3ICAA

The crystal structure of the beta subunit of a phenylalanyl-trna synthetase from porphyromonas gingivalis w83
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
212
structure length
205
Chain Sequence
NADRRYKWQTVVSEQLVGAGFNEILNNSLTAGSYYEGLKSHPREMAVELMNPLSQELNCMRQTLLFGGLETLSHNLRRKHLSLYLFEWGKCYRFHAAKRETPLAAYAEDDRLGIWICGQRVHPEEPTSVFELKAVVEQVLCRVGIETGAYTLKTADNDLYASAMEVKTRSGKLLGTFGTVSTELIKRFEIEQPVYFAELLWDALM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the beta subunit of a phenylalanyl-tRNA synthetase from Porphyromonas gingivalis W83
rcsb
source organism Porphyromonas gingivalis
molecule tags Ligase
molecule keywords Phenylalanyl-tRNA synthetase beta chain
total genus 55
structure length 205
sequence length 212
chains with identical sequence B
ec nomenclature ec 6.1.1.20: Phenylalanine--tRNA ligase.
pdb deposition date 2009-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3icaA00
3REXA 2E10A 4CS3A 2E5AA 3ERRA 4UP8A 3NENA 4YDQA 2DZCA 1YFSA 1IL2A 4TQDA 3VQVA 1EFWA 4LNSA 2RHQA 2DU5A 3HFZA 2Q7HA 4O2DA 2DTOA 5C52B 2Q7EA 1ADJA 1X56A 3PZCA 4XU3A 3WQZA 3HXWA 4P3OA 3IALA 4YRGA 5KNNA 2ZT7A 4BW9A 2Q7GA 3A74A 1X55A 4XTVA 3HXUA 4YRNA 2P5IA 3BJUA 4YCVA 3EFRA 4YRMA 4RDXA 1USYC 3HFVA 3V8JA 3P8YA 3UGTA 3MF2A 2E65A 4YRTA 5HGQA 3HXVA 1YB3A 1EIYB 4YRCA 2XTIA 4P71C 1EVLA 3CMQA 1G5HA 1B76A 3P8VA 1KMMA 4PG3A 2RHSA 2ARTA 1ASYA 2AMCA 1NYQA 2ZZFA 1QF6A 3HY0A 4UP7A 4HWSA 2ZZGA 4CH4A 1BBWA 2CJ9A 2DZ9A 2RHSB 4CS2A 2E3CA 2ZT5A 4X5OA 3QTCA 1JJCA 2ZT6A 4DPGA 4H2XA 4WJ4A 1WQWA 4PHCA 3NETA 1HC7A 1RIQA 1NJ5A 1HXDA 4H2UA 3NELA 4KR2A 4XTUA 2I4OA 3ICAA 4CH5A 1SETA 1C0AA 2G4CA 2DQ3A 2CIMA 3L4GA 2EJ9A 1EVKA 2ZCEA 3V7SA 2Q5IA 1B70A 2Q5HA 4CH6A 3P8TA 2DXTA 1X01A 1SRYA 1EOVA 4P3NA 4XU0A 1PYSA 3RACA 1WNLA 3HFZB 4YRQA 1USYA 4BWAA 1YFRA 3OD1A 4ZTUB 4OLFA 4KR3A 4K86A 3TUPA 1WQ7A 3PCOA 4YYEA 4TVYA 2E1HA 1SERA 3IKLA 4P75A 4XU1A 2ZT8A 3HTZA 2DEQA 1KOGA 4XTWA 1VQZA 1E22A 4K88A 4YRJA 3REUA 1WYDA 1KMNA 3KFUA 3L1AA 4YRIA 4HA8A 3E9IA 4HWOA 2E64A 1ATIA 4H2TA 2DQ0A 5K1PA 1YFTA 2E41A 3RUXA 1LYLA 1E24A 4HVCA 4H2WA 4UPAA 4H2SA 2ZXFA 2C8MA 1Z7MA 1GGMA 1X54A 3LC0A 4YRFA 3HXZA 1WLEA 3VBBA 2DTHA 1E1OA 2CGHA 3MEYA 5ELOA 4H2XB 3V7RA 1NNHA 1H4SA 4UP9A 2PMFA 4P74A 2DU7A 2P0LA 3HRKA 3A5YA 3A5ZA 4YRKA 2J3MA 4NCXA 4XTZA 3UFGA 3R07A 2IY5A 4RQFA 2DKGA 4P75C 4YRPA 4P73A 1BBUA 3V8LA 4CH3A 2EAYA 1PYSB 1SESA 2AKWB 4TTVA 2EJGA 1H4VB 4H2VA 2ZTGA 4J15A 1B8AA 3RGLA 2IY5B 1QE0A 5E3IA 2DDZA 2PMEA 4L87A 4TWAA 4Q6GA 4YREA 3PCOB 4YRRA 1X2HA 3VQYA 4YP0A 4ZTZB 2QHVA 2ZIMA 3QNEA 2ZNIA 4OP0A 4ZIBA 5C51B 4WI1A 2ARSA 1NJ1A 3EFSA 3V8KA 4H2YA 4K87A 3A7RA 3LSSA 3M4QA 2ODRD 1BIAA 1W66A 