3ICAA

The crystal structure of the beta subunit of a phenylalanyl-trna synthetase from porphyromonas gingivalis w83
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
212
structure length
205
Chain Sequence
NADRRYKWQTVVSEQLVGAGFNEILNNSLTAGSYYEGLKSHPREMAVELMNPLSQELNCMRQTLLFGGLETLSHNLRRKHLSLYLFEWGKCYRFHAAKRETPLAAYAEDDRLGIWICGQRVHPEEPTSVFELKAVVEQVLCRVGIETGAYTLKTADNDLYASAMEVKTRSGKLLGTFGTVSTELIKRFEIEQPVYFAELLWDALM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylalanyl-tRNA synthetase beta chain
publication title The crystal structure of the beta subunit of a phenylalanyl-tRNA synthetase from Porphyromonas gingivalis W83
rcsb
source organism Porphyromonas gingivalis
molecule tags Ligase
total genus 55
structure length 205
sequence length 212
chains with identical sequence B
ec nomenclature ec 6.1.1.20: Phenylalanine--tRNA ligase.
pdb deposition date 2009-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3icaA00
4CS2A 4G85A 3P8VA 4XU0A 1FYFA 3E9IA 4CH3A 4HWOA 1LYLA 1E1OA 2ZR2A 4XU2A 3G1ZA 4H2TA 1E24A 2ZGWA 1WQ7A 3ERRA 3RACA 3TUPA 1HTTA 2CJBA 1KMMA 3RKYA 3UFGA 4YRRA 1RIQA 4L87A 1JJCB 1Z7NA 4YRGA 2EWNA 1NJ6A 1YFTA 1YFSA 1IL2A 4K88A 2ARTA 4YREA 1EQRA 1EFWA 1L0WA 4XTYA 4CS3A 3EFRA 1C0AA 1VQZA 5K1XA 2ZZEA 2HNIA 4KR3A 1ASZA 3RKXA 4UP7A 2E10A 2ZNJA 1NJ8A 5HGQA 4YRKA 2ZIOA 3OD1A 1HC7A 2ZT8A 2ODRC 2EJGA 3NELA 1G51A 4YRFA 3QO5A 1USYA 5C52B 2CJ9A 3TEGA 1X2GA 3HXZA 4TWAA 1G5IA 4H2VA 5C51B 4YRPA 3MF2A 2DJZA 1EOVA 4P75A 3HY0A 1KMNA 1B76A 4YRNA 2ZNIA 2DZ9A 2E41A 1WQWA 3VBBA 1SERA 3HFVA 1WNLA 3L2ZA 4Q15A 3KFUA 3QTCA 4P75C 2DXUA 3RL6A 1X55A 1H4TA 3VQVA 4AH6A 3V7SA 4XTVA 4XTUA 2AKWA 1G5HA 4ZTZB 4XU1A 4P72A 4YROA 1BIBA 2ZIMA 3RF1A 2E64A 4YRIA 2DZCA 4PHCA 4HWTA 2DTOA 3CMQA 4J15A 2DU7A 1NNHA 3M4PA 4G84A 4OP0A 1ADYA 2CIMA 3V8JA 1SRYA 4RQFA 3LC0A 4P73C 1NYQA 2ZXFA 2EAYA 3MEYA 1YGBA 2PMFA 1SESA 1PYSA 3A7AA 2AMCA 4LNSA 3MF1A 3I7FA 2P5IA 3RGLA 3A5ZA 4RMFA 4RDXA 4CS4A 4Q6GA 2ZT7A 1EIYA 2DEQA 2ZCEA 3TEHA 4HWPA 4TQFA 2CJAA 3IALA 4YP0A 2E3CA 1W66A 4H2XA 1E1TA 4WJ4A 2DXTA 3WQZA 4BW9A 4EX5A 4YPFA 4P71A 2ARSA 1Z7MA 3HXWA 4XTWA 3VQXA 4P71C 4NCXA 1EVKA 2ALYA 1NJ5A 3BJUA 1B70A 4HA8A 11ASA 3RIRA 2DVEA 2EJFA 1X56A 3HY1A 3UGTA 3L4GB 3UH0A 4EO4A 1WYDA 3REUA 4H2UA 2ZINA 3R07A 5E3IA 3HTZA 3A31A 3RUXA 4YDQA 1QF6A 2E5AA 3L4GA 2XTIA 1USYC 4TTVA 4YRJA 4YCVA 3REXA 2E1HA 3NEMA 2ZTGA 2DTHA 2ODRD 1BBWA 2DDZA 1WU7A 2CGHA 2AKWB 3A32A 2Q7EA 1GGMA 1WPYA 4DPGA 4H2YA 1NJ1A 2QHTA 2QHVA 4CH6A 2XGTA 4XTZA 4ZIBA 5K1PA 4HWSA 2IY5A 4XEMA 4TVYA 4H2SA 2C7IA 3HRIA 3V7CA 2G4CA 3P8YA 1KOGA 1ASYA 4TVWA 4P72C 3HFZA 4WI1A 4P3OA 1PYSB 3PZCA 4KQEA 1ATIA 4TVAB 2AMCB 4E51A 5ELNA 