4A 3D3EA 3RFTA 5JSFA 1ND6A 3KQUA 1C8LA 1E1KA 1ZH6A 3C5EA 1GLVA 3DLIA 3KR9A 4FX5A 1P2TA 5A0VA 1UZNA 2ZJ6A 5KPDA 2QZ4A 1KQ3A 4EWLA 5B7QA 1XMVA 5C8YA 1DRUA 3KUXA 1JJAA 1ZH0A 4WACA 4F72A 1CLUA 5LU8A 2E4WA 3PXBA 4L95C 2NO6A 1J8YF 1DWUA 1FX0A 5G41A 2GK6A 1NFFA 4LISA 4UD6A 3UMVA 4QBGB 2WWWA 4IHJA 4BNDA 4ZHSA 2WU4A 1BSVA 4G0OA 3P96A 4CI9A 1KOFA 1TADA 1XSEA 2W6ID 2G5TA 3B48A 5B53A 4FM9A 1JZTA 1XZFA 2R00C 3V4VB 5L3VA 1PJ3A 4WFIA 1E1QA 4AQDA 3GGCA 4KYUA 3TTSA 3CRMA 4BZXA 5JY6A 3HKBB 1J8VA 1CZHA 3LCVB 1T5HX 4TVKA 3PQ6A 1JJVA 3FLAA 4FHDA 3UWKA 3R5SA 4M6WB 3ZY6A 3MQFA 4EIWA 3PHBE 4X1KA 5IH3A 1ESZA 1XBTA 2HM7A 3NBZC 3P9CA 1K27A 1LJLA 2FA9A 3IV6A 3ZNQA 4D9IA 2YYSA 3M9WA 2EHDA 4OB6A 1E3MA 3D8HA 1LPNA 1GWNA 3G88A 3WBJA 3F8TA 4NCJA 1U1IA 3HADA 3QVJA 2CJPA 1QGOA 1T1IA 4WZBB 4MVWA 4EG6A 4KSBA 4RHUA 4OI0A 2UZ0A 2XYGA 3D7RA 2H4WA 4XB6B 3C3AA 1EK6A 2GJ9A 2F1HA 3PA6A 4WERA 1XPOA 5A03A 2DFLA 2FP4A 3IP5A 1TAGA 3VGJA 2CFRA 3URKA 4O4LF 5HE9A 4BUCA 1E60A 1XAHA 1QWSA 3LM8A 4FFNA 5F12A 1RQNA 1XQXA 4FS3A 3L77A 1T3LA 2ZRKA 1C5KA 1NV9A 5CURA 4A26A 4B3XA 1MRNA 4AZ3A 1TYDE 4EHHA 1PEDA 3TM5A 2WWRA 5K3FA 3Q1LA 2RC6A 5I9MA 2G4CA 3DYIA 3EPKA 4F56A 1W35A 2J9RA 5FOTA 4E5MA 1UWCA 1IFXA 3R40A 1IUKA 2YN2A 4MKHA 1U3CA 3FMGA 1WDTA 5CGQB 3VYUB 3RUCA 1K8ZB 1TQ2A 2X8BA 3A2MA 3JWPA 2DGDA 4J8PA 1NQ5A 4YO7A 4WOCA 2FEXA 1YR2A 1EFDN 1S1MA 2IPAB 4FP9A 4F3RA 4U2GA 2FRXA 2W2KA 5KNBH 1EXWA 4XZ3A 4AJNA 1TVKB 4MGYR 4F5WA 4GOOD 2OCAA 3UY4A 1M2OB 3EQ2A 2AC4A 3BSFA 3H2GA 4EB8A 3ZIAD 4ZZ1A 4Y6LA 1K3UB 2AXEA 4LF8B 1VGQA 1VTKA 4Q1VA 1C7ZA 1DRWA 5IULC 2GQ0A 4BV8A 1L8QA 1ZWKA 1KZGB 1NF2A 3IDZA 1QCZA 1GHTA 1ZM7A 2AT1A 1NVGA 3BFPA 3FOCA 3H5VA 2OHFA 1XI2A 2HSWA 5ICFA 5IM4A 2N46A 3GZNB 5FNVB 3U31A 2EVWX 3ZGYA 4O4LB 2GEVA 4BUZA 1JLRA 1M67A 3ZGXA 4DJAA 5BORA 2LKDA 4MLCA 1MU0A 4FZRA 1PR0A 1RI4A 1ZVJA 1QTQA 1KNXA 1JKMA 2PMFA 1KYIA 3HSKA 2Z4SA 1NDUA 3I30X 4X6YA 4QRIA 2ACVA 3RYCA 3CX4A 3AF5A 4BB6A 1YFJA 2W4MA 1RKQA 4YRDA 5K3FB 3DWFA 3I9V1 4J1TC 3RYIA 3LRXA 2WSSA 4EX7A 2EQBA 2XGOA 2X5KO 5AUPB 2JW5A 3OLCX 1XYVA 2RHTA 1ITZA 4O1HA 4C4TA 5CCDA 4YMGA 3T41A 3ELUA 3BPSA 3EZNA 1DHRA 4Q01A 4AN1A 3H04A 4GM1A 2G7MC 5K3EA 1GPYA 2GAJA 4M36A 1PGJA 3I2KA 3K6KA 3RVNA 1Z47A 2OMEA 2RHRA 1QVAA 4ZANA 4YAKA 5CAEA 1URPA 2VP3A 5JWRA 3VR2D 5E4JA 3W1EA 2HHCA 3PDHA 1RADA 2OCDA 4NL4H 2AF4C 4X60A 4J0HA 2TS1A 4BLRA 4EZIA 3FWNA 1DJNA 4JB0A 1YKSA 2CFOA 4ZQFA 4U2EA 1ORTA 3KKMA 4NQZA 1U7HA 3ABOB 4MW1A 3JQPA 1G5PA 4OQXA 2OTCA 3LXRA 9ABPA 1PN3A 1WUIS 1AX9A 5GIOE 4YHHB 2FQ1A 1JYSA 1WRBA 5LXTF 3N75A 2EYQA 3WGZA 2FX3A 1IN4A 3I52A 1B1CA 2OM2A 3A9RA 4DCSA 2YNMA 4RTQA 3LLUA 5I51A 4ZPXA 6REQA 1GL6A 3T4XA 3RC7A 3LFTA 4OXKA 3UWMA 2WJHA 3S2EA 1GCOA 2W7TA 1XQWA 1MXHA 2XB6A 3JZAA 4FMCF 4UM8B 4G26A 2W90A 4BCDA 3LH5A 2AOTB 1RCTE 4DAEA 4N54A 2BKUA 1HC7A 1PS8A 2I8LA 4LOJA 1B6GA 4C07A 5CFMA 1RXWA 3SFZA 2OGTA 1FVHA 3E22B 4WLVA 3X1JA 4ACBA 5FPHA 3TJMA 1DELA 3WTBA 1QG4A 1UPXA 3FOBA 4C3VA 5DWVA 3LVQE 4ED9A 4R7TA 3VSCA 2X2EA 1A2KC 3KUCA 4G8DA 4TMXA 4CMIB 4OX9B 3ADPA 1IDN1 1ILWA 4FEEA 4BMYA 4CQMD 3KQKA 4Y30A 2V98A 3M3PA 5LL6P 2XCSB 1SO8A 5LIPA 1OZ0A 3G17A 5LQAA 1KHTA 3HU3A 1UP7A 4WECA 1L4EA 2NUTA 2IOFK 3GBVA 3H3JA 3WWYA 4G1FA 2YMMA 1FYDA 3HKDA 2CJFA 4D7AA 2H18A 3GVIA 3JPYA 4M38A 