3ICUA

Protease-associated domain of the e3 ligase grail
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
171
structure length
171
Chain Sequence
GAMDGAEAVWTAYLNVSWRVPHTGVNRTVWELSEEGVYGQDSPLEPVAGVLVPPDGPGALNACNPHTNFTVPTVWGSTVQVSWLALIQRGGGCTFADKIHLAYERGASGAVIFNFPGTRNEVIPMSHPGAVDIVAIMIGNLKGTKILQSIQRGIQVTMVIEVGKKHGPWVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title PA Domain of the E3 Ligase Grail
rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase RNF128
total genus 42
structure length 171
sequence length 171
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2009-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3icuA01
2JBJA 2XEGA 4OC1A 3S9LA 4C85A 4C84A 4C86A 1WVMA 5ELYA 4C9RA 3KASA 4NGSA 3VTAA 1V6CA 3FF3A 1XF1A 4TJXA 3FECA 4TJVA 4P4EA 4MCRA 4W9YA 3SJXA 4JZ0A 2C6GA 2C6PA 3ICUA 4MCQA 2CIJA 4X3RA 4C8AA 3IIBA 4MCSA 2EK8A 2PVWA 3FEEA 3S9NA 3I6SA 4KNGE 3EIFA 4P4FA 4YN3A 3FEDA 1CX8A 4C8FA 2PVVA 4P4DA 2C6CA 3BI0A 4OC2A 2XEJA 3SJFA 4OC3A 3S9MA 4JYWA 4OC4A 3SJEA 3I74A 4C9UA 4MCPA 3BXMA 4C99A 4C8TA 4CDJA 4LQGA 3SJGA 3RBUA 4NGRA 4P44A 2OOTA 5IB9A 3BI1A 4NGPA 4NGQA 4P45A 4OC0A 1Z8LA 5F09A 3D7DA 4OMEA 4C8PA 3BHXA 2OR4A 2XEIA 1DE4C 2JBKA 4NGMA 2EK9A 5D29A 4C9AA 3IWWA 4P4BA 4OC5A 4C8UA 3D7FA 4NGTA 1Y9ZA 4C9EA 4C8CA 3D7GA 4CDKA 4P4IA 4TWEA 4C9VA 3D7HA 2XEFA 4P4JA 4NGNA
chains in the Genus database with same CATH superfamily
2JBJA 2XEGA 4OC1A 3S9LA 1EZBA 4M8DA 4C85A 3TLBA 4C84A 1M6VB 4C86A 1CS0B 1WVMA 5ELYA 4C9RA 1EZAA 1ZYMA 3KASA 4NGSA 3TLCA 3VTAA 1V6CA 2B0AA 1KBLA 3FF3A 1XF1A 3EZEA 4TJXA 3FECA 3C8OA 4TJVA 4P4EA 3TLGA 4MCRA 4EYSA 4W9YA 3SJXA 1KC7A 2X0SA 4JZ0A 2C6GA 4MI1A 2C6PA 4H1HA 4IIYA 3TLEA 3ICUA 4MCQA 3U1BA 2CIJA 1ZRSA 4X3RA 4INJA 4C8AA 2EZCA 3IIBA 4MCSA 3T0TA 2EK8A 2YJVA 2GP4A 2PVWA 3GJZA 5IR2A 3FEEA 1ZL0A 1J3LA 4E5SA 3S9NA 3I6SA 4KNGE 3EIFA 1VI4A 4P4FA 4YN3A 3FEDA 3K9TA 1NBWA 1CX8A 3T5MA 3TLZA 4C8FA 2PVVA 4JVOA 4P4DA 2C6CA 1JDBC 3NOJA 3BI0A 4OC2A 2XEJA 1C3OB 2AUMA 3EZBA 3EZAA 4OC3A 3SJFA 1T36B 3S9MA 1JDEA 2EZAA 4IIXA 4JYWA 4OC4A 3SJEA 3I74A 4C9UA 3G23A 4MCPA 3BXMA 4COBA 1KEEB 1Q5XA 4CO9A 5K99A 4C99A 2HROA 4C8TA 4CDJA 4LQGA 2AUNA 1A9XB 5F9MA 3SJGA 3RBUA 4NGRA 4J0NA 1C30B 2EZBA 2D0OA 2R82A 3TYXA 4P44A 2C5QA 4E94A 5JVLA 2OOTA 1R61A 5IB9A 3TLYA 5FD8A 4MJXA 3BI1A 4NGPA 4NGQA 4P45A 4OC0A 2YJTA 5F5XA 2PCNA 1Z8LA 5F09A 3D7DA 4OMEA 2MP0A 2HI6A 4C8PA 3BHXA 2OR4A 2XEIA 1DE4C 2JBKA 4NGMA 1GGOA 2EK9A 5D29A 4C9AA 1VBGA 3IWWA 3SR3A 2E28A 4P4BA 2DIKA 1NXJA 1DIKA 2D0PA 4OC5A 3TLGB 4C8UA 3D7FA 4NGTA 1Y9ZA 3KRVA 4C9EA 4C8CA 3D7GA 4CDKA 4P4IA 3TLAA 1VBHA 4TWEA 3K4IA 1BXRB 3T05A 4COGA 1CE8B 5JYBA 4C9VA 5F1YA 2OLSA 3T07A 2HWGA 3D7HA 2XEFA 4CZ1A 4P4JA 2FM4A 4NGNA