5KNNA 3PCOA 3DSQA 4H2WA 1B7YA 2RHSA 5ELOA 2J3MA 2RHQB 4PG3A 1EIYB 4CH4A 3A74A 4O2DA 4WJ3M 3TEHB 3A7RA 4HVCA 4TVAA 1H4VB 1X01A 3M4QA 3NENA 4H2XB 2RHQA 2C8MA 4UPAA 3V8KA 1WLEA 1SETA 2DQ3A 4YRQA 2ARUA 3HXVA 4DQ2A 4XU3A 2FYKA 4P3PA 2ALYB 1B70B 12ASA 3EFSA 3V8LA 2Q7HA 4KR2A 1H4QA 2ZR3A 3HRKA 5C53B 3HXYA 1QE0A 4YRTA 5F5WA 4BWAA 4YCWA 4P3NA 1ADJA 3LSQA 2ZZFA 4ZTUB 3VQWA 3BFMA 3RKWA 1X54A 4XTXA 2DQ0A 2J3LA 2E65A 1H4SA 3QO8A 4XEOA 1EVLA 4YRCA 3W3SA 1YFRA 3FJPA 1JJCA 2ZZGA 3A7UA 2I4LA 3HXXA 3ICAA 3VQYA 2DU5A 4X5OA 4YCUA 4YRSA 3IKLA 1BIAA 1HXDA 4OLFA 2PMEA 2IY5B 2Q5HA 2DTIA 4CH5A 4RQEA 1J5WA 3NETA 4H02A 4UP8A 1YB3A 2I4MA 1BBUA 4HWRA 3HFZB 4TQDA 2I4NA 2I4OA 3QO7A 2Q5IA 1X2HA 3E9HA 3UGQA 3HXUA 4YRMA 4K86A 3V7RA 3PCOB 2QHSA 1N9WA 1B7YB 2RHSB 4K87A 4YYEA 3IG2A 2EJ9A 1B8AA 3A5YA 2EL9A 1NYRA 1E22A 1NJ2A 2ZT5A 2P0LA 3QNEA 4UP9A 3P8TA 2DKGA 4P73A 2QHUA 3L1AA 4P74A 4YRLA 2ZT6A 3IKMB 4WF2A 2Q7GA 4P74C 3LSSA
chains in the Genus database with same CATH superfamily
4CS2A 4G85A 3P8VA 4XU0A 1FYFA 3E9IA 4CH3A 4HWOA 1LYLA 1E1OA 2ZR2A 4XU2A 3G1ZA 4H2TA 1E24A 2ZGWA 1WQ7A 3ERRA 3RACA 3TUPA 1HTTA 2CJBA 1KMMA 3RKYA 3UFGA 4YRRA 1RIQA 4L87A 1JJCB 1Z7NA 4YRGA 2EWNA 4LVLA 1NJ6A 1YFTA 1YFSA 1IL2A 4K88A 2ARTA 4YREA 1EQRA 1EFWA 1L0WA 4XTYA 4CS3A 3EFRA 1C0AA 1VQZA 5K1XA 2ZZEA 2HNIA 4KR3A 1ASZA 3RKXA 4UP7A 2E10A 2ZNJA 1NJ8A 5HGQA 4YRKA 2ZIOA 3OD1A 1HC7A 2ZT8A 2ODRC 2EJGA 3NELA 1G51A 4YRFA 3QO5A 1USYA 5C52B 2CJ9A 3TEGA 1X2GA 3HXZA 4TWAA 1G5IA 4H2VA 5C51B 4YRPA 3MF2A 2DJZA 1EOVA 4P75A 3HY0A 1KMNA 1B76A 4YRNA 2ZNIA 2DZ9A 2E41A 1WQWA 3VBBA 1SERA 3HFVA 1WNLA 3L2ZA 4Q15A 3KFUA 3QTCA 4P75C 2DXUA 3RL6A 1X55A 1H4TA 3VQVA 4AH6A 3V7SA 4XTVA 4LVKA 4XTUA 2AKWA 1G5HA 4ZTZB 4XU1A 4P72A 4YROA 1BIBA 2ZIMA 3RF1A 2E64A 4YRIA 2DZCA 4PHCA 4HWTA 2DTOA 3CMQA 4J15A 2DU7A 1NNHA 3M4PA 4G84A 4OP0A 1ADYA 2CIMA 3V8JA 1SRYA 4RQFA 3LC0A 4P73C 1NYQA 2ZXFA 2EAYA 3MEYA 1YGBA 2PMFA 1SESA 1PYSA 3A7AA 2AMCA 4LNSA 4LVMA 3MF1A 3I7FA 2P5IA 3RGLA 3A5ZA 4RMFA 4RDXA 4CS4A 4Q6GA 2ZT7A 1EIYA 2DEQA 2ZCEA 3TEHA 4HWPA 4TQFA 2CJAA 3IALA 4YP0A 2E3CA 1W66A 4H2XA 1E1TA 4WJ4A 2DXTA 3WQZA 4BW9A 4EX5A 4YPFA 4P71A 2ARSA 1Z7MA 3HXWA 4XTWA 3VQXA 4P71C 4NCXA 1EVKA 2ALYA 1NJ5A 3BJUA 1B70A 4HA8A 3MQZA 11ASA 3RIRA 2DVEA 2EJFA 1X56A 3HY1A 3UGTA 3L4GB 3UH0A 4EO4A 1WYDA 3REUA 4H2UA 4HT4A 2ZINA 3R07A 5E3IA 3HTZA 3A31A 3RUXA 4YDQA 1QF6A 2E5AA 3L4GA 2XTIA 1USYC 4TTVA 4YRJA 4YCVA 3REXA 2E1HA 3NEMA 2ZTGA 2DTHA 2ODRD 1BBWA 2DDZA 1WU7A 2CGHA 2AKWB 3A32A 2Q7EA 1GGMA 1WPYA 4DPGA 4H2YA 1NJ1A 2QHTA 2QHVA 4CH6A 2XGTA 4XTZA 4ZIBA 5K1PA 4HWSA 2IY5A 4XEMA 4TVYA 4H2SA 2C7IA 3HRIA 3V7CA 2G4CA 3P8YA 1KOGA 1ASYA 4TVWA 4P72C 3HFZA 4WI1A 