3ICUA

Protease-associated domain of the e3 ligase grail
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
171
structure length
171
Chain Sequence
GAMDGAEAVWTAYLNVSWRVPHTGVNRTVWELSEEGVYGQDSPLEPVAGVLVPPDGPGALNACNPHTNFTVPTVWGSTVQVSWLALIQRGGGCTFADKIHLAYERGASGAVIFNFPGTRNEVIPMSHPGAVDIVAIMIGNLKGTKILQSIQRGIQVTMVIEVGKKHGPWVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase RNF128
publication title PA Domain of the E3 Ligase Grail
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 42
structure length 171
sequence length 171
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2009-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3icuA01
4P4JA 2C6CA 2OOTA 4CDKA 4CDJA 2C6PA 3SJFA 3IWWA 1XF1A 2JBKA 3BHXA 1WVMA 2EK9A 4OC0A 4P4FA 5F09A 5D29A 3SJGA 4P4EA 4JYWA 4C8CA 2XEGA 4C99A 3S9MA 4C9RA 4C9EA 2XEJA 4P4IA 4C8UA 4X3RA 5IB9A 4C85A 3EIFA 2C6GA 4NGTA 5ELYA 1V6CA 4NGQA 2JBJA 4NGNA 1CX8A 4NGSA 4C8AA 2EK8A 2OR4A 4C9VA 4P4DA 4TWEA 4NGRA 3FECA 4OC3A 4TJVA 3IIBA 4NGPA 2CIJA 3RBUA 4JZ0A 2PVVA 3KASA 4C8FA 3BI1A 4OC5A 3S9NA 4MCPA 4P44A 3FEEA 3VTAA 4C84A 4OMEA 4C9AA 3BXMA 3D7GA 3SJEA 4C9UA 1Z8LA 4YN3A 3D7HA 4MCQA 3SJXA 1DE4C 3D7DA 4LQGA 3FEDA 2PVWA 1Y9ZA 4W9YA 4C8PA 4OC1A 4MCSA 3S9LA 4C8TA 3FF3A 3BI0A 4OC2A 4P4BA 4KNGE 4P45A 2XEIA 4OC4A 3I6SA 3ICUA 4C86A 4TJXA 2XEFA 3D7FA 3I74A 4NGMA 4MCRA
chains in the Genus database with same CATH superfamily
4P4JA 3TYXA 2C6CA 2OOTA 4CDKA 4CDJA 2C6PA 3GJZA 3SJFA 3IWWA 4IIYA 5JYBA 1XF1A 3EZAA 2JBKA 3BHXA 1WVMA 2EK9A 2FM4A 4OC0A 4P4FA 3G23A 4H1HA 5F09A 5D29A 3SJGA 3TLAA 4P4EA 1M6VB 1ZL0A 4JYWA 4COBA 2B0AA 2YJVA 4C8CA 2PCNA 2XEGA 1ZRSA 4C99A 3T0TA 3S9MA 1EZBA 2R82A 5F5XA 3TLYA 1R61A 2E28A 4C9RA 4C9EA 5F1YA 1J3LA 2XEJA 4P4IA 2C5QA 4C8UA 3TLZA 4X3RA 5IB9A 4C85A 2X0SA 2HI6A 3EIFA 2C6GA 4NGTA 5ELYA 2EZCA 1V6CA 3K4IA 4NGQA 1KBLA 2JBJA 3T05A 4NGNA 1CX8A 1GGOA 3C8OA 1ZYMA 4NGSA 4C8AA 2D0OA 1C3OB 2EK8A 2OR4A 1VBHA 3EZBA 2D0PA 1NBWA 4C9VA 4P4DA 2YJTA 4TWEA 4NGRA 3FECA 4OC3A 4TJVA 3IIBA 4NGPA 1JDBC 3SR3A 2CIJA 1KEEB 1A9XB 3RBUA 1VI4A 4JZ0A 2PVVA 1CE8B 4COGA 4CO9A 3U1BA 2HROA 2EZAA 4MJXA 3TLCA 3KASA 3TLGB 3BI1A 4C8FA 4OC5A 3S9NA 4MCPA 3KRVA 2AUNA 4P44A 3FEEA 5F9MA 5FD8A 4CZ1A 2DIKA 3VTAA 1CS0B 4C84A 5JVLA 2OLSA 2AUMA 4OMEA 4J0NA 4E5SA 4C9AA 3BXMA 4E94A 3D7GA 3SJEA 1EZAA 1Z8LA 4YN3A 3T5MA 4C9UA 3D7HA 4MCQA 3SJXA 1T36B 1DE4C 3D7DA 2EZBA 2GP4A 1JDEA 4LQGA 3FEDA 4IIXA 1DIKA 2PVWA 1Y9ZA 4INJA 1C30B 2MP0A 5K99A 4W9YA 5IR2A 4C8PA 1KC7A 4OC1A 4M8DA 4MCSA 3S9LA 3TLGA 4C8TA 3T07A 1Q5XA 3BI0A 3FF3A 3K9TA 4OC2A 3TLBA 4P4BA 4KNGE 4P45A 3TLEA 2XEIA 4OC4A 3I6SA 3ICUA 4C86A 3NOJA 4EYSA 4TJXA 4MI1A 2XEFA 3EZEA 3D7FA 3I74A 1NXJA 4NGMA 1VBGA 4MCRA 1BXRB 2HWGA 4JVOA
