3IBTA

Structure of 1h-3-hydroxy-4-oxoquinoline 2,4-dioxygenase (qdo)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
263
structure length
263
Chain Sequence
b'MQSLNVNGTLMTYSESGDPHAPTLFLLSGWCQDHRLFKNLAPLLARDFHVICPDWRGHDAKQTDSGDFDSQTLAQDLLAFIDAKGIRDFQMVSTSHGCWVNIDVCEQLGAARLPKTIIIDWLLQPHPGFWQQLAEGQHPTEYVAGRQSFFDEWAETTDNADVLNHLRNEMPWFHGEMWQRACREIEANYRTWGSPLDRMDSLPQKPEICHIYSQPLSQDYRQLQLEFAAGHSWFHPRHIPGRTHFPSLENPVAVAQAIREFLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase
publication title Structural basis for cofactor-independent dioxygenation of N-heteroaromatic compounds at the alpha/beta-hydrolase fold.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 80
structure length 263
sequence length 263
ec nomenclature ec 1.13.11.47: 3-hydroxy-4-oxoquinoline 2,4-dioxygenase.
pdb deposition date 2009-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.210.20 Mainly Alpha Orthogonal Bundle Uteroglobin Uteroglobin 3ibtA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ibtA01
3P2MA 4IH9A 2AJBA 1Q0RA 5HQ3B 5ALKA 4MQLA 4FKBA 5HKAA 3FLEA 2GBIA 2FUKA 1YCDA 2WJ3A 3W9UA 2XMZA 1CUDA 2BUCA 3QVMA 3M81A 3IBTA 5AO9A 1XLUA 2PX6A 1LPMA 2RGUA 2QJRA 4BDTA 1LBTA 4FLEA 2LIPA 4NMWA 2JGIA 4EY4A 2XUHA 1VXRA 1TCAA 1QLWA 3A2MA 2BFNA 1BEEA 2WFLA 1WB6A 4ZV7A 5CW2A 4DMCA 3JWEA 2EEPA 1P0MA 1ZD2P 4CCYA 2Y2UA 4EB0A 5C7YA 3BDIA 2WTNA 1XRPA 4PF1A 1WOMA 2XMDA 3GUUA 4AZ3A 1VA4A 5D7BA 3ICWA 4BBZA 1THGA 3GA7A 1EB8A 2PPLA 5CMLA 5JD5A 4QDXA 2GZRA 2OG1A 1WPXA 2WFZA 2XMBA 3DDUA 4C87A 1L7QA 2P8SA 5DLPA 1IMJA 2I03A 1UK9A 1DX4A 2J4FA 1ETHA 3H19A 1UK8A 1UK6A 2O2HA 4CCWA 3AFIA 4OU5A 2PUHA 1EI9A 2WHRA 1GQSA 4P93A 3UUEA 3ZLTA 5ALRA 1R4ZA 2VJAA 2HDWA 1U8EA 4L72A 2XQIA 5C81A 5CT5A 3WL5A 2Z3ZA 4W1PA 5LZ7A 3KDAA 4GDMA 4J0KA 4I3FA 3VDXA 5AI4A 2QT9A 2HRRA 1W1IA 5AH0A 5DTIA 3BWXA 5YASA 1SCKA 2DQZA 1BU8A 3ESBA 4PSUA 4RNCA 5SYNA 1YA8A 1UOPA 2OAEA 1QO7A 2ZYRA 1J2EA 1QIHA 1VE6A 3E4DA 1VZ2A 1TK3A 2WIKA 3MVEA 2WILA 4UFNA 3X3HA 1W76A 3QZUA 4FNMA 3T52A 1ZD4A 5EIAA 5AJHA 4B0OA 2C0QA 4HZGA 1LBSA 1OILA 4I19A 5DNUA 3G8YA 1VZ3A 4W63A 2Z8ZA 1TQHA 2ZSIA 4B0PA 5T4HA 5EHXA 1DT3A 5ESRA 4C4YA 2WU4A 2H1IA 1RP1A 1ZIXA 4JYMA 3I2KA 4EBBA 3L1HA 3WL6A 3AZPA 1GPKA 1DQZA 1YA4A 5E2IA 3DJYA 5A6VA 3QMWA 1BEZA 2D5LA 4AX4A 5JIBA 2WIDA 3H1AA 2QKYA 2Y1KA 4DMKA 5JADA 1ACJA 5I9IA 2B61A 5KWIA 4UHCA 5EIEA 4QDOA 1Q0ZA 1P0QA 2HL6A 4S0XA 4MWTA 1G4HA 1XRMA 3HACA 3QMVA 1L7AA 2G5PA 4B9AA 1J07A 5CH3A 3KOOA 1QTIA 1USWA 2GYWA 3VISA 4C89A 1BCRA 2VJCA 2O2IA 2OCGA 4QEKA 2H9YA 1PJAA 2YYSA 2HFKA 2VTVA 1IZ8A 3C6XA 4K6HA 2WIFA 5K3FA 1GKKA 4BRZA 1AC5A 3K2IA 4DLNA 3FYUC 4WFKA 1JU3A 1MT3A 1CUVA 1HPLA 4OB8A 2JEZA 2E3JA 5HF6A 4MWSA 2OGSA 4L9AA 3O0DA 5AP9A 1F0PA 3GELA 5EI5A 5IVIA 3WIBA 3W9BA 3DD5A 4ETWA 2ROQA 1HDEA 4Q82A 5CT4A 2I3ZA 3CXUA 2BJHA 1P0IA 2HU7A 2ZJ7A 2YXPX 2XUFA 4Y2YA 2OGTA 5C8VA 4PNZA 2ACKA 1LGYA 1XQXA 2XUDA 1R9MA 4ZREA 3C6YA 2RHWA 3C8HA 4UBJA 5AI5A 4WY5A 3H0CA 4U2CA 2Y2VA 5JARA 2B9VA 2WLSA 2ECFA 4FOLA 4MEBA 1MPXA 1Y7HA 2C5FA 2HRQA 4UHFA 4CG1A 5CT9A 3BE8A 3KWFA 1UKAA 4JH0A 4TVKA 3U0VA 2CMFA 1ZI8A 3A70A 5ALFA 4MXDA 5HFAA 4QWWA 3HRHA 2RONA 3QBJA 2QR5A 4G4JA 4CFSA 1XKLA 1GKLA 2GYVA 4I4CA 1EK2A 3QPCA 5FXMA 2ZVDA 2GBFA 4F60A 5A7GA 2HA4A 3IULA 2V97A 5FRDA 1XRNA 4KAFA 4A23A 4OSEA 3V48A 4FNGA 5ISMA 3KSRA 1H2YA 5AOCA 4EZIA 4BTLA 2QMQA 2JGFA 2QS9A 4KE8A 4ZRDA 3BIXA 3HXKA 1UKBA 4H7HA 4DSZA 4BVLA 3ZLUA 1MU0A 3F98A 4B80A 2JGJA 3DOHA 3WJ1A 3H17A 2C5GA 4A16A 3C70A 1BROA 2VAVA 4PO3X 2JEYA 3V9AA 4ROTA 2CKMA 4CG3A 5AM5A 4X93A 4J0HA 2WFMA 3G0IA 5AK6A 1JMKC 3HI4A 1VE7A 1T4MA 4B9EA 1A88A 3ANTA 1QIGA 1JU4A 3G9XA 1JJBA 2PM8A 3F97A 5AK5A 1ZIYA 2HADA 1SC9A 3Q8WA 1XRQA 1XZCA 4K6KA 2XUOA 5JZBA 5LYYA 5JASA 1H2XA 2WQZA 3EBLA 2I3DA 1FFCA 1GGVA 2WUFA 3IDAA 1F8UA 5DWDA 1ODTC 2XT0A 3TEJA 1JKMA 3U1TA 2QOEA 4GXNA 1R1DA 2EDAA 2JIDA 2Z3WA 1QFMA 2YH2A 1K5PA 2WG0A 1JFRA 4GLBA 2XLBA 1N1MA 5EIHA 1BS9A 1MNQA 2R8BA 1CUJA 2PU5A 5ALIA 2XQFA 4LXIA 5EHNA 5K3DA 2JGKA 3PF8A 3H2GA 4ZXFA 1LPSA 4AN1A 5AM2A 5AKLA 3SX4A 1R88A 4LKOA 2Z5GA 5BOVA 5ALWA 3PFCA 1YS2X 4CIBA 2QTBA 3HEAA 3ED1A 1CVLA 4H7DA 4U2BA 1DINA 3D3NA 1CUEA 3FCYA 1ZJ4A 3WKDA 3D5EA 4J0GA 1E3QA 3FSGA 4JEIA 1ZI6A 1XROA 3SWWA 3EF3A 3VKFA 3STUA 3PI6A 4P08A 1DWOA 3M3DA 4KYVA 5LKRA 1XZJA 5AI6A 5AICA 4B6GA 1R50A 3WKCA 5HFNA 1JJIA 1IUPA 2JBWA 1G66A 2PU7A 1GPNA 1K8QA 2HA3A 2WHQA 4PSCA 5ALJA 4C4XA 2WM2A 1WB4A 4ARBA 5LLSA 4P9NA 1MN6A 4LYDA 3GBSA 3G7NA 3G9TA 3FLAA 5AKEA 2BGNA 5AI0A 1LPBB 4DSAA 2BAGA 5AKKA 5JAUA 5DTJA 1QIFA 3O95A 1FJ2A 1R3DA 4MQMA 5AKHA 1NU6A 4LXGA 3HJUA 4KE9A 4H77A 1XRLA 2XUKA 1LLFA 4X97A 4UPDA 1ZICA 1H2WA 3ESCA 1XFDA 3QPAA 3B5EA 4HS9A 2W6CX 3FSGD 1GXSA 3DL7A 2OXEA 3G9ZA 4FFWA 1QIJA 1A8QA 1A7UA 3WWEA 2AJ8A 1HBJA 4QLAA 5LZ9A 2XUJA 3AIOA 2GBCA 4RE5A 4WDQA 1UK7A 3I1YA 3QMMA 2V96A 4B84A 5A7HA 3LCRA 3DKRA 3PF9A 4W9RA 4OYYA 4XIIA 4PSDA 1QIDA 4BTVA 3N0TA 3HSSA 4J7AA 2NW6A 4BZWA 4UHDA 5BWBA 1TCBA 1QIIA 2Y6UA 4B81A 1JT2A 2PUJA 3TGLA 2WHPB 3TRDA 3R3ZA 5ALVA 3D59A 4H7IA 4X3CA 3C87A 5ALQA 3BDVA 4E14A 4BCDA 2VJBA 2XMSA 2JGMA 4G5XA 3MGAA 1CUCA 2ZYSA 1NX9A 4J0IA 1VOTA 1VKHA 