3ICFA

Structure of protein serine/threonine phosphatase from saccharomyces cerevisiae with similarity to human phosphatase pp5
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
318
structure length
316
Chain Sequence
MSQEFISKMVNDLFLKGKYLPKKYVAAIISHADTLFRQEPSMVELENNSTPDVKISVCGDTHGQFYDVLNLFRKFGKVGPKHTYLFNGDFVDRGSWSCEVALLFYCLKILHPNNFFLNRGNHESDNMNKIYGFEDECKYKYSQRIFNMFAQSFESLPLATLINNDYLVMHGGLPSDPSATLSDFKNIDRFAQPPRDGAFMELLWADPQEANGMGPSQRGHAFGPDITDRFLRNNKLRKIFRSHELRMGGVQFEQKGKLMTVFSAPNYCDSQGNLGGVIHVVPGHGILQAGRNDDQNLIIETFEAVEHPDIKPMAYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase T
publication title Structure of Protein serine/threonine phosphatase from Saccharomyces cerevisiae with similarity to human phosphatase PP5
rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 107
structure length 316
sequence length 318
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2009-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3icfA00
4UWQA 4YKEA 3PSOA 2BDXA 1W24A 1SU1A 2KKNA 3H62B 1S8EA 2NXFA 1OIDA 3KBPA 4UT3A 2WDEA 3CK2A 3QFOA 2DFJA 3H68A 3E7AA 1G5BA 4DHLA 2BCDA 2ZBMA 2Z1AA 3TGHA 4FBQA 4O43A 3AV0A 3AUZA 4XPNA 1II7A 1S95A 4OR9A 1HP1A 2O8GA 3H69A 4MOYA 4IYPC 3LL8A 3EGGA 1S3LA 3H63A 3K7WC 4O24A 1V73A 4HD0A 4O4KA 2XMOA 2YVTA 2GJUA 3IB7A 1T71A 3THNA 3DW8C 3RL5A 3QG5C 5DNYA 3E7BA 1Z2XA 2WDFA 4H2BA 1QHWA 4H2IA 3T1IA 2USHA 3ZU0A 4V0VA 4LU9A 2HYPA 3H67A 4UT2A 3RL4A 1HPUA 4O5GA 1MF8A 1UTEA 5J28A 1IT6A 3FGAC 2JOGA 3H64A 4FBWA 1HO5A 2O8AA 1XZWA 2NYLC 3JYFA 4Q7FA 5C1VA 3RL3A 3QFMA 4G9JA 4UT3B 3THOB 1XM7A 2Q8UA 4I5NC 3P71C 2CV9A 3H66A 4M0VA 2QJCA 4IL1A 4H1SA 4F0ZA 1WAO1 3EGHA 2Z06A 4JA9A 1M63A 1TCOA 3N5UA 4H1YP 1KBPA 2AHDA 4TUGA 4B2OA 4H2FA 4DT2A 2Z72A 1WARA 2NYMC 3PSNA 3ZTVA 1Z2WA 5F3WA 4ORBA 3RQZA 2R17A 1NNWA 3DSCA 4V0WA 5GTUA 2HYOA 3HVQA 4FCXA 2QFPA 5INBA 3DSDA 1QFCA 2HY1A 2IAEC 2A22A 3QFNA 3IVEA 4I5LC 4FBKA 4WWLA 4ZX2A 1FJMA 3GVEA 4ORAA 3H60A 5EQVA 1S3MA 4JA7A 1USHA 4MOVA 4MP0A 4KBPA 4NZVA 3V4YA 5JJTA 2P6BA 3H61A 3C5WC 4ZVZA 5IOHA 4TUIA 3IB8A 1U32A 1AUIA 5JPEA 2WDDA 3C9FA 5JPFA 2WDCA 4H2GA 1S3NA 1OI8A 1UF3A 3IVDA 4DSYA 4LACC 4LTYA 2QFRA 4ORCA 4V0XA 2BQ8X 4J6OA 1S70A 5B8IA 5HPEA 4KKZA 2IE4C 3ICFA 2IE3C 3QFKA 1JK7A 2NPPC 1OIEA 1T70A 3K7VC
