3ICAA

The crystal structure of the beta subunit of a phenylalanyl-trna synthetase from porphyromonas gingivalis w83
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
212
structure length
205
Chain Sequence
b'NADRRYKWQTVVSEQLVGAGFNEILNNSLTAGSYYEGLKSHPREMAVELMNPLSQELNCMRQTLLFGGLETLSHNLRRKHLSLYLFEWGKCYRFHAAKRETPLAAYAEDDRLGIWICGQRVHPEEPTSVFELKAVVEQVLCRVGIETGAYTLKTADNDLYASAMEVKTRSGKLLGTFGTVSTELIKRFEIEQPVYFAELLWDALM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylalanyl-tRNA synthetase beta chain
molecule tags Ligase
source organism Porphyromonas gingivalis
publication title The crystal structure of the beta subunit of a phenylalanyl-tRNA synthetase from Porphyromonas gingivalis W83
rcsb
total genus 55
structure length 205
sequence length 212
chains with identical sequence B
ec nomenclature ec 6.1.1.20: Phenylalanine--tRNA ligase.
pdb deposition date 2009-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3icaA00
1USYA 4ZTUB 1NJ5A 2E10A 4H02A 4G85A 2PMEA 3RKWA 2ZR3A 2AMCB 3LSQA 1J5WA 4RQFA 3RL6A 1B76A 1YGBA 4BWAA 1NYRA 2ZCEA 2HNIA 3VQVA 1H4SA 3A7AA 1ASYA 3V7SA 4YRNA 1PYSB 3TEGA 1B7YB 3UH0A 4HWTA 1KOGA 2DEQA 4YRRA 3V7RA 1W66A 3IKLA 2ALYA 2ZT7A 1SESA 1EFWA 1Z7NA 4KR2A 1C0AA 2RHQA 4WI1A 2DTIA 2Q7GA 2DTOA 3V8KA 2QHVA 3HRIA 4H2UA 5E3IA 1WLEA 1B70A 3L1AA 4TWAA 2J3LA 5K1XA 4WF2A 1E22A 1SRYA 3NETA 4P74A 2AKWA 1VQZA 3WQZA 4XTVA 3MEYA 4XU3A 4X5OA 4TVAB 4YRPA 4UP8A 3P8YA 4XU2A 2ZZEA 3A5YA 4Q15A 1NJ1A 3HXYA 3QO5A 3HFVA 4PHCA 4YPFA 3A7UA 4YRQA 3FJPA 1X55A 2E1HA 2E5AA 2IY5A 3TUPA 3HXWA 3L4GA 2DKGA 3RIRA 4HWRA 1BBUA 2EJGA 1X56A 3MF2A 3V8LA 2EL9A 3LC0A 2I4LA 3QNEA 4XTZA 1Z7MA 2P5IA 2ODRD 4DPGA 4UP9A 2ARSA 4YRIA 4K87A 3MF1A 3A74A 3VQYA 3VBBA 3KFUA 1G5HA 2DZCA 2ZNIA 1PYSA 4J15A 3REXA 3HY1A 2ZZGA 4TVYA 2AMCA 3A7RA 1EQRA 4O2DA 1HTTA 4YRCA 4CS4A 5K1PA 3NEMA 4P72A 1FYFA 1BIAA 12ASA 1WQ7A 3R07A 2DVEA 4TTVA 2ZT5A 4YRGA 1NNHA 2ZXFA 1ASZA 4HVCA 3NENA 3UFGA 3BJUA 2RHQB 4CH4A 2C7IA 1JJCA 4CS3A 5C52B 1WU7A 4YRTA 4P3NA 4H2VA 4XTYA 4OP0A 3IKMB 4TQFA 1KMNA 4XTXA 3VQWA 4YCWA 4E51A 3E9IA 4P72C 4HWOA 4TQDA 3RKYA 3V7CA 1X01A 3L4GB 4ZTZB 2CIMA 4G84A 2EAYA 3TEHB 1YFSA 1EVKA 4EX5A 5KNNA 3QO7A 3IG2A 3A31A 2QHSA 4Q6GA 1H4VB 4KQEA 3RF1A 2ZINA 1EIYA 4XTUA 1X54A 1HC7A 3HFZB 1G51A 1LYLA 1WPYA 1SERA 4H2WA 1BBWA 3LSSA 4YRKA 2XGTA 4YCUA 2DXTA 4CH6A 2E3CA 3A32A 4RDXA 1YB3A 2ARUA 2DTHA 1GGMA 1H4QA 1EIYB 3RUXA 4LNSA 4EO4A 4CH5A 4DQ2A 4XTWA 1RIQA 3EFRA 4H2YA 4H2XB 4XEOA 1ATIA 3EFSA 1NJ2A 2AKWB 3ICAA 1G5IA 4YRJA 1E24A 3NELA 4TVWA 4TVAA 4P74C 4P71C 2RHSA 3HY0A 3W3SA 3HFZA 3V8JA 1YFTA 2E41A 3P8VA 4XU0A 3CMQA 1E1TA 1KMMA 4CH3A 1IL2A 4KR3A 2I4NA 2DQ3A 1ADYA 3M4QA 