3T4UA 1K63A 5JAOA 2QUBA 4HXEB 3H04A 5ALTA 3CCBA 2G63A 2FJPA 2O7VA 4Y2TA 1XZMA 4FDMA 2XDWA 1CIJA 2DHCA 5FV4A 4F0JA 1CUXA 4HXFB 4UBIA 2VT6A 3IUQA 1RYYA 2QXTA 3DEAA 3DQZA 4Y2QA 3VJMA 1DWQA 1WHSA 5AKYA 1EX9A 4FLFA 4QDTA 2B20A 3F96A 4BCCA 3OPMA 1I6WA 5AIAA 2CUTA 4Y2JA 4DTCA 3LIIA 2YASA 4BC0A 5HCUA 1TIBA 5EHZA 5DNWA 1QIMA 3TJMA 3FAKA 1IVYA 5DNVA 5E4JA 1NU8A 4OB6A 5A7FA 4G8DA 5ALEA 4EA6A 4YX9A 3EIOA 1UT6A 4N8SA 4AO8A 3STXA 1MX9A 3IUMA 3O9MA 4HTAA 1YR2A 4KEAA 4DIUA 1UFOA 1W4LA 5FOQA 3NWOA 1O6FA 3STWA 3DNMA 1EDBA 3FYUB 4IHAA 1CR6A 1WM1A 5LZ4A 1RWQA 3WKEA 1TCCA 4X6XA 3WYNA 2VAXA 5KREA 1MJ5A 1M33A 4GEGA 2J3QA 4HXGA 2OCLA 2HIHA 4QDZA 4Z49A 4FHZA 2GYUA 4X6UA 3WMRA 1CUIA 4QA9A 5JYCA 1CUZA 3WK7A 1GZ7A 4YK7A 4JUIA 5LZ2A 3WLAA 1U2EA 4MEAA 4PW0A 4EHBA 2CEKA 4W1SA 5AKJA 4MYDA 4RGYA 3G9UA 1X2EA 4RPCA 5AM0A 1YAHA 1EVEA 3RLIA 1LPOA 6YASA 4F21A 2J3DA 2HU8A 4BB0A 2RI6A 1XKTA 5T4EA 1JJFA 4K5QA 1XQYA 5ALOA 3AINA 3E1GA 2WFLB 4Q34A 1OCEA 3D2AA 3IA2A 1ORWA 1F6WA 3B12A 4KE6A 1AQLA 4ZV9A 1VJ5A 4QLOA 1CEXA 2FX5A 3WA7A 1XZKA 3B3QA 3QH4A 3V1KA 3JYHA 5DYYA 2WUGA 1XZBA 3JW8A 3I2HA 4U2GA 2G4LA 1CUHA 5ALZA 4AQDA 4H0CA 1CQZA 1CUUA 3STYA 3VJKA 3D4LA 1ZGCA 1XLWA 1YAJA 4UBLA 4X92A 1Q83A 4J0JA 3G0CA 1QZ3A 2O7RA 3WK9A 3QYJA 1E8NA 4UFPA 4J03A 3DYVA 4Y9SA 4XWGA 5K3EA 3I2JA 3C5VA 4RE6A 1BCSA 1UOOA 4E46A 1H22A 2BGRA 5AKGA 3R3VA 3A2LA 1K4YA 1VXOA 5AM1A 2XQGA 5ALYA 2WUEA 3I6ZA 4FBLA 4EY6A 4LYEA 4KACA 2G5TA 2DCMA 2XE4A 3W06A 5IKXA 1W75A 2GBGA 2PSFA 3K6KA 1UKCA 4Q3OA 1XZHA 4HRYA 3C6ZA 4NVRA 4WY8A 1T2NA 1XLVA 4IH4A 4G8BA 3MUNA 2VJDA 5T4BA 5D6OA 1KU6A 4IQ4A 5LIPA 1MTZA 5K3CA 4YPVA 3FVRA 3R3WA 3QM1A 1AX9A 4C01A 3GROA 4PV7A 1WB5A 5LKAA 1MO2A 1N5MA 2HA0A 4H7EA 5CURA 4AN0A 2Q0XA 2PL5A 2QRUA 1CLEA 3UUFA 1UWCA 3O4GA 3WWPA 3DOIA 4QE3A 1XZAA 5HQ3A 4U2FA 3WK4A 5AKXA 5I8PA 1W52X 3CN9A 4DNPA 1EXWA 2WIJA 3D7RA 5KBYA 1JI3A 3H2JA 4UBNA 3O4HA 4W1QA 1CUBA 5CT8A 1IUOA 2K2QB 3FCXA 4E11A 1LPPA 1QFSA 4EUSA 3IB3A 4GBGA 1EH5A 3FVTA 1ORVA 4X95A 1EA5A 4J3JA 4KR0A 4Q3KA 2XLCA 3HZOA 4KE7A 3KXPA 1VLQA 5HF5A 4B7ZA 2JGEA 5AK3A 4GW3A 2ES4A 2DHEA 1LPNA 2QXUA 4OPMA 1EDEA 5DYWA 4Y2RA 1SCQA 2HA5A 3WWOA 1AURA 5K3FB 5AOAA 5DYTA 4Y2UA 4BAZA 4WCVA 4J0CA 4E15A 2AXEA 2HFJA 4O08A 2ZYHA 3FLBA 4BRSA 1YB6A 3WK8A 1QJ4A 1UZAA 4MYSA 4X91A 2DSNA 1U4NA 3AZOA 2H7CA 2OQIA 5ALPA 4UHHA 3WKAA 1C4XA 3V1MA 2XMQA 4BATA 4DYHA 4IH1A 3EQ7A 3VJLA 4U2EA 3C43A 1CQWA 4WFIA 3DYIA 4BYMA 3ESDA 1CFJA 1N5RA 2J4CA 3H1BA 4CI9A 4DNFA 2VT7A 3HLKA 4HRXA 5LP1A 4Y2XA 3H2IA 2OCIA 5D3ZA 1Q84A 4OB7A 3D2BA 3G02A 4GHWA 3HC7A 1GPLA 1MX1A 4JYPA 4H35A 2ZSHA 3H2KA 3F67A 7YASA 4IO0A 1C7JA 2OCKA 4X94A 5FPQA 1MAAA 1FFDA 5AM3A 3G0BA 2WTMA 3H18A 2XUIA 5ALDA 4WJLA 1D07A 5CTAA 2ZYIA 1CV2A 5HF8A 2DHDA 3I2IA 4BCBA 3DKKA 4FBMA 4ZWNA 3ZI7A 4Q3LA 3I2GA 1YASA 4X85A 1LPAB 2PBLA 5AKIA 3FOBA 2R11A 4KAAA 1HL7A 4M0FA 1QTRA 4H7FA 5J3JA 2C0PA 2PVSA 3C8DA 2IITA 3C5WP 3ZPXA 3R3UA 2QVBA 4FMPA 4AZ0A 1G42A 3CN7A 4JNCA 1CUAA 2RHTA 1G5FA 1KU0A 3H2HA 2C7BA 5AI8A 2DQYA 1HLGA 4BAUA 3NGMA 4M0EA 1WCYA 1ZD3A 5I7UA 3IURA 3W04A 4AO7A 2OQVA 4B85A 1CUYA 4ITVA 4DMFA 5CBKA 4OCZA 4BC1A 2HU5A 1XZGA 5LZ8A 5CXUA 4HVTA 2WKWA 5E4YA 2CB9A 4A5SA 4B82A 3I1IA 2QJWA 2ZJ6A 3EQ9A 3W05A 2ORYA 1DX6A 4INZA 5JZSA 1XQVA 2QUAA 1DTEA 2UZ0A 3WL8A 1E66A 2WJ6A 3LIPA 2H7YA 4UBKA 4G9GA 2ZJFA 4DGQA 4NS4A 1ZGBA 2VA9A 4PQEA 4TGLA 4U2DA 3F9CA 5BV7A 3OG9A 4QWMA 2OPHA 2VATA 4UFOA 4K6GA 3A6ZA 4EY5A 5HKBA 1FFBA 1QOZA 1CUWA 3I2FA 3E3AA 4KAJA 1BN6A 3V1LA 1ODSA 1YS1X 4OYLA 1LNSA 4YASA 2ONCA 1Y37A 3QPDA 3AILA 3WI7A 4KJXA 2FJ0A 1DWPA 2WIGA 1MX5A 1SFRA 1B6GA 4AMYA 1E8DA 2RAUA 3WKBA 1VA5A 1A8SA 4LIPD 1ACLA 1AGYA 4BE4A 5K3AA 2AJCA 5C8ZA 2CZQA 5FPPA 1AMNA 3ESAA 1LZKA 3WJ2A 3FBWA 4BP9A 1ZI9A 2DFPA 1GT6A 2BCEA 3R40A 1XZDA 3KWJA 1C7IA 3BJMA 3D0KA 5CT6A 1AUOA 5AI9A 1P0PA 4LXHA 5JZ9A 4UBMA 5JD6A 5HF9A 3K9BA 3ILSA 1ZOIA 4AMZA 5JAPA 2V98A 3C6BA 5AHXA 3WWCA 4M0MA 5ALXA 1YSCA 4WDRA 1IUNA 3S8YA 5K5EA 4QZVA 5JANA 3GFFA 3WK5A 1OXMA 2XMRA 4BE9A 2PSEA 4X90A 3E0XA 4TPKA 4X6YA 4X71A 2HHAA 5IVKA 3WZLA 2BUBA 4UHBA 3Q0TA 2X5XA 5H3HA 5CH8A 4DMHA 3EQ8A 2WG2A 5AKZA 3ZLVA 3S2ZA 3FNBA 1TRHA 3AJAA 2V9ZA 1HKHA 1WHTA 3VVLA 5FKJA 3ZV7A 1QE3A 5HK9A 4XVCA 5ALHA 3PE6A 2JF0A 1E89A 1QO9A 4H7KA 1MAHA 4C6HA 4Q05A 3HABA 5A71A 1O6GA 2XMCA 3FYTA 5IVDA 2BKLA 3NOXA 3SC2A 5IH7A 2HA6A 5JATA 2QZPA 1XZEA 3FWHA 3WYDA 3W2TA 4AXBA 3STVA 3AIKA 1BRTA 1EVQA 1ZJ5A 4N5IX 3IUJA 4EY8A 3WQHA 1UXOA 3IIIA 4CCYB 1BE0A 3PICA 1J1IA 1QGED 5EGNA 5EFZA 3V1NA 3R0VA 5D3KA 1DU4A 4Y2SA 1F0NA 4ARAA 4X7BA 1SCIA 3PUHA 3ICVA 4D9JA 3OURA 1X2BA 5CH5A 4BAGA 1CUGA 3WK6A 4N8EA 1EK1A 3DS8A 2ACEA 3ZWQA 2OAGA 3RK4A 1WPRA 1ISPA 1EB9A 2XMGA 3HYSA 1K6EA 3R3XA 5T4FA 2PSHA 3F8SA 4BDSA 5EHQA 2X76A 1A8UA 4ZGBA 3CCCA 3D2CA 1E5TA 4J0DA 4BVJA 4AO6A 4G4IA 2XUPA 2OGZA 1DT5A 5ALLA 3VXKA 2IIVA 3WL7A 3PFBA 3M82A 2XUGA 1QIKA 4CG2A 1Y7IA 3R41A 5AK4A 5FP0A 2CBGA 1CRLA 2WSLA 4DNQA 2CJPA 5K3BA 3C45A 1X70A 5FLKA 3IUNA 1S8OA 4XJVA 1EHYA 4Y2PA 2VEOA 5ALUA 3AUKA 3AIMA 1EDDA 3N2ZB 2C4HA 1SOMA 4EY7A 4XX1A 2WJ4A 5FDFA 1HQDA 3IVMA 5JAHA 4K2AA 1BN7A 4OU4A 3LP5A 4OUKX 3GZJA 4H18A 1CUFA 2HA7A 2Y6VA 3O9VA 