4P3OA 1PYSB 3PZCA 4KQEA 1ATIA 4TVAB 2AMCB 4E51A 5ELNA 5KNNA 3PCOA 3DSQA 4H2WA 1B7YA 2RHSA 5ELOA 2J3MA 2RHQB 4PG3A 1EIYB 4CH4A 3A74A 4O2DA 4LVJA 4WJ3M 3TEHB 3A7RA 4HVCA 4TVAA 1H4VB 1X01A 3M4QA 3NENA 2A8EA 4H2XB 2NS6A 2RHQA 2C8MA 4UPAA 3V8KA 1WLEA 1SETA 2DQ3A 4YRQA 2ARUA 3HXVA 4DQ2A 4XU3A 2FYKA 4P3PA 2ALYB 1B70B 12ASA 3EFSA 3V8LA 2Q7HA 4KR2A 1H4QA 2ZR3A 3HRKA 5C53B 3HXYA 1QE0A 4YRTA 5F5WA 4BWAA 4YCWA 4P3NA 1ADJA 3LSQA 2ZZFA 4ZTUB 3VQWA 3BFMA 3RKWA 1X54A 4XTXA 2DQ0A 2J3LA 2E65A 1H4SA 3QO8A 4XEOA 1EVLA 4YRCA 3W3SA 1YFRA 3FJPA 1JJCA 2ZZGA 3A7UA 2I4LA 3HXXA 3ICAA 3VQYA 2DU5A 4X5OA 4YCUA 4YRSA 3IKLA 1BIAA 1HXDA 4OLFA 2PMEA 2IY5B 2Q5HA 2DTIA 4CH5A 4RQEA 1J5WA 3NETA 4H02A 4UP8A 1YB3A 2I4MA 1BBUA 4HWRA 3HFZB 4TQDA 2I4NA 2I4OA 3QO7A 2Q5IA 1X2HA 3E9HA 3UGQA 3HXUA 4YRMA 4K86A 3V7RA 3PCOB 2QHSA 1N9WA 1B7YB 2RHSB 4K87A 4YYEA 3IG2A 2EJ9A 1B8AA 3A5YA 2EL9A 1NYRA 1E22A 1NJ2A 2ZT5A 2P0LA 3QNEA 4LVIA 4UP9A 3P8TA 2DKGA 4P73A 2QHUA 3L1AA 4P74A 4YRLA 2ZT6A 3IKMB 4WF2A 2Q7GA 4P74C 3LSSA
chains in the Genus database with same CATH topology
4CS2A 4G85A 3P8VA 4XU0A 1FYFA 3E9IA 4CH3A 4HWOA 1LYLA 1E1OA 2ZR2A 4XU2A 3G1ZA 4H2TA 1E24A 2ZGWA 1WQ7A 3ERRA 3RACA 3TUPA 1HTTA 2CJBA 1KMMA 3RKYA 3UFGA 4YRRA 1RIQA 4L87A 1JJCB 1Z7NA 4YRGA 2EWNA 4LVLA 1NJ6A 1YFTA 1YFSA 1IL2A 4K88A 2ARTA 4YREA 1EQRA 1EFWA 1L0WA 4XTYA 4CS3A 3EFRA 1C0AA 1VQZA 5K1XA 2ZZEA 2HNIA 4KR3A 1ASZA 3RKXA 4UP7A 2E10A 2ZNJA 1NJ8A 5HGQA 4YRKA 2ZIOA 3OD1A 1HC7A 2ZT8A 2ODRC 2EJGA 3NELA 1G51A 4YRFA 3QO5A 1USYA 5C52B 2CJ9A 3TEGA 1X2GA 3HXZA 4TWAA 1G5IA 4H2VA 5C51B 4YRPA 3MF2A 2DJZA 1EOVA 4P75A 3HY0A 1KMNA 1B76A 4YRNA 2ZNIA 2DZ9A 2E41A 1WQWA 3VBBA 1SERA 3HFVA 1WNLA 3L2ZA 4Q15A 3KFUA 3QTCA 4P75C 2DXUA 3RL6A 1X55A 1H4TA 3VQVA 4AH6A 3V7SA 4XTVA 4LVKA 4XTUA 2AKWA 1G5HA 4ZTZB 4XU1A 4P72A 4YROA 1BIBA 2ZIMA 3RF1A 2E64A 4YRIA 2DZCA 4PHCA 4HWTA 2DTOA 3CMQA 4J15A 2DU7A 1NNHA 3M4PA 4G84A 4OP0A 1ADYA 2CIMA 3V8JA 1SRYA 4RQFA 3LC0A 4P73C 1NYQA 2ZXFA 2EAYA 3MEYA 1YGBA 2PMFA 1SESA 1PYSA 3A7AA 2AMCA 4LNSA 4LVMA 3MF1A 3I7FA 2P5IA 3RGLA 3A5ZA 4RMFA 4RDXA 4CS4A 4Q6GA 2ZT7A 1EIYA 2DEQA 2ZCEA 3TEHA 4HWPA 4TQFA 2CJAA 3IALA 4YP0A 2E3CA 1W66A 4H2XA 1E1TA 4WJ4A 2DXTA 3WQZA 4BW9A 4EX5A 4YPFA 4P71A 2ARSA 1Z7MA 3HXWA 4XTWA 3VQXA 4P71C 4NCXA 1EVKA 2ALYA 1NJ5A 3BJUA 1B70A 4HA8A 3MQZA 11ASA 3RIRA 2DVEA 2EJFA 1X56A 3HY1A 3UGTA 3L4GB 3UH0A 4EO4A 1WYDA 3REUA 4H2UA 4HT4A 2ZINA 3R07A 5E3IA 3HTZA 3A31A 3RUXA 4YDQA 1QF6A 2E5AA 3L4GA 2XTIA 1USYC 4TTVA 4YRJA 4YCVA 3REXA 2E1HA 3NEMA 2ZTGA 2DTHA 2ODRD 1BBWA 2DDZA 1WU7A 2CGHA 2AKWB 3A32A 2Q7EA 1GGMA 1WPYA 4DPGA 4H2YA 1NJ1A 2QHTA 2QHVA 4CH6A 2XGTA 4XTZA 4ZIBA 5K1PA 4HWSA 2IY5A 4XEMA 4TVYA 