3ICAA

The crystal structure of the beta subunit of a phenylalanyl-trna synthetase from porphyromonas gingivalis w83
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
212
structure length
205
Chain Sequence
NADRRYKWQTVVSEQLVGAGFNEILNNSLTAGSYYEGLKSHPREMAVELMNPLSQELNCMRQTLLFGGLETLSHNLRRKHLSLYLFEWGKCYRFHAAKRETPLAAYAEDDRLGIWICGQRVHPEEPTSVFELKAVVEQVLCRVGIETGAYTLKTADNDLYASAMEVKTRSGKLLGTFGTVSTELIKRFEIEQPVYFAELLWDALM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the beta subunit of a phenylalanyl-tRNA synthetase from Porphyromonas gingivalis W83
rcsb
source organism Porphyromonas gingivalis
molecule tags Ligase
molecule keywords Phenylalanyl-tRNA synthetase beta chain
total genus 55
structure length 205
sequence length 212
chains with identical sequence B
ec nomenclature ec 6.1.1.20: Phenylalanine--tRNA ligase.
pdb deposition date 2009-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3icaA00
3NEMA 3P8YA 1E24A 4HWSA 4CS3A 4OLFA 2ZNJA 3QO8A 2DVEA 5K1PA 1WPYA 1B76A 4RQFA 2EJFA 4YRFA 3VQXA 5K1XA 2ZTGA 4CS2A 4ZIBA 1WNLA 4H02A 4TTVA 3BFMA 1L0WA 3HXVA 4P72A 2ARSA 3RKWA 3V7SA 2DDZA 2DZCA 4KR3A 3W3SA 4EX5A 3V8KA 2Q5IA 3HXXA 2RHSB 4UPAA 2J3LA 1E1TA 1YGBA 1E22A 4XTZA 2CIMA 2E1HA 2AMCA 4J15A 3EFSA 1H4QA 2C7IA 3VQVA 3M4QA 4P73C 1HC7A 3G1ZA 2XGTA 5C51B 4H2VA 2E3CA 3EFRA 2ZGWA 4OP0A 4P3NA 2ZIOA 4YCVA 4P75C 1E1OA 3UH0A 2Q7HA 4WJ3M 3VQWA 3MF2A 3V8JA 4CS4A 2DXUA 4YRTA 2ZCEA 4HWPA 3RF1A 2RHSA 1NJ1A 4G84A 1G51A 3RIRA 3MF1A 4RMFA 4YDQA 1WLEA 4YYEA 3V8LA 3L2ZA 2DXTA 3NETA 1EVKA 4UP9A 2RHQB 1YFTA 4WJ4A 3ICAA 1G5HA 1H4TA 2ALYB 2DKGA 3HY1A 4H2WA 1EVLA 4PHCA 2DZ9A 3PCOB 1WU7A 3HRKA 3HTZA 4ZTUB 2ZINA 1NJ8A 3TEHA 4YCWA 1EQRA 3P8TA 1X55A 1YB3A 3R07A 4TVYA 3E9HA 3V7RA 4H2XB 4Q6GA 2I4OA 2ARUA 3E9IA 4HWTA 4L87A 2Q5HA 3QTCA 3UGTA 2ODRD 1PYSB 3TEGA 3LSSA 3NENA 4XTUA 4XTYA 4YCUA 4BW9A 1GGMA 4H2SA 1SETA 2ZT5A 1HTTA 3REXA 1NYQA 1SRYA 4YREA 5F5WA 4PG3A 4YRIA 1Z7MA 2P5IA 4YRQA 3PCOA 1IL2A 2ZZEA 2E65A 4K86A 2FYKA 3RUXA 2ZZGA 11ASA 12ASA 1VQZA 2AKWA 4P72C 3LC0A 2DEQA 4TVWA 4AH6A 2ZIMA 4YPFA 1YFSA 3IKMB 3HXYA 3M4PA 2PMFA 1JJCB 2QHTA 4XU3A 4P74C 1X54A 4P71A 3NELA 2AMCB 4YRNA 1C0AA 2DU5A 1NNHA 3BJUA 2DJZA 4TQFA 4YRCA 3V7CA 1J5WA 1B70A 3TUPA 2DTIA 1USYA 3A31A 1X2HA 2C8MA 5KNNA 2RHQA 2ODRC 3HXWA 1QE0A 2QHVA 2CJ9A 3CMQA 1H4VB 4RQEA 4XU1A 4YRJA 2CJAA 4YRMA 4TQDA 4HWOA 3RL6A 3RKXA 1ASZA 4P3PA 5HGQA 3A7AA 2ZR2A 3OD1A 2IY5A 3RKYA 3L4GB 4P3OA 4EO4A 3HFZB 4XTXA 1PYSA 1NJ2A 4XEMA 3IALA 1B70B 4CH5A 4HVCA 2E10A 1B8AA 4XTVA 2EWNA 1ADJA 5C52B 1SERA 4YRPA 4NCXA 3HRIA 3LSQA 4YRGA 2I4LA 3QO5A 4HWRA 3REUA 3ERRA 3UFGA 1BIAA 2ZNIA 2E5AA 4RDXA 3P8VA 4XTWA 3UGQA 4E51A 