3G0DA 2ASVA 5AM1A 5GOZA 3CWCA 3SHVA 3TZLA 1RQPA 4QPNA 3D6AA 5C7OO 1Y3FE 4A2WA 4AY5A 5CLJA 3EEYA 4I4TB 4PO9A 4CCYA 1NE2A 5FR1A 1N5IA 2P78A 3FKQA 4I3GA 3VMMA 1KU0A 4X1YB 5ERYA 3I9NA 2OZLA 3R9IA 3N2YA 3PLRA 1VJTA 2Y8EA 3OVMA 3QF4A 4EFDA 1SQGA 1G64A 2CN1A 2IL1A 3LQFA 2P6OA 4RKEA 5DLDA 3AP2A 2BGIA 2W2TA 1WM1A 3GDOA 2IGTA 3EH1A 3T34A 5KOJB 2C7QA 4OYYA 3ZHZA 3IAS6 3PGA1 4GYJA 3MTGA 4A0GA 4F4HA 5JARA 5JS7A 3DW1X 4DY4A 1MEJA 3ODPA 4UJ5A 3D1LA 4MRVA 2W2PA 1YQ9A 3LPCA 4OQEA 3OE1A 4MWEA 5EKDA 2GKOA 4H7IA 2C2HA 4WKGA 4EGCB 2JKVA 1SULA 3QU2A 1NVTA 2C2ZA 2XPCA 2R84A 1MG5A 3KQPA 2QW0X 2N42A 3GCGA 3S55A 3DD1A 3V8PA 4Z4CA 2Q2OA 4WESA 5DEOA 3V4RA 1CB0A 4V0OA 3H6HA 3WGIA 4BC0A 1ECPA 1C7JA 1PGPA 5E3JA 3AUXA 4DMGA 3WNBA 2FSFA 5HG0A 1JBEA 2WSSD 2FZKA 2V8OA 3M2TA 4NENB 2DLCX 5ALYA 1R0ZA 2KM1A 2RJ3A 3UEOA 4BWVA 3AWDA 3PG5A 2Q7DA 2O2CA 1JX6A 2A67A 4L5YA 4Q6BA 3VNSA 1THMA 2C7VA 4C76A 1F2VA 1P4GA 3BXGA 3F2VA 3FROA 1X9GA 2AEEA 4RABA 5SY4A 1E18A 3CKKA 1WXDA 3W06A 4AUEA 1J8QA 1LU9A 1BU5A 6YASA 2O8FB 3BJIC 4KC0A 1EP2B 2IQIA 2XT6A 4HRAA 5JSUA 2A84A 1JAYA 4QGSA 2RK4A 5FTJA 4MUNA 4ALJA 2ORED 1G2QA 1OPXA 3KT3A 3FHLA 1VMDA 2WSYB 4EA6A 2BTOA 3BWDD 3W04A 4DCTA 1BA3A 4LV5B 2CF6A 3AVQA 1G21A 3IE0A 5T4HA 1Z0FA 2XZOA 3RWBA 1UXGA 3C1UA 3QWBA 5AVZA 2ZUFA 2B9EA 3C7AA 1E2IA 3KZ1E 2XTNA 1F1JA 1G8KA 1FSPA 2VZ8A 1PJ2A 4MP8A 3DE2X 4TL8A 2WOJA 4L0QA 2I5PO 4TTRA 5DX0A 3NTUA 3LI2A 1EA7A 3REFA 1VA4A 4G1BA 4GMHA 1XZLA 3EMDA 4M4SA 1JIUA 5HS6A 2D13A 4L50A 4EKDA 2OO5C 1NRIA 5TT0A 4DMUB 2XCRB 3QMMA 2PWBA 2FFJA 1ZXXA 1M7GA 4IDEA 2JARA 3LK7A 4FDMA 4JA2A 3MS7A 2ROQA 1LWNA 1EIZA 3G3EA 4F4JA 1W7AA 3ML1A 4Y6GB 3R2JA 8AT1A 1NUQA 3VAZA 1J5PA 2YN0A 4ZEVA 3GEEA 1AMUA 3KOOA 3A06A 1AC5A 2OD7A 3EWNA 2J3QA 2A94A 2ZTSA 4HY3A 3L6CA 1VPVA 5EJIA 3QJGA 1YCDA 1QLHA 4NKRA 4PSAA 5B3JA 2H4YA 5B36A 3EEBA 5KREA 4ZP1A 3TVDA 1AQLA 3FH0A 3MWEA 3P2EA 3PC8C 4NHEA 4AZSA 4MQEA 1FFBA 3DJYA 4HDSA 4C0AC 1JDBB 1UOEA 2PJUA 2B35A 5ADWA 3BE5A 1P9RA 4X7RA 2BHLA 4JVLA 3W9BA 2GKSA 2JC3A 1BQEA 1SVOA 3LO8A 1YOVA 3ZBPA 3ZCRA 4BYMA 2XMDA 1XTTA 4DSNA 3W6PA 1RM0A 2VHYA 3EFOA 1BGWA 3JWGA 3K0CC 2WU3A 1Z8FA 4RF5A 3IHKA 3ILXA 3VHLB 3RSSA 2GPYA 5HJ5A 5HBRA 1FPQA 4J0FA 4DCJA 3NRBA 4AJ9A 4YAIA 1K4KA 4JY7A 4ZKDA 5BWBA 1N33B 1W5TA 2CLDX 2NNWB 4ZCLA 2NO7A 2PVCA 1MKYA 4MYTA 1BOOA 2WG2A 3EODA 4DADA 4IO1A 1MAVA 1JQ5A 3PUIA 1MW8X 3U1TA 4H7EA 2YZNA 3OPVA 2C2YA 1OGJA 1ZBDA 4OB8A 4C0SA 5G40A 3UKOA 1ML3A 4EI9A 3GT3A 2O5VA 2IPMA 4PPQA 5AKGA 3URMA 2EZ4A 5BNFA 3GCWA 4TMYA 3NWBA 4DUZB 2ARKA 3NM5A 1O6GA 1J8MF 1TJ5A 2XQVA 3G2OA 3W2TA 5C32A 2YWCA 2PFGA 3ZIAA 1PR3A 1UEIA 2R7LA 3S1LA 4JR1A 3RIHA 3VR3A 4O1IA 1A95A 2P0EA 2JGNA 2OGZA 2AL7A 3A4VA 3AF4A 1P31A 2AS0A 4FSXA 4RKFA 3CLRC 4OBWA 1Y34E 3SQNA 4BBJA 4Q3EA 1VCOA 3NNDA 3HL4A 4O4HA 4QFMA 4JJ6A 1MHPA 4J9UE 5AVKA 2BJVA 5EKUA 4F4UA 1SBYA 3H2IA 4YMUA 3MF4A 2GA8A 3L7IA 1OI7A 1Z4PX 2P9EA 4DLKA 4DV1B 1SIWA 2OENG 1CETA 1ATIA 1GQFA 4BNTA 5K01A 1TUEA 5BO5A 1QR2A 3QX8A 3OCZA 5EPEA 4NCXA 1ZQ9A 3OTGA 1FPMA 5F9HA 1LV8A 4IYRA 5BUSA 1GY8A 4FXOA 1V6CA 5EZQA 1P2SA 2Q9CA 4KGXA 1H6BA 1DOHA 4EJMA 1U9YA 2Q3JA 3RFCA 3U81A 1XWWA 4J6FA 4MA0A 4C4SA 4WEOA 4D4JA 1UFVA 1T3GA 4Q3DA 4MEAA 3UTCA 1JZSA 1XZNA 3P27A 1DC8A 1GQRA 1Q84A 2MYPA 2QMEA 4UOEA 5LLDA 2BMFA 