1FFEA 3ANSA 4QDUA 3BL8A 4GI1A 4F5ZA 3OC0A 1QIEA 4DNOA 5IVHA 4C88A 2PSJA 2IX9A 2QM0A 4UHEA 1R9NA 1ODCA 4Y7DA 5BWCA 1H23A 1JMYA 2O2GA 3G0DA 2XI4A 3PUIA 3OM8A 4C4ZA 2HA2A 4G1FA 3RM3A 1FSSA 1AKNA 3WZMA 5C8XA 2XUQA 5A62A 3NUZA 1FFAA 3STTA 2H7XA 3L1JA 3DL4A 3G0GA 2PSDA 5AIBA 3KD2A 5SYMA 2B4KA 2DR0A 4G8CA 4X00A 1XRRA 4Q1VA 2HM7A 3BJRA 3WWDA 1QONA 4Y2VA 4BZZA 1PV1A 5DJ5A 4WFJA 3WA6A 3I6YA 2OLEA 4MJ3A 3OOSA 5LZ5A 3OTQA 1LZLA 2BUAA 2PKYX 2Z8XA 3VVMA 3BF8A 1TKRA 3YASA 3I28A 4FLMA 3LS2A 3WIOA 3BF7A 2X8BA 4HAIA 2VQ6A 3A2NA 4UUQA 2WHPA 3O4IA 1YB7A 1TAHA 4DM7A 3QITA 4QNNA 4B83A 4FFVA 3DCNA 1UOQA 3PDCA 3UMJA 4N8DA 4G9EA 1XZLA 4AB1A 2WUDA 1DQYA 4G4GA 4KRYA 3I6MA 5ALGA 2D0DA 2C58A 3AZQA 1EINA 3LLCA 1IZ7A 3DLTA 1THTA 1W6RA 5ALSA 4UBOA 2RIPA 3SK0A 5F4ZA 1CPYA 4L3WA 4NZZA 1KEZA 2I78A 4N5HX 4ZI5A 4FTWA 5JD4A 3L1IA 5HK8A 1E8MA 1XZFA 4H7JA 1GQRA 1AZWA 2AJLI 2XQKA 2XQJA 3BXPA 5CXXA 5E4TA 3R3YA 5HZGA 5JALA 1PFQA 5AM4A 5AOBA 1J06A 4V2IA 1XQWA 4GECA 4P92A 2WG1A 3M83A 5ALNA 2JGLA 2AJDA 3O4JA 1N8SA 1H2ZA 2VF2A 5KWJA 4FWBA 2WU3A 2XUAA 1L7RA 4W1RA 3BIWA 1Z68A 4BVKA 4LHEA 3MUOA 1CUSA 5A2GA 3RARA 5CRIA 1MNAA 2GZSA 1U65A 3FYUA 1XZIA 4GWLA 5ALMA 2W22A 3RKSA 4L0CA 1ZD5A 4OD0A 5FUMA 4CIAA 2XB6A 4BP8A 1B41A 2VSQA 4KRXA 2EDCA
chains in the Genus database with same CATH superfamily
5IH3A 1RAEA 1QYDA 2PVPA 1WKCA 5DTMA 3SP1A 3RVSA 5CDYA 3LW8A 2C78A 1KE2A 1CHNA 5JS7A 3F8TA 1G20B 3WYAA 2CVFA 2Q2VA 1T9GS 4OFBA 3EDRA 1MZPA 3W4IA 2FWJA 4MQLA 4FKBA 4Q3DA 2AFHE 3K6RA 4KP7A 5HKAA 5A6SB 1KL7A 4MUNA 3BZBA 2D5AA 1SBIA 2QTNA 3F74A 1GV0A 3W9UA 1LNQA 1UWVA 3L07A 1DLIA 4BO5A 1BMFA 3DBOB 4X8HA 4P7BA 1IXKA 1A96A 1SC1A 2BLLA 1ZIOA 2HQBA 4EHDA 1DV1A 5DM2A 5TE9A 3SDBA 2E1PA 4C7BA 1L2TA 3EXFA 3L8GA 2BUCA 5CG2A 1Z63A 4UVEA 4UDNA 2HWKA 2RGNC 1U9IA 3RHSA 1PR2A 3SYTA 1W36B 3R6TA 2VHEA 3REFA 1W30A 4LECA 1OTHA 5AUNB 4RVFA 2GM9A 1YE3A 1IXSB 1KE1A 2PX6A 3DAGA 1G3UA 1GN9A 4DYVA 2GKGA 4HUQB 4LHVA 4EF6A 2JA1A 4BNIA 1SU7A 5KDOA 1GPDG 3NTLA 4MV5A 4TKUA 1JHQA 1LPMA 3T3HA 2RGUA 1QPGA 2QJRA 5DCYA 1MF7A 4N3AA 1EX6A 4JXJA 1E1DA 5B2EA 4OK5A 1UIRA 2LIPA 2CLCX 4ZU6X 4OQYA 5IN4A 4CEJA 1UBKS 4Z4IA 3D7NA 2Q5IA 4ZI7A 1PT8A 3W6OA 1WEKA 1CX9B 1KVUA 2Z30A 4EELA 1AJEA 4EY4A 3EMVA 2XUHA 1T0PA 1VXRA 1J99A 2HJHA 1PU2A 1T34A 3D7LA 3NHMA 4K9OA 4NK5A 3PFIA 4IF6A 5IT0A 1LDMA 2VCYA 2BFNA 3G2KA 1P3DA 3OKPA 4CR8A 2WZQA 1BEEA 2IY9A 4RPKA 1WB6A 3M2PA 1UH5A 3ES9A 1K6IA 1P1HA 3H4IA 4IHQA 4PR0A 5F33A 5SZIA 5KNBD 3M9WA 4B1FA 1C7EA 1L5FA 4JA2A 4B6FA 3EK2A 1B0PA 2DPGA 1TJ3A 3N7TA 4B09A 5JEEA 5JDCA 4NU0A 2OLKA 3BDIA 1NN3A 1XRPA 3FPAA 4B2YA 1KPHA 3BSFA 2XMDA 1IPHA 4YYEA 4AZ3A 4XWOA 4D99A 2WV7A 4YRZA 1VA4A 2VZ8A 3D8NA 1EUDA 3UW1A 1QV6A 1X7ZB 1SELA 2H9IA 4BBZA 2AE1A 4K9MA 2BGWA 2UAGA 1Y1LA 3OCZA 2IXFA 1E59A 5DGHA 3OY2A 1WMAA 4REOA 2PPLA 2KM1A 1Y9AA 1E2HA 4YJ3F 3SKVA 5JT1A 4P4TA 1U8XX 3IPCA 3ND5A 3F6RA 3O1LA 4Z51A 4DR5B 3CB2A 3NKVA 1IZ0A 1T4CB 3H4MA 2ACWA 2V6MA 3ICCA 4LGMA 4OSPA 4UVDA 4HT3B 2Z0MA 3JCZA 4KXFB 3TPFA 5LP6B 1WPXA 5ERGB 1PJSA 1YVEI 2XMBA 3HCBA 4UU8A 1X9GA 4G9BA 3U81A 4RXTA 2QP4A 1L7QA 2P8SA 1X8JA 4GWKA 5DLPA 3MTQA 4ZZ2A 3TRFA 4XD7A 5IG2A 3NEPX 1UK9A 3ZLJA 3HM9A 1IHOA 2J4FA 2E37A 2W2KB 3EZGA 3H19A 4TMFA 1JHRA 2RHDA 4UMDA 1UK6A 4U0KA 3JVEA 3KT8A 4TZ0A 1QYVA 1CZHA 2B3DA 2O2HA 1JXMA 5AVKA 3VU3A 5IAAA 5K0FA 5FPKA 4CCWA 5JH7B 4O4JF 1GVHA 1F5SA 5LD2C 4K9LA 4OU5A 3TQFA 3RRYA 3B3GA 2QE7A 3O4RA 4BFLA 2H29A 4WOCA 4PLGA 4X41A 1R4ZA 3AERB 3C74A 4HATA 3G2PA 4AMUA 7ABPA 1ZK2A 4GSLA 1TI7A 2QYTA 1HEIA 4XVHA 3PQ7A 1VL0A 2GERA 3EASA 3CX7A 5C81A 5CT5A 1MABA 5FNVA 1RRPA 1NC1A 1U3VA 3WL5A 1KDYA 4YPFA 2GO1A 1Y6JA 1HV8A 1NVMB 5FHRA 4J0KA 2I2DA 2A9JA 2NO6A 4I3FA 1POWA 3S29A 3IH5A 2O5EA 4BEWA 5A0TA 2GDJA 3BD7A 2UZIR 4CF6A 5BSVA 4AYXA 1W1IA 3FFTA 1P3Y1 3RRBA 5A9TA 5JBQA 2UXCB 3ZWNA 4NS1A 1N57A 4WA7A 5ENDA 1U7ZA 5JC1A 2AUTA 4URFA 4TQGA 1DUVG 1FNCA 4ZVNA 4RZ3A 2R47A 2YMMA 1SCKA 2J07A 3KB1A 2DQZA 3OF2A 2QD5A 9ATCA 2PZKA 3P9YA 4LOKA 4DV5B 5HFAA 3ZE0B 1E6MA 3IOBA 5SYNA 3PQ5A 4E33A 3SR3A 2I87A 2AQKA 4MWDA 2FEXA 3LDHA 3VTAA 4FYKA 4CM5A 3H11B 1QLJA 2GUWA 2MINB 1FRNA 4JAVC 1WS6A 3QEKA 3WDMA 2I6QA 1PJCA 1VE6A 4XZ3A 4BLOA 1K86A 4R51A 4TM7A 3E4DA 5ES3A 4EVQA 3ENKA 3LXRA 1VDZA 2BGKA 2R8ZA 1HYEA 2IHYA 2GFIA 3WSTA 3MVEA 5CXSA 1EDZA 5KSYA 1A95A 3OLWA 4EFDA 1GPWB 1JZTA 4DTIA 4RZUA 4OXNA 3BMOB 3Q41A 4PAWA 2B30A 1SD5A 2LW7A 3QOYA 4HX5A 3UATA 3WLLA 4S1VA 1OLUB 3PLNA 1R4NB 1I3LA 5KZMB 1ZD4A 4NPHA 2IPXA 2W6OA 5EIAA 5EKTA 5BW8A 1ZR2A 1GOTA 4Q5IA 1HTWA 1I0LA 2AR7A 3FMFA 1KEPA 4OQQA 5G53C 4HPXB 4QJIA 3AU8A 4EOGA 4P82A 5U9CA 4U7DA 1M2NA 1PRYA 4N12A 1CU1A 2WF7A 3KYJB 3B7GA 3WGJA 3MTIA 3UKOA 5L45A 5KNDD 4G1EB 4K26A 2Q07A 2VPTA 3FKSD 4TXLA 4EGJA 3RG8A 2I2BA 1Z47A 3NDRA 4TRMA 5BYBA 2Z8ZA 1VLMA 4DCPA 1RZRA 1A69A 4MUAA 2EOAA 1BQEA 5JRZA 5CXQA 2ZSIA 3HP1A 4M76B 1DTSA 4BNWA 3N0VA 1IHYA 5EHXA 4CMCA 3DBLB 3MGCA 2FOIA 4XR4A 5IBRA 3ISVA 4BNVA 1P8AA 1P7PA 5DNYB 1DT3A 4RKRA 1RWPA 5ESRA 2WU4A 5HCIA 1X7YA 3ECAA 5I45A 2Y67A 1MC8A 4DN6A 1H94A 2EHJA 4Y1FA 3IX7A 4B6EA 5AW3A 4B46A 5A4JA 3R5XA 2FVXA 1H1LA 2V4ZA 5MN5A 1RQ7A 3L1HA 3LOUA 5D5HA 1UZNA 1VIMA 1JIKA 