4Q15A 1NJ8A 2DTIA 3FJPA 3A7AA 4TVWA 2AMCB 3TEGA 4DQ2A 2DVEA 4P73C 4XTXA 5ELNA 3W3SA 4H02A 3UGQA 4HWRA 3RL6A 2RHQB 4XTYA 2EJFA 4XU2A 11ASA 3IG2A 2ARUA 3A32A 4P74C 2ZR3A 3TEHA 2EL9A 2C7IA 1B7YA 2CJAA 2XGTA 1H4QA 3E9HA 2ZR2A 2CJBA 4WF2A 2ALYB 3BFMA 2HNIA 1E1TA 3HXYA 2ZIOA 3I7FA 4EX5A 3VQWA 1WPYA 1EQRA 1B70B 1J5WA 3LSQA 1G51A 4YRLA 2I4MA 3L4GB 3M4PA 3RKYA 1N9WA 4P72C 1HTTA 5K1XA 2QHTA 1NJ6A 4E51A 2ZINA 4YCUA 1ADYA 2J3LA 2AKWA 4WJ3M 2DXUA 4YROA 4CS4A 2EWNA 3DSQA 4EO4A 3TEHB 3HY1A 1EIYA 4XEMA 4HWPA 4HWTA 4TQFA 2ALYA 1FYFA 1G5IA 1BIBA 1B7YB 4KQEA 3HXXA 3NEMA 3VQXA 1WU7A 2ZGWA 4P71A 3V7CA 1NJ2A 4TVAB 1L0WA 1X2GA 2I4LA 4AH6A 3HRIA 3RF1A 5C53B 5F5WA 2FYKA 3MF1A 2ODRC 4P72A 3IKMB 3A7UA 3RKXA 4XEOA 1Z7NA 3L2ZA 4RMFA 2ZNJA 1NYRA 3G1ZA 3RIRA 2QHUA 1JJCB 2QHSA 3QO5A 4P3PA 3QO7A 1YGBA 4YRSA 3RKWA 3A31A 3UH0A 4RQEA 1H4TA 1ASZA 2I4NA 4G85A 12ASA 3QO8A 4G84A 4TVAA 4YPFA 2DJZA 2ZZEA 4YCWA
chains in the Genus database with same CATH superfamily
3REXA 2E10A 4CS3A 2E5AA 3ERRA 4UP8A 3NENA 4YDQA 2DZCA 1YFSA 1IL2A 4LVLA 4TQDA 3VQVA 1EFWA 4LNSA 2RHQA 2DU5A 3HFZA 2Q7HA 4O2DA 2DTOA 5C52B 2Q7EA 1ADJA 1X56A 3PZCA 4XU3A 3WQZA 3HXWA 4P3OA 3IALA 4YRGA 5KNNA 2ZT7A 4BW9A 2Q7GA 3A74A 1X55A 4XTVA 3HXUA 4YRNA 2P5IA 3BJUA 4YCVA 3EFRA 4YRMA 4RDXA 1USYC 3HFVA 3V8JA 3P8YA 2NS6A 3UGTA 3MF2A 2E65A 4YRTA 5HGQA 3HXVA 1YB3A 1EIYB 4YRCA 2XTIA 4P71C 1EVLA 3CMQA 1G5HA 1B76A 3P8VA 1KMMA 4PG3A 2RHSA 2ARTA 1ASYA 2AMCA 1NYQA 2ZZFA 1QF6A 3HY0A 4UP7A 4HWSA 2ZZGA 4CH4A 1BBWA 2CJ9A 2DZ9A 2RHSB 4CS2A 2E3CA 4LVMA 2ZT5A 4X5OA 3QTCA 1JJCA 2ZT6A 4DPGA 4H2XA 4WJ4A 1WQWA 4PHCA 3NETA 1HC7A 1RIQA 1NJ5A 3MQZA 1HXDA 4H2UA 3NELA 4KR2A 4XTUA 2I4OA 3ICAA 4CH5A 1SETA 1C0AA 2G4CA 2DQ3A 2CIMA 3L4GA 2EJ9A 1EVKA 2ZCEA 3V7SA 2Q5IA 1B70A 2Q5HA 4CH6A 3P8TA 2DXTA 1X01A 1SRYA 1EOVA 4P3NA 4XU0A 1PYSA 3RACA 1WNLA 3HFZB 4YRQA 1USYA 4BWAA 1YFRA 3OD1A 4ZTUB 4OLFA 4KR3A 4K86A 3TUPA 1WQ7A 3PCOA 4YYEA 4TVYA 2E1HA 1SERA 3IKLA 4P75A 4XU1A 2ZT8A 3HTZA 2DEQA 1KOGA 4XTWA 1VQZA 1E22A 4K88A 4YRJA 3REUA 1WYDA 1KMNA 3KFUA 3L1AA 4YRIA 4HA8A 3E9IA 4HWOA 2E64A 1ATIA 4H2TA 2DQ0A 5K1PA 1YFTA 2E41A 3RUXA 1LYLA 1E24A 4HVCA 4H2WA 4UPAA 4H2SA 2ZXFA 2C8MA 1Z7MA 1GGMA 1X54A 3LC0A 4YRFA 3HXZA 1WLEA 3VBBA 2DTHA 1E1OA 2CGHA 3MEYA 4LVJA 5ELOA 4H2XB 3V7RA 1NNHA 1H4SA 4UP9A 2PMFA 4P74A 2DU7A 2P0LA 3HRKA 3A5YA 3A5ZA 4YRKA 2J3MA 4NCXA 4XTZA 3UFGA 3R07A 2IY5A 4RQFA 2DKGA 4P75C 4YRPA 4P73A 1BBUA 3V8LA 4CH3A 2EAYA 1PYSB 1SESA 2AKWB 4TTVA 2EJGA 1H4VB 4H2VA 2ZTGA 4J15A 4LVIA 1B8AA 3RGLA 2IY5B 1QE0A 5E3IA 2DDZA 2PMEA 4L87A 4TWAA 4Q6GA 4YREA 3PCOB 4YRRA 1X2HA 3VQYA 4YP0A 4ZTZB 2QHVA 2ZIMA 3QNEA 2ZNIA 4OP0A 4ZIBA 5C51B 4WI1A 2ARSA 1NJ1A 