4H2SA 2C7IA 3HRIA 3V7CA 2G4CA 3P8YA 1KOGA 1ASYA 4TVWA 4P72C 3HFZA 4WI1A 4P3OA 1PYSB 3PZCA 4KQEA 1ATIA 4TVAB 2AMCB 4E51A 5ELNA 5KNNA 3PCOA 3DSQA 4H2WA 1B7YA 2RHSA 5ELOA 2J3MA 2RHQB 4PG3A 1EIYB 4CH4A 3A74A 4O2DA 4LVJA 4WJ3M 3TEHB 3A7RA 4HVCA 4TVAA 1H4VB 1X01A 3M4QA 3NENA 2A8EA 4H2XB 2NS6A 2RHQA 2C8MA 4UPAA 3V8KA 1WLEA 1SETA 2DQ3A 4YRQA 2ARUA 3HXVA 4DQ2A 4XU3A 2FYKA 4P3PA 2ALYB 1B70B 12ASA 3EFSA 3V8LA 2Q7HA 4KR2A 1H4QA 2ZR3A 3HRKA 5C53B 3HXYA 1QE0A 4YRTA 5F5WA 4BWAA 4YCWA 4P3NA 1ADJA 3LSQA 2ZZFA 4ZTUB 3VQWA 3BFMA 3RKWA 1X54A 4XTXA 2DQ0A 2J3LA 2E65A 1H4SA 3QO8A 4XEOA 1EVLA 4YRCA 3W3SA 1YFRA 3FJPA 1JJCA 2ZZGA 3A7UA 2I4LA 3HXXA 3ICAA 3VQYA 2DU5A 4X5OA 4YCUA 4YRSA 3IKLA 1BIAA 1HXDA 4OLFA 2PMEA 2IY5B 2Q5HA 2DTIA 4CH5A 4RQEA 1J5WA 3NETA 4H02A 4UP8A 1YB3A 2I4MA 1BBUA 4HWRA 3HFZB 4TQDA 2I4NA 2I4OA 3QO7A 2Q5IA 1X2HA 3E9HA 3UGQA 3HXUA 4YRMA 4K86A 3V7RA 3PCOB 2QHSA 1N9WA 1B7YB 2RHSB 4K87A 4YYEA 3IG2A 2EJ9A 1B8AA 3A5YA 2EL9A 1NYRA 1E22A 1NJ2A 2ZT5A 2P0LA 3QNEA 4LVIA 4UP9A 3P8TA 2DKGA 4P73A 2QHUA 3L1AA 4P74A 4YRLA 2ZT6A 3IKMB 4WF2A 2Q7GA 4P74C 3LSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CS2 A;  4G85 A;  3P8V A;  4XU0 A;  1FYF A;  3E9I A;  4CH3 A;  4HWO A;  1LYL A;  1E1O A;  2ZR2 A;  4XU2 A;  3G1Z A;  4H2T A;  1E24 A;  2ZGW A;  1WQ7 A;  3ERR A;  3RAC A;  3TUP A;  1HTT A;  2CJB A;  1KMM A;  3RKY A;  3UFG A;  4YRR A;  1RIQ A;  4L87 A;  1JJC B;  1Z7N A;  4YRG A;  2EWN A;  1NJ6 A;  1YFT A;  1YFS A;  1IL2 A;  4K88 A;  2ART A;  4YRE A;  1EQR A;  1EFW A;  1L0W A;  4XTY A;  4CS3 A;  3EFR A;  1C0A A;  1VQZ A;  5K1X A;  2ZZE A;  2HNI A;  4KR3 A;  1ASZ A;  3RKX A;  4UP7 A;  2E10 A;  2ZNJ A;  1NJ8 A;  5HGQ A;  4YRK A;  2ZIO A;  3OD1 A;  1HC7 A;  2ZT8 A;  2ODR C;  2EJG A;  3NEL A;  1G51 A;  4YRF A;  3QO5 A;  1USY A;  5C52 B;  2CJ9 A;  3TEG A;  1X2G A;  3HXZ A;  4TWA A;  1G5I A;  4H2V A;  5C51 B;  4YRP A;  3MF2 A;  2DJZ A;  1EOV A;  4P75 A;  3HY0 A;  1KMN A;  1B76 A;  4YRN A;  2ZNI A;  2DZ9 A;  2E41 A;  1WQW A;  3VBB A;  1SER A;  3HFV A;  1WNL A;  3L2Z A;  4Q15 A;  3KFU A;  3QTC A;  4P75 C;  2DXU A;  3RL6 A;  1X55 A;  1H4T A;  3VQV A;  4AH6 A;  3V7S A;  4XTV A;  4XTU A;  2AKW A;  1G5H A;  4ZTZ B;  4XU1 A;  4P72 A;  4YRO A;  1BIB A;  2ZIM A;  3RF1 A;  2E64 A;  4YRI A;  2DZC A;  4PHC A;  4HWT A;  2DTO A;  3CMQ A;  4J15 A;  2DU7 A;  1NNH A;  3M4P A;  4G84 A;  4OP0 A;  1ADY A;  2CIM A;  3V8J A;  1SRY A;  4RQF A;  3LC0 A;  4P73 C;  1NYQ A;  2ZXF A;  2EAY A;  3MEY A;  1YGB A;  2PMF A;  1SES A;  1PYS A;  3A7A A;  2AMC A;  4LNS A;  3MF1 A;  3I7F A;  2P5I A;  3RGL A;  3A5Z A;  4RMF A;  4RDX A;  4CS4 A;  4Q6G A;  2ZT7 A;  1EIY A;  2DEQ A;  