1WYDA 4AH6A 3VQXA 2QHTA 1EOVA 2E64A 4L87A 4HWSA 1QF6A 1WQWA 2ZT8A 4NCXA 2DZ9A 3HXVA 4HA8A 3UGQA 2IY5B 2ODRC 2DDZA 4YYEA 2Q5IA 4YRSA 2P0LA 2QHUA 1BIBA 4H2TA 4WJ4A 3HXXA 3RGLA 3QTCA 4P3PA 3I7FA 1NJ6A 3DSQA 1SETA 1NJ8A 3E9HA 4XEMA 3IALA 4H2SA 4YRMA 3OD1A 4YP0A 2DJZA 1X2HA 3RACA 4YDQA 3QO8A 3TEHA 1USYC 1B8AA 2Q7EA 5C53B 2DXUA 2DU7A 4P75A 2Q5HA 4XU1A 2C8MA 2XTIA 4P73A 5HGQA 1NYQA 2I4OA 2PMFA 4OLFA 4CS2A 1B7YA 4YROA 5ELNA 1ADJA 2ZIMA 2DQ0A 2G4CA 2CJ9A 1JJCB 2EJFA 2ZR2A 4PG3A 3BFMA 2EWNA 1EVLA 1E1OA 3HXUA 1H4TA 1HXDA 4K88A 5C51B 2DU5A 2CJAA 1WNLA 1X2GA 4P3OA 4P71A 1B70B 3RKXA 3PCOA 2ARTA 2ZIOA 2I4MA 2ALYB 1YFRA 3L2ZA 4RMFA 2J3MA 4YCVA 5ELOA 5F5WA 4RQEA 3A5ZA 2E65A 3HXZA 2ZTGA 3HTZA 1L0WA 3REUA 4BW9A 3HRKA 3PCOB 1N9WA 2CJBA 2CGHA 4YREA 4UPAA 2EJ9A 2ZT6A 4YRLA 3PZCA 4H2XA 2Q7HA 3M4PA 4UP7A 2ZZFA 2FYKA 3UGTA 4P73C 3P8TA 3G1ZA 4P75C 4WJ3M 2ZNJA 4K86A 11ASA 3ERRA 2RHSB 1QE0A 4HWPA 4ZIBA 4YRFA 2ZGWA
chains in the Genus database with same CATH superfamily
1USYA 4ZTUB 1NJ5A 2E10A 4H02A 4G85A 2PMEA 3RKWA 2ZR3A 2AMCB 3LSQA 1J5WA 4RQFA 3RL6A 1B76A 1YGBA 4BWAA 1NYRA 2ZCEA 2HNIA 3VQVA 1H4SA 3A7AA 1ASYA 3V7SA 4YRNA 1PYSB 2A8EA 3TEGA 1B7YB 3UH0A 4HWTA 1KOGA 2DEQA 4YRRA 3V7RA 1W66A 3IKLA 2ALYA 2ZT7A 1SESA 1EFWA 1Z7NA 4KR2A 1C0AA 2RHQA 4WI1A 2DTIA 2Q7GA 2DTOA 3V8KA 2QHVA 3HRIA 4H2UA 5E3IA 1WLEA 1B70A 3L1AA 4TWAA 2J3LA 5K1XA 4WF2A 1E22A 1SRYA 3NETA 4P74A 2AKWA 1VQZA 3WQZA 4XTVA 3MEYA 4XU3A 4X5OA 4TVAB 4YRPA 4UP8A 3P8YA 4XU2A 2ZZEA 3A5YA 4Q15A 1NJ1A 3HXYA 3QO5A 3HFVA 4PHCA 4YPFA 3A7UA 4YRQA 3FJPA 1X55A 2E1HA 2E5AA 2IY5A 3TUPA 3HXWA 3L4GA 2DKGA 3RIRA 4HWRA 1BBUA 2EJGA 1X56A 3MF2A 3V8LA 2EL9A 3LC0A 2I4LA 3QNEA 4XTZA 1Z7MA 2P5IA 2ODRD 4DPGA 4UP9A 2ARSA 4YRIA 4K87A 3MF1A 3A74A 3VQYA 3VBBA 3KFUA 1G5HA 2DZCA 2ZNIA 1PYSA 4J15A 3REXA 3HY1A 2ZZGA 4TVYA 2AMCA 3A7RA 1EQRA 4O2DA 1HTTA 4YRCA 4CS4A 5K1PA 3NEMA 4P72A 1FYFA 1BIAA 12ASA 1WQ7A 3R07A 2DVEA 4TTVA 2ZT5A 4YRGA 1NNHA 2ZXFA 1ASZA 4HVCA 3NENA 3UFGA 3BJUA 2RHQB 4CH4A 2C7IA 1JJCA 4CS3A 5C52B 1WU7A 4YRTA 4P3NA 4H2VA 4XTYA 4OP0A 3IKMB 4TQFA 1KMNA 4XTXA 3VQWA 4YCWA 4E51A 3E9IA 4P72C 4HWOA 4TQDA 3RKYA 3V7CA 1X01A 3L4GB 4ZTZB 2CIMA 4G84A 2EAYA 3TEHB 1YFSA 1EVKA 4EX5A 5KNNA 3QO7A 3IG2A 3A31A 2QHSA 4Q6GA 1H4VB 4KQEA 3RF1A 2ZINA 1EIYA 4XTUA 1X54A 1HC7A 3HFZB 1G51A 1LYLA 1WPYA 1SERA 4H2WA 1BBWA 3LSSA 4YRKA 2XGTA 4LVMA 4YCUA 2DXTA 4CH6A 2E3CA 3A32A 4RDXA 1YB3A 2ARUA 2DTHA 1GGMA 1H4QA 1EIYB 3RUXA 4LNSA 4EO4A 4CH5A 4DQ2A 4XTWA 1RIQA 3EFRA 4H2YA 4H2XB 4XEOA 1ATIA 3EFSA 1NJ2A 2AKWB 3ICAA 1G5IA 4YRJA 1E24A 3NELA 4TVWA 4TVAA 4P74C 2NS6A 4P71C 4LVLA 2RHSA 3HY0A 3W3SA 3HFZA 3V8JA 1YFTA 2E41A 3P8VA 4XU0A 3CMQA 1E1TA 