3EFSA 3V8KA 4H2YA 4K87A 3A7RA 3LSSA 3M4QA 2ODRD 1BIAA 4HT4A 1W66A 4Q15A 1NJ8A 2DTIA 3FJPA 3A7AA 4TVWA 2AMCB 4LVKA 3TEGA 4DQ2A 2DVEA 4P73C 4XTXA 5ELNA 3W3SA 4H02A 3UGQA 4HWRA 3RL6A 2RHQB 4XTYA 2EJFA 4XU2A 11ASA 3IG2A 2ARUA 3A32A 4P74C 2ZR3A 3TEHA 2EL9A 2C7IA 1B7YA 2CJAA 2XGTA 1H4QA 3E9HA 2ZR2A 2CJBA 4WF2A 2ALYB 3BFMA 2HNIA 1E1TA 3HXYA 2ZIOA 3I7FA 4EX5A 3VQWA 1WPYA 1EQRA 1B70B 1J5WA 3LSQA 1G51A 4YRLA 2I4MA 3L4GB 3M4PA 3RKYA 1N9WA 4P72C 1HTTA 5K1XA 2QHTA 1NJ6A 4E51A 2ZINA 4YCUA 1ADYA 2J3LA 2AKWA 4WJ3M 2DXUA 4YROA 4CS4A 2EWNA 3DSQA 4EO4A 3TEHB 3HY1A 1EIYA 4XEMA 4HWPA 4HWTA 4TQFA 2ALYA 1FYFA 1G5IA 1BIBA 1B7YB 4KQEA 3HXXA 3NEMA 3VQXA 1WU7A 2ZGWA 4P71A 3V7CA 1NJ2A 4TVAB 1L0WA 1X2GA 2I4LA 4AH6A 3HRIA 3RF1A 5C53B 5F5WA 2FYKA 3MF1A 2ODRC 4P72A 3IKMB 3A7UA 3RKXA 4XEOA 1Z7NA 3L2ZA 4RMFA 2ZNJA 1NYRA 3G1ZA 2A8EA 3RIRA 2QHUA 1JJCB 2QHSA 3QO5A 4P3PA 3QO7A 1YGBA 4YRSA 3RKWA 3A31A 3UH0A 4RQEA 1H4TA 1ASZA 2I4NA 4G85A 12ASA 3QO8A 4G84A 4TVAA 4YPFA 2DJZA 2ZZEA 4YCWA
chains in the Genus database with same CATH topology
3REXA 2E10A 4CS3A 2E5AA 3ERRA 4UP8A 3NENA 4YDQA 2DZCA 1YFSA 1IL2A 4LVLA 4TQDA 3VQVA 1EFWA 4LNSA 2RHQA 2DU5A 3HFZA 2Q7HA 4O2DA 2DTOA 5C52B 2Q7EA 1ADJA 1X56A 3PZCA 4XU3A 3WQZA 3HXWA 4P3OA 3IALA 4YRGA 5KNNA 2ZT7A 4BW9A 2Q7GA 3A74A 1X55A 4XTVA 3HXUA 4YRNA 2P5IA 3BJUA 4YCVA 3EFRA 4YRMA 4RDXA 1USYC 3HFVA 3V8JA 3P8YA 2NS6A 3UGTA 3MF2A 2E65A 4YRTA 5HGQA 3HXVA 1YB3A 1EIYB 4YRCA 2XTIA 4P71C 1EVLA 3CMQA 1G5HA 1B76A 3P8VA 1KMMA 4PG3A 2RHSA 2ARTA 1ASYA 2AMCA 1NYQA 2ZZFA 1QF6A 3HY0A 4UP7A 4HWSA 2ZZGA 4CH4A 1BBWA 2CJ9A 2DZ9A 2RHSB 4CS2A 2E3CA 4LVMA 2ZT5A 4X5OA 3QTCA 1JJCA 2ZT6A 4DPGA 4H2XA 4WJ4A 1WQWA 4PHCA 3NETA 1HC7A 1RIQA 1NJ5A 3MQZA 1HXDA 4H2UA 3NELA 4KR2A 4XTUA 2I4OA 3ICAA 4CH5A 1SETA 1C0AA 2G4CA 2DQ3A 2CIMA 3L4GA 2EJ9A 1EVKA 2ZCEA 3V7SA 2Q5IA 1B70A 2Q5HA 4CH6A 3P8TA 2DXTA 1X01A 1SRYA 1EOVA 4P3NA 4XU0A 1PYSA 3RACA 1WNLA 3HFZB 4YRQA 1USYA 4BWAA 1YFRA 3OD1A 4ZTUB 4OLFA 4KR3A 4K86A 3TUPA 1WQ7A 3PCOA 4YYEA 4TVYA 2E1HA 1SERA 3IKLA 4P75A 4XU1A 2ZT8A 3HTZA 2DEQA 1KOGA 4XTWA 1VQZA 1E22A 4K88A 4YRJA 3REUA 1WYDA 1KMNA 3KFUA 3L1AA 4YRIA 4HA8A 3E9IA 4HWOA 2E64A 1ATIA 4H2TA 2DQ0A 5K1PA 1YFTA 2E41A 3RUXA 1LYLA 1E24A 4HVCA 4H2WA 4UPAA 4H2SA 2ZXFA 2C8MA 1Z7MA 1GGMA 1X54A 3LC0A 4YRFA 3HXZA 1WLEA 3VBBA 2DTHA 1E1OA 2CGHA 3MEYA 4LVJA 5ELOA 4H2XB 3V7RA 1NNHA 1H4SA 4UP9A 2PMFA 4P74A 2DU7A 2P0LA 3HRKA 3A5YA 3A5ZA 4YRKA 2J3MA 4NCXA 4XTZA 3UFGA 3R07A 2IY5A 4RQFA 2DKGA 4P75C 4YRPA 4P73A 1BBUA 3V8LA 4CH3A 2EAYA 1PYSB 1SESA 2AKWB 4TTVA 2EJGA 1H4VB 4H2VA 2ZTGA 4J15A 4LVIA 1B8AA 3RGLA 2IY5B 1QE0A 5E3IA 2DDZA 2PMEA 4L87A 4TWAA 4Q6GA 4YREA 3PCOB 4YRRA 1X2HA 