3HY0A 1LYLA 2ZR3A 4G85A 4X5OA 2DTOA 4LNSA 1H4SA 1NJ5A 3HFZA 2PMEA 1FYFA 4YRKA 4UP8A 4YROA 3VQYA 2HNIA 3IKLA 2CJBA 2EL9A 1ADYA 4YRSA 4K87A 3L1AA 4CH4A 3A5ZA 4Q15A 4KR2A 3HFVA 3QO7A 4WF2A 4CH6A 1SESA 4H2TA 1KMNA 2J3MA 4P75A 1B7YA 2ZT8A 5E3IA 1KOGA 2E41A 5ELNA 1NJ6A 1Z7NA 4CH3A 3DSQA 2Q7EA 1KMMA 2ARTA 1RIQA 2EJGA 1HXDA 4XU0A 1B7YB 1BBUA 2QHUA 4O2DA 3IG2A 4TVAB 1EIYB 1WQWA 3A5YA 1WQ7A 4YP0A 3PZCA 1EOVA 2AKWB 2I4NA 4XEOA 1NYRA 4WI1A 3RGLA 3WQZA 3TEHB 4BWAA 4DPGA 5C53B 4P73A 4UP7A 3L4GA 2QHSA 4ZTZB 2DQ0A 3HXUA 4H2UA 1QF6A 4H2YA 3I7FA 1WYDA 1G5IA 2DU7A 3FJPA 3A32A 2DTHA 4P71C 3MEYA 2Q7GA 4TVAA 1EIYA 1USYC 3QNEA 2EJ9A 4P74A 1YFRA 2ZXFA 1BBWA 4K88A 2G4CA 1N9WA 4DQ2A 1EFWA 2EAYA 4XU2A 4H2XA 5ELOA 2E64A 3VBBA 4TWAA 3KFUA 4HA8A 4YRRA 2ZZFA 1X01A 3RACA 4YRLA 2IY5B 3A74A 1BIBA 2ZT6A 4KQEA 2P0LA 1X2GA 2DQ3A 3HXZA 2ZT7A 2XTIA 2ALYA 3A7UA 1ASYA 1JJCA 2I4MA 2CGHA 1ATIA 3A7RA 1X56A 1W66A
chains in the Genus database with same CATH superfamily
3NEMA 3P8YA 1E24A 4HWSA 4CS3A 4OLFA 2ZNJA 3QO8A 2DVEA 5K1PA 1WPYA 1B76A 4RQFA 2EJFA 4YRFA 3VQXA 5K1XA 2ZTGA 4CS2A 4ZIBA 1WNLA 4H02A 4TTVA 3BFMA 1L0WA 3HXVA 4P72A 2ARSA 3RKWA 3V7SA 2DDZA 2DZCA 4KR3A 3W3SA 4EX5A 3V8KA 2Q5IA 3HXXA 2RHSB 4UPAA 2J3LA 1E1TA 1YGBA 1E22A 4XTZA 2CIMA 2E1HA 2AMCA 4J15A 3EFSA 1H4QA 2C7IA 3VQVA 3M4QA 4P73C 1HC7A 3G1ZA 2XGTA 5C51B 4H2VA 2E3CA 3EFRA 2ZGWA 4OP0A 4P3NA 2ZIOA 4YCVA 4P75C 1E1OA 3UH0A 2Q7HA 4WJ3M 3VQWA 3MF2A 3V8JA 4CS4A 2DXUA 4YRTA 2ZCEA 4HWPA 3RF1A 2RHSA 1NJ1A 4G84A 1G51A 3RIRA 3MF1A 4RMFA 4YDQA 1WLEA 4YYEA 3V8LA 3L2ZA 2DXTA 3NETA 1EVKA 4UP9A 2RHQB 1YFTA 4WJ4A 3ICAA 1G5HA 1H4TA 2ALYB 2DKGA 3HY1A 4H2WA 1EVLA 4PHCA 2DZ9A 3PCOB 1WU7A 3HRKA 3HTZA 4ZTUB 2ZINA 1NJ8A 3TEHA 4YCWA 1EQRA 3P8TA 1X55A 1YB3A 3R07A 4TVYA 3E9HA 3V7RA 4H2XB 4Q6GA 2I4OA 2ARUA 3E9IA 4HWTA 4L87A 2Q5HA 3QTCA 3UGTA 2ODRD 1PYSB 3TEGA 3LSSA 3NENA 4XTUA 4XTYA 4YCUA 4BW9A 1GGMA 4H2SA 1SETA 2ZT5A 1HTTA 3REXA 1NYQA 1SRYA 4YREA 5F5WA 4PG3A 4YRIA 1Z7MA 2P5IA 4YRQA 3PCOA 1IL2A 4HT4A 2ZZEA 2E65A 4K86A 2FYKA 3RUXA 2ZZGA 11ASA 12ASA 1VQZA 2AKWA 4P72C 3LC0A 2DEQA 4TVWA 4AH6A 2ZIMA 4YPFA 1YFSA 3IKMB 3HXYA 3M4PA 2PMFA 1JJCB 2QHTA 4XU3A 4P74C 1X54A 4P71A 3NELA 2AMCB 4YRNA 1C0AA 2DU5A 1NNHA 3BJUA 2DJZA 4TQFA 4YRCA 3V7CA 1J5WA 1B70A 3TUPA 2DTIA 1USYA 3A31A 1X2HA 2C8MA 5KNNA 2RHQA 2ODRC 3HXWA 1QE0A 2QHVA 2CJ9A 3CMQA 1H4VB 4RQEA 4XU1A 4YRJA 2CJAA 4YRMA 4TQDA 4HWOA 3RL6A 3RKXA 1ASZA 4P3PA 5HGQA 3A7AA 2ZR2A 3OD1A 2IY5A 3RKYA 3L4GB 4P3OA 4EO4A 3HFZB 4XTXA 1PYSA 1NJ2A 4XEMA 3IALA 1B70B 4CH5A 4HVCA 2E10A 1B8AA 4XTVA 2EWNA 1ADJA 5C52B 1SERA 2A8EA 4YRPA 4NCXA 3HRIA 3LSQA 4YRGA 2I4LA 3QO5A 4HWRA 3REUA 3ERRA 3UFGA 1BIAA 2ZNIA 