2ZCE A;  3TEH A;  4HWP A;  4TQF A;  2CJA A;  3IAL A;  4YP0 A;  2E3C A;  1W66 A;  4H2X A;  1E1T A;  4WJ4 A;  2DXT A;  3WQZ A;  4BW9 A;  4EX5 A;  4YPF A;  4P71 A;  2ARS A;  1Z7M A;  3HXW A;  4XTW A;  3VQX A;  4P71 C;  4NCX A;  1EVK A;  2ALY A;  1NJ5 A;  3BJU A;  1B70 A;  4HA8 A;  11AS A;  3RIR A;  2DVE A;  2EJF A;  1X56 A;  3HY1 A;  3UGT A;  3L4G B;  3UH0 A;  4EO4 A;  1WYD A;  3REU A;  4H2U A;  2ZIN A;  3R07 A;  5E3I A;  3HTZ A;  3A31 A;  3RUX A;  4YDQ A;  1QF6 A;  2E5A A;  3L4G A;  2XTI A;  1USY C;  4TTV A;  4YRJ A;  4YCV A;  3REX A;  2E1H A;  3NEM A;  2ZTG A;  2DTH A;  2ODR D;  1BBW A;  2DDZ A;  1WU7 A;  2CGH A;  2AKW B;  3A32 A;  2Q7E A;  1GGM A;  1WPY A;  4DPG A;  4H2Y A;  1NJ1 A;  2QHT A;  2QHV A;  4CH6 A;  2XGT A;  4XTZ A;  4ZIB A;  5K1P A;  4HWS A;  2IY5 A;  4XEM A;  4TVY A;  4H2S A;  2C7I A;  3HRI A;  3V7C A;  2G4C A;  3P8Y A;  1KOG A;  1ASY A;  4TVW A;  4P72 C;  3HFZ A;  4WI1 A;  4P3O A;  1PYS B;  3PZC A;  4KQE A;  1ATI A;  4TVA B;  2AMC B;  4E51 A;  5ELN A;  5KNN A;  3PCO A;  3DSQ A;  4H2W A;  1B7Y A;  2RHS A;  5ELO A;  2J3M A;  2RHQ B;  4PG3 A;  1EIY B;  4CH4 A;  3A74 A;  4O2D A;  4WJ3 M;  3TEH B;  3A7R A;  4HVC A;  4TVA A;  1H4V B;  1X01 A;  3M4Q A;  3NEN A;  4H2X B;  2RHQ A;  2C8M A;  4UPA A;  3V8K A;  1WLE A;  1SET A;  2DQ3 A;  4YRQ A;  2ARU A;  3HXV A;  4DQ2 A;  4XU3 A;  2FYK A;  4P3P A;  2ALY B;  1B70 B;  12AS A;  3EFS A;  3V8L A;  2Q7H A;  4KR2 A;  1H4Q A;  2ZR3 A;  3HRK A;  5C53 B;  3HXY A;  1QE0 A;  4YRT A;  5F5W A;  4BWA A;  4YCW A;  4P3N A;  1ADJ A;  3LSQ A;  2ZZF A;  4ZTU B;  3VQW A;  3BFM A;  3RKW A;  1X54 A;  4XTX A;  2DQ0 A;  2J3L A;  2E65 A;  1H4S A;  3QO8 A;  4XEO A;  1EVL A;  4YRC A;  3W3S A;  1YFR A;  3FJP A;  1JJC A;  2ZZG A;  3A7U A;  2I4L A;  3HXX A;  3ICA A;  3VQY A;  2DU5 A;  4X5O A;  4YCU A;  4YRS A;  3IKL A;  1BIA A;  1HXD A;  4OLF A;  2PME A;  2IY5 B;  2Q5H A;  2DTI A;  4CH5 A;  4RQE A;  1J5W A;  3NET A;  4H02 A;  4UP8 A;  1YB3 A;  2I4M A;  1BBU A;  4HWR A;  3HFZ B;  4TQD A;  2I4N A;  2I4O A;  3QO7 A;  2Q5I A;  1X2H A;  3E9H A;  3UGQ A;  3HXU A;  4YRM A;  4K86 A;  3V7R A;  3PCO B;  2QHS A;  1N9W A;  1B7Y B;  2RHS B;  4K87 A;  4YYE A;  3IG2 A;  2EJ9 A;  1B8A A;  3A5Y A;  2EL9 A;  1NYR A;  1E22 A;  1NJ2 A;  2ZT5 A;  2P0L A;  3QNE A;  4UP9 A;  3P8T A;  2DKG A;  4P73 A;  2QHU A;  3L1A A;  4P74 A;  4YRL A;  2ZT6 A;  3IKM B;  4WF2 A;  2Q7G A;  4P74 C;  3LSS A; 
#chains in the Genus database with same CATH topology