3VQYA 4YP0A 4ZTZB 2QHVA 2ZIMA 3QNEA 2ZNIA 4OP0A 4ZIBA 5C51B 4WI1A 2ARSA 1NJ1A 3EFSA 3V8KA 4H2YA 4K87A 3A7RA 3LSSA 3M4QA 2ODRD 1BIAA 4HT4A 1W66A 4Q15A 1NJ8A 2DTIA 3FJPA 3A7AA 4TVWA 2AMCB 4LVKA 3TEGA 4DQ2A 2DVEA 4P73C 4XTXA 5ELNA 3W3SA 4H02A 3UGQA 4HWRA 3RL6A 2RHQB 4XTYA 2EJFA 4XU2A 11ASA 3IG2A 2ARUA 3A32A 4P74C 2ZR3A 3TEHA 2EL9A 2C7IA 1B7YA 2CJAA 2XGTA 1H4QA 3E9HA 2ZR2A 2CJBA 4WF2A 2ALYB 3BFMA 2HNIA 1E1TA 3HXYA 2ZIOA 3I7FA 4EX5A 3VQWA 1WPYA 1EQRA 1B70B 1J5WA 3LSQA 1G51A 4YRLA 2I4MA 3L4GB 3M4PA 3RKYA 1N9WA 4P72C 1HTTA 5K1XA 2QHTA 1NJ6A 4E51A 2ZINA 4YCUA 1ADYA 2J3LA 2AKWA 4WJ3M 2DXUA 4YROA 4CS4A 2EWNA 3DSQA 4EO4A 3TEHB 3HY1A 1EIYA 4XEMA 4HWPA 4HWTA 4TQFA 2ALYA 1FYFA 1G5IA 1BIBA 1B7YB 4KQEA 3HXXA 3NEMA 3VQXA 1WU7A 2ZGWA 4P71A 3V7CA 1NJ2A 4TVAB 1L0WA 1X2GA 2I4LA 4AH6A 3HRIA 3RF1A 5C53B 5F5WA 2FYKA 3MF1A 2ODRC 4P72A 3IKMB 3A7UA 3RKXA 4XEOA 1Z7NA 3L2ZA 4RMFA 2ZNJA 1NYRA 3G1ZA 2A8EA 3RIRA 2QHUA 1JJCB 2QHSA 3QO5A 4P3PA 3QO7A 1YGBA 4YRSA 3RKWA 3A31A 3UH0A 4RQEA 1H4TA 1ASZA 2I4NA 4G85A 12ASA 3QO8A 4G84A 4TVAA 4YPFA 2DJZA 2ZZEA 4YCWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REX A;  2E10 A;  4CS3 A;  2E5A A;  3ERR A;  4UP8 A;  3NEN A;  4YDQ A;  2DZC A;  1YFS A;  1IL2 A;  4TQD A;  3VQV A;  1EFW A;  4LNS A;  2RHQ A;  2DU5 A;  3HFZ A;  2Q7H A;  4O2D A;  2DTO A;  5C52 B;  2Q7E A;  1ADJ A;  1X56 A;  3PZC A;  4XU3 A;  3WQZ A;  3HXW A;  4P3O A;  3IAL A;  4YRG A;  5KNN A;  2ZT7 A;  4BW9 A;  2Q7G A;  3A74 A;  1X55 A;  4XTV A;  3HXU A;  4YRN A;  2P5I A;  3BJU A;  4YCV A;  3EFR A;  4YRM A;  4RDX A;  1USY C;  3HFV A;  3V8J A;  3P8Y A;  3UGT A;  3MF2 A;  2E65 A;  4YRT A;  5HGQ A;  3HXV A;  1YB3 A;  1EIY B;  4YRC A;  2XTI A;  4P71 C;  1EVL A;  3CMQ A;  1G5H A;  1B76 A;  3P8V A;  1KMM A;  4PG3 A;  2RHS A;  2ART A;  1ASY A;  2AMC A;  1NYQ A;  2ZZF A;  1QF6 A;  3HY0 A;  4UP7 A;  4HWS A;  2ZZG A;  4CH4 A;  1BBW A;  2CJ9 A;  2DZ9 A;  2RHS B;  4CS2 A;  2E3C A;  2ZT5 A;  4X5O A;  3QTC A;  1JJC A;  2ZT6 A;  4DPG A;  4H2X A;  4WJ4 A;  1WQW A;  4PHC A;  3NET A;  1HC7 A;  1RIQ A;  1NJ5 A;  1HXD A;  4H2U A;  3NEL A;  4KR2 A;  4XTU A;  2I4O A;  3ICA A;  4CH5 A;  1SET A;  1C0A A;  2G4C A;  2DQ3 A;  2CIM A;  3L4G A;  2EJ9 A;  1EVK A;  2ZCE A;  3V7S A;  2Q5I A;  1B70 A;  2Q5H A;  4CH6 A;  3P8T A;  2DXT A;  1X01 A;  1SRY A;  1EOV A;  4P3N A;  4XU0 A;  1PYS A;  3RAC A;  1WNL A;  3HFZ B;  4YRQ A;  1USY A;  4BWA A;  1YFR A;  3OD1 A;  4ZTU B;  4OLF A;  4KR3 A;  4K86 A;  3TUP A;  1WQ7 A;  3PCO A;  4YYE A;  4TVY A;  2E1H A;  1SER A;  3IKL A;  4P75 A;  4XU1 A;  2ZT8 A;  3HTZ A;  2DEQ A;  1KOG A;  4XTW A;  1VQZ A;  1E22 A;  4K88 A;  4YRJ A;  3REU A;  