3ICUA

Protease-associated domain of the e3 ligase grail
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
171
structure length
171
Chain Sequence
b'GAMDGAEAVWTAYLNVSWRVPHTGVNRTVWELSEEGVYGQDSPLEPVAGVLVPPDGPGALNACNPHTNFTVPTVWGSTVQVSWLALIQRGGGCTFADKIHLAYERGASGAVIFNFPGTRNEVIPMSHPGAVDIVAIMIGNLKGTKILQSIQRGIQVTMVIEVGKKHGPWVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase RNF128
publication title PA Domain of the E3 Ligase Grail
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 42
structure length 171
sequence length 171
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2009-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3icuA01
3FECA 3S9LA 1DE4C 3FF3A 4X3RA 4YN3A 4C8CA 2PVVA 4C86A 2XEGA 3VTAA 4TJXA 4C9AA 4JZ0A 2XEJA 4C8AA 3IIBA 2XEFA 4W9YA 4P4JA 3I74A 4CDKA 4C99A 2PVWA 4P45A 4NGNA 4OMEA 5ELYA 3SJFA 3S9NA 3ICUA 2XEIA 4NGTA 2C6CA 4P4EA 4KNGE 4NGSA 2EK8A 3SJGA 1V6CA 2OOTA 4JYWA 3D7GA 3BI1A 4TWEA 3FEEA 3BI0A 4C9RA 4P4BA 3RBUA 2JBKA 2OR4A 4NGPA 5D29A 4C8FA 3BXMA 3D7DA 4P44A 4P4IA 4OC4A 4C8UA 4NGQA 5IB9A 4P4FA 4NGMA 4OC2A 4MCQA 2C6GA 2CIJA 4MCPA 3I6SA 3IWWA 4MCRA 4C8PA 2EK9A 1Z8LA 4TJVA 1CX8A 2JBJA 1WVMA 3S9MA 4OC3A 4LQGA 3EIFA 4C8TA 4C84A 3SJEA 3D7HA 3D7FA 1XF1A 4C9UA 2C6PA 3KASA 4MCSA 4NGRA 4C9VA 4OC1A 4P4DA 3FEDA 4OC5A 4C9EA 3BHXA 1Y9ZA 5F09A 4OC0A 3SJXA 4C85A 4CDJA
chains in the Genus database with same CATH superfamily
3FECA 3S9LA 3G23A 1M6VB 2YJVA 4IIYA 1BXRB 1DE4C 1C30B 3FF3A 4X3RA 3TLYA 1CS0B 3NOJA 3TLGB 2D0PA 5JVLA 3TLBA 1KBLA 5JYBA 1GGOA 4YN3A 5F9MA 2HI6A 1KC7A 4C8CA 2PVVA 3EZAA 1NBWA 1R61A 3T5MA 1VI4A 4C86A 2XEGA 3VTAA 4TJXA 4C9AA 4MI1A 4JZ0A 2XEJA 3TLCA 4JVOA 4C8AA 3IIBA 1ZYMA 2XEFA 4COGA 1C3OB 4P4JA 4W9YA 4CZ1A 3I74A 2FM4A 3GJZA 2AUMA 4CDKA 4INJA 1JDBC 3SR3A 1A9XB 4C99A 5K99A 2PVWA 4P45A 2AUNA 4E94A 2EZBA 1T36B 4NGNA 4CO9A 2HROA 4OMEA 5F5XA 3TLGA 5ELYA 3SJFA 4EYSA 3K4IA 3S9NA 3ICUA 2XEIA 4NGTA 2C6CA 4P4EA 2OLSA 3TLEA 4KNGE 1ZRSA 4NGSA 2DIKA 2EK8A 3SJGA 1V6CA 2EZCA 2OOTA 2R82A 4JYWA 3D7GA 3BI1A 4TWEA 3FEEA 1EZBA 3U1BA 2X0SA 3BI0A 2YJTA 3TLAA 4P4BA 4C9RA 3RBUA 2B0AA 2JBKA 2OR4A 4NGPA 5D29A 4C8FA 1JDEA 3T07A 1KEEB 3T0TA 1DIKA 2GP4A 3BXMA 3D7DA 4P44A 4P4IA 3K9TA 4OC4A 4C8UA 3EZBA 4NGQA 5F1YA 3TLZA 1VBHA 5IB9A 4P4FA 4NGMA 1VBGA 4OC2A 1CE8B 4MCQA 2C6GA 2CIJA 4MCPA 1ZL0A 3I6SA 4COBA 2D0OA 2C5QA 1EZAA 3IWWA 4MCRA 4C8PA 2EZAA 2PCNA 2EK9A 3EZEA 4IIXA 1Z8LA 4H1HA 4J0NA 4TJVA 1CX8A 1WVMA 2JBJA 3S9MA 4OC3A 3C8OA 4LQGA 3EIFA 4C8TA 4C84A 3SJEA 4E5SA 3D7HA 3D7FA 1XF1A 3T05A 3KRVA 4M8DA 2E28A 1Q5XA 4C9UA 2C6PA 3KASA 4MCSA 4NGRA 4C9VA 3TYXA 1J3LA 4OC1A 4P4DA 5FD8A 1NXJA 5IR2A 2MP0A 3FEDA 4OC5A 4C9EA 4MJXA 3BHXA 1Y9ZA 5F09A 4OC0A 3SJXA 2HWGA 4C85A 4CDJA