4HT4A 1KMMA 4CH3A 1IL2A 4KR3A 2I4NA 2DQ3A 1ADYA 3M4QA 1WYDA 4AH6A 3VQXA 2QHTA 1EOVA 2E64A 4L87A 4HWSA 1QF6A 1WQWA 2ZT8A 4NCXA 2DZ9A 3HXVA 4LVJA 4HA8A 3UGQA 2IY5B 2ODRC 2DDZA 4YYEA 2Q5IA 4YRSA 2P0LA 2QHUA 1BIBA 4H2TA 4WJ4A 3HXXA 3RGLA 3QTCA 4P3PA 3I7FA 1NJ6A 3DSQA 1SETA 1NJ8A 3E9HA 4XEMA 3IALA 4H2SA 4YRMA 3OD1A 4YP0A 2DJZA 1X2HA 3RACA 4YDQA 3QO8A 3TEHA 1USYC 1B8AA 2Q7EA 5C53B 2DXUA 2DU7A 4P75A 2Q5HA 4XU1A 2C8MA 2XTIA 4P73A 5HGQA 1NYQA 2I4OA 2PMFA 4OLFA 4CS2A 1B7YA 4YROA 5ELNA 1ADJA 2ZIMA 2DQ0A 2G4CA 2CJ9A 1JJCB 2EJFA 2ZR2A 4PG3A 3BFMA 2EWNA 1EVLA 1E1OA 3HXUA 1H4TA 1HXDA 4K88A 5C51B 2DU5A 2CJAA 1WNLA 1X2GA 4P3OA 4P71A 1B70B 3RKXA 3PCOA 2ARTA 2ZIOA 2I4MA 2ALYB 1YFRA 3L2ZA 4RMFA 2J3MA 4YCVA 5ELOA 5F5WA 4RQEA 3A5ZA 2E65A 3HXZA 2ZTGA 3HTZA 1L0WA 3REUA 4BW9A 3HRKA 3PCOB 1N9WA 2CJBA 2CGHA 4YREA 4UPAA 3MQZA 2EJ9A 2ZT6A 4YRLA 3PZCA 4H2XA 2Q7HA 4LVIA 3M4PA 4LVKA 4UP7A 2ZZFA 2FYKA 3UGTA 4P73C 3P8TA 3G1ZA 4P75C 4WJ3M 2ZNJA 4K86A 11ASA 3ERRA 2RHSB 1QE0A 4HWPA 4ZIBA 4YRFA 2ZGWA
chains in the Genus database with same CATH topology
1USYA 4ZTUB 1NJ5A 2E10A 4H02A 4G85A 2PMEA 3RKWA 2ZR3A 2AMCB 3LSQA 1J5WA 4RQFA 3RL6A 1B76A 1YGBA 4BWAA 1NYRA 2ZCEA 2HNIA 3VQVA 1H4SA 3A7AA 1ASYA 3V7SA 4YRNA 1PYSB 2A8EA 3TEGA 1B7YB 3UH0A 4HWTA 1KOGA 2DEQA 4YRRA 3V7RA 1W66A 3IKLA 2ALYA 2ZT7A 1SESA 1EFWA 1Z7NA 4KR2A 1C0AA 2RHQA 4WI1A 2DTIA 2Q7GA 2DTOA 3V8KA 2QHVA 3HRIA 4H2UA 5E3IA 1WLEA 1B70A 3L1AA 4TWAA 2J3LA 5K1XA 4WF2A 1E22A 1SRYA 3NETA 4P74A 2AKWA 1VQZA 3WQZA 4XTVA 3MEYA 4XU3A 4X5OA 4TVAB 4YRPA 4UP8A 3P8YA 4XU2A 2ZZEA 3A5YA 4Q15A 1NJ1A 3HXYA 3QO5A 3HFVA 4PHCA 4YPFA 3A7UA 4YRQA 3FJPA 1X55A 2E1HA 2E5AA 2IY5A 3TUPA 3HXWA 3L4GA 2DKGA 3RIRA 4HWRA 1BBUA 2EJGA 1X56A 3MF2A 3V8LA 2EL9A 3LC0A 2I4LA 3QNEA 4XTZA 1Z7MA 2P5IA 2ODRD 4DPGA 4UP9A 2ARSA 4YRIA 4K87A 3MF1A 3A74A 3VQYA 3VBBA 3KFUA 1G5HA 2DZCA 2ZNIA 1PYSA 4J15A 3REXA 3HY1A 2ZZGA 4TVYA 2AMCA 3A7RA 1EQRA 4O2DA 1HTTA 4YRCA 4CS4A 5K1PA 3NEMA 4P72A 1FYFA 1BIAA 12ASA 1WQ7A 3R07A 2DVEA 4TTVA 2ZT5A 4YRGA 1NNHA 2ZXFA 1ASZA 4HVCA 3NENA 3UFGA 3BJUA 2RHQB 4CH4A 2C7IA 1JJCA 4CS3A 5C52B 1WU7A 4YRTA 4P3NA 4H2VA 4XTYA 4OP0A 3IKMB 4TQFA 1KMNA 4XTXA 3VQWA 4YCWA 4E51A 3E9IA 4P72C 4HWOA 4TQDA 3RKYA 3V7CA 1X01A 3L4GB 4ZTZB 2CIMA 4G84A 2EAYA 3TEHB 1YFSA 1EVKA 4EX5A 5KNNA 3QO7A 3IG2A 3A31A 2QHSA 4Q6GA 1H4VB 4KQEA 3RF1A 2ZINA 1EIYA 4XTUA 1X54A 1HC7A 3HFZB 1G51A 1LYLA 1WPYA 1SERA 4H2WA 1BBWA 3LSSA 4YRKA 2XGTA 4LVMA 4YCUA 2DXTA 4CH6A 2E3CA 3A32A 4RDXA 1YB3A 2ARUA 2DTHA 1GGMA 1H4QA 1EIYB 3RUXA 4LNSA 4EO4A 4CH5A 4DQ2A 4XTWA 1RIQA 3EFRA 4H2YA 4H2XB 4XEOA 1ATIA 3EFSA 1NJ2A 2AKWB 3ICAA 1G5IA 4YRJA 1E24A 3NELA 4TVWA 4TVAA 4P74C 2NS6A 