4HOYA 4C7OB 4EPVA 5HBGA 3UGJA 3MCUA 5F78A 4AZTA 2P3SA 4KH1A 9LDBA 2Z57A 3CLKA 2CXHA 1SOWA 3L7YA 4EG7A 4JR2A 2CXRA 4S2EA 4ZDJA 5LXTF 4CBVA 5A6VA 3GPCA 2KLBA 4MHSA 3QMWA 2AG8A 4BWVA 4G56A 2PGIA 2WIDA 1CF4A 1D4ZA 3PQ4A 3VPSA 4RZXA 2C9OA 4LC9A 4KIWA 2J7PD 4RCVA 2XAAA 3LT4A 3ROTA 3K9NA 1A4IA 5KWIA 4DEYA 2PXCA 4JSYA 3AWDA 1NMSA 2HT6A 4YUXA 4C0LA 2GO7A 4DOMA 4TMYA 3WQBA 1V1MB 4S0XA 3EPPA 1KAQA 2QTZA 4BQQA 2CV2A 1G4HA 2OE2A 1TA9A 1NP6A 1XRMA 3LX5A 2WPDD 4DLUA 2VNSA 1OIXA 5D51S 5DE3A 4N6NA 3ZXIA 3CF0A 1J8YF 2WNHA 1M75A 4RK6A 2V3CC 1M0TA 2ORVA 4MPTA 3KOOA 4KK4A 3ZJVA 3JV7A 2NO5A 1FJGB 2H3EA 1RKQA 3OT5A 1C4WA 1U1GA 1W8IA 3TX6A 1ADYA 3GHHA 4Q02A 1YUMA 4FCTA 3KYCA 3VISA 4C89A 4ER7A 3SLRA 5ILOA 1T5HX 1MKYA 1AXGA 2ILVA 2OCGA 5L7YA 3EHEA 4MWOA 3ELUA 2BFCB 4HS4A 3V2HA 1NT4A 2EEZA 2R96A 2YYSA 3STHA 1N2GA 5BSUA 2VTVA 4B5KA 2N3ZA 2OB2A 4AWXA 5C1BA 3EEQA 4KUGA 2EFYA 5K3FA 5F2OA 4ZVOA 3SSAA 5B2FA 3KUCA 1TM2A 2O8NA 3ZHTA 3AVTA 1OZAA 2ZRQA 4DMRA 2SHKA 3O03A 4LGCA 3FYUC 3NDIA 1Z6AA 2OUIA 5LXTB 1GTRA 2UVPA 4RULA 1SPXA 4OATA 4MQEA 4AMVA 5JSQA 1TVEA 2FWPA 2EZ8A 1Q77A 3FCCA 5EKSA 5A9RA 3A3YA 1VJDA 3IOYA 4DEXA 4YA6A 2R85A 1NA5A 2C8VA 5BNWA 5BMVB 2AVNA 1DKMA 2C5BA 2MMGA 3K16A 4PTLA 1JIVA 5J4LA 2B1RA 2X0IA 5B12A 2GSDA 1RABA 2FU5C 5KSPA 4LJ6A 2EC5A 3QKWA 5KTYA 2WM9B 4RKYA 5FUQA 4YDHB 1OX5A 3ABQB 4MRMB 4EB6A 2DB3A 3L46A 3GCDA 4R6XA 3O8DA 5IVIA 3DAPA 1NVBA 1GKIA 3EVCA 2W6QA 4YLEA 1KMMA 3MJCA 2WJGA 1ADGA 2H2IA 3U37A 4C3ZA 1S2OA 1AMOA 1S01A 2AHOA 1A4RA 2ROQA 4DLRA 5EC8A 2HJ9A 3ABZA 5CT4A 3RWOA 3SG0A 4XJSA 1MTOA 2DT5A 3PCXA 3TDKA 3TLAA 5IHPA 3GQBB 1PNOA 3CXUA 4FR5A 4F5YA 5K6TA 5GINE 3UWOA 3ZGOA 4J0QA 2A1TR 1E5XA 3T7AA 1I9GA 1X77A 2EX0A 1M2OB 4Y2YA 4YN3A 2GF0A 5AHKA 4DMUB 2YVKA 4CTMA 1K88A 1IOWA 2VO1A 5JROA 1DAFA 3UK2A 1HA3A 1Y1PA 5JQGB 1GTG1 2ZUSA 5CDHA 2GVZC 1TM4E 3BXFA 4PNZA 4DG5A 4OM8A 3FVQA 5E2AA 2ACKA 4EKGA 2X7XA 4HEA1 3ZI4A 5JCJD 1M2KA 2QN6A 3HN7A 4QLBA 4Q7MB 3TOCA 2FMHA 1JQ5A 3GPBA 4GPAA 4IFTA 4RHTA 4XYBA 4CLRB 4COKA 1NVVQ 2BM8A 2X77A 4ZREA 3R0XA 3MT8A 2QJTA 2CLLB 1TTPB 1OKKD 2BEJA 2IZ0A 3B5JA 4MVJG 3C8UA 2NUBA 4UNNA 4CTJA 2ZU0C 2JAUA 3JZFA 1W0JA 1UPCA 4Y1EA 4L2IB 4R2MA 4OQFA 4EPTA 3E82A 1P62B 4DADA 3NR2A 2VNKA 1WCIA 2OBXA 4HDCA 3O8QA 2BSAA 3ASYA 3M1YA 1ADJA 5JARA 3AEQB 4ZVSA 5DRYA 1UBHS 3F3YA 4Z8XA 3TJZA 2QRQA 2ECFA 1IXYA 4W5NA 4FOLA 3PFNA 4XIJA 3E8SA 2C03A 2C7OA 2HRQA 1O2DA 5H4HA 1G4UR 3NT5A 1XZQA 1V8PA 2PA3A 3NIBA 3SLKA 4CV1A 3L0DA 4JH0A 1IY2A 3C3KA 4JCCA 4X8OA 1FIUA 1Y3HA 1F4LA 2CMFA 3DA8A 3G2MA 4I1YA 5G3YA 1XC7A 3S2SA 5ALFA 4RPHA 4DV4B 1W85B 2E4WA 1D8TA 3SE7A 2QRVB 3L8CA 3HRHA 3DMPA 2F9MA 3B89A 3QHQA 4PG4A 2L69A 3JSAA 4YP6A 3MAAC 4EKIA 1RJ9A 2GILA 4G4JA 4UDXX 4Z99A 4AL4A 4RZIA 1YMUA 3Q3EA 1I51A 1ZGJA 1E3WB 4JL6A 2BM1A 1DKUA 4G24A 1JPUA 4ZVUA 2KQUA 5KX5A 3OFND 4HNRA 1THMA 3RS4A 5AVXA 3T1HB 2RKBA 1LA2A 4G2NA 2GBFA 4GLJA 4QTXA 4TXHA 2C4KA 4F60A 2HA4A 7MHTA 2V97A 4O1MA 1XRNA 3HYLA 1YZNA 1XELA 3PKIA 4H1HA 3A0RB 3VR0A 4HYYA 4N6GA 1WA5A 2PT5A 3LPLA 2LGJA 3HLYA 5LDGA 5AVTA 1JJAA 3CB4A 1R6DA 4EZIA 1I8TA 1UFRA 4CNQA 1CYEA 5HGJA 1OFTA 2NU9B 2WAYA 3M3HA 2B6HA 2W2VA 3Q72A 3VFDA 1D6JA 2QS9A 1YHNA 4KXLA 4ZRDA 5BV0A 5HOEA 2GOYA 3ONEA 3H83A 2QLNA 4OO3A 2W4MA 1X1CA 4UEQA 5HIIA 2Y4NA 3TW0A 3GNLA 1TGVA 4K6MA 1E6CA 4XDHA 3O1HB 1PUIA 1EM6A 4BVLA 1OZ0A 5C5DA 3THYB 5KNCH 3HDGA 3GFTA 3DKPA 3JQFA 5ECWA 3WHKA 3ZLUA 5KB3A 1MU0A 1ZRNA 5FOSA 1JNXX 1C1DB 5IXJA 1CTQA 1RBQA 3C3WA 2AOTB 4MAAA 5CVEA 2JK0A 1US8A 3P71T 4KN9S 2BELA 1G1MA 5EXPA 1ZIPA 1NONA 4G07A 5DULA 4N0MA 2CJWA 5K4AA 3SD7A 1Z29A 1AO0A 2C5GA 2JAPA 3AEUA 3PUKA 1ECPA 3AYZB 3C70A 3PA8A 4QBGB 4DVGA 2P79A 3GLQA 2VAVA 1DIAA 1AA6A 4IRXA 4M9QA 4QGAA 4GR9A 3P9SA 2PWBA 2HPAA 1XEWX 3VMFA 1FPQA 1UC8A 2YHAA 3BDAA 2NZWA 1Z8NA 2IE0A 1Q16A 1XXHE 4J0HA 4UTOA 4LFCB 3ZCXA 3PI7A 4JVMA 5D86A 5AK6A 1H0SA 2CEAA 4MW1A 1Z88A 2QI9F 5HUQA 4N76A 1Y3FE 4GI2A 3T3EA 4WK4B 3IHLA 5HMLA 5KVAA 4H17A 3ANTA 3GJ5A 2IODA 3DHWC 4OXYA 3WLRA 1AK1A 3OLQA 1QBGA 3R7WA 3LDAA 1USIA 3NW9A 3KEFA 4AECA 2PM8A 2QMYA 3PLAE 2QBYA 5CW1A 3E7PA 1KJNA 3UENA 5J4VA 3T6KA 3DE3X 2QROA 3H5NA 1R5OA 4PHTA 3VHQA 1HDZA 2AUMA 4XGQA 1XMPA 4OQEA 5JZBA 3BB3A 4UEOA 5BY2A 4UASA 5SZJA 5EFOA 3A6PC 4KN5A 1TTQB 2Q62A 4TX1A 5LYYA 5JASA 5LQKA 4M9UA 1K5HA 3LX6A 3EBLA 3PGXA 1DBQA 4DLLA 4OHBA 1FFCA 1J5EB 4C22A 1PL7A 3IDAA 1F8UA 3PDUA 4O2BF 3K09A 5G0SA 4PYIA 3LO8A 4WL0A 5FORA 4EB3A 2HYDA 4XQGA 3FOFC 2OL4A 1NRXA 2JJ8A 2X41A 3FJOA 5KSOA 1ITZA 2JW5A 1PNRA 1GCUA 1Q7GA 4U7GA 2QPAA 3PQ6A 4FMBB 5DVZA 5AVOA 1UXKA 4FUQA 4FR2A 4E5VA 3OVMA 4UMFA 1W7AA 2MWMA 1PUJA 5B3KA 4NP6A 5C4IA 2AK2A 1QK5A 3QW4B 4RKQA 2O48X 1VCOA 1XNGA 3KVYA 1ICIA 2B78A 4Q1BA 3TQRA 4KITB 1JLKA 1PBTA 1B8PA 1M54A 4G2TA 2NO7A 2B8TA 2JD1A 2YH2A 4RIFA 5KAMA 5IMSA 3GFVA 4LRUA 3JQAD 3TZKA 2DH6A 2CCJA 2KWIA 1UKZA 2ODQA 4XUEA 1OBCA 5L3SB 1C50A 1KK3A 2I8CA 1G6Q1 3TFOA 1UDRA 5LA6B 1JFRA 3RASA 1GR0A 3UK7A 1U5BB 4S1OA 4TTSA 1FJHA 3VMMA 3QBEA 4QUBA 4TXNA 2QTCA 4NOJA 3VYRB 2XVXA 4FZVA 1KIMA 1Z73A 2FR8A 2BPOA 1O6CA 2R8BA 1HT0A 4BV3A 1LX6A 1TQDA 2DKOA 2JJQA 4BXOA 4LHXA 5LN1A 4LXIA 4D5EA 4KHPB 3VDRA 4Q9NA 3L9XA 3PF8A 