chains in the Genus database with same CATH topology
3FECA 3S9LA 1DE4C 3FF3A 4X3RA 4YN3A 4C8CA 2PVVA 4C86A 2XEGA 3VTAA 4TJXA 4C9AA 4JZ0A 2XEJA 4C8AA 3IIBA 2XEFA 4W9YA 4P4JA 3I74A 4CDKA 4C99A 2PVWA 4P45A 4NGNA 4OMEA 5ELYA 3SJFA 3S9NA 3ICUA 2XEIA 4NGTA 2C6CA 4P4EA 4KNGE 4NGSA 2EK8A 3SJGA 1V6CA 2OOTA 4JYWA 3D7GA 3BI1A 4TWEA 3FEEA 3BI0A 4C9RA 4P4BA 3RBUA 2JBKA 2OR4A 4NGPA 5D29A 4C8FA 2GP4A 3BXMA 3D7DA 4P44A 4P4IA 3K9TA 4OC4A 4C8UA 4NGQA 5IB9A 4P4FA 4NGMA 4OC2A 4MCQA 2C6GA 2CIJA 4MCPA 3I6SA 3IWWA 2C5QA 4MCRA 4C8PA 2EK9A 1Z8LA 4TJVA 1CX8A 2JBJA 1WVMA 3S9MA 4OC3A 4LQGA 3EIFA 4C8TA 4C84A 3SJEA 3D7HA 3D7FA 1XF1A 4C9UA 2C6PA 3KASA 4MCSA 4NGRA 4C9VA 4OC1A 4P4DA 5IR2A 3FEDA 4OC5A 4C9EA 3BHXA 1Y9ZA 5F09A 4OC0A 3SJXA 4C85A 4CDJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FEC A;  3S9L A;  1DE4 C;  3FF3 A;  4X3R A;  4YN3 A;  4C8C A;  2PVV A;  4C86 A;  2XEG A;  3VTA A;  4TJX A;  4C9A A;  4JZ0 A;  2XEJ A;  4C8A A;  3IIB A;  2XEF A;  4W9Y A;  4P4J A;  3I74 A;  4CDK A;  4C99 A;  2PVW A;  4P45 A;  4NGN A;  4OME A;  5ELY A;  3SJF A;  3S9N A;  3ICU A;  2XEI A;  4NGT A;  2C6C A;  4P4E A;  4KNG E;  4NGS A;  2EK8 A;  3SJG A;  1V6C A;  2OOT A;  4JYW A;  3D7G A;  3BI1 A;  4TWE A;  3FEE A;  3BI0 A;  4C9R A;  4P4B A;  3RBU A;  2JBK A;  2OR4 A;  4NGP A;  5D29 A;  4C8F A;  3BXM A;  3D7D A;  4P44 A;  4P4I A;  4OC4 A;  4C8U A;  4NGQ A;  5IB9 A;  4P4F A;  4NGM A;  4OC2 A;  4MCQ A;  2C6G A;  2CIJ A;  4MCP A;  3I6S A;  3IWW A;  4MCR A;  4C8P A;  2EK9 A;  1Z8L A;  4TJV A;  1CX8 A;  2JBJ A;  1WVM A;  3S9M A;  4OC3 A;  4LQG A;  3EIF A;  4C8T A;  4C84 A;  3SJE A;  3D7H A;  3D7F A;  1XF1 A;  4C9U A;  2C6P A;  3KAS A;  4MCS A;  4NGR A;  4C9V A;  4OC1 A;  4P4D A;  3FED A;  4OC5 A;  4C9E A;  3BHX A;  1Y9Z A;  5F09 A;  4OC0 A;  3SJX A;  4C85 A;  4CDJ A; 
#chains in the Genus database with same CATH topology
 3FEC A;  3S9L A;  3G23 A;  1M6V B;  2YJV A;  4IIY A;  1BXR B;  1DE4 C;  1C30 B;  3FF3 A;  4X3R A;  3TLY A;  1CS0 B;  3NOJ A;  3TLG B;  2D0P A;  5JVL A;  3TLB A;  1KBL A;  5JYB A;  1GGO A;  4YN3 A;  5F9M A;  2HI6 A;  1KC7 A;  4C8C A;  2PVV A;  3EZA A;  1NBW A;  1R61 A;  3T5M A;  1VI4 A;  4C86 A;  2XEG A;  3VTA A;  4TJX A;  4C9A A;  4MI1 A;  4JZ0 A;  2XEJ A;  3TLC A;  4JVO A;  4C8A A;  3IIB A;  1ZYM A;  2XEF A;  4COG A;  1C3O B;  4P4J A;  4W9Y A;  4CZ1 A;  3I74 A;  2FM4 A;  3GJZ A;  2AUM A;  4CDK A;  4INJ A;  1JDB C;  