4P71C 4LVLA 2RHSA 3HY0A 3W3SA 3HFZA 3V8JA 1YFTA 2E41A 3P8VA 4XU0A 3CMQA 1E1TA 4HT4A 1KMMA 4CH3A 1IL2A 4KR3A 2I4NA 2DQ3A 1ADYA 3M4QA 1WYDA 4AH6A 3VQXA 2QHTA 1EOVA 2E64A 4L87A 4HWSA 1QF6A 1WQWA 2ZT8A 4NCXA 2DZ9A 3HXVA 4LVJA 4HA8A 3UGQA 2IY5B 2ODRC 2DDZA 4YYEA 2Q5IA 4YRSA 2P0LA 2QHUA 1BIBA 4H2TA 4WJ4A 3HXXA 3RGLA 3QTCA 4P3PA 3I7FA 1NJ6A 3DSQA 1SETA 1NJ8A 3E9HA 4XEMA 3IALA 4H2SA 4YRMA 3OD1A 4YP0A 2DJZA 1X2HA 3RACA 4YDQA 3QO8A 3TEHA 1USYC 1B8AA 2Q7EA 5C53B 2DXUA 2DU7A 4P75A 2Q5HA 4XU1A 2C8MA 2XTIA 4P73A 5HGQA 1NYQA 2I4OA 2PMFA 4OLFA 4CS2A 1B7YA 4YROA 5ELNA 1ADJA 2ZIMA 2DQ0A 2G4CA 2CJ9A 1JJCB 2EJFA 2ZR2A 4PG3A 3BFMA 2EWNA 1EVLA 1E1OA 3HXUA 1H4TA 1HXDA 4K88A 5C51B 2DU5A 2CJAA 1WNLA 1X2GA 4P3OA 4P71A 1B70B 3RKXA 3PCOA 2ARTA 2ZIOA 2I4MA 2ALYB 1YFRA 3L2ZA 4RMFA 2J3MA 4YCVA 5ELOA 5F5WA 4RQEA 3A5ZA 2E65A 3HXZA 2ZTGA 3HTZA 1L0WA 3REUA 4BW9A 3HRKA 3PCOB 1N9WA 2CJBA 2CGHA 4YREA 4UPAA 3MQZA 2EJ9A 2ZT6A 4YRLA 3PZCA 4H2XA 2Q7HA 4LVIA 3M4PA 4LVKA 4UP7A 2ZZFA 2FYKA 3UGTA 4P73C 3P8TA 3G1ZA 4P75C 4WJ3M 2ZNJA 4K86A 11ASA 3ERRA 2RHSB 1QE0A 4HWPA 4ZIBA 4YRFA 2ZGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USY A;  4ZTU B;  1NJ5 A;  2E10 A;  4H02 A;  4G85 A;  2PME A;  3RKW A;  2ZR3 A;  2AMC B;  3LSQ A;  1J5W A;  4RQF A;  3RL6 A;  1B76 A;  1YGB A;  4BWA A;  1NYR A;  2ZCE A;  2HNI A;  3VQV A;  1H4S A;  3A7A A;  1ASY A;  3V7S A;  4YRN A;  1PYS B;  3TEG A;  1B7Y B;  3UH0 A;  4HWT A;  1KOG A;  2DEQ A;  4YRR A;  3V7R A;  1W66 A;  3IKL A;  2ALY A;  2ZT7 A;  1SES A;  1EFW A;  1Z7N A;  4KR2 A;  1C0A A;  2RHQ A;  4WI1 A;  2DTI A;  2Q7G A;  2DTO A;  3V8K A;  2QHV A;  3HRI A;  4H2U A;  5E3I A;  1WLE A;  1B70 A;  3L1A A;  4TWA A;  2J3L A;  5K1X A;  4WF2 A;  1E22 A;  1SRY A;  3NET A;  4P74 A;  2AKW A;  1VQZ A;  3WQZ A;  4XTV A;  3MEY A;  4XU3 A;  4X5O A;  4TVA B;  4YRP A;  4UP8 A;  3P8Y A;  4XU2 A;  2ZZE A;  3A5Y A;  4Q15 A;  1NJ1 A;  3HXY A;  3QO5 A;  3HFV A;  4PHC A;  4YPF A;  3A7U A;  4YRQ A;  3FJP A;  1X55 A;  2E1H A;  2E5A A;  2IY5 A;  3TUP A;  3HXW A;  3L4G A;  2DKG A;  3RIR A;  4HWR A;  1BBU A;  2EJG A;  1X56 A;  3MF2 A;  3V8L A;  2EL9 A;  3LC0 A;  2I4L A;  3QNE A;  4XTZ A;  1Z7M A;  2P5I A;  2ODR D;  4DPG A;  4UP9 A;  2ARS A;  4YRI A;  4K87 A;  3MF1 A;  3A74 A;  3VQY A;  3VBB A;  3KFU A;  1G5H A;  2DZC A;  2ZNI A;  1PYS A;  4J15 A;  3REX A;  3HY1 A;  2ZZG A;  4TVY A;  2AMC A;  3A7R A;  1EQR A;  4O2D A;  1HTT A;  4YRC A;  4CS4 A;  5K1P A;  3NEM A;  4P72 A;  1FYF A;  1BIA A;  12AS A;  1WQ7 A;  3R07 A;  2DVE A;  4TTV A;  2ZT5 A;  4YRG A;  1NNH A;  2ZXF A;  1ASZ A;  4HVC A;  3NEN A;  3UFG A;  3BJU A;  2RHQ B;  4CH4 A;  2C7I A;  1JJC A;  4CS3 