 4CS2 A;  4G85 A;  3P8V A;  4XU0 A;  1FYF A;  3E9I A;  4CH3 A;  4HWO A;  1LYL A;  1E1O A;  2ZR2 A;  4XU2 A;  3G1Z A;  4H2T A;  1E24 A;  2ZGW A;  1WQ7 A;  3ERR A;  3RAC A;  3TUP A;  1HTT A;  2CJB A;  1KMM A;  3RKY A;  3UFG A;  4YRR A;  1RIQ A;  4L87 A;  1JJC B;  1Z7N A;  4YRG A;  2EWN A;  4LVL A;  1NJ6 A;  1YFT A;  1YFS A;  1IL2 A;  4K88 A;  2ART A;  4YRE A;  1EQR A;  1EFW A;  1L0W A;  4XTY A;  4CS3 A;  3EFR A;  1C0A A;  1VQZ A;  5K1X A;  2ZZE A;  2HNI A;  4KR3 A;  1ASZ A;  3RKX A;  4UP7 A;  2E10 A;  2ZNJ A;  1NJ8 A;  5HGQ A;  4YRK A;  2ZIO A;  3OD1 A;  1HC7 A;  2ZT8 A;  2ODR C;  2EJG A;  3NEL A;  1G51 A;  4YRF A;  3QO5 A;  1USY A;  5C52 B;  2CJ9 A;  3TEG A;  1X2G A;  3HXZ A;  4TWA A;  1G5I A;  4H2V A;  5C51 B;  4YRP A;  3MF2 A;  2DJZ A;  1EOV A;  4P75 A;  3HY0 A;  1KMN A;  1B76 A;  4YRN A;  2ZNI A;  2DZ9 A;  2E41 A;  1WQW A;  3VBB A;  1SER A;  3HFV A;  1WNL A;  3L2Z A;  4Q15 A;  3KFU A;  3QTC A;  4P75 C;  2DXU A;  3RL6 A;  1X55 A;  1H4T A;  3VQV A;  4AH6 A;  3V7S A;  4XTV A;  4LVK A;  4XTU A;  2AKW A;  1G5H A;  4ZTZ B;  4XU1 A;  4P72 A;  4YRO A;  1BIB A;  2ZIM A;  3RF1 A;  2E64 A;  4YRI A;  2DZC A;  4PHC A;  4HWT A;  2DTO A;  3CMQ A;  4J15 A;  2DU7 A;  1NNH A;  3M4P A;  4G84 A;  4OP0 A;  1ADY A;  2CIM A;  3V8J A;  1SRY A;  4RQF A;  3LC0 A;  4P73 C;  1NYQ A;  2ZXF A;  2EAY A;  3MEY A;  1YGB A;  2PMF A;  1SES A;  1PYS A;  3A7A A;  2AMC A;  4LNS A;  4LVM A;  3MF1 A;  3I7F A;  2P5I A;  3RGL A;  3A5Z A;  4RMF A;  4RDX A;  4CS4 A;  4Q6G A;  2ZT7 A;  1EIY A;  2DEQ A;  2ZCE A;  3TEH A;  4HWP A;  4TQF A;  2CJA A;  3IAL A;  4YP0 A;  2E3C A;  1W66 A;  4H2X A;  1E1T A;  4WJ4 A;  2DXT A;  3WQZ A;  4BW9 A;  4EX5 A;  4YPF A;  4P71 A;  2ARS A;  1Z7M A;  3HXW A;  4XTW A;  3VQX A;  4P71 C;  4NCX A;  1EVK A;  2ALY A;  1NJ5 A;  3BJU A;  1B70 A;  4HA8 A;  3MQZ A;  11AS A;  3RIR A;  2DVE A;  2EJF A;  1X56 A;  3HY1 A;  3UGT A;  3L4G B;  3UH0 A;  4EO4 A;  1WYD A;  3REU A;  4H2U A;  4HT4 A;  2ZIN A;  3R07 A;  5E3I A;  3HTZ A;  3A31 A;  3RUX A;  4YDQ A;  1QF6 A;  2E5A A;  3L4G A;  2XTI A;  1USY C;  4TTV A;  4YRJ A;  4YCV A;  3REX A;  2E1H A;  3NEM A;  2ZTG A;  2DTH A;  2ODR D;  1BBW A;  2DDZ A;  1WU7 A;  2CGH A;  2AKW B;  3A32 A;  2Q7E A;  1GGM A;  1WPY A;  4DPG A;  4H2Y A;  1NJ1 A;  2QHT A;  2QHV A;  4CH6 A;  2XGT A;  4XTZ A;  4ZIB A;  5K1P A;  4HWS A;  2IY5 A;  4XEM A;  4TVY A;  4H2S A;  2C7I A;  3HRI A;  3V7C A;  2G4C A;  3P8Y A;  1KOG A;  1ASY A;  4TVW A;  4P72 C;  3HFZ A;  4WI1 A;  4P3O A;  1PYS B;  3PZC A;  4KQE A;  1ATI A;  4TVA B;  2AMC B;  4E51 A;  5ELN A;  5KNN A;  3PCO A;  3DSQ A;  4H2W A;  1B7Y A;  2RHS A;  5ELO A;  2J3M A;  2RHQ B;  4PG3 A;  1EIY B;  4CH4 A;  3A74 A;  4O2D A;  4LVJ A;  4WJ3 M;  3TEH B;  3A7R A;  4HVC A;  4TVA A;  1H4V B;  1X01 A;  3M4Q A;  3NEN A;  2A8E A;  4H2X B;  2NS6 A;  