1WYD A;  1KMN A;  3KFU A;  3L1A A;  4YRI A;  4HA8 A;  3E9I A;  4HWO A;  2E64 A;  1ATI A;  4H2T A;  2DQ0 A;  5K1P A;  1YFT A;  2E41 A;  3RUX A;  1LYL A;  1E24 A;  4HVC A;  4H2W A;  4UPA A;  4H2S A;  2ZXF A;  2C8M A;  1Z7M A;  1GGM A;  1X54 A;  3LC0 A;  4YRF A;  3HXZ A;  1WLE A;  3VBB A;  2DTH A;  1E1O A;  2CGH A;  3MEY A;  5ELO A;  4H2X B;  3V7R A;  1NNH A;  1H4S A;  4UP9 A;  2PMF A;  4P74 A;  2DU7 A;  2P0L A;  3HRK A;  3A5Y A;  3A5Z A;  4YRK A;  2J3M A;  4NCX A;  4XTZ A;  3UFG A;  3R07 A;  2IY5 A;  4RQF A;  2DKG A;  4P75 C;  4YRP A;  4P73 A;  1BBU A;  3V8L A;  4CH3 A;  2EAY A;  1PYS B;  1SES A;  2AKW B;  4TTV A;  2EJG A;  1H4V B;  4H2V A;  2ZTG A;  4J15 A;  1B8A A;  3RGL A;  2IY5 B;  1QE0 A;  5E3I A;  2DDZ A;  2PME A;  4L87 A;  4TWA A;  4Q6G A;  4YRE A;  3PCO B;  4YRR A;  1X2H A;  3VQY A;  4YP0 A;  4ZTZ B;  2QHV A;  2ZIM A;  3QNE A;  2ZNI A;  4OP0 A;  4ZIB A;  5C51 B;  4WI1 A;  2ARS A;  1NJ1 A;  3EFS A;  3V8K A;  4H2Y A;  4K87 A;  3A7R A;  3LSS A;  3M4Q A;  2ODR D;  1BIA A;  1W66 A;  4Q15 A;  1NJ8 A;  2DTI A;  3FJP A;  3A7A A;  4TVW A;  2AMC B;  3TEG A;  4DQ2 A;  2DVE A;  4P73 C;  4XTX A;  5ELN A;  3W3S A;  4H02 A;  3UGQ A;  4HWR A;  3RL6 A;  2RHQ B;  4XTY A;  2EJF A;  4XU2 A;  11AS A;  3IG2 A;  2ARU A;  3A32 A;  4P74 C;  2ZR3 A;  3TEH A;  2EL9 A;  2C7I A;  1B7Y A;  2CJA A;  2XGT A;  1H4Q A;  3E9H A;  2ZR2 A;  2CJB A;  4WF2 A;  2ALY B;  3BFM A;  2HNI A;  1E1T A;  3HXY A;  2ZIO A;  3I7F A;  4EX5 A;  3VQW A;  1WPY A;  1EQR A;  1B70 B;  1J5W A;  3LSQ A;  1G51 A;  4YRL A;  2I4M A;  3L4G B;  3M4P A;  3RKY A;  1N9W A;  4P72 C;  1HTT A;  5K1X A;  2QHT A;  1NJ6 A;  4E51 A;  2ZIN A;  4YCU A;  1ADY A;  2J3L A;  2AKW A;  4WJ3 M;  2DXU A;  4YRO A;  4CS4 A;  2EWN A;  3DSQ A;  4EO4 A;  3TEH B;  3HY1 A;  1EIY A;  4XEM A;  4HWP A;  4HWT A;  4TQF A;  2ALY A;  1FYF A;  1G5I A;  1BIB A;  1B7Y B;  4KQE A;  3HXX A;  3NEM A;  3VQX A;  1WU7 A;  2ZGW A;  4P71 A;  3V7C A;  1NJ2 A;  4TVA B;  1L0W A;  1X2G A;  2I4L A;  4AH6 A;  3HRI A;  3RF1 A;  5C53 B;  5F5W A;  2FYK A;  3MF1 A;  2ODR C;  4P72 A;  3IKM B;  3A7U A;  3RKX A;  4XEO A;  1Z7N A;  3L2Z A;  4RMF A;  2ZNJ A;  1NYR A;  3G1Z A;  3RIR A;  2QHU A;  1JJC B;  2QHS A;  3QO5 A;  4P3P A;  3QO7 A;  1YGB A;  4YRS A;  3RKW A;  3A31 A;  3UH0 A;  4RQE A;  1H4T A;  1ASZ A;  2I4N A;  4G85 A;  12AS A;  3QO8 A;  4G84 A;  4TVA A;  4YPF A;  2DJZ A;  2ZZE A;  4YCW A; 
#chains in the Genus database with same CATH topology