A;  5C52 B;  1WU7 A;  4YRT A;  4P3N A;  4H2V A;  4XTY A;  4OP0 A;  3IKM B;  4TQF A;  1KMN A;  4XTX A;  3VQW A;  4YCW A;  4E51 A;  3E9I A;  4P72 C;  4HWO A;  4TQD A;  3RKY A;  3V7C A;  1X01 A;  3L4G B;  4ZTZ B;  2CIM A;  4G84 A;  2EAY A;  3TEH B;  1YFS A;  1EVK A;  4EX5 A;  5KNN A;  3QO7 A;  3IG2 A;  3A31 A;  2QHS A;  4Q6G A;  1H4V B;  4KQE A;  3RF1 A;  2ZIN A;  1EIY A;  4XTU A;  1X54 A;  1HC7 A;  3HFZ B;  1G51 A;  1LYL A;  1WPY A;  1SER A;  4H2W A;  1BBW A;  3LSS A;  4YRK A;  2XGT A;  4YCU A;  2DXT A;  4CH6 A;  2E3C A;  3A32 A;  4RDX A;  1YB3 A;  2ARU A;  2DTH A;  1GGM A;  1H4Q A;  1EIY B;  3RUX A;  4LNS A;  4EO4 A;  4CH5 A;  4DQ2 A;  4XTW A;  1RIQ A;  3EFR A;  4H2Y A;  4H2X B;  4XEO A;  1ATI A;  3EFS A;  1NJ2 A;  2AKW B;  3ICA A;  1G5I A;  4YRJ A;  1E24 A;  3NEL A;  4TVW A;  4TVA A;  4P74 C;  4P71 C;  2RHS A;  3HY0 A;  3W3S A;  3HFZ A;  3V8J A;  1YFT A;  2E41 A;  3P8V A;  4XU0 A;  3CMQ A;  1E1T A;  1KMM A;  4CH3 A;  1IL2 A;  4KR3 A;  2I4N A;  2DQ3 A;  1ADY A;  3M4Q A;  1WYD A;  4AH6 A;  3VQX A;  2QHT A;  1EOV A;  2E64 A;  4L87 A;  4HWS A;  1QF6 A;  1WQW A;  2ZT8 A;  4NCX A;  2DZ9 A;  3HXV A;  4HA8 A;  3UGQ A;  2IY5 B;  2ODR C;  2DDZ A;  4YYE A;  2Q5I A;  4YRS A;  2P0L A;  2QHU A;  1BIB A;  4H2T A;  4WJ4 A;  3HXX A;  3RGL A;  3QTC A;  4P3P A;  3I7F A;  1NJ6 A;  3DSQ A;  1SET A;  1NJ8 A;  3E9H A;  4XEM A;  3IAL A;  4H2S A;  4YRM A;  3OD1 A;  4YP0 A;  2DJZ A;  1X2H A;  3RAC A;  4YDQ A;  3QO8 A;  3TEH A;  1USY C;  1B8A A;  2Q7E A;  5C53 B;  2DXU A;  2DU7 A;  4P75 A;  2Q5H A;  4XU1 A;  2C8M A;  2XTI A;  4P73 A;  5HGQ A;  1NYQ A;  2I4O A;  2PMF A;  4OLF A;  4CS2 A;  1B7Y A;  4YRO A;  5ELN A;  1ADJ A;  2ZIM A;  2DQ0 A;  2G4C A;  2CJ9 A;  1JJC B;  2EJF A;  2ZR2 A;  4PG3 A;  3BFM A;  2EWN A;  1EVL A;  1E1O A;  3HXU A;  1H4T A;  1HXD A;  4K88 A;  5C51 B;  2DU5 A;  2CJA A;  1WNL A;  1X2G A;  4P3O A;  4P71 A;  1B70 B;  3RKX A;  3PCO A;  2ART A;  2ZIO A;  2I4M A;  2ALY B;  1YFR A;  3L2Z A;  4RMF A;  2J3M A;  4YCV A;  5ELO A;  5F5W A;  4RQE A;  3A5Z A;  2E65 A;  3HXZ A;  2ZTG A;  3HTZ A;  1L0W A;  3REU A;  4BW9 A;  3HRK A;  3PCO B;  1N9W A;  2CJB A;  2CGH A;  4YRE A;  4UPA A;  2EJ9 A;  2ZT6 A;  4YRL A;  3PZC A;  4H2X A;  2Q7H A;  3M4P A;  4UP7 A;  2ZZF A;  2FYK A;  3UGT A;  4P73 C;  3P8T A;  3G1Z A;  4P75 C;  4WJ3 M;  2ZNJ A;  4K86 A;  11AS A;  3ERR A;  2RHS B;  1QE0 A;  4HWP A;  4ZIB A;  4YRF A;  2ZGW A; 
#chains in the Genus database with same CATH topology
