3ID6C

Crystal structure of sulfolobus solfataricus nop5 (1-262) and fibrillarin complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
227
structure length
220
Chain Sequence
ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural organization of box C/D RNA-guided RNA methyltransferase.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
molecule keywords Pre mRNA splicing protein
total genus 58
structure length 220
sequence length 227
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3id6C01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3id6C02
3LQ8A 3O8TA 4YJOA 4KWCA 3QD3A 2RFDA 2I0YA 5FADA 5LCJA 1J1CA 3MVLA 3RW9A 3RINA 2C6IA 2R3GA 4RC4A 3OZ6A 1JG2A 3LKZA 4GEOA 4HYSA 1PXJA 4FSTA 2XNGA 5EDQA 4C35A 5JEBA 1IXKA 5HE2A 2GU8A 2P55A 2Y1WA 4O0XA 1VL5A 2YVLA 5DTQA 2HW7A 4CKIA 2VV9A 1R0EA 3ZO4A 4ZZOA 4PYQA 3JS2A 4BIEA 2Z7LA 3L9NA 4ALUA 2XP2A 4F0IA 1OPJA 2YEXA 3I81A 3GCPA 4GH2A 2WTVA 4LUEA 3WF9A 4AOTA 3JWHA 3K5VA 3VUGA 5AUTA 2IZTA 3R9RA 4IADA 3AMAA 4LI5A 4WIHA 4D2RA 2X2KA 4FVQA 3PS9A 4R78A 3C5IA 3QRUA 2UW6A 2VWZA 3OW4A 4KIOA 4C33A 2WAJA 3D9VA 3NUUA 4XYFA 4RX5A 5AA8A 3GXOA 4AN3A 4EKKA 3PXFA 4O7LA 2FA2A 5CVGA 3NDMA 4BGHA 3HV5A 1FBNA 4FV1A 4LMNA 4QQJA 2XM9A 5T67A 3FXXA 3HP7A 5CVDA 2QD9A 4KNBA 5CT0A 5FXSA 1SG9A 5IMXA 4FKWA 3A26A 4O0TA 4EOKA 2I6GA 3MVJA 5DM1A 3KU2A 4H1MA 4KB8A 5IG1A 1WVYA 3HMMA 2EX4A 5HBJA 2B9EA 1R0PA 4W8DA 4TWPA 5BP7A 3QV2A 3C5UA 1Y57A 5KHXA 2PXAA 2Q83A 4O7RA 4YUWA 5K0BA 2JKOA 3PJ3A 4L01A 3NLBA 2V0DA 4B4LA 3I5NA 4EZ7A 1R39A 1OPLA 2Q0BA 3EN5A 3VW8A 4DMGA 3UODA 1Q61A 4YMGA 2CKPA 4WNOA 1WCCA 3AC5A 2C68A 3LFAA 2JBPA 4RQKA 2QQ7A 4E20A 2BR4A 2NXNA 2UVYA 4DCAA 4QP9A 3PFHA 4MBJA 2REIA 3TZ7A 2EUFB 3NW5A 2JIUA 1KP9A 4GS6A 2VTIA 4M7IA 3DPKA 1YWVA 3LXNA 4R7BA 4JG8A 4F9BA 3BEAA 5DLSA 5BVNA 3R8UA 4YZBA 4EONA 1H08A 5C8KA 3OFJA 2WKMA 4QTEA 2BIKB 2ZBQA 5DM2A 4O2ZA 3IGOA 2RG6A 4QMLA 3REPA 2ERCA 3HEMA 4E31A 4KW7A 2IVVA 2XNOA 3BHHA 4I0SA 4LECA 3F7WA 2FPOA 4LWPA 2G01A 3MPTA 4X0MA 1H00A 3LKMA 4FP9A 5HKMA 1ATPE 2GNHA 2E5WA 1UKHA 4KDCA 3L8PA 4F0GA 2W1FA 3H3CA 2G72A 2WQBA 3SW4A 4QQCA 4EQCA 4GOOD 4TW9A 4QMXA 2PLWA 4HRAA 5HEKA 