2E5AA 4RDXA 3P8VA 4XTWA 3UGQA 4E51A 3HY0A 1LYLA 2ZR3A 4G85A 4X5OA 2DTOA 4LNSA 1H4SA 1NJ5A 3HFZA 4LVJA 2PMEA 1FYFA 4YRKA 4UP8A 4YROA 3VQYA 2HNIA 3IKLA 2CJBA 2EL9A 1ADYA 4YRSA 4K87A 3L1AA 4CH4A 3A5ZA 2NS6A 4Q15A 4KR2A 3HFVA 3QO7A 4WF2A 4CH6A 1SESA 4H2TA 1KMNA 2J3MA 4LVMA 4P75A 1B7YA 2ZT8A 4LVIA 5E3IA 1KOGA 2E41A 5ELNA 1NJ6A 1Z7NA 4CH3A 3DSQA 2Q7EA 1KMMA 2ARTA 1RIQA 2EJGA 1HXDA 4XU0A 1B7YB 1BBUA 2QHUA 3MQZA 4O2DA 3IG2A 4TVAB 1EIYB 1WQWA 3A5YA 1WQ7A 4YP0A 3PZCA 1EOVA 2AKWB 2I4NA 4XEOA 1NYRA 4LVLA 4WI1A 3RGLA 3WQZA 3TEHB 4BWAA 4DPGA 5C53B 4P73A 4UP7A 4LVKA 3L4GA 2QHSA 4ZTZB 2DQ0A 3HXUA 4H2UA 1QF6A 4H2YA 3I7FA 1WYDA 1G5IA 2DU7A 3FJPA 3A32A 2DTHA 4P71C 3MEYA 2Q7GA 4TVAA 1EIYA 1USYC 3QNEA 2EJ9A 4P74A 1YFRA 2ZXFA 1BBWA 4K88A 2G4CA 1N9WA 4DQ2A 1EFWA 2EAYA 4XU2A 4H2XA 5ELOA 2E64A 3VBBA 4TWAA 3KFUA 4HA8A 4YRRA 2ZZFA 1X01A 3RACA 4YRLA 2IY5B 3A74A 1BIBA 2ZT6A 4KQEA 2P0LA 1X2GA 2DQ3A 3HXZA 2ZT7A 2XTIA 2ALYA 3A7UA 1ASYA 1JJCA 2I4MA 2CGHA 1ATIA 3A7RA 1X56A 1W66A
chains in the Genus database with same CATH topology
3NEMA 3P8YA 1E24A 4HWSA 4CS3A 4OLFA 2ZNJA 3QO8A 2DVEA 5K1PA 1WPYA 1B76A 4RQFA 2EJFA 4YRFA 3VQXA 5K1XA 2ZTGA 4CS2A 4ZIBA 1WNLA 4H02A 4TTVA 3BFMA 1L0WA 3HXVA 4P72A 2ARSA 3RKWA 3V7SA 2DDZA 2DZCA 4KR3A 3W3SA 4EX5A 3V8KA 2Q5IA 3HXXA 2RHSB 4UPAA 2J3LA 1E1TA 1YGBA 1E22A 4XTZA 2CIMA 2E1HA 2AMCA 4J15A 3EFSA 1H4QA 2C7IA 3VQVA 3M4QA 4P73C 1HC7A 3G1ZA 2XGTA 5C51B 4H2VA 2E3CA 3EFRA 2ZGWA 4OP0A 4P3NA 2ZIOA 4YCVA 4P75C 1E1OA 3UH0A 2Q7HA 4WJ3M 3VQWA 3MF2A 3V8JA 4CS4A 2DXUA 4YRTA 2ZCEA 4HWPA 3RF1A 2RHSA 1NJ1A 4G84A 1G51A 3RIRA 3MF1A 4RMFA 4YDQA 1WLEA 4YYEA 3V8LA 3L2ZA 2DXTA 3NETA 1EVKA 4UP9A 2RHQB 1YFTA 4WJ4A 3ICAA 1G5HA 1H4TA 2ALYB 2DKGA 3HY1A 4H2WA 1EVLA 4PHCA 2DZ9A 3PCOB 1WU7A 3HRKA 3HTZA 4ZTUB 2ZINA 1NJ8A 3TEHA 4YCWA 1EQRA 3P8TA 1X55A 1YB3A 3R07A 4TVYA 3E9HA 3V7RA 4H2XB 4Q6GA 2I4OA 2ARUA 3E9IA 4HWTA 4L87A 2Q5HA 3QTCA 3UGTA 2ODRD 1PYSB 3TEGA 3LSSA 3NENA 4XTUA 4XTYA 4YCUA 4BW9A 1GGMA 4H2SA 1SETA 2ZT5A 1HTTA 3REXA 1NYQA 1SRYA 4YREA 5F5WA 4PG3A 4YRIA 1Z7MA 2P5IA 4YRQA 3PCOA 1IL2A 4HT4A 2ZZEA 2E65A 4K86A 2FYKA 3RUXA 2ZZGA 11ASA 12ASA 1VQZA 2AKWA 4P72C 3LC0A 2DEQA 4TVWA 4AH6A 2ZIMA 4YPFA 1YFSA 3IKMB 3HXYA 3M4PA 2PMFA 1JJCB 2QHTA 4XU3A 4P74C 1X54A 4P71A 3NELA 2AMCB 4YRNA 1C0AA 2DU5A 1NNHA 3BJUA 2DJZA 4TQFA 4YRCA 3V7CA 1J5WA 1B70A 3TUPA 2DTIA 1USYA 3A31A 1X2HA 2C8MA 5KNNA 2RHQA 2ODRC 3HXWA 1QE0A 2QHVA 2CJ9A 3CMQA 1H4VB 4RQEA 4XU1A 4YRJA 2CJAA 4YRMA 4TQDA 4HWOA 3RL6A 3RKXA 1ASZA 4P3PA 5HGQA 3A7AA 2ZR2A 3OD1A 2IY5A 3RKYA 3L4GB 4P3OA 4EO4A 3HFZB 4XTXA 1PYSA 1NJ2A 4XEMA 3IALA 1B70B 4CH5A 4HVCA 2E10A 1B8AA 4XTVA 2EWNA 1ADJA 5C52B 1SERA 2A8EA 