3ICFA

Structure of protein serine/threonine phosphatase from saccharomyces cerevisiae with similarity to human phosphatase pp5
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
318
structure length
316
Chain Sequence
MSQEFISKMVNDLFLKGKYLPKKYVAAIISHADTLFRQEPSMVELENNSTPDVKISVCGDTHGQFYDVLNLFRKFGKVGPKHTYLFNGDFVDRGSWSCEVALLFYCLKILHPNNFFLNRGNHESDNMNKIYGFEDECKYKYSQRIFNMFAQSFESLPLATLINNDYLVMHGGLPSDPSATLSDFKNIDRFAQPPRDGAFMELLWADPQEANGMGPSQRGHAFGPDITDRFLRNNKLRKIFRSHELRMGGVQFEQKGKLMTVFSAPNYCDSQGNLGGVIHVVPGHGILQAGRNDDQNLIIETFEAVEHPDIKPMAYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Protein serine/threonine phosphatase from Saccharomyces cerevisiae with similarity to human phosphatase PP5
rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords Serine/threonine-protein phosphatase T
total genus 107
structure length 316
sequence length 318
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2009-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3icfA00
2AHDA 4LTYA 1G5BA 3RQZA 3AUZA 3RL3A 3K7VC 3GVEA 5J28A 4H2IA 2R17A 3PSOA 2WDDA 4ORAA 3CK2A 4I5NC 2KKNA 4O24A 3H60A 3EGHA 2P6BA 2IAEC 3HVQA 5HPEA 2Z06A 2XMOA 1S3LA 2Q8UA 3TGHA 5JPFA 2NXFA 3RL4A 1IT6A 2Z1AA 1OIEA 1XZWA 3H61A 2QFPA 1UF3A 3IB8A 3PSNA 4UT3A 1QFCA 5EQVA 1HPUA 1T70A 2YVTA 3T1IA 2BDXA 4I5LC 1M63A 4O43A 3QFNA 3IVDA 4JA9A 4WWLA 5DNYA 3DW8C 4H1SA 4IL1A 4H2FA 2HYPA 4J6OA 2JOGA 4LU9A 2BQ8X 2QFRA 2ZBMA 3C9FA 3H69A 4FBQA 4MOYA 1NNWA 2HYOA 3THNA 2WDEA 1FJMA 1HO5A 2IE3C 3JYFA 4H1YP 5B8IA 4TUGA 1S3MA 3P71C 1OIDA 3E7BA 2BCDA 2NPPC 2USHA 3EGGA 1II7A 4DHLA 3DSDA 5C1VA 1S3NA 4OR9A 4V0WA 3RL5A 5INBA 2Z72A 3H68A 3QFOA 3H64A 4ORBA 3V4YA 4XPNA 1XM7A 4FCXA 1S8EA 3QFMA 3H67A 2A22A 3QG5C 5JPEA 1WARA 2DFJA 4H2BA 4O4KA 1MF8A 4UWQA 3LL8A 3IVEA 3N5UA 1JK7A 2HY1A 1AUIA 4DSYA 2GJUA 4FBWA 1V73A 2IE4C 4FBKA 2CV9A 1U32A 3E7AA 3C5WC 4V0VA 4B2OA 4M0VA 4UT2A 3QFKA 1W24A 4MOVA 4DT2A 4LACC 1KBPA 4UT3B 1Z2XA 5IOHA 3IB7A 1SU1A 4KKZA 5JJTA 3ZTVA 1T71A 1UTEA 4JA7A 4HD0A 1HP1A 3KBPA 3AV0A 4KBPA 4TUIA 3DSCA 3H63A 1USHA 1OI8A 4ZX2A 4NZVA 4O5GA 2O8AA 1QHWA 1WAO1 2WDCA 4H2GA 4ZVZA 4V0XA 4F0ZA 3FGAC 4G9JA 5GTUA 3H62B 4IYPC 4MP0A 4YKEA 4ORCA 5F3WA 2NYLC 1S70A 3ICFA 4Q7FA 3ZU0A 1S95A 2WDFA 2O8GA 3THOB 2QJCA 3K7WC 1TCOA 3H66A 2NYMC 1Z2WA