 1USY A;  4ZTU B;  1NJ5 A;  2E10 A;  4H02 A;  4G85 A;  2PME A;  3RKW A;  2ZR3 A;  2AMC B;  3LSQ A;  1J5W A;  4RQF A;  3RL6 A;  1B76 A;  1YGB A;  4BWA A;  1NYR A;  2ZCE A;  2HNI A;  3VQV A;  1H4S A;  3A7A A;  1ASY A;  3V7S A;  4YRN A;  1PYS B;  2A8E A;  3TEG A;  1B7Y B;  3UH0 A;  4HWT A;  1KOG A;  2DEQ A;  4YRR A;  3V7R A;  1W66 A;  3IKL A;  2ALY A;  2ZT7 A;  1SES A;  1EFW A;  1Z7N A;  4KR2 A;  1C0A A;  2RHQ A;  4WI1 A;  2DTI A;  2Q7G A;  2DTO A;  3V8K A;  2QHV A;  3HRI A;  4H2U A;  5E3I A;  1WLE A;  1B70 A;  3L1A A;  4TWA A;  2J3L A;  5K1X A;  4WF2 A;  1E22 A;  1SRY A;  3NET A;  4P74 A;  2AKW A;  1VQZ A;  3WQZ A;  4XTV A;  3MEY A;  4XU3 A;  4X5O A;  4TVA B;  4YRP A;  4UP8 A;  3P8Y A;  4XU2 A;  2ZZE A;  3A5Y A;  4Q15 A;  1NJ1 A;  3HXY A;  3QO5 A;  3HFV A;  4PHC A;  4YPF A;  3A7U A;  4YRQ A;  3FJP A;  1X55 A;  2E1H A;  2E5A A;  2IY5 A;  3TUP A;  3HXW A;  3L4G A;  2DKG A;  3RIR A;  4HWR A;  1BBU A;  2EJG A;  1X56 A;  3MF2 A;  3V8L A;  2EL9 A;  3LC0 A;  2I4L A;  3QNE A;  4XTZ A;  1Z7M A;  2P5I A;  2ODR D;  4DPG A;  4UP9 A;  2ARS A;  4YRI A;  4K87 A;  3MF1 A;  3A74 A;  3VQY A;  3VBB A;  3KFU A;  1G5H A;  2DZC A;  2ZNI A;  1PYS A;  4J15 A;  3REX A;  3HY1 A;  2ZZG A;  4TVY A;  2AMC A;  3A7R A;  1EQR A;  4O2D A;  1HTT A;  4YRC A;  4CS4 A;  5K1P A;  3NEM A;  4P72 A;  1FYF A;  1BIA A;  12AS A;  1WQ7 A;  3R07 A;  2DVE A;  4TTV A;  2ZT5 A;  4YRG A;  1NNH A;  2ZXF A;  1ASZ A;  4HVC A;  3NEN A;  3UFG A;  3BJU A;  2RHQ B;  4CH4 A;  2C7I A;  1JJC A;  4CS3 A;  5C52 B;  1WU7 A;  4YRT A;  4P3N A;  4H2V A;  4XTY A;  4OP0 A;  3IKM B;  4TQF A;  1KMN A;  4XTX A;  3VQW A;  4YCW A;  4E51 A;  3E9I A;  4P72 C;  4HWO A;  4TQD A;  3RKY A;  3V7C A;  1X01 A;  3L4G B;  4ZTZ B;  2CIM A;  4G84 A;  2EAY A;  3TEH B;  1YFS A;  1EVK A;  4EX5 A;  5KNN A;  3QO7 A;  3IG2 A;  3A31 A;  2QHS A;  4Q6G A;  1H4V B;  4KQE A;  3RF1 A;  2ZIN A;  1EIY A;  4XTU A;  1X54 A;  1HC7 A;  3HFZ B;  1G51 A;  1LYL A;  1WPY A;  1SER A;  4H2W A;  1BBW A;  3LSS A;  4YRK A;  2XGT A;  4LVM A;  4YCU A;  2DXT A;  4CH6 A;  2E3C A;  3A32 A;  4RDX A;  1YB3 A;  2ARU A;  2DTH A;  1GGM A;  1H4Q A;  1EIY B;  3RUX A;  4LNS A;  4EO4 A;  4CH5 A;  4DQ2 A;  4XTW A;  1RIQ A;  3EFR A;  4H2Y A;  4H2X B;  4XEO A;  1ATI A;  3EFS A;  1NJ2 A;  2AKW B;  3ICA A;  1G5I A;  4YRJ A;  1E24 A;  3NEL A;  4TVW A;  4TVA A;  4P74 C;  2NS6 A;  4P71 C;  4LVL A;  2RHS A;  3HY0 A;  3W3S A;  3HFZ A;  3V8J A;  1YFT A;  2E41 A;  3P8V A;  4XU0 A;  3CMQ A;  1E1T A;  4HT4 A;  1KMM A;  4CH3 A;  1IL2 A;  4KR3 A;  2I4N A;  2DQ3 A;  1ADY A;  3M4Q A;  1WYD A;  4AH6 A;  3VQX A;  2QHT A;  1EOV A;  2E64 A;  4L87 A;  4HWS A;  1QF6 A;  1WQW A;  2ZT8 A;  4NCX A;  2DZ9 A;  3HXV A;  4LVJ A;  4HA8 A;  3UGQ A;  2IY5 B;  2ODR C;  2DDZ A;  4YYE A;  2Q5I A;  4YRS A;  2P0L A;  2QHU A;  1BIB A;  4H2T A;  