4YRPA 4NCXA 3HRIA 3LSQA 4YRGA 2I4LA 3QO5A 4HWRA 3REUA 3ERRA 3UFGA 1BIAA 2ZNIA 2E5AA 4RDXA 3P8VA 4XTWA 3UGQA 4E51A 3HY0A 1LYLA 2ZR3A 4G85A 4X5OA 2DTOA 4LNSA 1H4SA 1NJ5A 3HFZA 4LVJA 2PMEA 1FYFA 4YRKA 4UP8A 4YROA 3VQYA 2HNIA 3IKLA 2CJBA 2EL9A 1ADYA 4YRSA 4K87A 3L1AA 4CH4A 3A5ZA 2NS6A 4Q15A 4KR2A 3HFVA 3QO7A 4WF2A 4CH6A 1SESA 4H2TA 1KMNA 2J3MA 4LVMA 4P75A 1B7YA 2ZT8A 4LVIA 5E3IA 1KOGA 2E41A 5ELNA 1NJ6A 1Z7NA 4CH3A 3DSQA 2Q7EA 1KMMA 2ARTA 1RIQA 2EJGA 1HXDA 4XU0A 1B7YB 1BBUA 2QHUA 3MQZA 4O2DA 3IG2A 4TVAB 1EIYB 1WQWA 3A5YA 1WQ7A 4YP0A 3PZCA 1EOVA 2AKWB 2I4NA 4XEOA 1NYRA 4LVLA 4WI1A 3RGLA 3WQZA 3TEHB 4BWAA 4DPGA 5C53B 4P73A 4UP7A 4LVKA 3L4GA 2QHSA 4ZTZB 2DQ0A 3HXUA 4H2UA 1QF6A 4H2YA 3I7FA 1WYDA 1G5IA 2DU7A 3FJPA 3A32A 2DTHA 4P71C 3MEYA 2Q7GA 4TVAA 1EIYA 1USYC 3QNEA 2EJ9A 4P74A 1YFRA 2ZXFA 1BBWA 4K88A 2G4CA 1N9WA 4DQ2A 1EFWA 2EAYA 4XU2A 4H2XA 5ELOA 2E64A 3VBBA 4TWAA 3KFUA 4HA8A 4YRRA 2ZZFA 1X01A 3RACA 4YRLA 2IY5B 3A74A 1BIBA 2ZT6A 4KQEA 2P0LA 1X2GA 2DQ3A 3HXZA 2ZT7A 2XTIA 2ALYA 3A7UA 1ASYA 1JJCA 2I4MA 2CGHA 1ATIA 3A7RA 1X56A 1W66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NEM A;  3P8Y A;  1E24 A;  4HWS A;  4CS3 A;  4OLF A;  2ZNJ A;  3QO8 A;  2DVE A;  5K1P A;  1WPY A;  1B76 A;  4RQF A;  2EJF A;  4YRF A;  3VQX A;  5K1X A;  2ZTG A;  4CS2 A;  4ZIB A;  1WNL A;  4H02 A;  4TTV A;  3BFM A;  1L0W A;  3HXV A;  4P72 A;  2ARS A;  3RKW A;  3V7S A;  2DDZ A;  2DZC A;  4KR3 A;  3W3S A;  4EX5 A;  3V8K A;  2Q5I A;  3HXX A;  2RHS B;  4UPA A;  2J3L A;  1E1T A;  1YGB A;  1E22 A;  4XTZ A;  2CIM A;  2E1H A;  2AMC A;  4J15 A;  3EFS A;  1H4Q A;  2C7I A;  3VQV A;  3M4Q A;  4P73 C;  1HC7 A;  3G1Z A;  2XGT A;  5C51 B;  4H2V A;  2E3C A;  3EFR A;  2ZGW A;  4OP0 A;  4P3N A;  2ZIO A;  4YCV A;  4P75 C;  1E1O A;  3UH0 A;  2Q7H A;  4WJ3 M;  3VQW A;  3MF2 A;  3V8J A;  4CS4 A;  2DXU A;  4YRT A;  2ZCE A;  4HWP A;  3RF1 A;  2RHS A;  1NJ1 A;  4G84 A;  1G51 A;  3RIR A;  3MF1 A;  4RMF A;  4YDQ A;  1WLE A;  4YYE A;  3V8L A;  3L2Z A;  2DXT A;  3NET A;  1EVK A;  4UP9 A;  2RHQ B;  1YFT A;  4WJ4 A;  3ICA A;  1G5H A;  1H4T A;  2ALY B;  2DKG A;  3HY1 A;  4H2W A;  1EVL A;  4PHC A;  2DZ9 A;  3PCO B;  1WU7 A;  3HRK A;  3HTZ A;  4ZTU B;  2ZIN A;  1NJ8 A;  3TEH A;  4YCW A;  1EQR A;  3P8T A;  1X55 A;  1YB3 A;  3R07 A;  4TVY A;  3E9H A;  3V7R A;  4H2X B;  4Q6G A;  2I4O A;  2ARU A;  3E9I A;  4HWT A;  4L87 A;  2Q5H A;  3QTC A;  3UGT A;  2ODR D;  1PYS B;  3TEG A;  3LSS A;  3NEN A;  4XTU A;  4XTY A;  4YCU A;  4BW9 A;  1GGM A;  4H2S A;  1SET A;  2ZT5 A;  1HTT A;  3REX A;  1NYQ A;  1SRY A;  4YRE A;  5F5W A;  4PG3 A;  4YRI A;  1Z7M A;  2P5I A;  4YRQ A;  3PCO A;  1IL2 A;  