3SR3 A;  1A9X B;  4C99 A;  5K99 A;  2PVW A;  4P45 A;  2AUN A;  4E94 A;  2EZB A;  1T36 B;  4NGN A;  4CO9 A;  2HRO A;  4OME A;  5F5X A;  3TLG A;  5ELY A;  3SJF A;  4EYS A;  3K4I A;  3S9N A;  3ICU A;  2XEI A;  4NGT A;  2C6C A;  4P4E A;  2OLS A;  3TLE A;  4KNG E;  1ZRS A;  4NGS A;  2DIK A;  2EK8 A;  3SJG A;  1V6C A;  2EZC A;  2OOT A;  2R82 A;  4JYW A;  3D7G A;  3BI1 A;  4TWE A;  3FEE A;  1EZB A;  3U1B A;  2X0S A;  3BI0 A;  2YJT A;  3TLA A;  4P4B A;  4C9R A;  3RBU A;  2B0A A;  2JBK A;  2OR4 A;  4NGP A;  5D29 A;  4C8F A;  1JDE A;  3T07 A;  1KEE B;  3T0T A;  1DIK A;  2GP4 A;  3BXM A;  3D7D A;  4P44 A;  4P4I A;  3K9T A;  4OC4 A;  4C8U A;  3EZB A;  4NGQ A;  5F1Y A;  3TLZ A;  1VBH A;  5IB9 A;  4P4F A;  4NGM A;  1VBG A;  4OC2 A;  1CE8 B;  4MCQ A;  2C6G A;  2CIJ A;  4MCP A;  1ZL0 A;  3I6S A;  4COB A;  2D0O A;  2C5Q A;  1EZA A;  3IWW A;  4MCR A;  4C8P A;  2EZA A;  2PCN A;  2EK9 A;  3EZE A;  4IIX A;  1Z8L A;  4H1H A;  4J0N A;  4TJV A;  1CX8 A;  1WVM A;  2JBJ A;  3S9M A;  4OC3 A;  3C8O A;  4LQG A;  3EIF A;  4C8T A;  4C84 A;  3SJE A;  4E5S A;  3D7H A;  3D7F A;  1XF1 A;  3T05 A;  3KRV A;  4M8D A;  2E28 A;  1Q5X A;  4C9U A;  2C6P A;  3KAS A;  4MCS A;  4NGR A;  4C9V A;  3TYX A;  1J3L A;  4OC1 A;  4P4D A;  5FD8 A;  1NXJ A;  5IR2 A;  2MP0 A;  3FED A;  4OC5 A;  4C9E A;  4MJX A;  3BHX A;  1Y9Z A;  5F09 A;  4OC0 A;  3SJX A;  2HWG A;  4C85 A;  4CDJ A; 
#chains in the Genus database with same CATH homology
 3FEC A;  3S9L A;  1DE4 C;  3FF3 A;  4X3R A;  4YN3 A;  4C8C A;  2PVV A;  4C86 A;  2XEG A;  3VTA A;  4TJX A;  4C9A A;  4JZ0 A;  2XEJ A;  4C8A A;  3IIB A;  2XEF A;  4W9Y A;  4P4J A;  3I74 A;  4CDK A;  4C99 A;  2PVW A;  4P45 A;  4NGN A;  4OME A;  5ELY A;  3SJF A;  3S9N A;  3ICU A;  2XEI A;  4NGT A;  2C6C A;  4P4E A;  4KNG E;  4NGS A;  2EK8 A;  3SJG A;  1V6C A;  2OOT A;  4JYW A;  3D7G A;  3BI1 A;  4TWE A;  3FEE A;  3BI0 A;  4C9R A;  4P4B A;  3RBU A;  2JBK A;  2OR4 A;  4NGP A;  5D29 A;  4C8F A;  2GP4 A;  3BXM A;  3D7D A;  4P44 A;  4P4I A;  3K9T A;  4OC4 A;  4C8U A;  4NGQ A;  5IB9 A;  4P4F A;  4NGM A;  4OC2 A;  4MCQ A;  2C6G A;  2CIJ A;  4MCP A;  3I6S A;  3IWW A;  2C5Q A;  4MCR A;  4C8P A;  2EK9 A;  1Z8L A;  4TJV A;  1CX8 A;  2JBJ A;  1WVM A;  3S9M A;  4OC3 A;  4LQG A;  3EIF A;  4C8T A;  4C84 A;  3SJE A;  3D7H A;  3D7F A;  1XF1 A;  4C9U A;  2C6P A;  3KAS A;  4MCS A;  4NGR A;  4C9V A;  4OC1 A;  4P4D A;  5IR2 A;  3FED A;  4OC5 A;  4C9E A;  3BHX A;  1Y9Z A;  5F09 A;  4OC0 A;  3SJX A;  4C85 A;  4CDJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...