chains in the Genus database with same CATH superfamily
4UWQA 4YKEA 3PSOA 3D03A 2BDXA 1W24A 1SU1A 2KKNA 3H62B 1S8EA 2NXFA 1OIDA 3KBPA 4UT3A 2WDEA 3CK2A 3QFOA 2DFJA 3H68A 3E7AA 1G5BA 4DHLA 2BCDA 2ZBMA 2Z1AA 3TGHA 4FBQA 4O43A 3AV0A 3AUZA 4XPNA 1II7A 1S95A 4OR9A 1HP1A 2O8GA 3H69A 4MOYA 4IYPC 3LL8A 3EGGA 1S3LA 3H63A 3K7WC 4O24A 1V73A 4HD0A 4O4KA 2XMOA 2GJUA 2YVTA 3IB7A 1T71A 3THNA 3DW8C 3RL5A 3QG5C 5DNYA 3E7BA 1Z2XA 2WDFA 4H2BA 1QHWA 4H2IA 3T1IA 2USHA 3ZU0A 4V0VA 4LU9A 2HYPA 3H67A 2YEQA 2ZO9B 4UT2A 3RL4A 1HPUA 4O5GA 1MF8A 1UTEA 5J28A 1IT6A 3FGAC 2JOGA 3H64A 4FBWA 1HO5A 2O8AA 1XZWA 2NYLC 3FLOA 3JYFA 4Q7FA 3E0JA 5C1VA 3QFMA 3RL3A 4G9JA 4UT3B 3THOB 1XM7A 2Q8UA 4I5NC 3P71C 2CV9A 3H66A 4M0VA 2QJCA 4IL1A 4H1SA 4F0ZA 1WAO1 3EGHA 2Z06A 4JA9A 1M63A 1TCOA 3N5UA 4H1YP 1KBPA 2AHDA 4TUGA 4B2OA 4H2FA 4DT2A 2Z72A 1WARA 2NYMC 3PSNA 3ZTVA 1Z2WA 5F3WA 4ORBA 3RQZA 2R17A 1NNWA 3DSCA 4V0WA 5GTUA 2HYOA 3HVQA 4FCXA 2QFPA 5INBA 3DSDA 1QFCA 2HY1A 2IAEC 2A22A 3QFNA 2ZOAA 3IVEA 4I5LC 4FBKA 4WWLA 4ZX2A 1FJMA 3GVEA 4ORAA 3H60A 5EQVA 1S3MA 2DXNA 4JA7A 1USHA 4MOVA 4MP0A 4KBPA 4NZVA 3V4YA 5JJTA 2P6BA 3H61A 3C5WC 4ZVZA 5IOHA 4TUIA 3IB8A 1U32A 1AUIA 5JPEA 2WDDA 3C9FA 5JPFA 2WDCA 4H2GA 1S3NA 1OI8A 1UF3A 3IVDA 4DSYA 4LACC 4LTYA 2DXLA 2QFRA 4ORCA 4V0XA 2BQ8X 4J6OA 1S70A 5B8IA 5HPEA 4KKZA 2IE4C 3ICFA 2IE3C 3QFKA 1JK7A 2NPPC 1OIEA 1T70A 3K7VC
chains in the Genus database with same CATH topology
4UWQA 4YKEA 3PSOA 3D03A 2BDXA 1W24A 1SU1A 2KKNA 3H62B 1S8EA 2NXFA 1OIDA 3KBPA 4UT3A 2WDEA 3CK2A 3QFOA 2DFJA 3H68A 3E7AA 1G5BA 4DHLA 2BCDA 2ZBMA 2Z1AA 3TGHA 4FBQA 4O43A 3AV0A 3AUZA 4XPNA 1II7A 1S95A 4OR9A 1HP1A 2O8GA 3H69A 4MOYA 4IYPC 3LL8A 3EGGA 1S3LA 3H63A 3K7WC 4O24A 1V73A 4HD0A 4O4KA 2XMOA 2GJUA 2YVTA 3IB7A 1T71A 3THNA 3DW8C 3RL5A 3QG5C 5DNYA 3E7BA 1Z2XA 2WDFA 4H2BA 1QHWA 4H2IA 3T1IA 2USHA 3ZU0A 4V0VA 4LU9A 2HYPA 3H67A 2YEQA 2ZO9B 4UT2A 3RL4A 1HPUA 4O5GA 1MF8A 1UTEA 5J28A 1IT6A 3FGAC 2JOGA 3H64A 4FBWA 1HO5A 2O8AA 1XZWA 2NYLC 3FLOA 3JYFA 4Q7FA 3E0JA 5C1VA 3QFMA 3RL3A 4G9JA 4UT3B 3THOB 1XM7A 2Q8UA 4I5NC 3P71C 2CV9A 3H66A 4M0VA 2QJCA 4IL1A 4H1SA 4F0ZA 1WAO1 3EGHA 2Z06A 4JA9A 1M63A 1TCOA 3N5UA 4H1YP 1KBPA 