 3REX A;  2E10 A;  4CS3 A;  2E5A A;  3ERR A;  4UP8 A;  3NEN A;  4YDQ A;  2DZC A;  1YFS A;  1IL2 A;  4LVL A;  4TQD A;  3VQV A;  1EFW A;  4LNS A;  2RHQ A;  2DU5 A;  3HFZ A;  2Q7H A;  4O2D A;  2DTO A;  5C52 B;  2Q7E A;  1ADJ A;  1X56 A;  3PZC A;  4XU3 A;  3WQZ A;  3HXW A;  4P3O A;  3IAL A;  4YRG A;  5KNN A;  2ZT7 A;  4BW9 A;  2Q7G A;  3A74 A;  1X55 A;  4XTV A;  3HXU A;  4YRN A;  2P5I A;  3BJU A;  4YCV A;  3EFR A;  4YRM A;  4RDX A;  1USY C;  3HFV A;  3V8J A;  3P8Y A;  2NS6 A;  3UGT A;  3MF2 A;  2E65 A;  4YRT A;  5HGQ A;  3HXV A;  1YB3 A;  1EIY B;  4YRC A;  2XTI A;  4P71 C;  1EVL A;  3CMQ A;  1G5H A;  1B76 A;  3P8V A;  1KMM A;  4PG3 A;  2RHS A;  2ART A;  1ASY A;  2AMC A;  1NYQ A;  2ZZF A;  1QF6 A;  3HY0 A;  4UP7 A;  4HWS A;  2ZZG A;  4CH4 A;  1BBW A;  2CJ9 A;  2DZ9 A;  2RHS B;  4CS2 A;  2E3C A;  4LVM A;  2ZT5 A;  4X5O A;  3QTC A;  1JJC A;  2ZT6 A;  4DPG A;  4H2X A;  4WJ4 A;  1WQW A;  4PHC A;  3NET A;  1HC7 A;  1RIQ A;  1NJ5 A;  3MQZ A;  1HXD A;  4H2U A;  3NEL A;  4KR2 A;  4XTU A;  2I4O A;  3ICA A;  4CH5 A;  1SET A;  1C0A A;  2G4C A;  2DQ3 A;  2CIM A;  3L4G A;  2EJ9 A;  1EVK A;  2ZCE A;  3V7S A;  2Q5I A;  1B70 A;  2Q5H A;  4CH6 A;  3P8T A;  2DXT A;  1X01 A;  1SRY A;  1EOV A;  4P3N A;  4XU0 A;  1PYS A;  3RAC A;  1WNL A;  3HFZ B;  4YRQ A;  1USY A;  4BWA A;  1YFR A;  3OD1 A;  4ZTU B;  4OLF A;  4KR3 A;  4K86 A;  3TUP A;  1WQ7 A;  3PCO A;  4YYE A;  4TVY A;  2E1H A;  1SER A;  3IKL A;  4P75 A;  4XU1 A;  2ZT8 A;  3HTZ A;  2DEQ A;  1KOG A;  4XTW A;  1VQZ A;  1E22 A;  4K88 A;  4YRJ A;  3REU A;  1WYD A;  1KMN A;  3KFU A;  3L1A A;  4YRI A;  4HA8 A;  3E9I A;  4HWO A;  2E64 A;  1ATI A;  4H2T A;  2DQ0 A;  5K1P A;  1YFT A;  2E41 A;  3RUX A;  1LYL A;  1E24 A;  4HVC A;  4H2W A;  4UPA A;  4H2S A;  2ZXF A;  2C8M A;  1Z7M A;  1GGM A;  1X54 A;  3LC0 A;  4YRF A;  3HXZ A;  1WLE A;  3VBB A;  2DTH A;  1E1O A;  2CGH A;  3MEY A;  4LVJ A;  5ELO A;  4H2X B;  3V7R A;  1NNH A;  1H4S A;  4UP9 A;  2PMF A;  4P74 A;  2DU7 A;  2P0L A;  3HRK A;  3A5Y A;  3A5Z A;  4YRK A;  2J3M A;  4NCX A;  4XTZ A;  3UFG A;  3R07 A;  2IY5 A;  4RQF A;  2DKG A;  4P75 C;  4YRP A;  4P73 A;  1BBU A;  3V8L A;  4CH3 A;  2EAY A;  1PYS B;  1SES A;  2AKW B;  4TTV A;  2EJG A;  1H4V B;  4H2V A;  2ZTG A;  4J15 A;  4LVI A;  1B8A A;  3RGL A;  2IY5 B;  1QE0 A;  5E3I A;  2DDZ A;  2PME A;  4L87 A;  4TWA A;  4Q6G A;  4YRE A;  3PCO B;  4YRR A;  1X2H A;  3VQY A;  4YP0 A;  4ZTZ B;  2QHV A;  2ZIM A;  3QNE A;  2ZNI A;  4OP0 A;  4ZIB A;  5C51 B;  4WI1 A;  2ARS A;  1NJ1 A;  3EFS A;  3V8K A;  4H2Y A;  4K87 A;  3A7R A;  3LSS A;  3M4Q A;  2ODR D;  1BIA A;  4HT4 A;  1W66 A;  4Q15 A;  1NJ8 A;  2DTI A;  3FJP A;  3A7A A;  4TVW A;  2AMC B;  4LVK A;  3TEG A;  4DQ2 A;  2DVE A;  4P73 C;  4XTX A;  5ELN A;  3W3S A;  4H02 A;  3UGQ A;  4HWR A;  3RL6 A;  2RHQ B;  4XTY A;  2EJF A;  4XU2 A;  