chains in the Genus database with same CATH topology
2JBJA 2XEGA 4OC1A 3S9LA 4C85A 4C84A 4C86A 1WVMA 5ELYA 4C9RA 3KASA 4NGSA 3VTAA 1V6CA 3FF3A 1XF1A 4TJXA 3FECA 4TJVA 4P4EA 4MCRA 4W9YA 3SJXA 4JZ0A 2C6GA 2C6PA 3ICUA 4MCQA 2CIJA 4X3RA 4C8AA 3IIBA 4MCSA 2EK8A 2GP4A 2PVWA 5IR2A 3FEEA 3S9NA 3I6SA 4KNGE 3EIFA 4P4FA 4YN3A 3FEDA 3K9TA 1CX8A 4C8FA 2PVVA 4P4DA 2C6CA 3BI0A 4OC2A 2XEJA 3SJFA 4OC3A 3S9MA 4JYWA 4OC4A 3SJEA 3I74A 4C9UA 4MCPA 3BXMA 4C99A 4C8TA 4CDJA 4LQGA 3SJGA 3RBUA 4NGRA 4P44A 2C5QA 2OOTA 5IB9A 3BI1A 4NGPA 4NGQA 4P45A 4OC0A 1Z8LA 5F09A 3D7DA 4OMEA 4C8PA 3BHXA 2OR4A 2XEIA 1DE4C 2JBKA 4NGMA 2EK9A 5D29A 4C9AA 3IWWA 4P4BA 4OC5A 4C8UA 3D7FA 4NGTA 1Y9ZA 4C9EA 4C8CA 3D7GA 4CDKA 4P4IA 4TWEA 4C9VA 3D7HA 2XEFA 4P4JA 4NGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JBJ A;  2XEG A;  4OC1 A;  3S9L A;  4C85 A;  4C84 A;  4C86 A;  1WVM A;  5ELY A;  4C9R A;  3KAS A;  4NGS A;  3VTA A;  1V6C A;  3FF3 A;  1XF1 A;  4TJX A;  3FEC A;  4TJV A;  4P4E A;  4MCR A;  4W9Y A;  3SJX A;  4JZ0 A;  2C6G A;  2C6P A;  3ICU A;  4MCQ A;  2CIJ A;  4X3R A;  4C8A A;  3IIB A;  4MCS A;  2EK8 A;  2PVW A;  3FEE A;  3S9N A;  3I6S A;  4KNG E;  3EIF A;  4P4F A;  4YN3 A;  3FED A;  1CX8 A;  4C8F A;  2PVV A;  4P4D A;  2C6C A;  3BI0 A;  4OC2 A;  2XEJ A;  3SJF A;  4OC3 A;  3S9M A;  4JYW A;  4OC4 A;  3SJE A;  3I74 A;  4C9U A;  4MCP A;  3BXM A;  4C99 A;  4C8T A;  4CDJ A;  4LQG A;  3SJG A;  3RBU A;  4NGR A;  4P44 A;  2OOT A;  5IB9 A;  3BI1 A;  4NGP A;  4NGQ A;  4P45 A;  4OC0 A;  1Z8L A;  5F09 A;  3D7D A;  4OME A;  4C8P A;  3BHX A;  2OR4 A;  2XEI A;  1DE4 C;  2JBK A;  4NGM A;  2EK9 A;  5D29 A;  4C9A A;  3IWW A;  4P4B A;  4OC5 A;  4C8U A;  3D7F A;  4NGT A;  1Y9Z A;  4C9E A;  4C8C A;  3D7G A;  4CDK A;  4P4I A;  4TWE A;  4C9V A;  3D7H A;  2XEF A;  4P4J A;  4NGN A; 
#chains in the Genus database with same CATH topology
 2JBJ A;  2XEG A;  4OC1 A;  3S9L A;  1EZB A;  4M8D A;  4C85 A;  3TLB A;  4C84 A;  1M6V B;  4C86 A;  1CS0 B;  1WVM A;  5ELY A;  4C9R A;  1EZA A;  1ZYM A;  3KAS A;  4NGS A;  3TLC A;  3VTA A;  1V6C A;  2B0A A;  1KBL A;  3FF3 A;  1XF1 A;  3EZE A;  4TJX A;  3FEC A;  3C8O A;  4TJV A;  4P4E A;  3TLG A;  4MCR A;  4EYS A;  4W9Y A;  3SJX A;  1KC7 A;  2X0S A;  4JZ0 A;  2C6G A;  4MI1 A;  2C6P A;  4H1H A;  4IIY A;  3TLE A;  3ICU A;  4MCQ A;  3U1B A;  2CIJ A;  1ZRS A;  4X3R A;  4INJ A;  4C8A A;  2EZC A;  3IIB A;  4MCS A;  3T0T A;  