1TU0A 4ARIA 3NTLA 3FJYA 5DK6A 1AKNA 4I1RA 5E6RB 3IUSA 1SKAA 2HWWA 5WRFA 4UAJA 4B3SB 2P2SA 3B5JA 2Y77A 1AK2A 1I3OA 4ZRNA 4KLZA 4CLOB 4FFRA 3DR3A 2IYWA 1SUPA 3RRZA 5CLHA 2YOGA 3EZFA 1ULBA 3DUWA 4A73A 4MQMA 5KU7A 3G0HA 1ZGAA 1C9KA 3TOZA 2ASEA 4P93A 3VJLA 1GCAA 4L8WB 4E1BA 3L93A 4KQIA 1J9ZA 2YTZA 2I7DA 1YZTA 4MVJI 4BFXA 2F62A 2NUPB 3UGKA 5ENVA 1XPJA 1X42A 2B69A 1NQWA 3M4ZA 4URWR 4A7PA 3FDJA 3LLVA 2I6TA 3LC2O 4EMTA 1SXJC 1XYYA 3GH3A 2GNOA 4N5LA 4FGUA 4KLRA 4MEBA 2QKYA 1U0SY 4EG3A 5BN3A 5KTSA 3R3JA 5T57A 2PEYA 2QB5A 2XVAA 3HRHA 4A2QA 4DWJA 5HHTA 4QUGA 1TE2A 3VTAA 3LPMA 3OPNA 3GFQA 4JU9A 1BGXT 4R8LA 3UAXA 4C05A 3D6HA 2PUHA 2QW8A 2EX0A 2R8XA 1RWKA 4R2WA 4G5YA 5A06A 1SUAA 2JFBA 1QO0A 1W5FA 5L7YA 4ZT7A 1C30B 4INJA 4A8JB 3S44A 2GM9A 3BJEA 3PEVA 3EFOB 2X58A 4JLKA 4HMQA 4D4MA 4N49A 5C8XA 3LFHA 4J6EA 2JI9A 2NU9A 1SUCA 1T3ZA 1ZHFA 5FADA 3PEWA 1O89A 3ED5A 2ONYA 8OHMA 1BO6A 5KQGA 5GM2A 3S2UA 4I3FA 4NWIA 2Q4BA 2C00A 2J6IA 2QYHA 3B1JA 3ROPA 3KK0A 1MZPA 1U8EA 5C53B 4MMXB 5IYZB 3OJWA 8MHTA 2VXCA 3H2SA 3II6X 4NYIR 1DEKA 2C9MA 2GO7A 3OEHD 1EFPA 2W93A 3W5HA 3KJGA 5BUZA 3LP5A 2EFGA 4YS6A 2ID8A 1CC1S 2JCSA 1RWPA 5BSEA 3EF1A 4JZYA 3PFGA 3K0FB 4JC8A 2KHZA 3W6NA 2QR2A 2IEIA 4X45A 4I1IA 4FWIB 5G1PA 1GRQA 2OFFA 1BWQA 3I8SA 4E22A 4DCOA 3TMAA 3EZXA 1JFSA 4MTLA 1J2UA 2OXTA 3B1XA 3UF0A 5AKXA 4MKRA 1PG2A 3DOHA 1G8GA 3N0RA 3V8BA 4DXAA 1BMDA 2JB9A 2JANA 2XTZA 2Y4OA 1WCXA 3UXHA 3BGVA 1HE5A 2QN2A 4EAAA 4C30A 2ZRDA 4AT1A 4X97A 2D2IA 3EQZA 2Q3CA 5BVHB 3AB7A 3SHOA 1M2VB 3MWYW 4JUCA 2KLBA 2QS9A 3DBHA 4NESA 1R37A 3BXZA 1GFSA 5E8JA 4JU8A 5LOVB 4B48A 4PZLA 1U8YA 3W8RA 2MSEB 4M86A 5EVJA 1YZYA 3C98A 5CD9A 1PE0A 2XXAA 4BC1A 2X9LA 3F46A 3BGOS 3IILA 1K4YA 3JQDA 4OHPA 5LM3A 3AVVA 3TLKA 2DWOA 4L4SA 3HCCA 3I8OA 1JIQA 4FMDF 1EQ2A 2IHNA 4BN5A 4YQEA 4UBLA 3ZC3A 1DIOB 3DLHA 2JLUA 2TMYA 4JS0A 2DT5A 4LC1A 4DA0A 4ZDWA 4BKRA 1E32A 1NULA 1M1NB 2PSJA 1P17A 2DQYA 3AW9A 1TQ4A 4G0PA 4NPAA 2AWNA 3ZE0B 2D1YA 2GZ3A 3BB4A 2NTVA 5C1PA 3HDTA 1YASA 5F5LA 2DUUA 1KBQA 4EG5A 1PDOA 3ZJYA 4HNAB 2GAOA 4K6KA 3ZV4A 4CKXA 4NZYA 4JB3A 1DBWA 2NZJA 2HF9A 4WESB 3USES 3T3OA 1W29A 2AZXA 2BPOA 4QUIA 3MCAA 2D2FA 4FFOA 3SBOA 4TMWA 4OYHA 1WJGA 4O63O 4PC6A 4RD6A 4W7IA 5KYYB 5AT1A 3QPAA 4JXKA 4WNAA 4CDNA 5LZ5A 1PK7A 4UBIA 2QAGC 3B1YA 2XCUA 2ZJ7A 3UXMA 1J8DA 5E1DA 3N6VA 1Z2CA 2YXPX 1IM2A 5DGIA 5EXEA 4Z6KA 3COJA 1KGSA 4RK5A 1VB5A 5KOYA 3BCSA 1U8ZA 3RJ9A 1UXOA 1GEEA 3KO8A 2MR5A 1FYXA 1W75A 3R3UA 3AEKA 4FDAA 3UJ8A 1DX9A 3GAAA 4FC7A 4RL6A 4BLPA 3LG2A 2VTBA 5DI3A 4OQPA 1GCGA 1XWFA 1RS0A 4OH1A 2FWPA 3RR2A 5DXJA 1Q7BA 1JEQB 1XAJA 2ANCA 5EIWA 4YCNA 2EP8A 4D5GA 2WD7A 1E8DA 3HEMA 3GFRA 4MRSA 2GHIA 3GJYA 1KYVA 3TGLA 1YIOA 3CNHA 1IN8A 1IYZA 3AR4A 3DV0B 5KSOA 1RIFA 2P27A 3L8DA 3ZH9B 5DNYB 1FEZA 1ST2A 2CE2X 4DBZA 4ARAA 2XKBA 2EGUA 5IP5A 4ZYUA 3C7DB 5ILQA 4EPRA 4MV3A 1XTQA 3HNRA 4IJ5A 4YV1A 3ZE8A 3CJQA 1N0IA 4FMBB 1FSSA 4QVKA 4KQ6A 4C14A 4W1SA 4R31A 1Z4JA 3FMPB 4LPSA 3IVXA 1P3Y1 2HWYA 1I7PA 2OVFA 3LQYA 1T8RA 4LCBA 4RHXA 3VVLA 3E0QA 1SMKA 1ZPDA 3KOYA 2Z0MA 3ITNA 3FSJX 3FYDA 2WSMA 3IUNA 4KQHA 3D64A 3I9FA 4KH0A 2HF8A 5I7RA 1MT0A 2O2SA 4AMUA 4LCEA 4NOKA 5M04A 2C3UA 4OQZA 1JGTA 2I2CA 2NO5A 4FR0A 3DPSA 3C3CA 5IAGA 3WWPA 3EGXB 3I42A 5ITSA 1H3FA 3FPFA 4FI3F 