chains in the Genus database with same CATH superfamily
2AHDA 4LTYA 1G5BA 3RQZA 3AUZA 3RL3A 3K7VC 3GVEA 5J28A 4H2IA 2R17A 3PSOA 2WDDA 4ORAA 3CK2A 4I5NC 2KKNA 4O24A 3H60A 3EGHA 2P6BA 2IAEC 3HVQA 5HPEA 2Z06A 2XMOA 1S3LA 2Q8UA 3TGHA 5JPFA 2NXFA 3RL4A 1IT6A 2Z1AA 1OIEA 1XZWA 3H61A 2QFPA 1UF3A 3IB8A 3PSNA 4UT3A 1QFCA 5EQVA 1HPUA 1T70A 2YVTA 3T1IA 2BDXA 4I5LC 1M63A 4O43A 3QFNA 3IVDA 4JA9A 4WWLA 5DNYA 3DW8C 4H1SA 4IL1A 4H2FA 2HYPA 4J6OA 2JOGA 4LU9A 2BQ8X 2QFRA 2ZBMA 3C9FA 3H69A 3D03A 4FBQA 4MOYA 1NNWA 2HYOA 3THNA 2WDEA 1FJMA 1HO5A 2IE3C 3JYFA 4H1YP 5B8IA 4TUGA 1S3MA 3P71C 1OIDA 3E7BA 2BCDA 2NPPC 2USHA 3EGGA 1II7A 2ZOAA 4DHLA 3DSDA 5C1VA 1S3NA 4OR9A 4V0WA 3RL5A 5INBA 2Z72A 3H68A 3QFOA 3H64A 4ORBA 3V4YA 2ZO9B 1XM7A 4XPNA 4FCXA 1S8EA 3QFMA 3H67A 2A22A 3QG5C 5JPEA 1WARA 2DFJA 4H2BA 4O4KA 1MF8A 4UWQA 3LL8A 3IVEA 3N5UA 1JK7A 2HY1A 1AUIA 4DSYA 2GJUA 4FBWA 1V73A 2IE4C 4FBKA 2CV9A 1U32A 3E0JA 3E7AA 3C5WC 4V0VA 4B2OA 4M0VA 4UT2A 3QFKA 1W24A 4MOVA 4DT2A 4LACC 1KBPA 4UT3B 1Z2XA 5IOHA 3IB7A 1SU1A 4KKZA 2DXLA 5JJTA 3ZTVA 3FLOA 1T71A 1UTEA 4JA7A 4HD0A 1HP1A 3KBPA 3AV0A 4KBPA 4TUIA 3DSCA 3H63A 1USHA 1OI8A 4ZX2A 4NZVA 4O5GA 2O8AA 2DXNA 1QHWA 1WAO1 2WDCA 4H2GA 4ZVZA 4V0XA 4F0ZA 3FGAC 4G9JA 5GTUA 3H62B 4IYPC 4MP0A 4YKEA 4ORCA 5F3WA 2NYLC 1S70A 3ICFA 4Q7FA 3ZU0A 1S95A 2WDFA 2O8GA 3THOB 2QJCA 3K7WC 1TCOA 3H66A 2NYMC 1Z2WA 2YEQA
chains in the Genus database with same CATH topology
2AHDA 4LTYA 1G5BA 3RQZA 3AUZA 3RL3A 3K7VC 3GVEA 5J28A 4H2IA 2R17A 3PSOA 2WDDA 4ORAA 3CK2A 4I5NC 2KKNA 4O24A 3H60A 3EGHA 2P6BA 2IAEC 3HVQA 5HPEA 2Z06A 2XMOA 1S3LA 2Q8UA 3TGHA 5JPFA 2NXFA 3RL4A 1IT6A 2Z1AA 1OIEA 1XZWA 3H61A 2QFPA 1UF3A 3IB8A 3PSNA 4UT3A 1QFCA 5EQVA 1HPUA 1T70A 2YVTA 3T1IA 2BDXA 4I5LC 1M63A 4O43A 3QFNA 3IVDA 4JA9A 4WWLA 5DNYA 3DW8C 4H1SA 4IL1A 4H2FA 2HYPA 4J6OA 2JOGA 4LU9A 2BQ8X 2QFRA 2ZBMA 3C9FA 3H69A 3D03A 4FBQA 4MOYA 1NNWA 2HYOA 3THNA 2WDEA 1FJMA 1HO5A 2IE3C 3JYFA 4H1YP 5B8IA 4TUGA 1S3MA 3P71C 1OIDA 3E7BA 2BCDA 2NPPC 2USHA 3EGGA 1II7A 2ZOAA 4DHLA 3DSDA 5C1VA 1S3NA 4OR9A 4V0WA 3RL5A 5INBA 2Z72A 3H68A 3QFOA 3H64A 4ORBA 3V4YA 2ZO9B 1XM7A 4XPNA 4FCXA 1S8EA 3QFMA 3H67A 2A22A 3QG5C 