2ZZE A;  2E65 A;  4K86 A;  2FYK A;  3RUX A;  2ZZG A;  11AS A;  12AS A;  1VQZ A;  2AKW A;  4P72 C;  3LC0 A;  2DEQ A;  4TVW A;  4AH6 A;  2ZIM A;  4YPF A;  1YFS A;  3IKM B;  3HXY A;  3M4P A;  2PMF A;  1JJC B;  2QHT A;  4XU3 A;  4P74 C;  1X54 A;  4P71 A;  3NEL A;  2AMC B;  4YRN A;  1C0A A;  2DU5 A;  1NNH A;  3BJU A;  2DJZ A;  4TQF A;  4YRC A;  3V7C A;  1J5W A;  1B70 A;  3TUP A;  2DTI A;  1USY A;  3A31 A;  1X2H A;  2C8M A;  5KNN A;  2RHQ A;  2ODR C;  3HXW A;  1QE0 A;  2QHV A;  2CJ9 A;  3CMQ A;  1H4V B;  4RQE A;  4XU1 A;  4YRJ A;  2CJA A;  4YRM A;  4TQD A;  4HWO A;  3RL6 A;  3RKX A;  1ASZ A;  4P3P A;  5HGQ A;  3A7A A;  2ZR2 A;  3OD1 A;  2IY5 A;  3RKY A;  3L4G B;  4P3O A;  4EO4 A;  3HFZ B;  4XTX A;  1PYS A;  1NJ2 A;  4XEM A;  3IAL A;  1B70 B;  4CH5 A;  4HVC A;  2E10 A;  1B8A A;  4XTV A;  2EWN A;  1ADJ A;  5C52 B;  1SER A;  4YRP A;  4NCX A;  3HRI A;  3LSQ A;  4YRG A;  2I4L A;  3QO5 A;  4HWR A;  3REU A;  3ERR A;  3UFG A;  1BIA A;  2ZNI A;  2E5A A;  4RDX A;  3P8V A;  4XTW A;  3UGQ A;  4E51 A;  3HY0 A;  1LYL A;  2ZR3 A;  4G85 A;  4X5O A;  2DTO A;  4LNS A;  1H4S A;  1NJ5 A;  3HFZ A;  2PME A;  1FYF A;  4YRK A;  4UP8 A;  4YRO A;  3VQY A;  2HNI A;  3IKL A;  2CJB A;  2EL9 A;  1ADY A;  4YRS A;  4K87 A;  3L1A A;  4CH4 A;  3A5Z A;  4Q15 A;  4KR2 A;  3HFV A;  3QO7 A;  4WF2 A;  4CH6 A;  1SES A;  4H2T A;  1KMN A;  2J3M A;  4P75 A;  1B7Y A;  2ZT8 A;  5E3I A;  1KOG A;  2E41 A;  5ELN A;  1NJ6 A;  1Z7N A;  4CH3 A;  3DSQ A;  2Q7E A;  1KMM A;  2ART A;  1RIQ A;  2EJG A;  1HXD A;  4XU0 A;  1B7Y B;  1BBU A;  2QHU A;  4O2D A;  3IG2 A;  4TVA B;  1EIY B;  1WQW A;  3A5Y A;  1WQ7 A;  4YP0 A;  3PZC A;  1EOV A;  2AKW B;  2I4N A;  4XEO A;  1NYR A;  4WI1 A;  3RGL A;  3WQZ A;  3TEH B;  4BWA A;  4DPG A;  5C53 B;  4P73 A;  4UP7 A;  3L4G A;  2QHS A;  4ZTZ B;  2DQ0 A;  3HXU A;  4H2U A;  1QF6 A;  4H2Y A;  3I7F A;  1WYD A;  1G5I A;  2DU7 A;  3FJP A;  3A32 A;  2DTH A;  4P71 C;  3MEY A;  2Q7G A;  4TVA A;  1EIY A;  1USY C;  3QNE A;  2EJ9 A;  4P74 A;  1YFR A;  2ZXF A;  1BBW A;  4K88 A;  2G4C A;  1N9W A;  4DQ2 A;  1EFW A;  2EAY A;  4XU2 A;  4H2X A;  5ELO A;  2E64 A;  3VBB A;  4TWA A;  3KFU A;  4HA8 A;  4YRR A;  2ZZF A;  1X01 A;  3RAC A;  4YRL A;  2IY5 B;  3A74 A;  1BIB A;  2ZT6 A;  4KQE A;  2P0L A;  1X2G A;  2DQ3 A;  3HXZ A;  2ZT7 A;  2XTI A;  2ALY A;  3A7U A;  1ASY A;  1JJC A;  2I4M A;  2CGH A;  1ATI A;  3A7R A;  1X56 A;  1W66 A; 
#chains in the Genus database with same CATH topology
