3ICUA

Protease-associated domain of the e3 ligase grail
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
171
structure length
171
Chain Sequence
GAMDGAEAVWTAYLNVSWRVPHTGVNRTVWELSEEGVYGQDSPLEPVAGVLVPPDGPGALNACNPHTNFTVPTVWGSTVQVSWLALIQRGGGCTFADKIHLAYERGASGAVIFNFPGTRNEVIPMSHPGAVDIVAIMIGNLKGTKILQSIQRGIQVTMVIEVGKKHGPWVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title PA Domain of the E3 Ligase Grail
rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase RNF128
total genus 42
structure length 171
sequence length 171
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2009-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3icuA01
2EK9A 2OOTA 4OC3A 2JBKA 3D7GA 3FF3A 4MCSA 4C85A 4CDJA 4OC5A 4C86A 3BI1A 5IB9A 1V6CA 3RBUA 2XEFA 2C6PA 4JYWA 3SJFA 4NGSA 3S9NA 2C6GA 4P4FA 4NGMA 2OR4A 4OMEA 4X3RA 2C6CA 4C8AA 2XEJA 4OC1A 3FEEA 4C9RA 3BI0A 3FEDA 2CIJA 4TWEA 4P44A 4C8CA 3S9MA 4OC4A 4KNGE 4P4IA 3BHXA 4TJXA 2PVVA 4C8FA 3EIFA 4C8PA 1Z8LA 4LQGA 2XEGA 4MCQA 3I6SA 3SJEA 2EK8A 2XEIA 4C8UA 4C8TA 3FECA 2PVWA 4OC2A 4TJVA 4C99A 5F09A 4P45A 4NGNA 5ELYA 3SJGA 3D7HA 3D7FA 4C9EA 4MCPA 3SJXA 1XF1A 5D29A 3S9LA 1Y9ZA 4OC0A 4W9YA 4C9VA 3IWWA 3ICUA 4NGPA 4YN3A 4C9AA 1DE4C 4P4EA 3KASA 4MCRA 3D7DA 4P4JA 4C9UA 4C84A 4P4DA 1CX8A 1WVMA 3BXMA 3VTAA 4CDKA 3IIBA 4NGRA 4JZ0A 4NGTA 4NGQA 2JBJA 4P4BA 3I74A
chains in the Genus database with same CATH superfamily
2EK9A 2OOTA 1KC7A 2HROA 4J0NA 4OC3A 2OLSA 1CS0B 2JBKA 3D7GA 3FF3A 3K9TA 4MCSA 3T5MA 2AUNA 3TLZA 4C85A 4OC5A 4CDJA 1VI4A 3T05A 1VBGA 4C86A 3U1BA 3TLYA 5F5XA 2D0OA 3BI1A 4H1HA 5F9MA 2EZCA 5IB9A 3K4IA 1V6CA 1C30B 3RBUA 3EZEA 2C5QA 4E5SA 1Q5XA 2XEFA 2C6PA 4JYWA 3SJFA 1ZYMA 4NGSA 3S9NA 1DIKA 2C6GA 5FD8A 3KRVA 4P4FA 3TLAA 1NXJA 2D0PA 5IR2A 4NGMA 2OR4A 4OMEA 2DIKA 4X3RA 2C6CA 4C8AA 2XEJA 4OC1A 3FEEA 2R82A 4C9RA 1M6VB 1A9XB 3BI0A 3GJZA 3FEDA 2CIJA 1CE8B 2X0SA 3C8OA 4TWEA 1BXRB 2GP4A 4P44A 4C8CA 3TLCA 4INJA 3S9MA 3TLGB 4OC4A 4COGA 4KNGE 4P4IA 2MP0A 3BHXA 4TJXA 2PVVA 3T07A 4C8FA 3EIFA 4C8PA 1NBWA 2E28A 4IIXA 4COBA 1Z8LA 2YJTA 4LQGA 3SR3A 2HWGA 2XEGA 4MCQA 3I6SA 3SJEA 5JYBA 2EK8A 2XEIA 3TLEA 4C8UA 1KBLA 4C8TA 3FECA 2PVWA 4OC2A 4TJVA 4C99A 2HI6A 4E94A 4JVOA 5F09A 1ZRSA 4P45A 4NGNA 2AUMA 5ELYA 3T0TA 3SJGA 1VBHA 3D7HA 2EZBA 3D7FA 3EZAA 3TLGA 1ZL0A 2PCNA 4C9EA 4IIYA 4MCPA 5JVLA 3SJXA 1XF1A 5D29A 3S9LA 1Y9ZA 4OC0A 4W9YA 2FM4A 3G23A 4C9VA 4CO9A 1KEEB 5K99A 3IWWA 3ICUA 1EZAA 2B0AA 1J3LA 4M8DA 4NGPA 4YN3A 1EZBA 4C9AA 1DE4C 4P4EA 1GGOA 4CZ1A 1JDBC 2YJVA 3D7DA 3KASA 4MCRA 4EYSA 1C3OB 4P4JA 2EZAA 4C9UA 4C84A 3EZBA 3TLBA 4P4DA 1CX8A 1T36B 3NOJA 4MI1A 1WVMA 3BXMA 5F1YA 3VTAA 4CDKA 4MJXA 3IIBA 4NGRA 4JZ0A 1R61A 4NGTA 4NGQA 1JDEA 2JBJA 4P4BA 3I74A 3TYXA