2AHDA 4TUGA 4B2OA 4H2FA 4DT2A 2Z72A 1WARA 2NYMC 3PSNA 3ZTVA 1Z2WA 5F3WA 4ORBA 3RQZA 2R17A 1NNWA 3DSCA 4V0WA 5GTUA 2HYOA 3HVQA 4FCXA 2QFPA 5INBA 3DSDA 1QFCA 2HY1A 2IAEC 2A22A 3QFNA 2ZOAA 3IVEA 4I5LC 4FBKA 4WWLA 4ZX2A 1FJMA 3GVEA 4ORAA 3H60A 5EQVA 1S3MA 2DXNA 4JA7A 1USHA 4MOVA 4MP0A 4KBPA 4NZVA 3V4YA 5JJTA 2P6BA 3H61A 3C5WC 4ZVZA 5IOHA 4TUIA 3IB8A 1U32A 1AUIA 5JPEA 2WDDA 3C9FA 5JPFA 2WDCA 4H2GA 1S3NA 1OI8A 1UF3A 3IVDA 4DSYA 4LACC 4LTYA 2DXLA 2QFRA 4ORCA 4V0XA 2BQ8X 4J6OA 1S70A 5B8IA 5HPEA 4KKZA 2IE4C 3ICFA 2IE3C 3QFKA 1JK7A 2NPPC 1OIEA 1T70A 3K7VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UWQ A;  4YKE A;  3PSO A;  2BDX A;  1W24 A;  1SU1 A;  2KKN A;  3H62 B;  1S8E A;  2NXF A;  1OID A;  3KBP A;  4UT3 A;  2WDE A;  3CK2 A;  3QFO A;  2DFJ A;  3H68 A;  3E7A A;  1G5B A;  4DHL A;  2BCD A;  2ZBM A;  2Z1A A;  3TGH A;  4FBQ A;  4O43 A;  3AV0 A;  3AUZ A;  4XPN A;  1II7 A;  1S95 A;  4OR9 A;  1HP1 A;  2O8G A;  3H69 A;  4MOY A;  4IYP C;  3LL8 A;  3EGG A;  1S3L A;  3H63 A;  3K7W C;  4O24 A;  1V73 A;  4HD0 A;  4O4K A;  2XMO A;  2YVT A;  2GJU A;  3IB7 A;  1T71 A;  3THN A;  3DW8 C;  3RL5 A;  3QG5 C;  5DNY A;  3E7B A;  1Z2X A;  2WDF A;  4H2B A;  1QHW A;  4H2I A;  3T1I A;  2USH A;  3ZU0 A;  4V0V A;  4LU9 A;  2HYP A;  3H67 A;  4UT2 A;  3RL4 A;  1HPU A;  4O5G A;  1MF8 A;  1UTE A;  5J28 A;  1IT6 A;  3FGA C;  2JOG A;  3H64 A;  4FBW A;  1HO5 A;  2O8A A;  1XZW A;  2NYL C;  3JYF A;  4Q7F A;  5C1V A;  3RL3 A;  3QFM A;  4G9J A;  4UT3 B;  3THO B;  1XM7 A;  2Q8U A;  4I5N C;  3P71 C;  2CV9 A;  3H66 A;  4M0V A;  2QJC A;  4IL1 A;  4H1S A;  4F0Z A;  1WAO 1;  3EGH A;  2Z06 A;  4JA9 A;  1M63 A;  1TCO A;  3N5U A;  4H1Y P;  1KBP A;  2AHD A;  4TUG A;  4B2O A;  4H2F A;  4DT2 A;  2Z72 A;  1WAR A;  2NYM C;  3PSN A;  3ZTV A;  1Z2W A;  5F3W A;  4ORB A;  3RQZ A;  2R17 A;  1NNW A;  3DSC A;  4V0W A;  5GTU A;  2HYO A;  3HVQ A;  4FCX A;  2QFP A;  5INB A;  3DSD A;  1QFC A;  2HY1 A;  2IAE C;  2A22 A;  3QFN A;  3IVE A;  4I5L C;  4FBK A;  4WWL A;  4ZX2 A;  1FJM A;  3GVE A;  4ORA A;  3H60 A;  5EQV A;  1S3M A;  4JA7 A;  1USH A;  4MOV A;  4MP0 A;  4KBP A;  4NZV A;  3V4Y A;  5JJT A;  2P6B A;  3H61 A;  3C5W C;  4ZVZ A;  5IOH A;  4TUI A;  3IB8 A;  1U32 A;  1AUI A;  5JPE A;  2WDD A;  3C9F A;  5JPF A;  2WDC A;  4H2G A;  1S3N A;  1OI8 A;  1UF3 A;  3IVD A;  4DSY A;  4LAC C;  4LTY A;  2QFR A;  4ORC A;  4V0X A;  2BQ8 X;  4J6O A;  1S70 A;  5B8I A;  5HPE A;  4KKZ A;  2IE4 C;  3ICF A;  2IE3 C;  3QFK A;  1JK7 A;  2NPP C;  1OIE A;  1T70 A;  3K7V C; 