11AS A;  3IG2 A;  2ARU A;  3A32 A;  4P74 C;  2ZR3 A;  3TEH A;  2EL9 A;  2C7I A;  1B7Y A;  2CJA A;  2XGT A;  1H4Q A;  3E9H A;  2ZR2 A;  2CJB A;  4WF2 A;  2ALY B;  3BFM A;  2HNI A;  1E1T A;  3HXY A;  2ZIO A;  3I7F A;  4EX5 A;  3VQW A;  1WPY A;  1EQR A;  1B70 B;  1J5W A;  3LSQ A;  1G51 A;  4YRL A;  2I4M A;  3L4G B;  3M4P A;  3RKY A;  1N9W A;  4P72 C;  1HTT A;  5K1X A;  2QHT A;  1NJ6 A;  4E51 A;  2ZIN A;  4YCU A;  1ADY A;  2J3L A;  2AKW A;  4WJ3 M;  2DXU A;  4YRO A;  4CS4 A;  2EWN A;  3DSQ A;  4EO4 A;  3TEH B;  3HY1 A;  1EIY A;  4XEM A;  4HWP A;  4HWT A;  4TQF A;  2ALY A;  1FYF A;  1G5I A;  1BIB A;  1B7Y B;  4KQE A;  3HXX A;  3NEM A;  3VQX A;  1WU7 A;  2ZGW A;  4P71 A;  3V7C A;  1NJ2 A;  4TVA B;  1L0W A;  1X2G A;  2I4L A;  4AH6 A;  3HRI A;  3RF1 A;  5C53 B;  5F5W A;  2FYK A;  3MF1 A;  2ODR C;  4P72 A;  3IKM B;  3A7U A;  3RKX A;  4XEO A;  1Z7N A;  3L2Z A;  4RMF A;  2ZNJ A;  1NYR A;  3G1Z A;  2A8E A;  3RIR A;  2QHU A;  1JJC B;  2QHS A;  3QO5 A;  4P3P A;  3QO7 A;  1YGB A;  4YRS A;  3RKW A;  3A31 A;  3UH0 A;  4RQE A;  1H4T A;  1ASZ A;  2I4N A;  4G85 A;  12AS A;  3QO8 A;  4G84 A;  4TVA A;  4YPF A;  2DJZ A;  2ZZE A;  4YCW A; 
#chains in the Genus database with same CATH homology
 3REX A;  2E10 A;  4CS3 A;  2E5A A;  3ERR A;  4UP8 A;  3NEN A;  4YDQ A;  2DZC A;  1YFS A;  1IL2 A;  4LVL A;  4TQD A;  3VQV A;  1EFW A;  4LNS A;  2RHQ A;  2DU5 A;  3HFZ A;  2Q7H A;  4O2D A;  2DTO A;  5C52 B;  2Q7E A;  1ADJ A;  1X56 A;  3PZC A;  4XU3 A;  3WQZ A;  3HXW A;  4P3O A;  3IAL A;  4YRG A;  5KNN A;  2ZT7 A;  4BW9 A;  2Q7G A;  3A74 A;  1X55 A;  4XTV A;  3HXU A;  4YRN A;  2P5I A;  3BJU A;  4YCV A;  3EFR A;  4YRM A;  4RDX A;  1USY C;  3HFV A;  3V8J A;  3P8Y A;  2NS6 A;  3UGT A;  3MF2 A;  2E65 A;  4YRT A;  5HGQ A;  3HXV A;  1YB3 A;  1EIY B;  4YRC A;  2XTI A;  4P71 C;  1EVL A;  3CMQ A;  1G5H A;  1B76 A;  3P8V A;  1KMM A;  4PG3 A;  2RHS A;  2ART A;  1ASY A;  2AMC A;  1NYQ A;  2ZZF A;  1QF6 A;  3HY0 A;  4UP7 A;  4HWS A;  2ZZG A;  4CH4 A;  1BBW A;  2CJ9 A;  2DZ9 A;  2RHS B;  4CS2 A;  2E3C A;  4LVM A;  2ZT5 A;  4X5O A;  3QTC A;  1JJC A;  2ZT6 A;  4DPG A;  4H2X A;  4WJ4 A;  1WQW A;  4PHC A;  3NET A;  1HC7 A;  1RIQ A;  1NJ5 A;  3MQZ A;  1HXD A;  4H2U A;  3NEL A;  4KR2 A;  4XTU A;  2I4O A;  3ICA A;  4CH5 A;  1SET A;  1C0A A;  2G4C A;  2DQ3 A;  2CIM A;  3L4G A;  2EJ9 A;  1EVK A;  2ZCE A;  3V7S A;  2Q5I A;  1B70 A;  2Q5H A;  4CH6 A;  3P8T A;  2DXT A;  1X01 A;  1SRY A;  1EOV A;  4P3N A;  4XU0 A;  1PYS A;  3RAC A;  1WNL A;  3HFZ B;  4YRQ A;  1USY A;  4BWA A;  1YFR A;  3OD1 A;  4ZTU B;  4OLF A;  4KR3 A;  4K86 A;  3TUP A;  1WQ7 A;  3PCO A;  4YYE A;  4TVY