chains in the Genus database with same CATH topology
2EK9A 2OOTA 4OC3A 2JBKA 3D7GA 3FF3A 3K9TA 4MCSA 4C85A 4CDJA 4OC5A 4C86A 3BI1A 5IB9A 1V6CA 3RBUA 2C5QA 2XEFA 2C6PA 4JYWA 3SJFA 4NGSA 3S9NA 2C6GA 4P4FA 5IR2A 4NGMA 2OR4A 4OMEA 4X3RA 2C6CA 4C8AA 2XEJA 4OC1A 3FEEA 4C9RA 3BI0A 3FEDA 2CIJA 4TWEA 2GP4A 4P44A 4C8CA 3S9MA 4OC4A 4KNGE 4P4IA 3BHXA 4TJXA 2PVVA 4C8FA 3EIFA 4C8PA 1Z8LA 4LQGA 2XEGA 4MCQA 3I6SA 3SJEA 2EK8A 2XEIA 4C8UA 4C8TA 3FECA 2PVWA 4OC2A 4TJVA 4C99A 5F09A 4P45A 4NGNA 5ELYA 3SJGA 3D7HA 3D7FA 4C9EA 4MCPA 3SJXA 1XF1A 5D29A 3S9LA 1Y9ZA 4OC0A 4W9YA 4C9VA 3IWWA 3ICUA 4NGPA 4YN3A 4C9AA 1DE4C 4P4EA 3KASA 4MCRA 3D7DA 4P4JA 4C9UA 4C84A 4P4DA 1CX8A 1WVMA 3BXMA 3VTAA 4CDKA 3IIBA 4NGRA 4JZ0A 4NGTA 4NGQA 2JBJA 4P4BA 3I74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EK9 A;  2OOT A;  4OC3 A;  2JBK A;  3D7G A;  3FF3 A;  4MCS A;  4C85 A;  4CDJ A;  4OC5 A;  4C86 A;  3BI1 A;  5IB9 A;  1V6C A;  3RBU A;  2XEF A;  2C6P A;  4JYW A;  3SJF A;  4NGS A;  3S9N A;  2C6G A;  4P4F A;  4NGM A;  2OR4 A;  4OME A;  4X3R A;  2C6C A;  4C8A A;  2XEJ A;  4OC1 A;  3FEE A;  4C9R A;  3BI0 A;  3FED A;  2CIJ A;  4TWE A;  4P44 A;  4C8C A;  3S9M A;  4OC4 A;  4KNG E;  4P4I A;  3BHX A;  4TJX A;  2PVV A;  4C8F A;  3EIF A;  4C8P A;  1Z8L A;  4LQG A;  2XEG A;  4MCQ A;  3I6S A;  3SJE A;  2EK8 A;  2XEI A;  4C8U A;  4C8T A;  3FEC A;  2PVW A;  4OC2 A;  4TJV A;  4C99 A;  5F09 A;  4P45 A;  4NGN A;  5ELY A;  3SJG A;  3D7H A;  3D7F A;  4C9E A;  4MCP A;  3SJX A;  1XF1 A;  5D29 A;  3S9L A;  1Y9Z A;  4OC0 A;  4W9Y A;  4C9V A;  3IWW A;  3ICU A;  4NGP A;  4YN3 A;  4C9A A;  1DE4 C;  4P4E A;  3KAS A;  4MCR A;  3D7D A;  4P4J A;  4C9U A;  4C84 A;  4P4D A;  1CX8 A;  1WVM A;  3BXM A;  3VTA A;  4CDK A;  3IIB A;  4NGR A;  4JZ0 A;  4NGT A;  4NGQ A;  2JBJ A;  4P4B A;  3I74 A; 
#chains in the Genus database with same CATH topology
 2EK9 A;  2OOT A;  1KC7 A;  2HRO A;  4J0N A;  4OC3 A;  2OLS A;  1CS0 B;  2JBK A;  3D7G A;  3FF3 A;  3K9T A;  4MCS A;  3T5M A;  2AUN A;  3TLZ A;  4C85 A;  4OC5 A;  4CDJ A;  1VI4 A;  3T05 A;  1VBG A;  4C86 A;  3U1B A;  3TLY A;  5F5X A;  2D0O A;  3BI1 A;  4H1H A;  5F9M A;  2EZC A;  5IB9 A;  3K4I A;  1V6C A;  1C30 B;  3RBU A;  3EZE A;  2C5Q A;  4E5S A;  1Q5X A;  2XEF A;  2C6P A;  4JYW A;  3SJF A;  1ZYM A;  4NGS A;  3S9N A;  1DIK A;  2C6G A;  5FD8 A;  3KRV A;  4P4F A;  3TLA A;  1NXJ A;  2D0P A;  5IR2 A;  4NGM A;  2OR4 A;  