chains in the Genus database with same CATH topology
4P4JA 2C6CA 2OOTA 4CDKA 4CDJA 2C6PA 3SJFA 3IWWA 1XF1A 2JBKA 3BHXA 1WVMA 2EK9A 4OC0A 4P4FA 5F09A 5D29A 3SJGA 4P4EA 4JYWA 4C8CA 2XEGA 4C99A 3S9MA 4C9RA 4C9EA 2XEJA 4P4IA 2C5QA 4C8UA 4X3RA 5IB9A 4C85A 3EIFA 2C6GA 4NGTA 5ELYA 1V6CA 4NGQA 2JBJA 4NGNA 1CX8A 4NGSA 4C8AA 2EK8A 2OR4A 4C9VA 4P4DA 4TWEA 4NGRA 3FECA 4OC3A 4TJVA 3IIBA 4NGPA 2CIJA 3RBUA 4JZ0A 2PVVA 3KASA 4C8FA 3BI1A 4OC5A 3S9NA 4MCPA 4P44A 3FEEA 3VTAA 4C84A 4OMEA 4C9AA 3BXMA 3D7GA 3SJEA 4C9UA 1Z8LA 4YN3A 3D7HA 4MCQA 3SJXA 1DE4C 3D7DA 2GP4A 4LQGA 3FEDA 2PVWA 1Y9ZA 4W9YA 5IR2A 4C8PA 4OC1A 4MCSA 3S9LA 4C8TA 3FF3A 3BI0A 3K9TA 4OC2A 4P4BA 4KNGE 4P45A 2XEIA 4OC4A 3I6SA 3ICUA 4C86A 4TJXA 2XEFA 3D7FA 3I74A 4NGMA 4MCRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P4J A;  2C6C A;  2OOT A;  4CDK A;  4CDJ A;  2C6P A;  3SJF A;  3IWW A;  1XF1 A;  2JBK A;  3BHX A;  1WVM A;  2EK9 A;  4OC0 A;  4P4F A;  5F09 A;  5D29 A;  3SJG A;  4P4E A;  4JYW A;  4C8C A;  2XEG A;  4C99 A;  3S9M A;  4C9R A;  4C9E A;  2XEJ A;  4P4I A;  4C8U A;  4X3R A;  5IB9 A;  4C85 A;  3EIF A;  2C6G A;  4NGT A;  5ELY A;  1V6C A;  4NGQ A;  2JBJ A;  4NGN A;  1CX8 A;  4NGS A;  4C8A A;  2EK8 A;  2OR4 A;  4C9V A;  4P4D A;  4TWE A;  4NGR A;  3FEC A;  4OC3 A;  4TJV A;  3IIB A;  4NGP A;  2CIJ A;  3RBU A;  4JZ0 A;  2PVV A;  3KAS A;  4C8F A;  3BI1 A;  4OC5 A;  3S9N A;  4MCP A;  4P44 A;  3FEE A;  3VTA A;  4C84 A;  4OME A;  4C9A A;  3BXM A;  3D7G A;  3SJE A;  4C9U A;  1Z8L A;  4YN3 A;  3D7H A;  4MCQ A;  3SJX A;  1DE4 C;  3D7D A;  4LQG A;  3FED A;  2PVW A;  1Y9Z A;  4W9Y A;  4C8P A;  4OC1 A;  4MCS A;  3S9L A;  4C8T A;  3FF3 A;  3BI0 A;  4OC2 A;  4P4B A;  4KNG E;  4P45 A;  2XEI A;  4OC4 A;  3I6S A;  3ICU A;  4C86 A;  4TJX A;  2XEF A;  3D7F A;  3I74 A;  4NGM A;  4MCR A; 
#chains in the Genus database with same CATH topology
 4P4J A;  3TYX A;  2C6C A;  2OOT A;  4CDK A;  4CDJ A;  2C6P A;  3GJZ A;  3SJF A;  3IWW A;  4IIY A;  5JYB A;  1XF1 A;  3EZA A;  2JBK A;  3BHX A;  1WVM A;  2EK9 A;  2FM4 A;  4OC0 A;  4P4F A;  3G23 A;  4H1H A;  5F09 A;  5D29 A;  3SJG A;  3TLA A;  4P4E A;  1M6V B;  1ZL0 A;  4JYW A;  4COB A;  2B0A A;  2YJV A;  4C8C A;  2PCN A;  2XEG A;  1ZRS A;  4C99 A;  3T0T A;  3S9M A;  1EZB A;  2R82 A;  5F5X A;  3TLY A;  1R61 A;  2E28 A;  4C9R A;  4C9E A;  5F1Y A;  1J3L A;  2XEJ A;  4P4I A;  2C5Q A;  4C8U A;  3TLZ A;  4X3R A;  5IB9 A;  