2RHQ A;  2C8M A;  4UPA A;  3V8K A;  1WLE A;  1SET A;  2DQ3 A;  4YRQ A;  2ARU A;  3HXV A;  4DQ2 A;  4XU3 A;  2FYK A;  4P3P A;  2ALY B;  1B70 B;  12AS A;  3EFS A;  3V8L A;  2Q7H A;  4KR2 A;  1H4Q A;  2ZR3 A;  3HRK A;  5C53 B;  3HXY A;  1QE0 A;  4YRT A;  5F5W A;  4BWA A;  4YCW A;  4P3N A;  1ADJ A;  3LSQ A;  2ZZF A;  4ZTU B;  3VQW A;  3BFM A;  3RKW A;  1X54 A;  4XTX A;  2DQ0 A;  2J3L A;  2E65 A;  1H4S A;  3QO8 A;  4XEO A;  1EVL A;  4YRC A;  3W3S A;  1YFR A;  3FJP A;  1JJC A;  2ZZG A;  3A7U A;  2I4L A;  3HXX A;  3ICA A;  3VQY A;  2DU5 A;  4X5O A;  4YCU A;  4YRS A;  3IKL A;  1BIA A;  1HXD A;  4OLF A;  2PME A;  2IY5 B;  2Q5H A;  2DTI A;  4CH5 A;  4RQE A;  1J5W A;  3NET A;  4H02 A;  4UP8 A;  1YB3 A;  2I4M A;  1BBU A;  4HWR A;  3HFZ B;  4TQD A;  2I4N A;  2I4O A;  3QO7 A;  2Q5I A;  1X2H A;  3E9H A;  3UGQ A;  3HXU A;  4YRM A;  4K86 A;  3V7R A;  3PCO B;  2QHS A;  1N9W A;  1B7Y B;  2RHS B;  4K87 A;  4YYE A;  3IG2 A;  2EJ9 A;  1B8A A;  3A5Y A;  2EL9 A;  1NYR A;  1E22 A;  1NJ2 A;  2ZT5 A;  2P0L A;  3QNE A;  4LVI A;  4UP9 A;  3P8T A;  2DKG A;  4P73 A;  2QHU A;  3L1A A;  4P74 A;  4YRL A;  2ZT6 A;  3IKM B;  4WF2 A;  2Q7G A;  4P74 C;  3LSS A; 
#chains in the Genus database with same CATH homology
 4CS2 A;  4G85 A;  3P8V A;  4XU0 A;  1FYF A;  3E9I A;  4CH3 A;  4HWO A;  1LYL A;  1E1O A;  2ZR2 A;  4XU2 A;  3G1Z A;  4H2T A;  1E24 A;  2ZGW A;  1WQ7 A;  3ERR A;  3RAC A;  3TUP A;  1HTT A;  2CJB A;  1KMM A;  3RKY A;  3UFG A;  4YRR A;  1RIQ A;  4L87 A;  1JJC B;  1Z7N A;  4YRG A;  2EWN A;  4LVL A;  1NJ6 A;  1YFT A;  1YFS A;  1IL2 A;  4K88 A;  2ART A;  4YRE A;  1EQR A;  1EFW A;  1L0W A;  4XTY A;  4CS3 A;  3EFR A;  1C0A A;  1VQZ A;  5K1X A;  2ZZE A;  2HNI A;  4KR3 A;  1ASZ A;  3RKX A;  4UP7 A;  2E10 A;  2ZNJ A;  1NJ8 A;  5HGQ A;  4YRK A;  2ZIO A;  3OD1 A;  1HC7 A;  2ZT8 A;  2ODR C;  2EJG A;  3NEL A;  1G51 A;  4YRF A;  3QO5 A;  1USY A;  5C52 B;  2CJ9 A;  3TEG A;  1X2G A;  3HXZ A;  4TWA A;  1G5I A;  4H2V A;  5C51 B;  4YRP A;  3MF2 A;  2DJZ A;  1EOV A;  4P75 A;  3HY0 A;  1KMN A;  1B76 A;  4YRN A;  2ZNI A;  2DZ9 A;  2E41 A;  1WQW A;  3VBB A;  1SER A;  3HFV A;  1WNL A;  3L2Z A;  4Q15 A;  3KFU A;  3QTC A;  4P75 C;  2DXU A;  3RL6 A;  1X55 A;  1H4T A;  3VQV A;  4AH6 A;  3V7S A;  4XTV A;  4LVK A;  4XTU A;  2AKW A;  1G5H A;  4ZTZ B;  4XU1 A;  4P72 A;  4YRO A;  1BIB A;  2ZIM A;  3RF1 A;  2E64 A;  4YRI A;  2DZC A;  4PHC A;  4HWT A;  2DTO A;  3CMQ A;  4J15 A;  2DU7 A;  1NNH A;  3M4P A;  4G84 A;  4OP0 A;  1ADY A;  2CIM A;  3V8J A;  1SRY A;  4RQF A;  3LC0 A;  4P73 C;  1NYQ A;  2ZXF A;  2EAY A;  3MEY A;  1YGB A;  2PMF A;  1SES A;  1PYS A;  3A7A A;  2AMC A;  4LNS