4OME A;  2DIK A;  4X3R A;  2C6C A;  4C8A A;  2XEJ A;  4OC1 A;  3FEE A;  2R82 A;  4C9R A;  1M6V B;  1A9X B;  3BI0 A;  3GJZ A;  3FED A;  2CIJ A;  1CE8 B;  2X0S A;  3C8O A;  4TWE A;  1BXR B;  2GP4 A;  4P44 A;  4C8C A;  3TLC A;  4INJ A;  3S9M A;  3TLG B;  4OC4 A;  4COG A;  4KNG E;  4P4I A;  2MP0 A;  3BHX A;  4TJX A;  2PVV A;  3T07 A;  4C8F A;  3EIF A;  4C8P A;  1NBW A;  2E28 A;  4IIX A;  4COB A;  1Z8L A;  2YJT A;  4LQG A;  3SR3 A;  2HWG A;  2XEG A;  4MCQ A;  3I6S A;  3SJE A;  5JYB A;  2EK8 A;  2XEI A;  3TLE A;  4C8U A;  1KBL A;  4C8T A;  3FEC A;  2PVW A;  4OC2 A;  4TJV A;  4C99 A;  2HI6 A;  4E94 A;  4JVO A;  5F09 A;  1ZRS A;  4P45 A;  4NGN A;  2AUM A;  5ELY A;  3T0T A;  3SJG A;  1VBH A;  3D7H A;  2EZB A;  3D7F A;  3EZA A;  3TLG A;  1ZL0 A;  2PCN A;  4C9E A;  4IIY A;  4MCP A;  5JVL A;  3SJX A;  1XF1 A;  5D29 A;  3S9L A;  1Y9Z A;  4OC0 A;  4W9Y A;  2FM4 A;  3G23 A;  4C9V A;  4CO9 A;  1KEE B;  5K99 A;  3IWW A;  3ICU A;  1EZA A;  2B0A A;  1J3L A;  4M8D A;  4NGP A;  4YN3 A;  1EZB A;  4C9A A;  1DE4 C;  4P4E A;  1GGO A;  4CZ1 A;  1JDB C;  2YJV A;  3D7D A;  3KAS A;  4MCR A;  4EYS A;  1C3O B;  4P4J A;  2EZA A;  4C9U A;  4C84 A;  3EZB A;  3TLB A;  4P4D A;  1CX8 A;  1T36 B;  3NOJ A;  4MI1 A;  1WVM A;  3BXM A;  5F1Y A;  3VTA A;  4CDK A;  4MJX A;  3IIB A;  4NGR A;  4JZ0 A;  1R61 A;  4NGT A;  4NGQ A;  1JDE A;  2JBJ A;  4P4B A;  3I74 A;  3TYX A; 
#chains in the Genus database with same CATH homology
 2EK9 A;  2OOT A;  4OC3 A;  2JBK A;  3D7G A;  3FF3 A;  3K9T A;  4MCS A;  4C85 A;  4CDJ A;  4OC5 A;  4C86 A;  3BI1 A;  5IB9 A;  1V6C A;  3RBU A;  2C5Q A;  2XEF A;  2C6P A;  4JYW A;  3SJF A;  4NGS A;  3S9N A;  2C6G A;  4P4F A;  5IR2 A;  4NGM A;  2OR4 A;  4OME A;  4X3R A;  2C6C A;  4C8A A;  2XEJ A;  4OC1 A;  3FEE A;  4C9R A;  3BI0 A;  3FED A;  2CIJ A;  4TWE A;  2GP4 A;  4P44 A;  4C8C A;  3S9M A;  4OC4 A;  4KNG E;  4P4I A;  3BHX A;  4TJX A;  2PVV A;  4C8F A;  3EIF A;  4C8P A;  1Z8L A;  4LQG A;  2XEG A;  4MCQ A;  3I6S A;  3SJE A;  2EK8 A;  2XEI A;  4C8U A;  4C8T A;  3FEC A;  2PVW A;  4OC2 A;  4TJV A;  4C99 A;  5F09 A;  4P45 A;  4NGN A;  5ELY A;  3SJG A;  3D7H A;  3D7F A;  4C9E A;  4MCP A;  3SJX A;  1XF1 A;  5D29 A;  3S9L A;  1Y9Z A;  4OC0 A;  4W9Y A;  4C9V A;  3IWW A;  3ICU A;  4NGP A;  4YN3 A;  4C9A A;  1DE4 C;  4P4E A;  3KAS A;  4MCR A;  3D7D A;  4P4J A;  4C9U A;  4C84 A;  4P4D A;  1CX8 A;  1WVM A;  3BXM A;  3VTA A;  4CDK A;  3IIB A;  4NGR A;  4JZ0 A;  4NGT A;  4NGQ A;  2JBJ A;  4P4B A;  3I74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...