3E5RA 4KSCA 4NQRA 2O5RA 5J2TA 4GOKA 4R8VA 121PA 1SCUB 2XGJA 3DVAB 1IRIA 3NJ8A 3KYCA 3ONWA 3A1NA 1YHYA 3B6JA 3UK6A 3ZDCA 1RHRA 3GO4A 2VCYA 4CTJA 4CTOA 4EPXA 1PL8A 3R0VA 4WXRA 1SKBA 3B6EA 1DRJA 4WH0A 3BILA 3V34A 1EJ2A 3VHXB 3VKUA 5ITVA 4N0MA 3CZAA 1C8BA 2O2IA 4MCJA 1V9SA 3TMKA 1N6KA 3MJSA 1AO3A 2QEQA 1N0VC 1PJ8A 1BMQA 3CCCA 3PICA 1UDCA 2NU8A 2X0IA 2IOHA 1S4MA 1T4CB 2AC7A 4NPCA 4Q05A 3RBAA 6ABPA 2X0JA 2LRHA 3FSRA 3A2LA 4LBWA 1ZGCA 4LYHA 3NB0A 5B3LA 1A1VA 3I1YA 2Z6UA 3VR4A 1M5TA 5L3ZA 1FTNA 1WB5A 3EN0A 3NHRA 4HBZA 4MYSA 1NUTA 1Y1RA 4IEEA 3H5AA 2SICE 1L7PA 1E3WA 5ARCA 2WHPA 1VCHA 4CG1A 1TUIA 4LXGA 3A6EA 4YGXB 1JPVA 4J0IA 3KVRA 2FU5C 1ZOSA 2XXJA 3AYZB 3E27A 3IMKA 1U0NA 1C2TA 4MV6A 4O4LA 4EG1A 4I50A 3SIRA 4UARA 1FJGB 1KQNA 1NBIA 3U48A 2P4QA 2ZZKA 1FQKA 3D4BA 4KDRA 4Y9RA 3NT4A 4PICA 3AIKA 4QPZA 3RIXA 2YJ5A 4DLAA 2QP9X 1VKHA 4FB5A 4NMXB 2XRZA 3GA0A 2R5NA 4GOXA 1IQPA 1WPRA 2XOKA 4XXHA 3RYFB 3TEMA 1G9XA 4NZPA 4Y1EA 3AL0C 3ESCA 3KVYA 3OM8A 4KODA 4JI3B 1RRKA 2RI0A 4PU0A 1P7PA 2RONA 1CP2A 2K6GA 3DQZA 5IJ0A 2GTIA 2Y6UA 3FE2A 5AW5A 3TLJA 5BY2A 4QEKA 1TA4A 2R1ZA 4AP9A 4W5WA 5C5DA 1Z5UA 2J5RA 2EBHX 1KS2A 4W9NA 1P74A 1NJFA 1POXA 2DG2A 3DTTA 2DBRA 3M33A 2E21A 5E7IA 5EZ6B 2HRDA 2VTBB 4CLRB 2BFNA 4ML3A 4RZXA 4R1SA 5IT0A 2NM0A 1I32A 3G8DA 1R4NA 1WG8A 3KKNA 3M6AA 3RRFA 1J39A 2EKBA 2G7ZA 3N70A 1UIMA 1YJCA 3IR5A 5DYTA 2HA5A 1JHZA 3KDSE 3MFQA 3RE1A 1N7HA 3ZCTA 1BZYA 3CKYA 4CEIA 1PUIA 3ER6A 3W5JA 1CJMA 1CYEA 4OF4A 1QQ7A 4C0XA 1XNHA 1V7CA 3U60B 2ODAA 4D4IA 4FKBA 4WZBA 1WDMA 1W88A 3TPFA 4DQLA 2XCQA 2D4AA 3K0AB 4HNHA 2XECA 3VC3A 2HXSA 3FJOA 4RESA 4YP9A 2B7BA 2ET6A 3DEYX 4PYLA 1MB3A 1OKKA 1E2KA 3RVJA 3HH8A 1W8DA 1VCNA 3ASVA 4IFBA 4ZVMA 2P9FA 3DKRA 4O8ZA 2MT9A 2PBZA 2VHEA 5L45A 4H1UA 1C2YA 3Q6NA 4K8RB 4ZREA 1L7EA 3QRWA 3Q85A 4MV0A 1JFVA 1N2CB 1IONA 1BDMA 2Q2VA 2WTAA 3MT7A 3LC0A 4G4IA 4PONA 2GCOB 3T7KA 5A2GA 3NBQA 3PLAE 4ZGGA 1DBPA 3GJ0A 3IJPA 4E6PA 4ZI7F 2VDVE 2JBAA 3PXXA 3FVRA 5IG2A 2PJDA 2NZ2A 1GGFA 1T3SA 3GNQA 2YJ6A 4MDEA 3D9QX 3WG9A 3AKYA 4PWZA 2ZBGA 1DINA 4X8HA 5ECDA 4IG4A 4LG1A 1SHLA 4DG9A 2DBQA 4WSOA 3QKRA 3CW2A 3CVWA 3CRQA 1T6YA 3B82A 2GDZA 3LY9A 1ZM3A 3EB9A 1CUEA 4ZK6A 2C5FA 1GYRA 4EI8A 2WM3A 3KQTA 3E03A 5FNVF 1Y6JA 4C0QC 5KQMA 3V9AA 5GP1A 2HBZA 1JE0A 5M34A 3C4VA 1P80A 5BT9A 2JFGA 1DARA 1VP3A 2DMRA 5JAZA 3UMMA 5ECGC 2GEBA 3LC1O 3SZUA 1PL6A 3UMGA 1VKRA 1IY0A 4ISCA 3NONA 1PWXA 4I7EA 2ZEJA 3K0AA 5KCZA 3GLFE 1M83A 2L17A 2X9NA 1I3NA 1PZXA 3D7MA 2G4VA 4HTAA 2VWHA 3IUEA 3PHJA 4U2CA 5FLKA 3OLYA 1EWRA 3S27A 3V4SA 4DKXA 4UEWA 4E4RA 3O4JA 1OXTA 5EHQA 2D1RA 5FWYA 5K7SA 1DJMA 5IK2D 2LE0A 3A32A 3E05A 1TW2A 4L75A 2BMJA 2KW5A 2QN1A 1US8B 3TO5A 4MLPA 5DNUA 4YLEA 1IBSA 2H63A 1DGQA 1LRKA 2GMWA 3C5WP 5G3ZA 5GY7A 5FX2A 5KTRA 1YS6A 4L8YA 3RK1A 2ACEA 2A2ZA 4U1RA 4YAFA 3ANMA 4R1PA 2WZQA 1SBCA 3HI6A 1Y9DA 3QLJA 2RCYA 3IMCA 4INZA 5ADVA 2Z6QA 2HHJA 3RRBA 1X7XB 4EVRA 5E9AA 4U7PB 3UJ9A 4EARA 2QQFA 1TAQA 1KS9A 3ITDA 2JHGA 2QL6A 4DE5A 5DGXA 1DU4A 3H83A 1AXEA 2C3MA 4JFAA 4M1QA 5TQ2B 3OZEA 4JVNA 4MWTA 3W1VA 2YW9A 4FDTA 5DM60 3PQ8A 2PPLA 2V7GA 2VPWA 5JWOA 3S6JA 1ZR4A 2O54A 3MJHA 3B51X 1LVGA 1JL3A 4JLWA 1OLSA 4BASA 3JZDA 4GMKA 1VIVA 4MR9B 1CF2O 2VQSA 3FWZA 5DHUA 5A3QA 2JNWA 4PQFA 5C7YA 2ZWPA 3AFHA 5HA5A 