A;  2E1H A;  1SER A;  3IKL A;  4P75 A;  4XU1 A;  2ZT8 A;  3HTZ A;  2DEQ A;  1KOG A;  4XTW A;  1VQZ A;  1E22 A;  4K88 A;  4YRJ A;  3REU A;  1WYD A;  1KMN A;  3KFU A;  3L1A A;  4YRI A;  4HA8 A;  3E9I A;  4HWO A;  2E64 A;  1ATI A;  4H2T A;  2DQ0 A;  5K1P A;  1YFT A;  2E41 A;  3RUX A;  1LYL A;  1E24 A;  4HVC A;  4H2W A;  4UPA A;  4H2S A;  2ZXF A;  2C8M A;  1Z7M A;  1GGM A;  1X54 A;  3LC0 A;  4YRF A;  3HXZ A;  1WLE A;  3VBB A;  2DTH A;  1E1O A;  2CGH A;  3MEY A;  4LVJ A;  5ELO A;  4H2X B;  3V7R A;  1NNH A;  1H4S A;  4UP9 A;  2PMF A;  4P74 A;  2DU7 A;  2P0L A;  3HRK A;  3A5Y A;  3A5Z A;  4YRK A;  2J3M A;  4NCX A;  4XTZ A;  3UFG A;  3R07 A;  2IY5 A;  4RQF A;  2DKG A;  4P75 C;  4YRP A;  4P73 A;  1BBU A;  3V8L A;  4CH3 A;  2EAY A;  1PYS B;  1SES A;  2AKW B;  4TTV A;  2EJG A;  1H4V B;  4H2V A;  2ZTG A;  4J15 A;  4LVI A;  1B8A A;  3RGL A;  2IY5 B;  1QE0 A;  5E3I A;  2DDZ A;  2PME A;  4L87 A;  4TWA A;  4Q6G A;  4YRE A;  3PCO B;  4YRR A;  1X2H A;  3VQY A;  4YP0 A;  4ZTZ B;  2QHV A;  2ZIM A;  3QNE A;  2ZNI A;  4OP0 A;  4ZIB A;  5C51 B;  4WI1 A;  2ARS A;  1NJ1 A;  3EFS A;  3V8K A;  4H2Y A;  4K87 A;  3A7R A;  3LSS A;  3M4Q A;  2ODR D;  1BIA A;  4HT4 A;  1W66 A;  4Q15 A;  1NJ8 A;  2DTI A;  3FJP A;  3A7A A;  4TVW A;  2AMC B;  4LVK A;  3TEG A;  4DQ2 A;  2DVE A;  4P73 C;  4XTX A;  5ELN A;  3W3S A;  4H02 A;  3UGQ A;  4HWR A;  3RL6 A;  2RHQ B;  4XTY A;  2EJF A;  4XU2 A;  11AS A;  3IG2 A;  2ARU A;  3A32 A;  4P74 C;  2ZR3 A;  3TEH A;  2EL9 A;  2C7I A;  1B7Y A;  2CJA A;  2XGT A;  1H4Q A;  3E9H A;  2ZR2 A;  2CJB A;  4WF2 A;  2ALY B;  3BFM A;  2HNI A;  1E1T A;  3HXY A;  2ZIO A;  3I7F A;  4EX5 A;  3VQW A;  1WPY A;  1EQR A;  1B70 B;  1J5W A;  3LSQ A;  1G51 A;  4YRL A;  2I4M A;  3L4G B;  3M4P A;  3RKY A;  1N9W A;  4P72 C;  1HTT A;  5K1X A;  2QHT A;  1NJ6 A;  4E51 A;  2ZIN A;  4YCU A;  1ADY A;  2J3L A;  2AKW A;  4WJ3 M;  2DXU A;  4YRO A;  4CS4 A;  2EWN A;  3DSQ A;  4EO4 A;  3TEH B;  3HY1 A;  1EIY A;  4XEM A;  4HWP A;  4HWT A;  4TQF A;  2ALY A;  1FYF A;  1G5I A;  1BIB A;  1B7Y B;  4KQE A;  3HXX A;  3NEM A;  3VQX A;  1WU7 A;  2ZGW A;  4P71 A;  3V7C A;  1NJ2 A;  4TVA B;  1L0W A;  1X2G A;  2I4L A;  4AH6 A;  3HRI A;  3RF1 A;  5C53 B;  5F5W A;  2FYK A;  3MF1 A;  2ODR C;  4P72 A;  3IKM B;  3A7U A;  3RKX A;  4XEO A;  1Z7N A;  3L2Z A;  4RMF A;  2ZNJ A;  1NYR A;  3G1Z A;  2A8E A;  3RIR A;  2QHU A;  1JJC B;  2QHS A;  3QO5 A;  4P3P A;  3QO7 A;  1YGB A;  4YRS A;  3RKW A;  3A31 A;  3UH0 A;  4RQE A;  1H4T A;  1ASZ A;  2I4N A;  4G85 A;  12AS A;  3QO8 A;  4G84 A;  4TVA A;  4YPF A;  2DJZ A;  2ZZE A;  4YCW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...