1ZGGA 3KLPX 2YWFA 1ZW1A 3FI0A 5AM2A 2XX3A 4ZAYA 1AOXA 4Q7QA 5BUQA 4MR9A 2W2LA 4YI5A 3I05A 4I2VA 4XFDA 1R88A 3DR3A 5JVDF 3T94A 1RE0A 3SXPA 1K4KA 2DUUA 3NNNA 3TPCA 4TLAA 3GGDA 3GX1A 4CIWA 1XTVA 5KMGB 2O0JA 5AW2A 3ZDYB 2IS4A 4H9GA 3DEYX 3GFGA 4NICA 5IVPA 2OXFA 3H5OA 5BRJA 4LBWA 5D3QA 5ARDA 5EUQB 5F23A 1Z0UA 1P5JA 4EKEA 1CVLA 4YCSA 1O8BA 3C1OA 4KIFA 4U2BA 4D0GA 2JH3A 3RCBA 1MAWA 3N87A 1XNRB 3U4AA 1CUEA 2ODEA 2PAFA 3OQJA 3FCYA 3VNVA 4I50B 3WKDA 1YFLA 2R7MA 3D5EA 2XWJI 4QU5A 4EI8A 1F4VA 2RDMA 3EE6A 4N0QA 4OJQA 1E3QA 4WH0A 5GGYA 4AMBA 5FEUA 2ZQZA 2D59A 2VOEA 4M1ZA 1EXNA 4GICA 3U7IA 2H52A 3PHBE 1NQVA 1QG2A 4EDHA 3CVUA 3L43A 1JX6A 3STUA 3PI6A 3MAGA 1NG9A 4I1PA 2HHHB 2M1XA 2IHVA 1NQ5A 1P73A 2CW5A 2VTEA 3EXHB 3U7EB 2D54A 3ZTWA 1T4DA 4M8KA 2YV3A 3E6AA 2HRCA 2AT1A 4G86A 1H0RA 4HDRB 2Z56A 3MTBA 4LDQA 1XVIA 3IV6A 4YJDA 4ASUA 3TG8A 4QULA 4EW2A 4I99A 1L7XA 1W0CA 2OKGA 4PYLA 2Z6UA 2WP8J 3NMUF 4FIZA 3QOFA 2QPLA 4LWOA 5AICA 1R50A 4YQEA 3ZGZA 1JIIA 3PNOA 3N75A 3S1AB 5HFNA 5E1DA 3T4EA 5I5GA 4EHFA 3L2OB 1JJIA 1Z7GA 3I9MA 2JBWA 4PM4A 5I9BA 3DVSX 4HLDA 4F56A 3BS4A 1G66A 2QAJA 2P9FA 2B5WA 2INGX 5G0TA 3VO1A 4IVQA 2Y0PA 4KW7A 2DHQA 3ND9A 5CLFA 1SUEA 1DELA 3KZVA 3QK7A 3OJXA 4AZWA 5LPNA 4HN2A 5ALJA 5KWEA 1E77A 3EGIA 2WNIA 2WM2A 3AFHA 2ZYGA 2Q2WA 5HTKA 4ARBA 3DL0A 1KH2A 5LLSA 3UQZA 1ILEA 4XYLA 4C7XA 5ED4A 2ZIZA 1QGYA 2P35A 4Z9XA 5B3AA 3B3FA 3O84A 5IS2A 2GRUA 1QTNA 3G9TA 1E5QA 2NXJA 3RSLA 5ESDA 3A6KA 2DG2A 3DAOA 3WYCA 1R0XA 1AS0A 2GVDC 1XX6A 3HXPA 1I5EA 3M4YA 5AKKA 5DTJA 1EWTA 1QIFA 4QFCA 4MQMA 4RM3A 5AKHA 3AG5A 5CYGA 4DT1A 5B1EA 4LXGA 1UBSB 3U39A 3DVAA 1N6IA 1OB5A 3SEAA 3BD9A 4KE9A 1W1UA 4M7RA 2G1PA 2VDLB 3ETDA 3HWSA 4FGLA 4Z1MD 1SCDA 1YZFA 3HCOA 2OB1A 3VPDA 2FAXA 1LRJA 4UPDA 1ZICA 4DPLA 1Y4UA 2H0QA 1Q1GA 3DTYA 1ZL2A 3QEOA 1KO7A 3LH5A 4XVQA 4XARA 3FSGD 2H1FA 4PZUA 2R79A 3DL7A 4FFWA 1BDMA 4BQNA 1V25A 1SHKA 1S0UA 1W5AA 4KMMA 3IYLW 3WWEA 2Q4DA 4HADA 1HORA 1ZGAA 4W6QA 1GRQA 3NHWA 4QLAA 4E5KA 5LZ9A 1HNWB 4RNDB 3JWJA 5LNK1 1OGIA 1OH5A 1U4OA 3FE2A 3RTGA 1T15A 1JDUA 4RSMA 2H85A 5F52A 4EMSA 1GGMA 2NU6A 4JJ6A 5J2TB 4WDQA 3JVVA 1S2IA 1A9YA 3ZGVA 1JSRA 1JPNA 3GFBA 4LTMA 1YQTA 2V96A 4M1WA 5AFSA 1K9SA 1MD9A 1YACA 1Y42X 2C2MA 5A7HA 1X42A 4RV5A 1P1JA 2I6FA 3PT9A 1J8QA 3F46A 4GRIA 1KDTA 4II7A 4UZSA 3HYNA 3RTCA 1OLSB 2XDAA 4D8YA 4EHHA 4NFYA 1NXQA 3COPA 1M72A 1ZVMA 5DIZA 5T5QA 1R10A 4B8ZA 3VTFA 4MVJI 3RGWS 1L4EA 2G88A 2R00C 3AI1A 3MGKA 2D2VA 4DLWA 1HYQA 1F2UA 4QGHA 5KYVA 3HSSA 1E2IA 3NM4A 1OZHA 4XCQA 3C3CA 3C7KA 3KBBA 4UDYX 4R2XA 3ZH2A 1NIJA 2V58A 1WZUA 1T43A 5IASA 2D7JA 5EJMA 2N1BA 1QIIA 4HMQA 4LOLA 1A4UA 4MV4A 1GPBA 3GDGA 4WK2B 2Y6UA 4AKEA 4UD2A 2NYUA 4FHDA 4CM6A 5HVNA 4WLOA 3PQ8A 3FNIA 4WOKA 2HK8A 1XDBA 2H2DA 3B9RA 3E9DA 1XCBA 4R1TA 2PUJA 1QGAA 2IV2X 3KLOA 5MGNA 3I5XA 2O8BA 3R3ZA 1ESEA 3BJIC 4QXPA 1B43A 2BFFB 1INLA 4NMXB 2YCLA 1OXXK 2CDRA 3JTEA 3LTEA 3H9GA 5ALQA 1CQIB 1Z07A 5IAOA 2VP9A 1UT5A 3CM0A 4RY9A 4QUDA 4BCDA 1U1CA 3W5DA 2JGMA 3UHFA 1CUCA 2G17A 3M6WA 1MPTA 4GPBA 1NX9A 3HBFA 1YB4A 2ZYTX 1JU9A 1VOTA 2HUNA 1C1XB 1VKHA 3G6KA 4J0IA 3TLEA 3OCVA 3KOUA 1C7RA 5EJEA 4TV8B 1KI7A 1GUZA 5KHAA 4OHMA 1N9GA 2NNWB 3DYBA 3HR7A 4FE7A 4CQJA 2O8FB 2CUZA 2AZMA 2RBEA 4RPLA 1N9ZA 5TGZA 3TSZA 3T5PA 4DSUA 2HGSA 2FPIA 4OJMX 4REMA 5JAOA 2GMWA 2HSDA 1ICEA 4Q7EA 4FFBB 2ZIXA 4LDAA 3KSBC 1O94D 3EOZA 1LBIA 1T8TA 2COKA 2B3TA 4HQFA 4J07A 2G63A 2Q3CA 2FJPA 3AY3A 2PRSA 3PTZA 5AK0A 4BKMA 5C1OA 4LBZA 3D4PA 3EG9B 1QOPB 4BEJA 4IHJB 1XZMA 4KZPA 2M32A 4RA9A 1TMYA 2DHCA 1Q2UA 2XYHA 5AW4A 4DIOA 1PDWA 4KYIB 3D8TA 4QG7A 4F0JA 4UOEA 3FR7A 3P5BA 1DRWA 4DUGD 1WPQA 1W88B 4K7JA 3QA9A 1V41E 1BDJA 1J39A 5FR2A 3IUQA 1RYYA 3KVVA 4HNTA 2QXTA 3ADKA 2XADA 4Y2QA 3ZE8A 4B8YA 4EP1A 1DWQA 1WHSA 2B94A 1EX9A 1EU1A 3AF1A 4FLFA 3OOYA 1EBFA 1WDKA 5DCWA 3BXHA 4M38A 2PWZA 3P20A 3F96A 1BKDR 4XQEA 3DL2A 1X7GA 1XUOA 2PLAA 4D96A 4G5OA 1F9EA 2OAQ1 4ZALA 4IP0A 4NABA 4PAGA 4QFMA 2FW9A 4FWIB 3TKLA 4QKQA 2PO7A 3ZWXA 2PGJA 5HHTA 2X19A 2AYZA 1MQSA 3CJQA 4ZYVA 4N4AA 2WSSD 5EHZA 3R9WA 4RHUA 2GDZA 4D3DA 3X2FA 3DAHA 3OQBA 3EAGA 3JYNA 2GJAA 3JPWA 1TKBA 4YRCA 4BN5A 4MAFA 3PQCA 2E4AA 3OZEA 5FWYA 5AVRA 4RHEA 1AVTA 3JQCA 3IR6A 4F4IA 1S1MA 3A9TA 2QP9X 4MB0A 3ZHUA 1NURA 4EUKA 4MWGA 3GJ6A 5LP6C 4DM3A 2F9FA 4KAXA 4RGBA 2HXGA 1G8PA 2BLNA 3JRWA 4PZZA 5DCUA 1MX9A 3IUMA 4RDXA 3RAGA 4JENA 4MV3A 1ETUA 1XI2A 1Z5ZA 1PK7A 4KFTA 3N2KB 3REGA 1UT8A 3DT9A 2EQ5A 1W4LA 5UKDA 4BQFA 1HH4A 5IJZA 1JIJA 1RRKA 2LTAA 1KSHA 1MC4A 2R6ZA 4IHAA 2F43A 4NATA 3CLTC 3TECE 3WFJA 3QJ5A 1TYAE 2ZB3A 1KMNA 1E5VA 2EFCB 2C1ZA 1QRAA 1TCCA 3AEXA 3BZWA 3HKCA 1G6KA 3PX2A 1HI9A 3GD7A 1Y4SA 4RZ2A 4AG3A 1BX1A 2VAXA 4IQ0A 3EAQA 1W5TA 1NXVA 4JP5A 5KREA 4HQRA 4KV9A 4PO9A 5HRCA 4IWNA 4P5DA 4MUYA 4XDGA 5ECDA 2MYPA 4RKEA 4GM1A 2QTVB 2PVCA 3IMEA 3AESA 2FEPA 1DLJA 3JS5A 4JWTA 3ZY6A 4BVGA 1HF3A 1WG8A 2IRWA 3CVWA 4LF4B 4Z49A 3K9CA 4FHZA 1L7VC 3SS9X 1UBFA 3D6AA 1JDSA 1HTBA 4ATNA 2G25A 3TTWA 5TIIA 4NE7A 1E1QA 2IDJA 1A82A 2NTJA 2VNAA 3KPVA 3DMRA 2GCNA 4JC0A 4PC6A 1VKNA 2Z9BA 2DBZA 3Q85A 2J6BA 2XSZD 4NQZA 1TYZA 3FWNA 2XE8A 2B9EA 4KQFA 4R5MA 3SZLA 3H16A 1OV4A 1VBKA 3L7MA 