4C85 A;  2X0S A;  2HI6 A;  3EIF A;  2C6G A;  4NGT A;  5ELY A;  2EZC A;  1V6C A;  3K4I A;  4NGQ A;  1KBL A;  2JBJ A;  3T05 A;  4NGN A;  1CX8 A;  1GGO A;  3C8O A;  1ZYM A;  4NGS A;  4C8A A;  2D0O A;  1C3O B;  2EK8 A;  2OR4 A;  1VBH A;  3EZB A;  2D0P A;  1NBW A;  4C9V A;  4P4D A;  2YJT A;  4TWE A;  4NGR A;  3FEC A;  4OC3 A;  4TJV A;  3IIB A;  4NGP A;  1JDB C;  3SR3 A;  2CIJ A;  1KEE B;  1A9X B;  3RBU A;  1VI4 A;  4JZ0 A;  2PVV A;  1CE8 B;  4COG A;  4CO9 A;  3U1B A;  2HRO A;  2EZA A;  4MJX A;  3TLC A;  3KAS A;  3TLG B;  3BI1 A;  4C8F A;  4OC5 A;  3S9N A;  4MCP A;  3KRV A;  2AUN A;  4P44 A;  3FEE A;  5F9M A;  5FD8 A;  4CZ1 A;  2DIK A;  3VTA A;  1CS0 B;  4C84 A;  5JVL A;  2OLS A;  2AUM A;  4OME A;  4J0N A;  4E5S A;  4C9A A;  3BXM A;  4E94 A;  3D7G A;  3SJE A;  1EZA A;  1Z8L A;  4YN3 A;  3T5M A;  4C9U A;  3D7H A;  4MCQ A;  3SJX A;  1T36 B;  1DE4 C;  3D7D A;  2EZB A;  2GP4 A;  1JDE A;  4LQG A;  3FED A;  4IIX A;  1DIK A;  2PVW A;  1Y9Z A;  4INJ A;  1C30 B;  2MP0 A;  5K99 A;  4W9Y A;  5IR2 A;  4C8P A;  1KC7 A;  4OC1 A;  4M8D A;  4MCS A;  3S9L A;  3TLG A;  4C8T A;  3T07 A;  1Q5X A;  3BI0 A;  3FF3 A;  3K9T A;  4OC2 A;  3TLB A;  4P4B A;  4KNG E;  4P45 A;  3TLE A;  2XEI A;  4OC4 A;  3I6S A;  3ICU A;  4C86 A;  3NOJ A;  4EYS A;  4TJX A;  4MI1 A;  2XEF A;  3EZE A;  3D7F A;  3I74 A;  1NXJ A;  4NGM A;  1VBG A;  4MCR A;  1BXR B;  2HWG A;  4JVO A; 
#chains in the Genus database with same CATH homology
 4P4J A;  2C6C A;  2OOT A;  4CDK A;  4CDJ A;  2C6P A;  3SJF A;  3IWW A;  1XF1 A;  2JBK A;  3BHX A;  1WVM A;  2EK9 A;  4OC0 A;  4P4F A;  5F09 A;  5D29 A;  3SJG A;  4P4E A;  4JYW A;  4C8C A;  2XEG A;  4C99 A;  3S9M A;  4C9R A;  4C9E A;  2XEJ A;  4P4I A;  2C5Q A;  4C8U A;  4X3R A;  5IB9 A;  4C85 A;  3EIF A;  2C6G A;  4NGT A;  5ELY A;  1V6C A;  4NGQ A;  2JBJ A;  4NGN A;  1CX8 A;  4NGS A;  4C8A A;  2EK8 A;  2OR4 A;  4C9V A;  4P4D A;  4TWE A;  4NGR A;  3FEC A;  4OC3 A;  4TJV A;  3IIB A;  4NGP A;  2CIJ A;  3RBU A;  4JZ0 A;  2PVV A;  3KAS A;  4C8F A;  3BI1 A;  4OC5 A;  3S9N A;  4MCP A;  4P44 A;  3FEE A;  3VTA A;  4C84 A;  4OME A;  4C9A A;  3BXM A;  3D7G A;  3SJE A;  4C9U A;  1Z8L A;  4YN3 A;  3D7H A;  4MCQ A;  3SJX A;  1DE4 C;  3D7D A;  2GP4 A;  4LQG A;  3FED A;  2PVW A;  1Y9Z A;  4W9Y A;  5IR2 A;  4C8P A;  4OC1 A;  4MCS A;  3S9L A;  4C8T A;  3FF3 A;  3BI0 A;  3K9T A;  4OC2 A;  4P4B A;  4KNG E;  4P45 A;  2XEI A;  4OC4 A;  3I6S A;  3ICU A;  4C86 A;  4TJX A;  2XEF A;  3D7F A;  3I74 A;  4NGM A;  4MCR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...