4WJ4 A;  3HXX A;  3RGL A;  3QTC A;  4P3P A;  3I7F A;  1NJ6 A;  3DSQ A;  1SET A;  1NJ8 A;  3E9H A;  4XEM A;  3IAL A;  4H2S A;  4YRM A;  3OD1 A;  4YP0 A;  2DJZ A;  1X2H A;  3RAC A;  4YDQ A;  3QO8 A;  3TEH A;  1USY C;  1B8A A;  2Q7E A;  5C53 B;  2DXU A;  2DU7 A;  4P75 A;  2Q5H A;  4XU1 A;  2C8M A;  2XTI A;  4P73 A;  5HGQ A;  1NYQ A;  2I4O A;  2PMF A;  4OLF A;  4CS2 A;  1B7Y A;  4YRO A;  5ELN A;  1ADJ A;  2ZIM A;  2DQ0 A;  2G4C A;  2CJ9 A;  1JJC B;  2EJF A;  2ZR2 A;  4PG3 A;  3BFM A;  2EWN A;  1EVL A;  1E1O A;  3HXU A;  1H4T A;  1HXD A;  4K88 A;  5C51 B;  2DU5 A;  2CJA A;  1WNL A;  1X2G A;  4P3O A;  4P71 A;  1B70 B;  3RKX A;  3PCO A;  2ART A;  2ZIO A;  2I4M A;  2ALY B;  1YFR A;  3L2Z A;  4RMF A;  2J3M A;  4YCV A;  5ELO A;  5F5W A;  4RQE A;  3A5Z A;  2E65 A;  3HXZ A;  2ZTG A;  3HTZ A;  1L0W A;  3REU A;  4BW9 A;  3HRK A;  3PCO B;  1N9W A;  2CJB A;  2CGH A;  4YRE A;  4UPA A;  3MQZ A;  2EJ9 A;  2ZT6 A;  4YRL A;  3PZC A;  4H2X A;  2Q7H A;  4LVI A;  3M4P A;  4LVK A;  4UP7 A;  2ZZF A;  2FYK A;  3UGT A;  4P73 C;  3P8T A;  3G1Z A;  4P75 C;  4WJ3 M;  2ZNJ A;  4K86 A;  11AS A;  3ERR A;  2RHS B;  1QE0 A;  4HWP A;  4ZIB A;  4YRF A;  2ZGW A; 
#chains in the Genus database with same CATH homology
 1USY A;  4ZTU B;  1NJ5 A;  2E10 A;  4H02 A;  4G85 A;  2PME A;  3RKW A;  2ZR3 A;  2AMC B;  3LSQ A;  1J5W A;  4RQF A;  3RL6 A;  1B76 A;  1YGB A;  4BWA A;  1NYR A;  2ZCE A;  2HNI A;  3VQV A;  1H4S A;  3A7A A;  1ASY A;  3V7S A;  4YRN A;  1PYS B;  2A8E A;  3TEG A;  1B7Y B;  3UH0 A;  4HWT A;  1KOG A;  2DEQ A;  4YRR A;  3V7R A;  1W66 A;  3IKL A;  2ALY A;  2ZT7 A;  1SES A;  1EFW A;  1Z7N A;  4KR2 A;  1C0A A;  2RHQ A;  4WI1 A;  2DTI A;  2Q7G A;  2DTO A;  3V8K A;  2QHV A;  3HRI A;  4H2U A;  5E3I A;  1WLE A;  1B70 A;  3L1A A;  4TWA A;  2J3L A;  5K1X A;  4WF2 A;  1E22 A;  1SRY A;  3NET A;  4P74 A;  2AKW A;  1VQZ A;  3WQZ A;  4XTV A;  3MEY A;  4XU3 A;  4X5O A;  4TVA B;  4YRP A;  4UP8 A;  3P8Y A;  4XU2 A;  2ZZE A;  3A5Y A;  4Q15 A;  1NJ1 A;  3HXY A;  3QO5 A;  3HFV A;  4PHC A;  4YPF A;  3A7U A;  4YRQ A;  3FJP A;  1X55 A;  2E1H A;  2E5A A;  2IY5 A;  3TUP A;  3HXW A;  3L4G A;  2DKG A;  3RIR A;  4HWR A;  1BBU A;  2EJG A;  1X56 A;  3MF2 A;  3V8L A;  2EL9 A;  3LC0 A;  2I4L A;  3QNE A;  4XTZ A;  1Z7M A;  2P5I A;  2ODR D;  4DPG A;  4UP9 A;  2ARS A;  4YRI A;  4K87 A;  3MF1 A;  3A74 A;  3VQY A;  3VBB A;  3KFU A;  1G5H A;  2DZC A;  2ZNI A;  1PYS A;  4J15 A;  3REX A;  3HY1 A;  2ZZG A;  4TVY A;  2AMC A;  3A7R A;  1EQR A;  4O2D A;  1HTT A;  4YRC A;  4CS4 A;  5K1P A;  3NEM A;  4P72 A;  1FYF A;  1BIA A;  12AS A;  1WQ7 A;  3R07 A;  2DVE A;  4TTV A;  2ZT5 A;  4YRG A;  1NNH