1OMOA 1U2EA 3JQ7A 4PQRA 5IMBA 4MEAA 4ZO6A 3CUTA 3IEIA 1L7MA 5HM6A 4NPCA 5AKJA 5TB5A 5CA0F 2YHBA 3BHNA 2D2FA 3C5CA 1QF9A 5T3YA 1WVGA 2VP6A 4LNAA 1F38A 1N1GA 2OXRA 2YXDA 1GYRA 2HRZA 3L4SO 3PD1A 3BGVA 1I2BA 5J40A 3S40A 3EUAA 3OM9A 3SJ7A 3N2GA 3FVWA 4L50A 2YWXA 5I7OA 2Q6OA 2FV8A 3C3MA 3H65A 5B5SA 3I5YA 1H0HA 4HEA6 1JSXA 3BXOA 3AP3A 4YJKA 1VHTA 3W4KA 3BGWA 1ECFA 3N53A 3WWZA 3EXAA 4RVCA 1VPEA 1IHXA 2OHIA 2RI6A 3MB8A 3PS9A 4XE5A 3IP8A 3LUJA 5KTKA 1NXWA 1J9ZA 1UJ2A 3BCUA 4Q24A 1WXGA 4TTRA 4DLTA 5H82A 4RK5A 1PN3A 1UFKA 2GSWA 1I6KA 1NMEA 2NAFA 4XEUA 4X1KB 1Y8AA 3FUTA 2PXAA 3AINA 4OVKA 1LI5A 4J1NA 4U6NA 1U28C 4ERNA 1OCEA 3NBFA 5EJGA 3U80A 2FDXA 3KL2A 2B2CA 2NVUA 4FC7A 4W9NA 1GDTA 2QZJA 3CIOA 1F6WA 2I9KA 3B12A 4S3MA 3SHOA 4OHYA 2GJSA 3C3DA 1A7KA 2J0QA 5LYJA 1J2RA 3BE6A 5EXXA 4ZV9A 2ZP1A 2RK6A 1NTOA 4QLOA 3HUTA 4RQAA 3UMMA 2Y1OA 3ETLA 1N2EA 2D3WA 1L1EA 3C5EA 4HO1X 4IJ5A 3QPWA 5DRTA 5LUBA 4MW4A 1UBEA 3B3QA 3VOTA 4LF8B 4G25A 3F6BX 1WBJB 3TOZA 2Q0HA 1QFXA 4QYXA 2WUGA 5DYYA 1XZBA 3WLJA 2QTGA 3AF2A 1Y6ZA 3I2HA 2C2GA 3KPJA 4U2GA 2POCA 1LSUA 1XZNA 1UPXA 3SQXA 4MR7B 1KP3A 3ESQA 3W5JA 2R1ZA 3MRXA 1D0IA 5ALZA 2Z2ZA 1O54A 4H0CA 4LJ9A 5EKXA 5KNLA 3VJKA 4EI2A 3L0CA 221PA 2QAGC 3D4LA 1NUUA 2Q6VA 1PNQA 2WA1A 1XLWA 3EBOA 1O57A 3L7IA 4IX9A 2X1LA 4PIMA 1KJ8A 4R9UC 4QOSA 3T3IA 1DCKA 2AFHB 4IJUA 2WKPA 1Q83A 3PNLA 1U0RA 1RRFA 2Q6TA 3NBYC 3P97A 1QZ3A 2O7RA 3P0IA 1Y5LA 1JG7A 3RKRA 1ISJA 1SC4A 4J03A 2WWHA 3L0YA 3CBQA 1SOVA 3A1TA 4CV0A 4HJRA 4X9XA 2VBFA 5B57C 1L0BA 3NPMA 4OJNA 1AK9A 2G0AA 4F38A 4IAOA 2X2PA 1HGXA 3AI3A 1XEAA 5CFLA 5K3EA 5K99A 1BCSA 5WRFA 1R66A 1SZPA 3E5HA 2H5IA 4O2AF 4C06A 4F46A 3B2NA 5L7TA 1ESZA 3CNBA 5G4LA 2GFQA 3X1WA 2OQRA 2BMWA 1TYBE 3GI1A 4G41A 1IEXA 1W47A 2VSOA 4UCWA 2XQGA 2HV9A 3RV3A 5ALYA 1DRKA 1Z5VA 2WUEA 4LX0A 4EY6A 4LY9A 4L27A 3KB8A 3CRW1 4HX9A 3VR5H 4GYJA 5HA5A 4CV2A 3BAZA 1PJ3A 3W06A 1P4GA 3B9PA 1CERA 4B6OA 4RAOA 4IGFA 2GBGA 3P0HA 2JGDA 2O6LA 2GCOB 2PSFA 2BH9A 1DAIA 3AETB 4ZOBA 3T38A 4B4KA 5B36A 1I3OA 4HRYA 3C6ZA 2QT1A 1T2NA 3KEQA 5F7JA 3TNJA 3NPAA 3CRNA 2XGJA 1AUVA 4XGNA 1NUTA 1DIBA 3GFOA 2NUAA 3MUNA 4MI3A 2WB2A 3OOJA 2VQEB 1EFTA 5M04A 2VJDA 1N32B 2C95A 4Q21A 4YAUA 4MGKR 8GPBA 1Y1SA 3H5VA 4DA6A 3MT7A 4FYIA 4ZTUB 4YPVA 2ZYWX 3OTIA 1FFXA 1X7HA 2OZEA 3ND8A 4PBTA 3OETA 3BRSA 4QQRA 4URXR 1T1JA 3VI3B 4AF6A 1QWSA 1JE1A 2CUKA 1HDRA 3KQYA 2R5FA 3TX2A 4YXWD 3LQ4A 5KOHA 4CNBA 1W5EA 4A27A 1CXZA 1Y9ZA 1JDZA 1AGRA 1Q22A 1WTAA 1C80A 2HA0A 2J1LA 4ZHQB 3DSRA 4QXQA 2MYNA 5CURA 1RD4A 4ZK6A 1KEWA 3MSXA 3FCEA 3TQIA 4JA0A 4WCFA 3GLGE 2QWXA 3ZK7A 3UUFA 3WP1B 3AEYA 3WSWA 2C92A 3C1UA 1DRVA 1G20A 1VYVA 5D3MB 3UN1A 4FGKA 2FSGA 3DZ8A 4IMIB 4UHJA 5EE9A 4IXNA 1NXPA 5A6SA 1YA6A 2IW3A 1MJHA 3L1VA 1PL6A 2KBFA 2H65A 2OV3A 5KPJA 2G5GX 4H7PA 2C20A 2HNKA 3KXKA 4ALKA 3AW9A 1G60A 1W52X 4FBGA 4YP5A 2JCVA 4O4LB 5HUHA 1EXWA 4GX5A 3W5SA 2H3HA 2QL7A 1RYDA 2QG9A 5IUJC 3HR8A 5JO9A 2BIFA 5KBYA 4MRPA 4A8JB 4BUCA 3LXXA 3SBXA 4AK9A 3MELA 1MRZA 4E5DA 1N8TA 1U2DC 3O4HA 4UBNA 4DS3A 2K5UA 5KS2A 4QVIA 4JEUA 1MW9X 3O83A 2YVUA 1RACA 3A4MA 1DXQA 1D2CA 4GUDA 3LL4A 3NHAA 1HEYA 5A05A 3TW8B 1E3LA 3AVPA 3PNSA 1YCFA 4RS3A 4GXRA 1RWVA 2HY7A 3CUEF 2GNOA 2PTGA 2OFPA 3RF7A 2YZGA 4C0HA 3EW9A 3IB3A 1N7IA 4JBGA 2WYVA 2WTUA 1EH5A 3ZDQA 3E35A 1IUKA 2H31A 1EFVA 4MR8B 4YVFA 3E2MA 2IH5A 2HYIC 2Q28A 4ND8B 4KGDA 3PTAA 1EA5A 4AUMA 4KR0A 4JI8B 1WBDA 2HTFA 1Y5NA 3N8IA 3O8OA 2BTOA 3MBIA 4KX3A 3P9PA 5JRDS 1DUSA 4G5FA 5AVUA 4KE7A 2P3QA 3F7MA 4ENTA 1L7EA 4DZZA 3OA0A 1SVLA 4EVIA 1T9AA 2ZRLA 3DKIA 4B7ZA 1YZ3A 1AGPA 4QPDA 4S1NA 3TZQA 1UM8A 2W71A 2QLJA 3CNEA 1Q12A 3NAQA 3QENA 3MJHA 4XR9A 3HRIA 4ZQGA 4YV2A 1JTFA 1IPEA 4R2IA 4QBTA 1ZKMA 1KEKA 1X7ZA 1NF3A 1RT9A 1IIRA 2DHEA 1NTRA 1XRJA 3KQVA 1L5NA 2H1WA 4Y0NA 3L18A 2IHJA 3QIAA 4MLDA 1PZEA 4HCJA 4OPMA 2G82A 4YRTA 1PR6A 1ND5A 2J48A 5J2UB 2ZI7A 3V7WA 5LQNA 5IEJA 1XPOA 2GNPA 2ZR8A 4Q16A 3WWOA 3EC7A 1JWBB 3FMOB 3BC1A 4HH4A 3NAMA 5EINA 3RVJA 5CIYA 5AOAA 1T4CA 2C42A 2G9RA 4KDEA 3UG6A 4YP0A 5LP6A 3L0PA 2YIJA 2K4MA 5FBKA 2YN2A 1O03A 3AM5A 1EGHA 2YS7A 4IEFB 3IQDB 2EWVA 4C0BA 3HP7A 3PUVA 5DEIA 3H4TA 4UOZA 3CV3A 1U1FA 2W2KA 2O5VA 3BHJA 1UZAA 4FDUA 5I51A 2P62A 1T8PA 4JB8A 3TKYA 4MYUA 1JNYA 3JQPA 2NZJA 2RJOA 5JH7A 5FBVB 4I1SA 1P45A 1YC2A 3VKUA 1MW8X 4CKZA 2CZCA 2W6ID 3AF5A 3X43A 3WKAA 4WXRA 3V1MA 2XMQA 5JY1A 3T4XA 3KT3A 1E6UA 3RV4A 1JLSA 3ZDZB 3S1SA 1Z75A 3JTMA 4MA4A 2NZXA 3QG1A 2GZAA 3LE8A 5K0NA 1L5LA 3U4MA 3JR3A 3F5SA 2A59A 2QTLA 5SY6A 4BKQA 1TM7E 3I9V6 3P45A 4EECA 4XWKA 3OJCA 1CQWA 4ENPA 5BVGB 1R6UA 3CYFA 1GT91 1G3IA 2XCLA 1N5OX 3LUDA 3I0NA 4C3UA 3SHVA 3HI6A 3TQOA 1CFJA 5HFJA 1KJJA 2HJSA 3C1AA 4LMBA 3RS7A 5D1NA 4BLWA 2ONYA 5MGBA 2CFTA 4WCFB 4M4SA 2V6IA 5L4SA 4UTPA 4CI9A 1YRBA 2BCJQ 1ONNA 3HLKA 2GPNA 4RJIA 1R37A 4C08A 1I7DA 2O7QA 1HR0B 4MIKA 3PX3A 3QHPA 1YE5A 5H59A 3Q8LA 1NWHA 3KXLA 3H2IA 3FHJA 2WPNA 3WV5A 1EA7A 1XU9A 3CSDA 5KTOA 5AHOA 4EA7A 3JQ9C 5BOSB 4CGZA 3WHIA 1C2TA 2P4SA 2O8EA 5HRUA 1OXBB 1P2DA 2A2ZA 3NJ8A 4PO1A 2MINA 1JA9A 2H2FA 2QV0A 3MWDA 1IH8A 2AV6A 3UHAA 1Z4LA 4GM4A 3ZBUA 2CK3A 4EM6A 3UPTA 1Y34E 2Y76A 3LZDA 3Q1LA 4HD8A 4LJ4A 1NUAA 