 3NEM A;  3P8Y A;  1E24 A;  4HWS A;  4CS3 A;  4OLF A;  2ZNJ A;  3QO8 A;  2DVE A;  5K1P A;  1WPY A;  1B76 A;  4RQF A;  2EJF A;  4YRF A;  3VQX A;  5K1X A;  2ZTG A;  4CS2 A;  4ZIB A;  1WNL A;  4H02 A;  4TTV A;  3BFM A;  1L0W A;  3HXV A;  4P72 A;  2ARS A;  3RKW A;  3V7S A;  2DDZ A;  2DZC A;  4KR3 A;  3W3S A;  4EX5 A;  3V8K A;  2Q5I A;  3HXX A;  2RHS B;  4UPA A;  2J3L A;  1E1T A;  1YGB A;  1E22 A;  4XTZ A;  2CIM A;  2E1H A;  2AMC A;  4J15 A;  3EFS A;  1H4Q A;  2C7I A;  3VQV A;  3M4Q A;  4P73 C;  1HC7 A;  3G1Z A;  2XGT A;  5C51 B;  4H2V A;  2E3C A;  3EFR A;  2ZGW A;  4OP0 A;  4P3N A;  2ZIO A;  4YCV A;  4P75 C;  1E1O A;  3UH0 A;  2Q7H A;  4WJ3 M;  3VQW A;  3MF2 A;  3V8J A;  4CS4 A;  2DXU A;  4YRT A;  2ZCE A;  4HWP A;  3RF1 A;  2RHS A;  1NJ1 A;  4G84 A;  1G51 A;  3RIR A;  3MF1 A;  4RMF A;  4YDQ A;  1WLE A;  4YYE A;  3V8L A;  3L2Z A;  2DXT A;  3NET A;  1EVK A;  4UP9 A;  2RHQ B;  1YFT A;  4WJ4 A;  3ICA A;  1G5H A;  1H4T A;  2ALY B;  2DKG A;  3HY1 A;  4H2W A;  1EVL A;  4PHC A;  2DZ9 A;  3PCO B;  1WU7 A;  3HRK A;  3HTZ A;  4ZTU B;  2ZIN A;  1NJ8 A;  3TEH A;  4YCW A;  1EQR A;  3P8T A;  1X55 A;  1YB3 A;  3R07 A;  4TVY A;  3E9H A;  3V7R A;  4H2X B;  4Q6G A;  2I4O A;  2ARU A;  3E9I A;  4HWT A;  4L87 A;  2Q5H A;  3QTC A;  3UGT A;  2ODR D;  1PYS B;  3TEG A;  3LSS A;  3NEN A;  4XTU A;  4XTY A;  4YCU A;  4BW9 A;  1GGM A;  4H2S A;  1SET A;  2ZT5 A;  1HTT A;  3REX A;  1NYQ A;  1SRY A;  4YRE A;  5F5W A;  4PG3 A;  4YRI A;  1Z7M A;  2P5I A;  4YRQ A;  3PCO A;  1IL2 A;  4HT4 A;  2ZZE A;  2E65 A;  4K86 A;  2FYK A;  3RUX A;  2ZZG A;  11AS A;  12AS A;  1VQZ A;  2AKW A;  4P72 C;  3LC0 A;  2DEQ A;  4TVW A;  4AH6 A;  2ZIM A;  4YPF A;  1YFS A;  3IKM B;  3HXY A;  3M4P A;  2PMF A;  1JJC B;  2QHT A;  4XU3 A;  4P74 C;  1X54 A;  4P71 A;  3NEL A;  2AMC B;  4YRN A;  1C0A A;  2DU5 A;  1NNH A;  3BJU A;  2DJZ A;  4TQF A;  4YRC A;  3V7C A;  1J5W A;  1B70 A;  3TUP A;  2DTI A;  1USY A;  3A31 A;  1X2H A;  2C8M A;  5KNN A;  2RHQ A;  2ODR C;  3HXW A;  1QE0 A;  2QHV A;  2CJ9 A;  3CMQ A;  1H4V B;  4RQE A;  4XU1 A;  4YRJ A;  2CJA A;  4YRM A;  4TQD A;  4HWO A;  3RL6 A;  3RKX A;  1ASZ A;  4P3P A;  5HGQ A;  3A7A A;  2ZR2 A;  3OD1 A;  2IY5 A;  3RKY A;  3L4G B;  4P3O A;  4EO4 A;  3HFZ B;  4XTX A;  1PYS A;  1NJ2 A;  4XEM A;  3IAL A;  1B70 B;  4CH5 A;  4HVC A;  2E10 A;  1B8A A;  4XTV A;  2EWN A;  1ADJ A;  5C52 B;  1SER A;  2A8E A;  4YRP A;  4NCX A;  3HRI A;  3LSQ A;  4YRG A;  2I4L A;  3QO5 A;  4HWR A;  3REU A;  3ERR A;  3UFG A;  1BIA A;  2ZNI A;  2E5A A;  4RDX A;  3P8V A;  4XTW A;  3UGQ A;  4E51 A;  3HY0 A;  1LYL A;  2ZR3 A;  4G85 A;  4X5O A;  2DTO A;  4LNS A;  1H4S A;  1NJ5 A;  3HFZ A;  4LVJ A;  2PME A;  1FYF A;  4YRK A;  4UP8 A;  4YRO A;  3VQY A;  2HNI A;  3IKL A;  2CJB A;  2EL9 A;  1ADY A;  4YRS A;  4K87 A;  3L1A A;  4CH4 A;  3A5Z A;  2NS6 A;  