A;  2ZXF A;  1ASZ A;  4HVC A;  3NEN A;  3UFG A;  3BJU A;  2RHQ B;  4CH4 A;  2C7I A;  1JJC A;  4CS3 A;  5C52 B;  1WU7 A;  4YRT A;  4P3N A;  4H2V A;  4XTY A;  4OP0 A;  3IKM B;  4TQF A;  1KMN A;  4XTX A;  3VQW A;  4YCW A;  4E51 A;  3E9I A;  4P72 C;  4HWO A;  4TQD A;  3RKY A;  3V7C A;  1X01 A;  3L4G B;  4ZTZ B;  2CIM A;  4G84 A;  2EAY A;  3TEH B;  1YFS A;  1EVK A;  4EX5 A;  5KNN A;  3QO7 A;  3IG2 A;  3A31 A;  2QHS A;  4Q6G A;  1H4V B;  4KQE A;  3RF1 A;  2ZIN A;  1EIY A;  4XTU A;  1X54 A;  1HC7 A;  3HFZ B;  1G51 A;  1LYL A;  1WPY A;  1SER A;  4H2W A;  1BBW A;  3LSS A;  4YRK A;  2XGT A;  4LVM A;  4YCU A;  2DXT A;  4CH6 A;  2E3C A;  3A32 A;  4RDX A;  1YB3 A;  2ARU A;  2DTH A;  1GGM A;  1H4Q A;  1EIY B;  3RUX A;  4LNS A;  4EO4 A;  4CH5 A;  4DQ2 A;  4XTW A;  1RIQ A;  3EFR A;  4H2Y A;  4H2X B;  4XEO A;  1ATI A;  3EFS A;  1NJ2 A;  2AKW B;  3ICA A;  1G5I A;  4YRJ A;  1E24 A;  3NEL A;  4TVW A;  4TVA A;  4P74 C;  2NS6 A;  4P71 C;  4LVL A;  2RHS A;  3HY0 A;  3W3S A;  3HFZ A;  3V8J A;  1YFT A;  2E41 A;  3P8V A;  4XU0 A;  3CMQ A;  1E1T A;  4HT4 A;  1KMM A;  4CH3 A;  1IL2 A;  4KR3 A;  2I4N A;  2DQ3 A;  1ADY A;  3M4Q A;  1WYD A;  4AH6 A;  3VQX A;  2QHT A;  1EOV A;  2E64 A;  4L87 A;  4HWS A;  1QF6 A;  1WQW A;  2ZT8 A;  4NCX A;  2DZ9 A;  3HXV A;  4LVJ A;  4HA8 A;  3UGQ A;  2IY5 B;  2ODR C;  2DDZ A;  4YYE A;  2Q5I A;  4YRS A;  2P0L A;  2QHU A;  1BIB A;  4H2T A;  4WJ4 A;  3HXX A;  3RGL A;  3QTC A;  4P3P A;  3I7F A;  1NJ6 A;  3DSQ A;  1SET A;  1NJ8 A;  3E9H A;  4XEM A;  3IAL A;  4H2S A;  4YRM A;  3OD1 A;  4YP0 A;  2DJZ A;  1X2H A;  3RAC A;  4YDQ A;  3QO8 A;  3TEH A;  1USY C;  1B8A A;  2Q7E A;  5C53 B;  2DXU A;  2DU7 A;  4P75 A;  2Q5H A;  4XU1 A;  2C8M A;  2XTI A;  4P73 A;  5HGQ A;  1NYQ A;  2I4O A;  2PMF A;  4OLF A;  4CS2 A;  1B7Y A;  4YRO A;  5ELN A;  1ADJ A;  2ZIM A;  2DQ0 A;  2G4C A;  2CJ9 A;  1JJC B;  2EJF A;  2ZR2 A;  4PG3 A;  3BFM A;  2EWN A;  1EVL A;  1E1O A;  3HXU A;  1H4T A;  1HXD A;  4K88 A;  5C51 B;  2DU5 A;  2CJA A;  1WNL A;  1X2G A;  4P3O A;  4P71 A;  1B70 B;  3RKX A;  3PCO A;  2ART A;  2ZIO A;  2I4M A;  2ALY B;  1YFR A;  3L2Z A;  4RMF A;  2J3M A;  4YCV A;  5ELO A;  5F5W A;  4RQE A;  3A5Z A;  2E65 A;  3HXZ A;  2ZTG A;  3HTZ A;  1L0W A;  3REU A;  4BW9 A;  3HRK A;  3PCO B;  1N9W A;  2CJB A;  2CGH A;  4YRE A;  4UPA A;  3MQZ A;  2EJ9 A;  2ZT6 A;  4YRL A;  3PZC A;  4H2X A;  2Q7H A;  4LVI A;  3M4P A;  4LVK A;  4UP7 A;  2ZZF A;  2FYK A;  3UGT A;  4P73 C;  3P8T A;  3G1Z A;  4P75 C;  4WJ3 M;  2ZNJ A;  4K86 A;  11AS A;  3ERR A;  2RHS B;  1QE0 A;  4HWP A;  4ZIB A;  4YRF A;  2ZGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...