2EBWA 4H35A 4MO2A 3KEGA 1P1CA 1NPDA 2A88A 3F67A 1NY6A 1N0HA 5IRCD 3OJFA 3RIYA 1NMXA 2NYAA 1G7TA 4NE9A 3BWEA 1EFRD 3BMOA 1Z8HA 1FFDA 4RKFA 3KB2A 3KWMA 2C31A 3TLYA 1EXMA 1R4NA 1SA0B 1Z9BA 2MIIA 2PEZA 2PKRA 1RAGA 1VMEA 2Q5JA 3EDOA 1AQJA 2CL0X 2AMFA 5BRAA 4CPDA 3NV7A 4TS3A 1N6OA 5ALDA 3J7AC 3FLMA 1J09A 1E2FA 5NLLA 2YJZA 3UFXB 1L4KA 3QEMB 2NUPB 3ZG6A 3BRWD 4E32A 5CTAA 2ZYIA 3U1VA 4D43A 2DHDA 3MILA 1QTQA 3W7BA 2XH8A 3BPSA 1AA9A 3NWJA 5EQFA 4GRDA 4FBMA 2HEIA 4L5YA 4ZWNA 1LTKA 3UAXA 5C32A 4CMKA 4N3BA 5F35A 1IM8A 4G36A 2EJVA 1I10A 3KV3O 4Z3KA 3DBLA 1NM5C 5EZQA 1T5DX 2PBLA 3TUIC 1E62A 3E84A 2O1EA 3QGMA 5JDIA 3FOBA 4RPGA 4M0FA 3GK3A 4H7FA 1CIVA 4JBXA 4YRFA 4O59O 3SZUA 4PHHA 1TVCA 5J3JA 2MYUA 4L5JA 3JSXA 4RBNA 2PJRA 1T8RA 1KH1A 4FS8A 2IITA 2Q5HA 2XRZA 1BX3A 3DEHA 3OPNA 3R3UA 4JCOA 1T4GA 1XTPA 2I2FA 5LMZA 1NJ1A 1QH9A 2QTAA 2H63A 4BFWA 4NLLA 1P19A 3HJTA 3CN7A 2J5BA 1LW7A 1AQ6A 5TEVA 4JOSA 1PW7A 3F3MA 5F1PA 4DANA 1SUPA 4M9CA 2V4UA 3D8UA 1KU0A 2VRCD 3UKDA 4UE2A 2C7BA 4YJ3B 1IFXA 2VDQB 5AI8A 4BZXA 2IF2A 2VKQA 2VWQA 2VJKA 2ZCVA 3CQ9A 4BAUA 4D4KA 2J3EA 1FYXA 2I7DA 1IWOA 3NGMA 5CT9A 2KW5A 2XTZA 4KOEC 4M0EA 3HCFA 1QHHA 4WE3A 4PN3A 3ZK9A 4YRLA 1M2VB 3IURA 5B4TA 5JQWA 4O3MA 1GKYA 2IEBA 5TMEA 3EA0A 2NXEA 1U3CA 1CUYA 3HB9A 4ITVA 4CDRA 1CT9A 1V1MA 1K4MA 1GU0A 1ZMTA 3HO1A 2VZ0A 3IJ5A 1OV6A 1RRGA 2QUKA 1H8ED 1XZGA 1DJMA 1OY1A 2C29D 5KOJA 3GY0A 4HVTA 1RBMA 3DTNA 4ZHSA 1P60A 4J94A 1FE8A 1YU6A 2Z95A 2FWMX 3B6IA 3CMMA 3JQGB 2JAWA 1BNCA 4Q3EA 3AP1A 4YUVA 3ZTTA 5BWMA 3HXOA 4M7WA 2GKSA 2FWBA 3W05A 1QQ7A 3IAFA 3N58A 3OF5A 1YR7A 2CCKA 5GMOA 5JCOC 3BSWA 3CC8A 5B7PA 1XQVA 2QUAA 3L6CA 4AF8A 4FCWA 1DTEA 3UYKA 1YZTA 2AFRA 2YOFA 2BFCA 2VYVA 3WL8A 3O1JC 4EPYA 2AKEA 1E3MA 2NN3C 7REQB 5AJWA 1FDRA 4EJMA 2WJ6A 5CVVA 3LIPA 2H7YA 2OO5C 4XJXA 4UBKA 4G9GA 5KDLA 2ZJFA 1MB3A 3GA0A 1YU9A 3K5HA 1WW2A 1G8MA 2VA9A 3QLUA 1ZNQO 2VR1A 4PTZA 2Q1UA 3KSDO 3Q7TA 2VYFA 1OVMA 2FE4A 5DCLA 1LFAA 4WQMA 3ETJA 5TY0A 2B69A 2OBYA 4U7TB 5CGQB 2WSYB 2Z4SA 5BV7A 4QWMA 3IXQA 2UYHA 1P80A 1SQGA 3D4OA 3ETEA 4WNAB 2G8LA 3BA6A 1P2TA 1S3IA 2RH4A 1BJTA 3VYUB 3AR2A 4YJGA 1X14A 4MLCA 1JV2B 3MMZA 3CISA 5M34A 1ABBA 4YV7A 5BMVA 1G5TA 4IV8A 4YAFA 1K8YB 1XHLA 2B4QA 3S5UA 2F17A 4QYTA 3AB7A 3W1WA 1WUYA 3GOHA 4F7WA 5HKBA 1E9SA 4LDZA 3K0EA 1DIHA 3K35A 2QN3A 4N5DA 1G17A 4XJTA 1I2DA 3I2FA 4FEAA 4MRMA 3RU7A 4MTLA 1YZKA 1F6BA 4KAJA 5G0VA 3CVOA 5L3ZA 4BX9A 4B3GA 4LWPA 2X5KO 3EVEA 3IAXA 4Q4JB 5CB4F 5JFOA 3A9UA 3I92A 5EMNA 4ECEA 1OGJA 3Q7PA 4FQ5A 4QOGA 2FFBA 1XDUA 1ZU4A 3DMTC 3E7WA 4P4GA 1T9DA 4YASA 4GDFA 1J5XA 3LRXA 2QU8A 2EJBA 3AILA 4MZXA 3R6LA 2H2HA 3F4KA 3GQBA 4KJXA 2PWPA 1GNRA 2IBSA 4J4BA 2JIRA 4P7JA 4DY6A 4Q4CA 2FG7C 2BCGY 3ELYA 5DXAA 1BD3A 2WF8A 4JMLA 1ZW6A 3VR1A 3L04A 1B6GA 3OLZA 4ZCMA 2J67A 5DOZA 3HMKA 3ZDDA 4LHZA 3C7AA 3UMCA 1ACLA 4W8GA 2IEZA 5E1OA 1RYEA 2I1LA 1Q15A 3ABSB 3NAZA 5CEJA 5JQGA 3PNBA 1U2DA 5KVSA 1R15A 2HRDA 4LYGA 3TSWA 2AJCA 3BIFA 5AVJA 4DB2A 3OU6A 1NXOA 2EW1A 2CZQA 2D7CA 3QYAA 3IIKA 5B2ZA 4MV7A 4MQUA 1BOOA 1E7RA 1CJUC 3GP5A 1PTJC 1X19A 3G82C 2GD2A 4YT5A 1E1RA 3V1TC 2J85A 5U4QA 4EHIA 1PEDA 1GT6A 4QUGA 4QNMA 1OF1A 3KAQA 2BCEA 5H81A 3EZ6A 1YQQA 1WSDA 3V55A 3OQ1A 1UFQA 1XZDA 2I71A 1RCFA 3UTCA 3X2EA 5AW8A 1GG9A 1M7GA 3MT0A 1BXZA 1ZX1A 3MMPA 3UCEA 3AEQA 3ZHSA 5C1PA 2UUOA 5AI9A 1WETA 1HT2E 3EVDA 1KAGA 4HBGA 2GN1A 4L9WA 1NP7A 3FCOA 4RD4A 1IG0A 1FDTA 5LIRA 1RW4A 2SCUB 1HC7A 4L5IA 2V03A 4UBMA 4GD3Q 3QBDA 2IYPA 3NIWA 3ZBTA 2QN8A 4DWOA 2GEDA 2H2AA 2AMYA 3K9BA 4HEJA 2BHNA 2PV7A 4H1TA 4MP8A 3T34A 3D5QA 4V0QA 3DXXA 3G49A 1P5HA 3CH5A 1Q0HA 4NKRA 1W35A 1W85A 3EZXA 1Q57A 3AXTA 2CXQA 2QRVA 3CLUD 1FRZA 2V98A 2HMVA 4C2TA 3D0OA 2FF7A 4ZYLA 3DP9A 2H4HA 3G79A 4UEJA 1E3WA 4DJAA 1NBIA 1MVLA 4NONA 1SXJE 1E18A 1ORRA 1JBQA 1Y98A 4JIMA 4C5BA 2I3BA 2GN2A 1PWHA 1IUNA 1NAIA 4WDRA 1L8QA 5H3CA 1E20A 3Q9NA 1ESMA 3WQRA 5K5EA 4QZVA 3BYZA 2VQSA 1P2SA 1TRKA 4JJAA 1C41A 4OBXA 3WK5A 4UZEA 3ZIAA 5JANA 2JGRA 3D1JA 4K05A 4LHSA 4Q48A 3UV6A 1JFTA 2HLDD 3F3SA 2PA0A 3FPEA 2HWUA 2GA9A 3AV0B 1KMQA 1RZUA 4O2LA 1OR8A 1KI3A 1Y63A 3HL4A 4DILA 4L7QA 6Q21A 3GRFA 4OLHA 1KHTA 4X71A 3T9AA 1G4AE 1TYCA 1NY5A 1STOA 5JYBA 2ZUTA 2G9VA 1Z13A 2BUBA 2J5QA 2P0YA 4Y0AA 2HWYA 5JO0A 2JIBA 2X5XA 2PEYA 3E1SA 3RR2A 4MROA 4DMHA 1NSTA 1JSLA 1O6ZA 3OZCA 3NHPA 4FNAA 4U5QA 4WGFA 3VZQA 1VHJA 5CEFA 1NXXA 1FFWA 4BU0A 3TR0A 3UH0A 1Z6TA 1GCAA 2FRDC 3S2ZA 1C1DA 4EO7A 2QW0X 3H0KA 3ID6C 4XUCA 2AOTA 2FPOA 2NV6A 4PLFA 1P9NA 1QP0A 1K6JA 2ATIA 1WHTA 3CW8X 1C3OA 1GQOA 5BR7A 4AW9A 1KR5A 1Z2EA 4QVKA 1QE3A 1PO7A 3H4VA 3GFRA 4KGVA 4RORA 3K8QA 5ALHA 3ZDRA 1JEQB 3PE6A 2Q3DA 4LSWA 4D97A 2CXSA 2R44A 4V0OA 4PRLA 2H51A 1GAXA 1MO5A 3BXGA 4GR5A 4TL7A 1PUXA 2I29A 4KUHA 1IN5A 3IC5A 4KWTA 4Q05A 1XCLA 4R41A 4AKHA 1OFUX 4GBMA 1LSOA 4WXHA 3FPKA 4G81A 4BJ1A 4IDHA 5CBPB 4MWBA 5DGDA 3R75A 4ZAXA 1LWNA 3EFBA 2AXNA 4BJ3A 3OPYB 3NBQA 4HDSB 4EHNA 1TUIA 1H93A 3UXMA 4PG8A 2HA6A 2HBZA 3P52A 2PUFA 2BFPA 2A9QA 1DSSG 1XZEA 3Q5GA 4URVR 3OX2A 3TFQA 3V8RA 3WYDA 1FTQA 3FGOA 5TJHA 3AIKA 3BXXA 4LAFA 4PS1A 1EUQA 4YMHA 1BRTA 3KETA 1T6BY 4A2CA 1CP2A 5KJCA 4BNHA 4RMNA 4R01A 2NOAA 5KTSA 2W93A 