4Q15 A;  4KR2 A;  3HFV A;  3QO7 A;  4WF2 A;  4CH6 A;  1SES A;  4H2T A;  1KMN A;  2J3M A;  4LVM A;  4P75 A;  1B7Y A;  2ZT8 A;  4LVI A;  5E3I A;  1KOG A;  2E41 A;  5ELN A;  1NJ6 A;  1Z7N A;  4CH3 A;  3DSQ A;  2Q7E A;  1KMM A;  2ART A;  1RIQ A;  2EJG A;  1HXD A;  4XU0 A;  1B7Y B;  1BBU A;  2QHU A;  3MQZ A;  4O2D A;  3IG2 A;  4TVA B;  1EIY B;  1WQW A;  3A5Y A;  1WQ7 A;  4YP0 A;  3PZC A;  1EOV A;  2AKW B;  2I4N A;  4XEO A;  1NYR A;  4LVL A;  4WI1 A;  3RGL A;  3WQZ A;  3TEH B;  4BWA A;  4DPG A;  5C53 B;  4P73 A;  4UP7 A;  4LVK A;  3L4G A;  2QHS A;  4ZTZ B;  2DQ0 A;  3HXU A;  4H2U A;  1QF6 A;  4H2Y A;  3I7F A;  1WYD A;  1G5I A;  2DU7 A;  3FJP A;  3A32 A;  2DTH A;  4P71 C;  3MEY A;  2Q7G A;  4TVA A;  1EIY A;  1USY C;  3QNE A;  2EJ9 A;  4P74 A;  1YFR A;  2ZXF A;  1BBW A;  4K88 A;  2G4C A;  1N9W A;  4DQ2 A;  1EFW A;  2EAY A;  4XU2 A;  4H2X A;  5ELO A;  2E64 A;  3VBB A;  4TWA A;  3KFU A;  4HA8 A;  4YRR A;  2ZZF A;  1X01 A;  3RAC A;  4YRL A;  2IY5 B;  3A74 A;  1BIB A;  2ZT6 A;  4KQE A;  2P0L A;  1X2G A;  2DQ3 A;  3HXZ A;  2ZT7 A;  2XTI A;  2ALY A;  3A7U A;  1ASY A;  1JJC A;  2I4M A;  2CGH A;  1ATI A;  3A7R A;  1X56 A;  1W66 A; 
#chains in the Genus database with same CATH homology
 3NEM A;  3P8Y A;  1E24 A;  4HWS A;  4CS3 A;  4OLF A;  2ZNJ A;  3QO8 A;  2DVE A;  5K1P A;  1WPY A;  1B76 A;  4RQF A;  2EJF A;  4YRF A;  3VQX A;  5K1X A;  2ZTG A;  4CS2 A;  4ZIB A;  1WNL A;  4H02 A;  4TTV A;  3BFM A;  1L0W A;  3HXV A;  4P72 A;  2ARS A;  3RKW A;  3V7S A;  2DDZ A;  2DZC A;  4KR3 A;  3W3S A;  4EX5 A;  3V8K A;  2Q5I A;  3HXX A;  2RHS B;  4UPA A;  2J3L A;  1E1T A;  1YGB A;  1E22 A;  4XTZ A;  2CIM A;  2E1H A;  2AMC A;  4J15 A;  3EFS A;  1H4Q A;  2C7I A;  3VQV A;  3M4Q A;  4P73 C;  1HC7 A;  3G1Z A;  2XGT A;  5C51 B;  4H2V A;  2E3C A;  3EFR A;  2ZGW A;  4OP0 A;  4P3N A;  2ZIO A;  4YCV A;  4P75 C;  1E1O A;  3UH0 A;  2Q7H A;  4WJ3 M;  3VQW A;  3MF2 A;  3V8J A;  4CS4 A;  2DXU A;  4YRT A;  2ZCE A;  4HWP A;  3RF1 A;  2RHS A;  1NJ1 A;  4G84 A;  1G51 A;  3RIR A;  3MF1 A;  4RMF A;  4YDQ A;  1WLE A;  4YYE A;  3V8L A;  3L2Z A;  2DXT A;  3NET A;  1EVK A;  4UP9 A;  2RHQ B;  1YFT A;  4WJ4 A;  3ICA A;  1G5H A;  1H4T A;  2ALY B;  2DKG A;  3HY1 A;  4H2W A;  1EVL A;  4PHC A;  2DZ9 A;  3PCO B;  1WU7 A;  3HRK A;  3HTZ A;  4ZTU B;  2ZIN A;  1NJ8 A;  3TEH A;  4YCW A;  1EQR A;  3P8T A;  1X55 A;  1YB3 A;  3R07 A;  4TVY A;  3E9H A;  3V7R A;  4H2X B;  4Q6G A;  2I4O A;  2ARU A;  3E9I A;  4HWT A;  4L87 A;  2Q5H A;  3QTC A;  3UGT A;  2ODR D;  1PYS B;  3TEG A;  3LSS A;  3NEN A;  4XTU A;  4XTY A;  4YCU A;  4BW9 A;  1GGM A;  4H2S A;  1SET A;  2ZT5 A;  1HTT A;  3REX