5JPEA 1WARA 2DFJA 4H2BA 4O4KA 1MF8A 4UWQA 3LL8A 3IVEA 3N5UA 1JK7A 2HY1A 1AUIA 4DSYA 2GJUA 4FBWA 1V73A 2IE4C 4FBKA 2CV9A 1U32A 3E0JA 3E7AA 3C5WC 4V0VA 4B2OA 4M0VA 4UT2A 3QFKA 1W24A 4MOVA 4DT2A 4LACC 1KBPA 4UT3B 1Z2XA 5IOHA 3IB7A 1SU1A 4KKZA 2DXLA 5JJTA 3ZTVA 3FLOA 1T71A 1UTEA 4JA7A 4HD0A 1HP1A 3KBPA 3AV0A 4KBPA 4TUIA 3DSCA 3H63A 1USHA 1OI8A 4ZX2A 4NZVA 4O5GA 2O8AA 2DXNA 1QHWA 1WAO1 2WDCA 4H2GA 4ZVZA 4V0XA 4F0ZA 3FGAC 4G9JA 5GTUA 3H62B 4IYPC 4MP0A 4YKEA 4ORCA 5F3WA 2NYLC 1S70A 3ICFA 4Q7FA 3ZU0A 1S95A 2WDFA 2O8GA 3THOB 2QJCA 3K7WC 1TCOA 3H66A 2NYMC 1Z2WA 2YEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AHD A;  4LTY A;  1G5B A;  3RQZ A;  3AUZ A;  3RL3 A;  3K7V C;  3GVE A;  5J28 A;  4H2I A;  2R17 A;  3PSO A;  2WDD A;  4ORA A;  3CK2 A;  4I5N C;  2KKN A;  4O24 A;  3H60 A;  3EGH A;  2P6B A;  2IAE C;  3HVQ A;  5HPE A;  2Z06 A;  2XMO A;  1S3L A;  2Q8U A;  3TGH A;  5JPF A;  2NXF A;  3RL4 A;  1IT6 A;  2Z1A A;  1OIE A;  1XZW A;  3H61 A;  2QFP A;  1UF3 A;  3IB8 A;  3PSN A;  4UT3 A;  1QFC A;  5EQV A;  1HPU A;  1T70 A;  2YVT A;  3T1I A;  2BDX A;  4I5L C;  1M63 A;  4O43 A;  3QFN A;  3IVD A;  4JA9 A;  4WWL A;  5DNY A;  3DW8 C;  4H1S A;  4IL1 A;  4H2F A;  2HYP A;  4J6O A;  2JOG A;  4LU9 A;  2BQ8 X;  2QFR A;  2ZBM A;  3C9F A;  3H69 A;  4FBQ A;  4MOY A;  1NNW A;  2HYO A;  3THN A;  2WDE A;  1FJM A;  1HO5 A;  2IE3 C;  3JYF A;  4H1Y P;  5B8I A;  4TUG A;  1S3M A;  3P71 C;  1OID A;  3E7B A;  2BCD A;  2NPP C;  2USH A;  3EGG A;  1II7 A;  4DHL A;  3DSD A;  5C1V A;  1S3N A;  4OR9 A;  4V0W A;  3RL5 A;  5INB A;  2Z72 A;  3H68 A;  3QFO A;  3H64 A;  4ORB A;  3V4Y A;  4XPN A;  1XM7 A;  4FCX A;  1S8E A;  3QFM A;  3H67 A;  2A22 A;  3QG5 C;  5JPE A;  1WAR A;  2DFJ A;  4H2B A;  4O4K A;  1MF8 A;  4UWQ A;  3LL8 A;  3IVE A;  3N5U A;  1JK7 A;  2HY1 A;  1AUI A;  4DSY A;  2GJU A;  4FBW A;  1V73 A;  2IE4 C;  4FBK A;  2CV9 A;  1U32 A;  3E7A A;  3C5W C;  4V0V A;  4B2O A;  4M0V A;  4UT2 A;  3QFK A;  1W24 A;  4MOV A;  4DT2 A;  4LAC C;  1KBP A;  4UT3 B;  1Z2X A;  5IOH A;  3IB7 A;  1SU1 A;  4KKZ A;  5JJT A;  3ZTV A;  1T71 A;  1UTE A;  4JA7 A;  4HD0 A;  1HP1 A;  3KBP A;  3AV0 A;  4KBP A;  4TUI A;  3DSC A;  3H63 A;  1USH A;  1OI8 A;  4ZX2 A;  4NZV A;  4O5G A;  2O8A A;  1QHW A;  1WAO 1;  2WDC A;  4H2G A;  4ZVZ A;  4V0X A;  4F0Z A;  3FGA C;  4G9J A;  5GTU A;  3H62 B;  4IYP C;  4MP0 A;  4YKE A;  4ORC A;  5F3W A;  2NYL C;  1S70 A;  3ICF A;  4Q7F A;  3ZU0 A;  1S95 A;  2WDF A;  2O8G A;  3THO B;  2QJC A;  3K7W C;  1TCO A;  3H66 A;  2NYM C;  1Z2W A; 