#chains in the Genus database with same CATH topology
 4UWQ A;  4YKE A;  3PSO A;  3D03 A;  2BDX A;  1W24 A;  1SU1 A;  2KKN A;  3H62 B;  1S8E A;  2NXF A;  1OID A;  3KBP A;  4UT3 A;  2WDE A;  3CK2 A;  3QFO A;  2DFJ A;  3H68 A;  3E7A A;  1G5B A;  4DHL A;  2BCD A;  2ZBM A;  2Z1A A;  3TGH A;  4FBQ A;  4O43 A;  3AV0 A;  3AUZ A;  4XPN A;  1II7 A;  1S95 A;  4OR9 A;  1HP1 A;  2O8G A;  3H69 A;  4MOY A;  4IYP C;  3LL8 A;  3EGG A;  1S3L A;  3H63 A;  3K7W C;  4O24 A;  1V73 A;  4HD0 A;  4O4K A;  2XMO A;  2GJU A;  2YVT A;  3IB7 A;  1T71 A;  3THN A;  3DW8 C;  3RL5 A;  3QG5 C;  5DNY A;  3E7B A;  1Z2X A;  2WDF A;  4H2B A;  1QHW A;  4H2I A;  3T1I A;  2USH A;  3ZU0 A;  4V0V A;  4LU9 A;  2HYP A;  3H67 A;  2YEQ A;  2ZO9 B;  4UT2 A;  3RL4 A;  1HPU A;  4O5G A;  1MF8 A;  1UTE A;  5J28 A;  1IT6 A;  3FGA C;  2JOG A;  3H64 A;  4FBW A;  1HO5 A;  2O8A A;  1XZW A;  2NYL C;  3FLO A;  3JYF A;  4Q7F A;  3E0J A;  5C1V A;  3QFM A;  3RL3 A;  4G9J A;  4UT3 B;  3THO B;  1XM7 A;  2Q8U A;  4I5N C;  3P71 C;  2CV9 A;  3H66 A;  4M0V A;  2QJC A;  4IL1 A;  4H1S A;  4F0Z A;  1WAO 1;  3EGH A;  2Z06 A;  4JA9 A;  1M63 A;  1TCO A;  3N5U A;  4H1Y P;  1KBP A;  2AHD A;  4TUG A;  4B2O A;  4H2F A;  4DT2 A;  2Z72 A;  1WAR A;  2NYM C;  3PSN A;  3ZTV A;  1Z2W A;  5F3W A;  4ORB A;  3RQZ A;  2R17 A;  1NNW A;  3DSC A;  4V0W A;  5GTU A;  2HYO A;  3HVQ A;  4FCX A;  2QFP A;  5INB A;  3DSD A;  1QFC A;  2HY1 A;  2IAE C;  2A22 A;  3QFN A;  2ZOA A;  3IVE A;  4I5L C;  4FBK A;  4WWL A;  4ZX2 A;  1FJM A;  3GVE A;  4ORA A;  3H60 A;  5EQV A;  1S3M A;  2DXN A;  4JA7 A;  1USH A;  4MOV A;  4MP0 A;  4KBP A;  4NZV A;  3V4Y A;  5JJT A;  2P6B A;  3H61 A;  3C5W C;  4ZVZ A;  5IOH A;  4TUI A;  3IB8 A;  1U32 A;  1AUI A;  5JPE A;  2WDD A;  3C9F A;  5JPF A;  2WDC A;  4H2G A;  1S3N A;  1OI8 A;  1UF3 A;  3IVD A;  4DSY A;  4LAC C;  4LTY A;  2DXL A;  2QFR A;  4ORC A;  4V0X A;  2BQ8 X;  4J6O A;  1S70 A;  5B8I A;  5HPE A;  4KKZ A;  2IE4 C;  3ICF A;  2IE3 C;  3QFK A;  1JK7 A;  2NPP C;  1OIE A;  1T70 A;  3K7V C; 