A;  1NYQ A;  1SRY A;  4YRE A;  5F5W A;  4PG3 A;  4YRI A;  1Z7M A;  2P5I A;  4YRQ A;  3PCO A;  1IL2 A;  4HT4 A;  2ZZE A;  2E65 A;  4K86 A;  2FYK A;  3RUX A;  2ZZG A;  11AS A;  12AS A;  1VQZ A;  2AKW A;  4P72 C;  3LC0 A;  2DEQ A;  4TVW A;  4AH6 A;  2ZIM A;  4YPF A;  1YFS A;  3IKM B;  3HXY A;  3M4P A;  2PMF A;  1JJC B;  2QHT A;  4XU3 A;  4P74 C;  1X54 A;  4P71 A;  3NEL A;  2AMC B;  4YRN A;  1C0A A;  2DU5 A;  1NNH A;  3BJU A;  2DJZ A;  4TQF A;  4YRC A;  3V7C A;  1J5W A;  1B70 A;  3TUP A;  2DTI A;  1USY A;  3A31 A;  1X2H A;  2C8M A;  5KNN A;  2RHQ A;  2ODR C;  3HXW A;  1QE0 A;  2QHV A;  2CJ9 A;  3CMQ A;  1H4V B;  4RQE A;  4XU1 A;  4YRJ A;  2CJA A;  4YRM A;  4TQD A;  4HWO A;  3RL6 A;  3RKX A;  1ASZ A;  4P3P A;  5HGQ A;  3A7A A;  2ZR2 A;  3OD1 A;  2IY5 A;  3RKY A;  3L4G B;  4P3O A;  4EO4 A;  3HFZ B;  4XTX A;  1PYS A;  1NJ2 A;  4XEM A;  3IAL A;  1B70 B;  4CH5 A;  4HVC A;  2E10 A;  1B8A A;  4XTV A;  2EWN A;  1ADJ A;  5C52 B;  1SER A;  2A8E A;  4YRP A;  4NCX A;  3HRI A;  3LSQ A;  4YRG A;  2I4L A;  3QO5 A;  4HWR A;  3REU A;  3ERR A;  3UFG A;  1BIA A;  2ZNI A;  2E5A A;  4RDX A;  3P8V A;  4XTW A;  3UGQ A;  4E51 A;  3HY0 A;  1LYL A;  2ZR3 A;  4G85 A;  4X5O A;  2DTO A;  4LNS A;  1H4S A;  1NJ5 A;  3HFZ A;  4LVJ A;  2PME A;  1FYF A;  4YRK A;  4UP8 A;  4YRO A;  3VQY A;  2HNI A;  3IKL A;  2CJB A;  2EL9 A;  1ADY A;  4YRS A;  4K87 A;  3L1A A;  4CH4 A;  3A5Z A;  2NS6 A;  4Q15 A;  4KR2 A;  3HFV A;  3QO7 A;  4WF2 A;  4CH6 A;  1SES A;  4H2T A;  1KMN A;  2J3M A;  4LVM A;  4P75 A;  1B7Y A;  2ZT8 A;  4LVI A;  5E3I A;  1KOG A;  2E41 A;  5ELN A;  1NJ6 A;  1Z7N A;  4CH3 A;  3DSQ A;  2Q7E A;  1KMM A;  2ART A;  1RIQ A;  2EJG A;  1HXD A;  4XU0 A;  1B7Y B;  1BBU A;  2QHU A;  3MQZ A;  4O2D A;  3IG2 A;  4TVA B;  1EIY B;  1WQW A;  3A5Y A;  1WQ7 A;  4YP0 A;  3PZC A;  1EOV A;  2AKW B;  2I4N A;  4XEO A;  1NYR A;  4LVL A;  4WI1 A;  3RGL A;  3WQZ A;  3TEH B;  4BWA A;  4DPG A;  5C53 B;  4P73 A;  4UP7 A;  4LVK A;  3L4G A;  2QHS A;  4ZTZ B;  2DQ0 A;  3HXU A;  4H2U A;  1QF6 A;  4H2Y A;  3I7F A;  1WYD A;  1G5I A;  2DU7 A;  3FJP A;  3A32 A;  2DTH A;  4P71 C;  3MEY A;  2Q7G A;  4TVA A;  1EIY A;  1USY C;  3QNE A;  2EJ9 A;  4P74 A;  1YFR A;  2ZXF A;  1BBW A;  4K88 A;  2G4C A;  1N9W A;  4DQ2 A;  1EFW A;  2EAY A;  4XU2 A;  4H2X A;  5ELO A;  2E64 A;  3VBB A;  4TWA A;  3KFU A;  4HA8 A;  4YRR A;  2ZZF A;  1X01 A;  3RAC A;  4YRL A;  2IY5 B;  3A74 A;  1BIB A;  2ZT6 A;  4KQE A;  2P0L A;  1X2G A;  2DQ3 A;  3HXZ A;  2ZT7 A;  2XTI A;  2ALY A;  3A7U A;  1ASY A;  1JJC A;  2I4M A;  2CGH A;  1ATI A;  3A7R A;  1X56 A;  1W66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...