2EK8 A;  2YJV A;  2GP4 A;  2PVW A;  3GJZ A;  5IR2 A;  3FEE A;  1ZL0 A;  1J3L A;  4E5S A;  3S9N A;  3I6S A;  4KNG E;  3EIF A;  1VI4 A;  4P4F A;  4YN3 A;  3FED A;  3K9T A;  1NBW A;  1CX8 A;  3T5M A;  3TLZ A;  4C8F A;  2PVV A;  4JVO A;  4P4D A;  2C6C A;  1JDB C;  3NOJ A;  3BI0 A;  4OC2 A;  2XEJ A;  1C3O B;  2AUM A;  3EZB A;  3EZA A;  4OC3 A;  3SJF A;  1T36 B;  3S9M A;  1JDE A;  2EZA A;  4IIX A;  4JYW A;  4OC4 A;  3SJE A;  3I74 A;  4C9U A;  3G23 A;  4MCP A;  3BXM A;  4COB A;  1KEE B;  1Q5X A;  4CO9 A;  5K99 A;  4C99 A;  2HRO A;  4C8T A;  4CDJ A;  4LQG A;  2AUN A;  1A9X B;  5F9M A;  3SJG A;  3RBU A;  4NGR A;  4J0N A;  1C30 B;  2EZB A;  2D0O A;  2R82 A;  3TYX A;  4P44 A;  2C5Q A;  4E94 A;  5JVL A;  2OOT A;  1R61 A;  5IB9 A;  3TLY A;  5FD8 A;  4MJX A;  3BI1 A;  4NGP A;  4NGQ A;  4P45 A;  4OC0 A;  2YJT A;  5F5X A;  2PCN A;  1Z8L A;  5F09 A;  3D7D A;  4OME A;  2MP0 A;  2HI6 A;  4C8P A;  3BHX A;  2OR4 A;  2XEI A;  1DE4 C;  2JBK A;  4NGM A;  1GGO A;  2EK9 A;  5D29 A;  4C9A A;  1VBG A;  3IWW A;  3SR3 A;  2E28 A;  4P4B A;  2DIK A;  1NXJ A;  1DIK A;  2D0P A;  4OC5 A;  3TLG B;  4C8U A;  3D7F A;  4NGT A;  1Y9Z A;  3KRV A;  4C9E A;  4C8C A;  3D7G A;  4CDK A;  4P4I A;  3TLA A;  1VBH A;  4TWE A;  3K4I A;  1BXR B;  3T05 A;  4COG A;  1CE8 B;  5JYB A;  4C9V A;  5F1Y A;  2OLS A;  3T07 A;  2HWG A;  3D7H A;  2XEF A;  4CZ1 A;  4P4J A;  2FM4 A;  4NGN A; 
#chains in the Genus database with same CATH homology
 2JBJ A;  2XEG A;  4OC1 A;  3S9L A;  4C85 A;  4C84 A;  4C86 A;  1WVM A;  5ELY A;  4C9R A;  3KAS A;  4NGS A;  3VTA A;  1V6C A;  3FF3 A;  1XF1 A;  4TJX A;  3FEC A;  4TJV A;  4P4E A;  4MCR A;  4W9Y A;  3SJX A;  4JZ0 A;  2C6G A;  2C6P A;  3ICU A;  4MCQ A;  2CIJ A;  4X3R A;  4C8A A;  3IIB A;  4MCS A;  2EK8 A;  2GP4 A;  2PVW A;  5IR2 A;  3FEE A;  3S9N A;  3I6S A;  4KNG E;  3EIF A;  4P4F A;  4YN3 A;  3FED A;  3K9T A;  1CX8 A;  4C8F A;  2PVV A;  4P4D A;  2C6C A;  3BI0 A;  4OC2 A;  2XEJ A;  3SJF A;  4OC3 A;  3S9M A;  4JYW A;  4OC4 A;  3SJE A;  3I74 A;  4C9U A;  4MCP A;  3BXM A;  4C99 A;  4C8T A;  4CDJ A;  4LQG A;  3SJG A;  3RBU A;  4NGR A;  4P44 A;  2C5Q A;  2OOT A;  5IB9 A;  3BI1 A;  4NGP A;  4NGQ A;  4P45 A;  4OC0 A;  1Z8L A;  5F09 A;  3D7D A;  4OME A;  4C8P A;  3BHX A;  2OR4 A;  2XEI A;  1DE4 C;  2JBK A;  4NGM A;  2EK9 A;  5D29 A;  4C9A A;  3IWW A;  4P4B A;  4OC5 A;  4C8U A;  3D7F A;  4NGT A;  1Y9Z A;  4C9E A;  4C8C A;  3D7G A;  4CDK A;  4P4I A;  4TWE A;  4C9V A;  3D7H A;  2XEF A;  4P4J A;  4NGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...