3ET5A 4X62B 1NLYA 2BFEB 3KAPA 1A76A 2CGEA 2OK7A 1YB5A 1J1IA 1M6VB 1G9TA 3BN3A 3FTNA 3PEFA 3QE2A 1JEDA 2VLIA 4L02A 2B7BA 1BWSA 5A3JA 5KKAA 1CVRA 1XDZA 2CNBA 3BKXA 3V1NA 3VGJA 1BH2A 1T3GA 4TWIA 1L4HA 1FBNA 1AKUA 1NLZA 2EVWX 1N75A 2ODWA 2PMDA 1YO6A 2Y27A 1T6NA 3DFIA 1ATIA 2GM5A 2IF0A 3OURA 3PGJA 2YWRA 4WSOA 5FOXA 521PA 4BAGA 1KQGA 1MA3A 3EVTA 1CUGA 5JSUA 3HFSA 4BVFA 5BNZA 4N8EA 1EK1A 2GLXA 4BB6A 2IOFK 4IIJF 3E3LA 1GNTA 1Z5GA 4XEHA 4QPCA 2PUGA 3ZBQA 3GGOA 4ZIRB 1MJGA 4FU0A 4WKGA 2I62A 1B4DA 3OO1A 1WPRA 3CGGA 5CDFA 3RK4A 5LMCA 5ENVA 4LPKA 3R3XA 2G80A 3N8NA 1D2AA 1BJKA 1JS1X 2UZ1B 4UAUA 2JHAA 3BGDA 3F8SA 3FUVA 4NEGA 1Y5RA 3I04M 3DULA 2AYYA 3W8RA 4CYMA 1OFHA 2ZLBA 4J0DA 1PFWA 5L3SA 1UOEA 1DIRA 2DLDA 5LQCA 4JUBA 1A5SB 1PZFA 5FOTA 1KYIA 5LA6A 1FDWA 4B4OA 1U5BA 3CONA 3W3AD 3PRYA 3NVAA 4U9HS 4EW1A 5L3QB 4BQRA 2R6CA 4RTNA 2G8NA 1FU8A 3Q3VA 5B3JA 1RTTA 3PV0A 2JRCA 1B16A 1ZN8A 2QV7A 2RKWA 2WU1A 3LQQA 4A8TA 1FFYA 2QQGA 4MVJP 4QU9A 2EW8A 2VSFA 4Q12A 2XVMA 1FU7A 1LVGA 4DBZA 3FWYA 5BNIA 2CB0A 2FFHA 4CG2A 2JI9A 2ZUEA 3OFNA 4PCLA 1Y7IA 4YBZA 3L92A 3R9IA 4IDQA 4RIHA 2XYPA 4EJ6A 1JSZA 3DXFA 1ODLA 4Q9IA 5FP0A 2CBGA 4LCBA 4YB8A 5K0SA 1CRLA 3I58A 1XNHA 3ROXA 3W2GA 1EJ2A 1Y9DA 4ZYWA 3AOGA 5HZKA 5KMGA 5K6AC 2O20A 2DOKA 2P8JA 2M6LA 1ZC4A 3HUUA 1Y4DE 4POAA 3DE4X 4WXEA 3JAKB 4LUCA 4RTMA 4AG5A 4DR2B 3UZUA 1CY8A 3HVHA 4WBXC 1L4FA 1ZD8A 1IONA 2OBMA 3WOVA 4DHWA 4IJVA 4I9GA 5K3BA 2GS9A 1IBCA 1LRKA 2GN4A 1TDJA 2WT4A 1QH0A 4R98A 4CF7A 1X70A 1J25A 3VPXA 4F6LA 2BN4A 2ZIGA 5JCOA 1EK0A 4MVJD 4EA9A 3D8SA 1ZR4A 2GASA 3HR4A 1EHYA 1OB2A 4I50A 4LDJA 1KNXA 3ONFA 5EP3A 4B33A 5AD1A 5DTRA 2D1FA 4D4JA 1KSFX 2VEOA 2ZWIA 5ALUA 2JIZA 2WNSA 4DQUA 1DRUA 4XSGA 5I5EA 3AO0B 2I2AA 4PHCA 1IL0A 3NTUA 4CW7A 1JHUA 1PR9A 5BMOA 2C4HA 4HB2A 2B36A 3JQ6A 4JJKA 3ZBPA 4ER0A 3GLUA 1BWPA 3Q4GA 4O33A 3EXHA 2OG2A 2JARA 1HDOA 1JEEA 1QVVA 5G0UA 3VR2A 3HADA 1N5LA 4HDRA 4B9AA 2AZTA 2ZVPX 5FI3A 3WMEA 5JAZA 1FMFA 2F55A 2FW0A 3VHLB 3ET4A 1LKZA 2FW1A 3I6IA 2IEYA 5C9ZA 2ZUUA 5HUJA 4OU4A 1V47A 3IVCA 4L85A 4AKIA 3GZJA 4NIMA 4RF5A 4M89A 3FFBA 3JD4A 4X1IB 1M1YE 1PQ4A 2OORA 1W581 4H18A 4ZVKA 3S1AA 3ZV6A 3EXEB 4RH0A 1E1YA 2H1CA 2A5DA 1SNYA 3ANSA 3HS3A 3S44A 2TMGA 4QDUA 1FJXA 3FTPA 1KO1A 4GI1A 4QYMA 2PRJA 4Q0MA 2FSHA 1OASA 3H9BA 4W82A 4YO7A 2VK4A 5HE9A 5IVHA 2V3VA 3HB7A 1HUQA 4C88A 1YBHA 2PSJA 2RSLA 3DPSA 1IQ0A 3E70C 4FQ8A 2Q3HA 4UD6A 3HEMA 3ZE7A 2IX9A 2Q4RA 1ZSYA 1DPFA 1YGPA 3GFQA 3FJYA 4IDEA 3ZUPA 2PGDA 1GZ5A 1ODCA 2BI8A 4Z3DA 3SEZA 5TLSA 1MENA 1ZJ6A 1VRVA 1G9SA 2O52A 3DV0A 4Y7DA 1B8OA 1OE0A 3DMTA 4TYMA 4HBZA 2BGUA 2O2GA 3X2SA 5JNVA 1F7VA 1O95D 4NZMA 3ROKA 3WNZA 4QXOA 3A9SA 1NJ5A 4GIBA 2H5EA 4C04A 1NI3A 1O0BA 4G0UA 4D9MA 1OJLA 4ARVA 4ZOQI 4QUJA 3Q98A 2PO5A 7AT1A 4O02B 4YCAA 5EIWA 3FPBA 2J9ZB 4TZTA 1PKXA 3MTEA 4O2BB 4XB1A 2OYRA 3QXSA 3EIUA 3KSZO 3F5MA 2V0GA 4P3YA 3FUXA 3GBPA 1WB9A 3GU3A 4NAVA 3RM3A 2ZRFA 3CZPA 4KUEA 1T3HA 4DLKA 2QE6A 2XUQA 3VA7A 4P4SA 2HI0A 1YONA 3AHHA 2V3WA 1JG3A 2QGFA 3EA5A 1P4HA 1N5DA 1YQDA 1ZA1A 2H7XA 3I09A 3RC3A 3DL4A 3G0GA 1U99A 5GPBA 2GPSA 4ZZ0A 1J5PA 5LQSA 5SYMA 2PG3A 5JS6A 1E2EA 1EE1A 1PWEA 4HFRA 3HYTA 4X00A 2OBLA 2P9EA 4L07A 2D13A 3KNZA 3T8YA 2FK8A 3U13A 2VXOA 5KCMA 3WQSB 5J2TA 4QPNA 3KQKA 2XOXA 4Y2VA 1E7YA 1P9RA 1DX9A 3SBEA 1RZ3A 1DQPA 1DAGA 1NFRA 1QB7A 1J24A 3UWKA 4CMJA 4BZZA 1XAIA 1PV1A 1RSZA 4U02A 1XF1A 5DJ5A 1OLSA 4EK9A 1RQXA 1JFFB 2Y8EA 4WOBA 5KYNA 3IBCA 3I6YA 4TRRA 5CPBA 1TEHA 5HCNA 1PEYA 1MFZA 2FZVA 1LZLA 1Z2DA 5JVDB 4KR9A 3ZCRA 5EE1A 3ORFA 3QOXA 2YVQA 3LX4A 2FH5B 2ZQYA 3LHIA 1GJRA 4AG6A 1QFJA 4RTSA 3RK0A 5DH9A 3EXG2 2BKEA 3LUGA 3NS7A 4HAOA 1RQGA 4L0QA 4XSVA 3UK1A 3F6YA 3KOWA 4OUDA 1DKQA 2WMOB 3WGYA 4LS3A 3MNFA 2VQ6A 3BX1A 3OAAA 4L3VA 4P5EA 4AWAA 5AJVB 4AJHA 2A84A 3A2NA 4IIDA 2BC9A 8MHTA 5A02A 1Y6RA 4GSYA 5TQVA 4R1OA 4D3FA 4ZDKA 4XM2A 2NMVA 1GTJ1 1YB7A 1TUBA 2OGWA 3QVVA 4U5XA 5GONF 5ECGC 3DHVA 4QNNA 4B83A 3INNA 5U4XA 1CQIA 4M3NA 4QOJA 3O1IC 1U3TA 4O1IA 2GK4A 3DCNA 2IUUA 1T1RA 1F4PA 1P33A 1TC1A 1UOQA 1M8PA 1DE0A 2PFSA 3PDCA 4OY3A 3ZVNA 4II3A 3O47A 4MOWA 1BG6A 1D0VA 2DBQA 3TD2A 1TECE 5C8YA 1T2AA 3G2HA 1XZLA 1C1XA 5DYIA 1KAOA 4XPIA 4QBIA 2YDYA 3IPRA 1ENOA 5ALGA 1LF0A 3SR0A 2WB4A 1XEWY 2O8FA 2DCUA 2DQ4A 2GLUA 3B3JA 1YS7A 3IBYA 3L4BC 4IF4A 4JLWA 3RSCA 4A8JC 1EINA 3IDOA 3LLCA 2K87A 4KQXA 2FQXA 2Q1WA 2IEDA 3P0EA 5E2BA 4E5UA 3SZ3A 3K73O 4FFBA 3AF6A 4JJZA 4LOAA 3ADDA 3GUHA 1THTA 1W6RA 3FOWA 1XTZA 3HL0A 1EE9A 5ALSA 2FRDA 3ESXA 2RIPA 4UBOA 3EG9A 5IKMA 3SK0A 2JS7A 2IQIA 4KPFC 5KCZA 1CPYA 1N7JA 2VZLA 2W8BB 4NZZA 5CM8B 4ZCTA 4PYOA 2R3SA 5HIAA 3LLVA 5DP2A 1H2EA 5KU1A 2ZSJA 1W88A 3GGCA 3PPVA 4XASA 3RSGA 4EHLA 4MZDA 2HLPA 3GLHE 4KLZA 4MHOA 5AVVA 1FUEA 5FYQA 2R97A 3LC7O 2F1KA 2QX8A 2GN8A 3MUFA 5HK8A 1XZFA 3PP8A 1GQRA 1C0LA 3KOMA 1HY3A 4FEEA 4NK4A 3K0AA 4NYJR 3ZD7A 4G84A 2VYND 1SCBA 1K27A 4NPAA 3UMVA 3QX9A 3LUHA 3MYYA 3WRVA 4OAQA 4E5YA 4F93B 1TT7A 1PZMA 2XQKA 5T8KC 3EEIA 4RS4A 5GOZA 4IYJA 3SNKA 3M5WA 3IP6A 4X61A 3SS7X 3KX2A 4I9NA 4E4TA 2E49A 3M70A 2FX2A 4OFZA 1J06A 1XQWA 2RCNA 3D4IA 1WXDA 4GECA 4CUJA 3M83A 4EMUA 4URZR 4R83A 2ZJBA 2O2XA 2BMDA 2VNJA 5ALNA