#chains in the Genus database with same CATH homology
 4UWQ A;  4YKE A;  3PSO A;  3D03 A;  2BDX A;  1W24 A;  1SU1 A;  2KKN A;  3H62 B;  1S8E A;  2NXF A;  1OID A;  3KBP A;  4UT3 A;  2WDE A;  3CK2 A;  3QFO A;  2DFJ A;  3H68 A;  3E7A A;  1G5B A;  4DHL A;  2BCD A;  2ZBM A;  2Z1A A;  3TGH A;  4FBQ A;  4O43 A;  3AV0 A;  3AUZ A;  4XPN A;  1II7 A;  1S95 A;  4OR9 A;  1HP1 A;  2O8G A;  3H69 A;  4MOY A;  4IYP C;  3LL8 A;  3EGG A;  1S3L A;  3H63 A;  3K7W C;  4O24 A;  1V73 A;  4HD0 A;  4O4K A;  2XMO A;  2GJU A;  2YVT A;  3IB7 A;  1T71 A;  3THN A;  3DW8 C;  3RL5 A;  3QG5 C;  5DNY A;  3E7B A;  1Z2X A;  2WDF A;  4H2B A;  1QHW A;  4H2I A;  3T1I A;  2USH A;  3ZU0 A;  4V0V A;  4LU9 A;  2HYP A;  3H67 A;  2YEQ A;  2ZO9 B;  4UT2 A;  3RL4 A;  1HPU A;  4O5G A;  1MF8 A;  1UTE A;  5J28 A;  1IT6 A;  3FGA C;  2JOG A;  3H64 A;  4FBW A;  1HO5 A;  2O8A A;  1XZW A;  2NYL C;  3FLO A;  3JYF A;  4Q7F A;  3E0J A;  5C1V A;  3QFM A;  3RL3 A;  4G9J A;  4UT3 B;  3THO B;  1XM7 A;  2Q8U A;  4I5N C;  3P71 C;  2CV9 A;  3H66 A;  4M0V A;  2QJC A;  4IL1 A;  4H1S A;  4F0Z A;  1WAO 1;  3EGH A;  2Z06 A;  4JA9 A;  1M63 A;  1TCO A;  3N5U A;  4H1Y P;  1KBP A;  2AHD A;  4TUG A;  4B2O A;  4H2F A;  4DT2 A;  2Z72 A;  1WAR A;  2NYM C;  3PSN A;  3ZTV A;  1Z2W A;  5F3W A;  4ORB A;  3RQZ A;  2R17 A;  1NNW A;  3DSC A;  4V0W A;  5GTU A;  2HYO A;  3HVQ A;  4FCX A;  2QFP A;  5INB A;  3DSD A;  1QFC A;  2HY1 A;  2IAE C;  2A22 A;  3QFN A;  2ZOA A;  3IVE A;  4I5L C;  4FBK A;  4WWL A;  4ZX2 A;  1FJM A;  3GVE A;  4ORA A;  3H60 A;  5EQV A;  1S3M A;  2DXN A;  4JA7 A;  1USH A;  4MOV A;  4MP0 A;  4KBP A;  4NZV A;  3V4Y A;  5JJT A;  2P6B A;  3H61 A;  3C5W C;  4ZVZ A;  5IOH A;  4TUI A;  3IB8 A;  1U32 A;  1AUI A;  5JPE A;  2WDD A;  3C9F A;  5JPF A;  2WDC A;  4H2G A;  1S3N A;  1OI8 A;  1UF3 A;  3IVD A;  4DSY A;  4LAC C;  4LTY A;  2DXL A;  2QFR A;  4ORC A;  4V0X A;  2BQ8 X;  4J6O A;  1S70 A;  5B8I A;  5HPE A;  4KKZ A;  2IE4 C;  3ICF A;  2IE3 C;  3QFK A;  1JK7 A;  2NPP C;  1OIE A;  1T70 A;  3K7V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...