#chains in the Genus database with same CATH topology
 2AHD A;  4LTY A;  1G5B A;  3RQZ A;  3AUZ A;  3RL3 A;  3K7V C;  3GVE A;  5J28 A;  4H2I A;  2R17 A;  3PSO A;  2WDD A;  4ORA A;  3CK2 A;  4I5N C;  2KKN A;  4O24 A;  3H60 A;  3EGH A;  2P6B A;  2IAE C;  3HVQ A;  5HPE A;  2Z06 A;  2XMO A;  1S3L A;  2Q8U A;  3TGH A;  5JPF A;  2NXF A;  3RL4 A;  1IT6 A;  2Z1A A;  1OIE A;  1XZW A;  3H61 A;  2QFP A;  1UF3 A;  3IB8 A;  3PSN A;  4UT3 A;  1QFC A;  5EQV A;  1HPU A;  1T70 A;  2YVT A;  3T1I A;  2BDX A;  4I5L C;  1M63 A;  4O43 A;  3QFN A;  3IVD A;  4JA9 A;  4WWL A;  5DNY A;  3DW8 C;  4H1S A;  4IL1 A;  4H2F A;  2HYP A;  4J6O A;  2JOG A;  4LU9 A;  2BQ8 X;  2QFR A;  2ZBM A;  3C9F A;  3H69 A;  3D03 A;  4FBQ A;  4MOY A;  1NNW A;  2HYO A;  3THN A;  2WDE A;  1FJM A;  1HO5 A;  2IE3 C;  3JYF A;  4H1Y P;  5B8I A;  4TUG A;  1S3M A;  3P71 C;  1OID A;  3E7B A;  2BCD A;  2NPP C;  2USH A;  3EGG A;  1II7 A;  2ZOA A;  4DHL A;  3DSD A;  5C1V A;  1S3N A;  4OR9 A;  4V0W A;  3RL5 A;  5INB A;  2Z72 A;  3H68 A;  3QFO A;  3H64 A;  4ORB A;  3V4Y A;  2ZO9 B;  1XM7 A;  4XPN A;  4FCX A;  1S8E A;  3QFM A;  3H67 A;  2A22 A;  3QG5 C;  5JPE A;  1WAR A;  2DFJ A;  4H2B A;  4O4K A;  1MF8 A;  4UWQ A;  3LL8 A;  3IVE A;  3N5U A;  1JK7 A;  2HY1 A;  1AUI A;  4DSY A;  2GJU A;  4FBW A;  1V73 A;  2IE4 C;  4FBK A;  2CV9 A;  1U32 A;  3E0J A;  3E7A A;  3C5W C;  4V0V A;  4B2O A;  4M0V A;  4UT2 A;  3QFK A;  1W24 A;  4MOV A;  4DT2 A;  4LAC C;  1KBP A;  4UT3 B;  1Z2X A;  5IOH A;  3IB7 A;  1SU1 A;  4KKZ A;  2DXL A;  5JJT A;  3ZTV A;  3FLO A;  1T71 A;  1UTE A;  4JA7 A;  4HD0 A;  1HP1 A;  3KBP A;  3AV0 A;  4KBP A;  4TUI A;  3DSC A;  3H63 A;  1USH A;  1OI8 A;  4ZX2 A;  4NZV A;  4O5G A;  2O8A A;  2DXN A;  1QHW A;  1WAO 1;  2WDC A;  4H2G A;  4ZVZ A;  4V0X A;  4F0Z A;  3FGA C;  4G9J A;  5GTU A;  3H62 B;  4IYP C;  4MP0 A;  4YKE A;  4ORC A;  5F3W A;  2NYL C;  1S70 A;  3ICF A;  4Q7F A;  3ZU0 A;  1S95 A;  2WDF A;  2O8G A;  3THO B;  2QJC A;  3K7W C;  1TCO A;  3H66 A;  2NYM C;  1Z2W A;  2YEQ A; 