1SUIA 2XRMA 3KHKA 5L4SA 3A6HA 3WZMA 4GLLA 4H7KA 1UQTA 4L4ZA 2FZCA 4PSCA 2OQVA 3TNJA 1CPYA 3BH7A 2IPLA 3ZNOA 4WLFA 1ABBA 1J6UA 1F06A 2PX8A 4AMBA 5EXPA 4RXUA 4HQKA 1DAKA 2R5WA 3Q8MA 5JDIA 4Y6SA 2CXNA 2JH8A 3RYHA 2D2VA 4D02A 4O2BA 4ZAZA 1II0A 2P4HX 3NZEA 5EQDA 2CJWA 1W1UA 4IRXA 4RSRA 1U8CB 3KYIB 1P33A 3MUFA 4BVAA 2XE6A 4DRXB 4X7MA 3WGOA 4GE3A 2QRKA 1ZS9A 3ZGLA 3WLLA 1BJRE 5DCWA 2YIMA 1BQ3A 4ALIA 5JCZA 5EYPB 4ZAVA 4JI2B 2WYVA 3VR5A 5ICMA 5CFRA 1YZLA 4F8YA 1FYWA 4ZEXA 2O8VA 3MGBA 3MGGA 3DO8A 2QTTA 2FR8C 1A2OA 3CLUC 1EHCA 4LJ7A 1HE4A 3BHIA 4C7MA 3DTYA 4XI9A 3UMJA 2QJWA 2GWHA 2IXBA 4IF4A 4YRPA 3K9HA 4JP8A 4GBED 5ADUS 1DT3A 3NV9A 5KYNA 1KRWA 1UODA 4YRFA 2HCTA 3A6LA 4I3HA 3BJZA 4MPDA 2P0AA 1EINA 4HSEA 5EWJA 4EG7A 2ZFUA 3NHUA 1Q77A 3GJQA 3GMDA 1NXOA 1QIJA 4TS9A 2GRJA 5C8DA 1KIMA 2ORYA 4M37A 2D8MA 3GRKA 1U7TA 4N3NA 2FSUA 5C9ZA 3UHJA 3MAJA 4R54A 3SMVA 2O50A 3ABRB 2ESRA 4FMDB 3KB2A 4LCJA 5BV1A 2HLPA 4AS1A 3MMXA 1JLMA 3FD8A 5HUHA 1C0LA 3A27A 4LX8A 3KPYA 3T38A 5IJ9A 4BO0A 4FPXA 2QRNA 4EJ0A 3FNQA 4QT4A 1KJ8A 4LSWA 5FTWA 3EF0A 2G08A 5CMLA 4ZRMA 3VJKA 4NIMA 1F3OA 1RRVA 3MXTA 4LMPA 3CIFA 4EHAA 2CMGA 2VA8A 3BWMA 3FNFA 3OQ6A 1SCIA 4H2DA 2YIDA 3OZFA 1RRPA 3SK0A 1U2EA 3D8RA 5BSHA 4BZZA 3FPKA 1PV4A 2F4VB 5AK6A 1CG6A 3OZBA 4O2BF 3V5NA 3ILHA 4YUAA 1KTIA 3GCZA 1Y3CE 2X9QA 4LZPA 4F91B 2WP8J 2BGJA 2WM2A 1TZBA 2B9VA 2G1AA 3ZTWA 4OGFA 1MO3A 4JSRA 2O8DA 2DTEA 3DJFA 4MLZA 1PFKA 1N57A 1X2EA 5ADHA 1DFIA 4J3JA 1O9GA 1V11A 3A1WA 2F3PA 3G5MA 1D2CA 5DGHA 5AW7A 1VRWA 3QXJA 4ROTA 1EM8B 3OIVA 2R1VA 2NN3C 2QZZA 2VYND 4CN8A 2FOXA 4CIWA 1DNPA 1SXJA 1X3SA 3BDVA 3NIBA 2V6FA 2WYUA 3E2PA 1V4NA 4BWFB 3DNFA 4OFZA 1W94A 3L7CA 4DMMA 1DTWB 2VJPA 4M1WA 3V42A 1P6QA 1M0WA 3VGPA 2X13A 4TQ9A 4KX5A 4IJMA 4K6FA 4CU2A 1DKOA 2MYTA 2OFXA 3NXSA 3EAFA 1U7XA 1PTJC 2OORC 4QPDA 4S2UA 3DKPA 3CINA 3DO5A 4B6PA 1YZKA 4WCFA 5EMNA 3ILSA 2VZEA 3PD0A 2XZPA 3BDAA 1PJLA 3HZOA 2OCGA 3KCNA 4KSYA 5BW6B 4P81A 3UBMA 4IDGA 1KFBB 3WGJA 3JD0A 2UUPA 5D6OA 4V2IA 1N6HA 1MBZA 1FE8A 4GEGA 4YJGA 4P1ZA 4L8VA 1W46A 3NEJA 4D0RA 3SNHA 2X0KA 3ZWDA 4C5AA 3KVNA 3C48A 2OXEA 2VAWA 2ZI4A 1Q0SA 2GCPA 2CW5A 3CV3A 4ZTBA 1ZHHA 3MJ4A 1MX5A 3U13A 3UN1A 3K6RA 4PLCA 5HFNA 3JD1A 2CDNA 2XUAA 3BM5A 1B8PA 2NYRA 1AHNA 2J4CA 3DCIA 3HG7A 3TI7A 3ND5A 3STYA 5B3AA 1SG0A 1RWMA 2RBGA 1HETA 3IVAA 3ZN2A 2AI2A 3QMWA 3IQWA 1CUAA 2HA3A 4XJSA 5AFSA 4F9FA 4GL4A 1YJ8A 2JFWA 4G85A 1WP9A 1DP4A 2FRDC 1NSTA 3E9CA 4IDNA 3TJZA 1N6NA 3GVCA 1NIPA 3I76A 2QTHA 4MS4B 3TLMA 3OTWA 1Z88A 1NNEA 1RBZA 4FS8A 4M0KA 1IJFA 1LK0A 2XBMA 2JIZA 3MJDA 3H65A 3OJFA 4WLOA 2I4NA 1KEUA 3Q3HA 2A4MA 4PV7A 3VPXA 3T61A 1QOPB 1TOAA 1M2JA 3J81k 3PWSA 1T5IA 3PUXA 3NTOA 1QHFA 4PS1A 1MB0A 4LDRA 5DGDA 2ZU0C 2RHDA 3OZCA 3N1UA 3D4IA 3LX5A 2YQ4A 4OIFA 1R8QA 4ZHQF 3ORYA 5EUCA 3WGNA 2XCOA 2JDID 3R6TA 1HG1A 1QC5B 4JOQA 3G7NA 4Z9XA 3DOUA 1JKJB 3VU9A 4ZMSA 5JS6A 1GUBA 5I8ZA 4F5EA 3BA1A 1JTFA 1EFVB 1XZMA 2OUIA 3DE5X 5ER6A 2CDAA 3ZQJA 1JSCA 3SM9A 1R1DA 1SC1A 1ONBA 1N32B 1G16A 1IEVA 4FYWA 4YBRA 1L1FA 2ZT8A 5HQ3A 1PW5A 1HFEL 3AV3A 3RTGA 1KEEA 1GSHA 5ALIA 3R76A 2VF5X 2VQDA 1UM8A 1F60A 1YE8A 2FWAA 3W7AA 5DSTA 5I9BA 4MA4A 1NQXA 1JWAB 3BD7A 1ZUNA 4FQ8A 1BDJA 3R7BA 2IDJA 3MCZA 4FQ5A 3LBYA 2WA2A 4W6QA 2AH5A 2O7QA 1C9NA 5DNVA 3ZHRA 