A;  4LVM A;  3MF1 A;  3I7F A;  2P5I A;  3RGL A;  3A5Z A;  4RMF A;  4RDX A;  4CS4 A;  4Q6G A;  2ZT7 A;  1EIY A;  2DEQ A;  2ZCE A;  3TEH A;  4HWP A;  4TQF A;  2CJA A;  3IAL A;  4YP0 A;  2E3C A;  1W66 A;  4H2X A;  1E1T A;  4WJ4 A;  2DXT A;  3WQZ A;  4BW9 A;  4EX5 A;  4YPF A;  4P71 A;  2ARS A;  1Z7M A;  3HXW A;  4XTW A;  3VQX A;  4P71 C;  4NCX A;  1EVK A;  2ALY A;  1NJ5 A;  3BJU A;  1B70 A;  4HA8 A;  3MQZ A;  11AS A;  3RIR A;  2DVE A;  2EJF A;  1X56 A;  3HY1 A;  3UGT A;  3L4G B;  3UH0 A;  4EO4 A;  1WYD A;  3REU A;  4H2U A;  4HT4 A;  2ZIN A;  3R07 A;  5E3I A;  3HTZ A;  3A31 A;  3RUX A;  4YDQ A;  1QF6 A;  2E5A A;  3L4G A;  2XTI A;  1USY C;  4TTV A;  4YRJ A;  4YCV A;  3REX A;  2E1H A;  3NEM A;  2ZTG A;  2DTH A;  2ODR D;  1BBW A;  2DDZ A;  1WU7 A;  2CGH A;  2AKW B;  3A32 A;  2Q7E A;  1GGM A;  1WPY A;  4DPG A;  4H2Y A;  1NJ1 A;  2QHT A;  2QHV A;  4CH6 A;  2XGT A;  4XTZ A;  4ZIB A;  5K1P A;  4HWS A;  2IY5 A;  4XEM A;  4TVY A;  4H2S A;  2C7I A;  3HRI A;  3V7C A;  2G4C A;  3P8Y A;  1KOG A;  1ASY A;  4TVW A;  4P72 C;  3HFZ A;  4WI1 A;  4P3O A;  1PYS B;  3PZC A;  4KQE A;  1ATI A;  4TVA B;  2AMC B;  4E51 A;  5ELN A;  5KNN A;  3PCO A;  3DSQ A;  4H2W A;  1B7Y A;  2RHS A;  5ELO A;  2J3M A;  2RHQ B;  4PG3 A;  1EIY B;  4CH4 A;  3A74 A;  4O2D A;  4LVJ A;  4WJ3 M;  3TEH B;  3A7R A;  4HVC A;  4TVA A;  1H4V B;  1X01 A;  3M4Q A;  3NEN A;  2A8E A;  4H2X B;  2NS6 A;  2RHQ A;  2C8M A;  4UPA A;  3V8K A;  1WLE A;  1SET A;  2DQ3 A;  4YRQ A;  2ARU A;  3HXV A;  4DQ2 A;  4XU3 A;  2FYK A;  4P3P A;  2ALY B;  1B70 B;  12AS A;  3EFS A;  3V8L A;  2Q7H A;  4KR2 A;  1H4Q A;  2ZR3 A;  3HRK A;  5C53 B;  3HXY A;  1QE0 A;  4YRT A;  5F5W A;  4BWA A;  4YCW A;  4P3N A;  1ADJ A;  3LSQ A;  2ZZF A;  4ZTU B;  3VQW A;  3BFM A;  3RKW A;  1X54 A;  4XTX A;  2DQ0 A;  2J3L A;  2E65 A;  1H4S A;  3QO8 A;  4XEO A;  1EVL A;  4YRC A;  3W3S A;  1YFR A;  3FJP A;  1JJC A;  2ZZG A;  3A7U A;  2I4L A;  3HXX A;  3ICA A;  3VQY A;  2DU5 A;  4X5O A;  4YCU A;  4YRS A;  3IKL A;  1BIA A;  1HXD A;  4OLF A;  2PME A;  2IY5 B;  2Q5H A;  2DTI A;  4CH5 A;  4RQE A;  1J5W A;  3NET A;  4H02 A;  4UP8 A;  1YB3 A;  2I4M A;  1BBU A;  4HWR A;  3HFZ B;  4TQD A;  2I4N A;  2I4O A;  3QO7 A;  2Q5I A;  1X2H A;  3E9H A;  3UGQ A;  3HXU A;  4YRM A;  4K86 A;  3V7R A;  3PCO B;  2QHS A;  1N9W A;  1B7Y B;  2RHS B;  4K87 A;  4YYE A;  3IG2 A;  2EJ9 A;  1B8A A;  3A5Y A;  2EL9 A;  1NYR A;  1E22 A;  1NJ2 A;  2ZT5 A;  2P0L A;  3QNE A;  4LVI A;  4UP9 A;  3P8T A;  2DKG A;  4P73 A;  2QHU A;  3L1A A;  4P74 A;  4YRL A;  2ZT6 A;  3IKM B;  4WF2 A;  2Q7G A;  4P74 C;  3LSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...