#chains in the Genus database with same CATH homology
 2AHD A;  4LTY A;  1G5B A;  3RQZ A;  3AUZ A;  3RL3 A;  3K7V C;  3GVE A;  5J28 A;  4H2I A;  2R17 A;  3PSO A;  2WDD A;  4ORA A;  3CK2 A;  4I5N C;  2KKN A;  4O24 A;  3H60 A;  3EGH A;  2P6B A;  2IAE C;  3HVQ A;  5HPE A;  2Z06 A;  2XMO A;  1S3L A;  2Q8U A;  3TGH A;  5JPF A;  2NXF A;  3RL4 A;  1IT6 A;  2Z1A A;  1OIE A;  1XZW A;  3H61 A;  2QFP A;  1UF3 A;  3IB8 A;  3PSN A;  4UT3 A;  1QFC A;  5EQV A;  1HPU A;  1T70 A;  2YVT A;  3T1I A;  2BDX A;  4I5L C;  1M63 A;  4O43 A;  3QFN A;  3IVD A;  4JA9 A;  4WWL A;  5DNY A;  3DW8 C;  4H1S A;  4IL1 A;  4H2F A;  2HYP A;  4J6O A;  2JOG A;  4LU9 A;  2BQ8 X;  2QFR A;  2ZBM A;  3C9F A;  3H69 A;  3D03 A;  4FBQ A;  4MOY A;  1NNW A;  2HYO A;  3THN A;  2WDE A;  1FJM A;  1HO5 A;  2IE3 C;  3JYF A;  4H1Y P;  5B8I A;  4TUG A;  1S3M A;  3P71 C;  1OID A;  3E7B A;  2BCD A;  2NPP C;  2USH A;  3EGG A;  1II7 A;  2ZOA A;  4DHL A;  3DSD A;  5C1V A;  1S3N A;  4OR9 A;  4V0W A;  3RL5 A;  5INB A;  2Z72 A;  3H68 A;  3QFO A;  3H64 A;  4ORB A;  3V4Y A;  2ZO9 B;  1XM7 A;  4XPN A;  4FCX A;  1S8E A;  3QFM A;  3H67 A;  2A22 A;  3QG5 C;  5JPE A;  1WAR A;  2DFJ A;  4H2B A;  4O4K A;  1MF8 A;  4UWQ A;  3LL8 A;  3IVE A;  3N5U A;  1JK7 A;  2HY1 A;  1AUI A;  4DSY A;  2GJU A;  4FBW A;  1V73 A;  2IE4 C;  4FBK A;  2CV9 A;  1U32 A;  3E0J A;  3E7A A;  3C5W C;  4V0V A;  4B2O A;  4M0V A;  4UT2 A;  3QFK A;  1W24 A;  4MOV A;  4DT2 A;  4LAC C;  1KBP A;  4UT3 B;  1Z2X A;  5IOH A;  3IB7 A;  1SU1 A;  4KKZ A;  2DXL A;  5JJT A;  3ZTV A;  3FLO A;  1T71 A;  1UTE A;  4JA7 A;  4HD0 A;  1HP1 A;  3KBP A;  3AV0 A;  4KBP A;  4TUI A;  3DSC A;  3H63 A;  1USH A;  1OI8 A;  4ZX2 A;  4NZV A;  4O5G A;  2O8A A;  2DXN A;  1QHW A;  1WAO 1;  2WDC A;  4H2G A;  4ZVZ A;  4V0X A;  4F0Z A;  3FGA C;  4G9J A;  5GTU A;  3H62 B;  4IYP C;  4MP0 A;  4YKE A;  4ORC A;  5F3W A;  2NYL C;  1S70 A;  3ICF A;  4Q7F A;  3ZU0 A;  1S95 A;  2WDF A;  2O8G A;  3THO B;  2QJC A;  3K7W C;  1TCO A;  3H66 A;  2NYM C;  1Z2W A;  2YEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...