4L51A 1TT5A 2WF7A 1ODCA 4QYIA 4NBLA 1JKXA 4R5HA 5E1MA 1U3GA 4YRTA 1GZUA 2CHUA 5ALGA 2OCIA 9GPBA 3QFFA 1OA0A 1N36B 4LS3A 2ZJ0A 2PSSA 2ERCA 3RU3A 5HMLA 2QT1A 3UJAA 4AS3A 2R4UA 3M49A 5PGMA 3A3NA 3LHSA 4NAUA 5JSZB 1XA3A 4B8ZA 3HKDB 2EKQA 2H1SA 5B58T 3QWAA 4HH3C 2R0QC 4QEDA 3FLMA 4IEFB 1K98A 3C4QA 3P0EA 5KDLA 4NSNA 4IUBS 4JQOA 1LB1B 4YPOA 4PN3A 2FVYA 1RXEA 2NSLA 4YPFA 2HMVA 3KP1A 2OZLB 4R2IA 1UWLA 2QNIA 4KE8A 3FFXA 2KX7A 3WHKA 3O90A 4M0MA 3HNOA 1NGSA 3ZVKA 2JLWA 2VTDA 4CUZA 3WYCA 3QVMA 1EVQA 1LSSA 3PXCX 4LKRA 4ZDKA 3JS5A 3QEKA 1NVXQ 3KJIA 1OXVA 3QLVA 4IWXA 2WR8A 3V80A 1G291 4W9RA 5K3OA 1CNFA 4UTZA 2OPHA 3RS4A 2H0QA 1GV1A 2QRLA 4M0CA 4LY9A 2IYSA 3VPSA 3FHTA 4Z8XA 3H9EO 1NVKA 5CNMA 3NTRA 1EHIA 3DMFA 4ZJYA 4GYWA 3VDQA 2HJVA 4Y2QA 2G8NA 2GJ4A 2ZTHA 1YGYA 2ZXFA 3L8EA 4HB4A 1KYYA 1VECA 4HUJA 2XOKD 1BE0A 4JNCA 3VTFA 4EUHA 4CFSA 5ER9A 4A10A 1KZ4A 1H2FA 4GHWA 4TX1A 4MVCA 3F6YA 3EARA 1JDTA 2I7XA 2AFIA 1HX7A 4NFYA 2VP2A 4LHEA 3KUUA 3N5CA 5F21A 2OXCA 4JJKA 2D1TA 4ZYYA 1KR2A 1PKXA 2H11A 3NW9A 4L3VA 1C1HA 3RS9A 3R5JA 4JQYA 3I2HA 4IHAA 4P0TA 4PBTA 1U2PA 1YBVA 1U2GC 4WOJA 4JP3A 4MW2A 1LBQA 1QRUA 1OXMA 3L1VA 4JKOA 1T0PA 5EJEA 3O8RA 1E99A 1XCGB 3QFRA 1U80A 3VQTA 1RJGA 1PTKA 2GPAA 5KYUA 3KT0A 4LJKA 4B3DA 4DA7A 3L0DA 4LJRA 1S5PA 4YP1A 1LPBB 1BQ4A 1YZGA 4W1RA 5CNKA 4CKWA 5LIRA 1FL9A 1TA0A 4LHZA 1JNXX 1XC7A 1H2HA 3NVMB 1Z7WA 2A1TS 3KEMA 4KXVA 4OPMA 5FHQA 3RJ5A 1JXMA 5CYOA 4P0PB 3PRHA 3B8HA 3EYAA 2F48A 1MLDA 4OHBA 4G24A 3SOZA 1HTBA 5AVUA 2Q49A 1DJPA 2AZ4A 2MTBA 4JLOA 4XWTA 2CXSA 2FMFA 3BIXA 1UT5A 3PFNA 3EISA 3PU6A 1E4OA 4DLTA 3TLZA 3GC6A 1G8MA 3KSMA 4CT4B 2QJOA 1WHTB 2HHAA 5T8KC 5FOUA 2WB4A 3DE4X 5F51A 3F5QA 5B2ZA 2ZUEA 5AD1A 3TW0A 5DHQA 4ZV7A 5JCJD 2Y9PB 1TVEA 1SUDA 3MBOA 4EELA 3PEUA 3INYA 1RLOA 4W1PA 4B8WA 1D9XA 4WV3A 1TQHA 3PR1A 3T5PA 3IBSA 2PGLA 4G5HA 1HY3A 2HPVA 3QVKA 5EL0A 1UJ6A 2YJ3A 4HAUA 1G7RA 3DUFB 3HI4A 4NYJQ 1DKLA 2ZIVB 3IEMA 4FTWA 3PEYA 2RGUA 1PO7A 2WFMA 4H3VA 3S81A 2BY4A 3AGQA 3B9BA 1G3RA 3TXXA 1QHSA 9LDBA 2P35A 3NO4A 3UB4A 4RETA 3I2GA 4HN4B 2WF6A 3I4FA 5B1EA 1U2DC 2DHRA 1CUZA 3P9XA 5L3QB 5JLAA 5IAJA 4B82A 3KZCA 4KP7A 4H6WA 3PTZA 2QMQA 4OUDB 3KQLA 1UBKS 1N9GB 1JNYA 4UUMA 8ADHA 2HL6A 3EDRA 3QVGA 4TM8A 1DB3A 3ESRA 3I12A 2NSYA 1PR1A 4S1OA 2ZCUA 4UU8A 1U7PA 1VL5A 3ZXSA 4XVUA 1VE6A 4GU5A 4MWSA 1JHOA 4PF1A 4NH4A 2ZWOA 3U4AA 5HM8A 4GD3Q 1X7WB 1E4EA 2QD4A 2YINC 3K20A 2GD0A 2HK6A 4MOWA 4QU8A 5JD3A 4ZO9A 4BIIA 5JBIA 3OCWA 1J0CA 5ITWA 2V0GA 2V7VA 4QHSA 4RIGA 1BW9A 2O07A 1ZG3A 3X3HA 5AR1A 4MVJG 4OD0A 1N9GA 4RD3A 1LJ8A 2IF2A 3O0TA 4NMLA 1J1IA 1ZIYA 1RTKA 2JLQA 3IALA 4CUKA 3IV9A 5FT9A 3V1LA 2O0KA 4TROA 2ZAOA 3SXPA 4C2TA 3OX4A 2JBWA 3QXGA 2GAFA 1P2UA 2ZBRA 4GQIA 2AUNA 2XLBA 4UNIA 1XCPA 3DW3X 2FKAA 3HJHA 4U4AA 3IT3A 2ZQYA 3C7KA 1Q0TA 4G6ZA 4EQ6B 5A5EA 2CWDA 1NW9B 1VHWA 1VP9A 1CLEA 1QYWA 1V9CA 1T0BA 3DEIA 2JRLA 3KR2A 3MQ2A 3O4VA 5HE8A 4LOHA 1PLLA 1EFCA 3F7TA 5TR9A 1X8JA 2K4MA 3QQ5A 1IZ7A 3H5RA 4BAUA 1H1TA 4KRYA 3F6PA 1WQ3A 4UHEA 3REGA 3FCSB 2ONKA 3MTEA 5E6SB 3RUEA 1QE3A 3IOCA 1UTGA 3CIOA 2RHWA 3U49A 2Z08A 1SXQA 3VJRA 1IPHA 4MGIR 2WKSA 1UFKA 5INTA 5BN1A 4MVJP 1CFJA 1E9RA 1B7GO 1M8KA 3AUKA 3IURA 5A4JA 3H1GA 4HAXA 1YVEI 3FUXA 4O3FA 5E2IA 1UCFA 2WJJA 1DDOA 2GUWA 2QUHA 3GOQA 2ECQA 3I0ZA 2VJMB 4A8TA 1I01A 5B1HA 3G7UA 3GJRA 3PE3A 4NV0A 1CZRA 4KQ9A 5BNWA 2FVXA 3HFJA 1BG6A 2GCIA 5DHSA 1K7YA 4G25A 2J3MA 4OHFA 1E2DA 2GLTA 5I8PA 3SEZA 2CK3A 4G2TA 2OHIA 2YHUA 3H9BA 4KVZA 4Q4HA 3DFIA 4TV8F 1MDBA 3P4XA 1CY1A 3CNNA 2Q4OA 2GZRA 2VHTA 2QM3A 3UV3A 1JEYB 1F7UA 2SHKA 2DYKA 1VIDA 4PQYA 4EY8A 1PHRA 4EGFA 5EZSA 2Z95A 2FNAA 1VB3A 4PYKA 1OASA 4YRRA 4JA0A 3GRCA 4R2KA 3N0XA 4YUZA 3R6WA 3ZK7A 5I01A 4A9AA 3O1IC 4BAGA 4IHQA 4IUDS 1CULC 3KQYA 2AK2A 1DEAA 4FDLA 5GM1A 1UJ2A 4OGKA 4CLHA 2OBNA 1OY1A 2HPAA 4K9QA 1LBHA 2OXIA 4BEJA 4J1SA 2P6PA 4O8CA 2QMZA 4H0CA 1ZJ5A 1UEXC 5FBRB 3B7WA 3NBXX 1PNRA 4R9UC 5TMEA 5JISA 2BSXA 3CVYA 4O2LA 3S5UA 4RENA 1Z7GA 2HGZA 4RORA 1N5RA 2G9ZA 3DKVA 3G1WA 2A9KA 3E5MA 4MARA 3DFKA 2HREA 3AY0A 1GGHA 3FWPA 4LJ4A 5BWLA 1N8SA 1MR3F 3U61B 1EB9A 1GITA 3TZKA 5CH5A 3UAYA 2AG1A 2AG5A 2ZDQA 3V1MA 5IVKA 4P3NA 4C6TA 5BUCA 5AICA 1G17A 2HX1A 3UJPA 5BYAA 2XJ4A 3KQSA 1GKLA 4K6HA 4QGGA 3RK0A 2BKEA 3OSUA 4Q9LA 1XZHA 4RQAA 1KL7A 2AX4A 3HB5X 4ENQA 1GZ4A 1P8AA 3RWOA 1UZAA 3OT5A 4Y2RA 3JVVA 2VUUA 1K7CA 5IVPA 3GHYA 5CHEA 3IAS1 3WLNA 4C0JA 3ZWKA 3LDFA 4G5QA 4P34A 3U7EB 1YBAA 1RBQA 2AEMA 3BXEA 4PFJA 5DMXA 1H2RS 3BRSA 3EW7A 4PZPA 3VZBA 2VDNB 1ISMA 4NJEB 4X90A 1U4OA 2YFKA 5KJ6A 2K87A 4D9JA 2VAPA 2V3WA 4E5KA 5KJCA 2P9YA 4BJ6A 5KQPA 4XQ9A 4LXIA 4AYXA 4C7BA 5EGSA 3RSGA 1ZKDA 3OY2A 3A14A 1KWGA 1SEPA 1V5EA 3MINB 3LRPA 3B8EA 4YRIA 1F4LA 1CJTC 5JQGB 3PPWA 4MAFA 3SIPA 4WXHA 2XQFA 4FCWA 4CM3A 2J9FB 1PV2A 5FL7D 4LZOA 3L18A 2RGRA 1YQEA 4UXIA 4XW2A 4QLBA 3MTDA 5EP3A 4IKEA 2Q5QA 4TWBA 4AXBA 2FZWA 4D25A 1XB2A 4KPEC 2AR0A 1Y3BE 3HMKA 4U2BA 1MT3A 1XDBA 2NADA 1D04A 4Q9AA 1T25A 1M5RA 1SUSA 2FPGA 1LSJA 3LF1A 4C06A 1HYHA 2I67A 1M6VA 2GPNA 1K7EB 1NLUA 4WINA 1QRTA 1DUIA 4IDCA 4DKJA 3R4CA 1BRMA 5TGDA 3O8NA 1DOZA 1GAWA 2ZIFA 2UU9B 4M98A 3AB3A 1C7FA 3PTLA 1CR4A 3HBNA 5J2TB 2RGGA 2VJAA 3HR7A 4BECA 2QSJA 2OAP1 5BRJA 5FP0A 2EATA 2QD3A 1N2ZA 2XNSA 5FFFA 5A7GA 1NI4B 3D6VA 1KE2A 1WL8A 1KWKA 5JMWA 4TKZA 1RI2A 1P5ZB 2AIRA 2I76A 3CN9A 2WQZA 4DW8A 1FS6A 2HSZA 1G41A 3COSA 1U3FA 1MV8A 2JFHA 5D3ZA 2ZYTX 3DH0A 1I51A 1G20A 3FTDA 2CEKA 3CO0S 1U0HC 2ZB4A 2FQXA 5ALTA 2AOXA 2ZAYA 4G4SP 4XYGA 2FLVA 3BN3A 3TEFA 2UUAB 1NRWA 2IP2A 2P65A 1P1RA 4IBOA 5CFZA 3NASA 3IO5A 1TLLA 4IH9A 1P2VA 2Z5FA 3L0IB 3ZBQA 3OCVA 1VQ1A 2Q4TA 1Q20A 2H31A 2I4TA 5ALQA 5BWMA 4B84A 4M21A 4DNFA 3LWDA 4BVKA 1DRKA 1ZW1A 5EIHA 5IYZA 4C7OA 3OIDA 4HUQB 7YASA 3DV0A 3DOOA 4XDGA 3H2ZA 1IBMB 2B99A 3GFGA 2P8SA 1VIMA 2DOKA 4I1VA 1H4VB 3JRXA 1HT1E 4G0NA 4RMNA 4LYGA 3WLAA 5D01A 5I9NA 4NJMA 1P7ZA 1FMLA 1L7BA 4BKMA 1XV5A 3UXYA 3GFTA 3IQIX 3MCTA 5I4CA 1PQUA 3SKXA 3D4PA 4OSEA 3S29A 2XAUA 1RIIA 1XN4A 3GRUA 3WYEA 2QRGA 2OBMA 3KQQA 2YS6A 4XUGB 1WKVA 3GJ7A 3KZVA 3TLGA 4NBNA 1W0JA 1QP4A 4HNGA 3KXIA 3JZIA 1XNRB 2Q50A 4AY2A 1AZTA 2F1IA 2FSGA 3I1FA 3T4UA 5LKAA 3PWZA 3LT4A 3I6MA 3T8YA 5E0KB 2FP4B 3HB7A 3IUJA 3RVOA 2C4MA 4P22A 3PITA 2DH5A 2I29A 3DGEC 1F8UA 3OT4A 1KI1A 1NZDA 4JL5A 2NO4A 1ZA1A 3QZUA 4J2TA 1KP2A 4ZK2A 1X1BA 5IUNC 4NS4A 1B2LA 3TTTA 4RV4A 4W8HA 2WTBA 4JROA 5CNIA 4KE6A 3HDGA 1QOQB 4OXQA 3FZGA 2DTXA 2QIOA 3L8YA 1TM7E 4ITUA 3AONB 1ZMBA 2I1WA 1QE5A 3KXKA 3MELA 4TL7A 5B6PA 3NETA 3EZ7A 4XA8A 3GMSA 3IT0A 3EHEA 3L46A 5J63A 1ZMXA 1ZL0A 1VOTA 2A9VA 2ZDGA 3I1IA 2GPJA 2CMHA 4DANA 5LOVF 1E9AA 2NVBA 2RGNC 1W2GA 4LRXA 4OFXA 5F5NA 3ISJA 3NLLA 1NJ8A 1ARZA 1E1YA 3U80A 1RLIA 3AX6A 4JKYA 2H5LA 1J9EA 3ECCA 4ZU6X 3LFUA 2AOTA 4WBXC 1Y82A 2YC4C 1J21A 4FGWA 3O2JA 5AJWA 3ILYA 1G8SA 1MF7A 2WZCA 4TL6A 4GH5A 3HR8A 3K9NA 1PUJA 5EC8A 4ABTA 5D5HA 3D54D 3GL9A 3NUZA 1VE7A 4DIDA 3GAFA 2FRVA 1IHOA 2RJOA 3G5TA 2CE7A 2G77B 4ND1A 3PFCA 4W8OA 2ZROA 3BE4A 4DS3A 4AY6A 2Z1DA 3GFFA 2LNDA 5EKTA 5KYWB 3JQ7B 5CXSA 3LUKA 1P0MA 4AWBA 2LZ0A 3LKVA 1GUDA 4HX5A 3UMFA 2HDWA 4L7VA 1EG2A 4LMAA 2GETA 2DHQA 4TSFA 5JYEA 1YZ3A 2W8BB 2JLBA 1J2JA 1RQXA 2NXJA 3AF3A 4K9MA 4O4IF 1XXHE 2REQA 2WT8A 4F12A 1JPUA 4E5SA 4D26A 1U99A 1Z6TA 1WKBA 5D1NA 1FX0B 3BMOA 5K3CA 3Q15C 1E6EA 3REOA 4J1QA 1H9AA 1YDEA 2VF7A 1JI3A 1NAHA 1JKIA 3AG5A 4R05A 4Y2TA 3BFJA 5D5PA 3J7AC 4ND8B 5HQTA 1YV9A 2EKDA 4CLEA 3FHCB 4KIFA 4EA8A 4LTDA 4CFZA 1FFAA 4BQFA 1NE7A 1AQYA 5C4IA 4DZZA 3OJ0A 1Y63A 3O83A 4S3MA 3V33A 4PGHA 4KXNA 1KGDA 2O8CA 3E3AA 4KFTA 3M6UA 1ENZA 2PL1A 1EE9A 1ZGJA 2IGBA 3HP7A 5DT2A 4QM7A 3EZLA 1IAVA 3TZHA 3V4FA 4BX8A 1PQWA 1ACJA 3VYWA 3LCUA 1WKCA 5CD1A 3CUUA 2NAPA 3D1VA 2Q5OA 1I6MA 3STUA 1Z0AA 3DZGA 2CJWB 2WJZB 3WWOA 1WQ4A 3B1ZA 4PY2A 4X71A 3ZR4B 1D1TA 2ZBPA 2X0FA 2ATVA 6Q21A 2X6TA 5MHTA 4O4IB 1PT8A 4BVGA 1VJ5A 3Q87B 4JI6B 1KY4A 2ZT7A 1Q0QA 3K30A 2QHXA 1EU1A 1ID1A 1QYIA 5KTKA 2XZTA 1VGRA 4S1VA 4YVFA 3MOGA 3IELA 4M8KA 2B2NA 1W0JD 1UBGA 1UKAA 2B7LA 3TMYA 1I0ZA 1KMIY 2VJNA 1G2OA 1I2CA 2B36A 2EARA 3H5IA 5A4MS 5FTNA 5M5BA 1FNNA 4X62B 4I81A 4RF4A 4N7BA 4NV1A 4BLSA 1GUAA 2G5CA 4RWZA 3LQKA 4TLDA 2QRPA 2ZKIA 3CPEA 1OH8A 2QRVB 4O4IA 3M5WA 1XK7A 2Q07A 3PD1A 1HSZA 4LYYA 5ERGB 5L3QA 3LD9A 2EERA 4BNWA 4YDSA 1NYTA 4X1IA 4TVSA 1K92A 1QTRA 2PLNA 3VSAA 4E2YA 4H35A 3RWMB 2RGWA 4DUGA 4REMA 3RS2A 3FZQA 5K0JA 5FBWB 3SS7X 1FDVA 2DWCA 3P9QA 3OZUA 1LNZA 221PA 2NYAA 4MAAA 4UMDA 2WP0A 3OPXA 7GPBA 4QJ3A 4HGNA 5KVVA 2ZIGA 1RPJA 4X9XA 3JXEA 5LSAA 1T8WA 2CNKA 2Q7XA 3RS0A 1LA2A 1MA0A 3FKSD 3LHKA 1VXOA 2W6PA 3BB3A 4C4XA 3SNKA 3DO6A 4BAZA 4EKYA 5EIXA 4KGVA 5C51B 1UBSB 3HKCB 3NT5A 4JR2A 4X6LA 1ANKA 5H81A 2UYCA 1A8PA 1WPXA 3A26A 5GOTA 1RCFA 3FVQA 3UOAB 1KDTA 3AU8A 4D43A 2ORIA 1G7TA 2GYYA 4O1MA 4ISBA 4DAOA 4K9SA 4F45A 5JYCA 3NHLA 3DLCA 4R6XA 4YCDA 1QV9A 1GFZA 4KMMA 2CLMB 5BSVA 1COWD 3OF2A 2SCUA 2FQWA 2E4VA 1PR5A 4BGUA 3BORA 1CEYA 2ZREA 5TY0A 1BH6A 1P44A 1Q1NA 3MPOA 3R8FA 4ZKEA 1UDWA 3LWBA 1SR8A 3WLQA 3PX2A 4LF6B 2G9VA 3EXIA 2V8BA 4MQ5A 2WWTA 3X1ZA 4F2PA 2PTGA 2FKNA 4MSUA 1K3FA 1PFVA 2ZUCA 4UHBA 4D8TA 4DCMA 4I4LA 5AKJA 1R0RE 1F1BA 5REQA 1E0AA 5LA6B 1L5SA 1V9LA 1CEXA 4B4DA 3QWIA 5C5EA 2REQB 4BJHB 3I34X 4PZUA 5D6NA 3LMKA 3VDXA 1W36B 4LDJA 3QBVA 3DDUA 4PN7A 4UVIA 2FF7A 3PC7A 3SR0A 1V5WA 4IDQA 4B6JA 4LMRA 4BNYA 3OQMA 2PGJA 4QYXA 2M98A 4J16A 2VHCA 4RCZA 1M8FA 1MA3A 1OA1A 4XLTA 2QMUA 4K03A 2C5GA 1G5HA 1IB0A 4X3CA 3DDSA 2VL7A 3P8ZA 4MWDA 4DTIA 4UTNA 5JTUA 1U0BB 5CJPA 3CW8X 4CJXA 4RVOA 3R3VA 1EXDA 4DR2B 1E5TA 3DTNA 1K6EA 1SRQA 3PPYA 4HZUB 1W76A 2LPMA 3ROZA 4O6VA 4R2HA 2VG8A 5BSUA 3V7UA 3KWMA 1KEZA 3NI2A 3R6LA 4GOND 4P33A 4KQEA 5CJ2A 5BRAA 1N8NA 1ZVMA 2FK7A 2P2CA 2RIRA 3JARA 2KE5A 2HLDD 3MJVA 5F23A 1H0SA 3H9QA 3M7IA 4YECA 5MN4A 1OH6A 3L41A 3ZD6A 1RRGA 4WXEA 2V4UA 1FZTA 1Z5OA 2F7SA 5JECA 3AZPA 2X4GA 2DBVO 3ZE1B