1BI8A 4F84A 2B4SB 3E8NA 2XK9A 3IDCA 3KCKA 3MFSA 1OVEA 3MJ2A 4RBLA 2PGXA 3F3UA 4FTNA 3UYTA 5EHLA 3BHTA 2VWBA 4O96A 4QT1A 3UBTA 1H28A 2UUEA 3G9LX 4RX9A 4R8SA 4EQZA 3BEGA 1BI7A 3D5XA 3E88A 4FKVA 4FNWA 3FZGA 2XVDA 5HNBA 3E3PA 4C36A 4RWKA 1TQPA 4I5HA 2GS2A 3UOLA 2WMQA 3ERKA 2WEIA 5EIFA 5GOZA 2FYTA 1YRPA 3OWPA 2JH8A 2B2CA 3PA5A 2OH4A 3V8VA 2PVKA 3MCZA 1Z9XA 3GP0A 3X0DA 4IAAA 4E70A 4EOOA 4IWOA 5DVRA 3COHA 5M4IA 2X9EA 1NVRA 5A14A 1N7JA 2YJRA 3Q4TA 3NX8A 2OJGA 3PXZA 1XH6A 5D12A 1Q5KA 5FTOA 3QQHA 3HECA 4FA2A 5E8SA 3Q5ZA 1ZQ9A 3UZUA 5K0NA 2GSFA 1U54A 3NGAA 3C0KA 2G15A 3OT3A 4CTBA 2YIRA 3PA4A 3R30A 4E93A 2DULA 4KIFA 4LG1A 4J8MA 4R77A 1VLMA 1MUOA 3C4XA 3V6RA 4DG0E 4AZEA 4F9WA 4P7KA 3R7VA 1XBCA 1OIQA 3ORLA 2C69A 4P58A 1PYXA 2ZOQA 2JDRA 3TT0A 3UBDA 4RX1A 3MFUA 3RKBA 2DS1A 4OBQA 4LRJA 4ORKA 3ELWA 3LBFA 4WUNA 1FVVA 1GZ8A 5HESA 3E05A 3QUEA 1RDQE 3M42A 4IEBA 4CLJA 5J9YA 4IZ5A 4RVKA 4M68A 3CP9A 4LYNA 4F6UA 3UWPA 5E8TA 10MHA 2GLUA 2R0UA 4QQTA 3DFAA 3EVDA 4O38A 3L8VA 2H96A 4G9CA 3BU6A 4Y72A 3ZXZA 4BDAA 3LGAA 2YXEA 1JQHA 1ZYDA 3E7PA 3ACKA 1Q0TA 1NA7A 4P7EA 4EUTA 5DR2A 1L1EA 4P5QA 4DGGA 5K4IA 3HV4A 1UWHA 4XUFA 4DGLC 1YW2A 2P1DA 2ZWAA 5M09A 1JG1A 3OVVA 2QLUA 3HV6A 2CNVA 2W17A 3SGLA 4O83A 3BX5A 4F1OA 2WZJA 5E92A 2YJSA 1I09A 1U5QA 2J9MA 2CSNA 3E8DA 3HP2A 2YM8A 2FSTX 3DZQA 3DJ6A 5TT7A 3WF6A 2XNBA 3LPMA 3HUCA 3RNIA 3HLLA 4OTDA 3OBGA 2W4OA 3BCEA 4LWOA 3CXWA 2WMUA 2ZDTA 4ZY4A 3I53A 4PWYA 4C4EA 2FYSA 3PY3A 2IZRA 5CVJA 1Q4LA 3DBQA 4GC5A 1YDTE 3QU0A 4AN2A 4V01A 1WXXA 1KHHA 3HCBA 3L1SA 4PYLA 4RLKA 2Z2WA 3FL5A 4F7JA 2W7XA 3F3ZA 3EVZA 5IH4A 1INLA 1JKKA 2VUWA 4LFIA 3T8OA 1KPHA 2F49A 3WF5A 4N6YA 1P14A 5DT0A 4ANMA 2Y4IC 2EWAA 2ZB1A 2PVLA 4YHJA 2OBJA 4HVHA 1H0WA 2BDFA 1VBFA 3NAXA 4DFLA 2PX2A 5E8ZA 4RVFA 2Y7JA 4Z55A 4ZS4A 3IV6A 1B42A 5I9VA 4DH7A 3F5GA 4FSWA 4LM5A 1YFLA 4JBVA 3ENHA 4UY9A 3DDQA 2QONA 4IANA 1DM2A 5GJFA 3FZRA 4CTKA 4L6QA 3ZFMA 2ZVJA 4GIHA 2I9KA 2WPAA 1JQDA 3LW0A 4O0VA 1NBIA 3CQUA 4G31A 3PZEA 4QP1A 4XRLA 4EYJA 3EEYA 4QTUB 3LMHA 5BVEA 4FIFA 2AOUA 1CKJA 3P9IA 2VTPA 1J7UA 4JR3A 5HIJA 3FPMA 1OBDA 3W2CA 1UU3A 4KAOA 4F1MA 1WBOA 2VTJA 4ZTSA 3D94A 3E64A 2ZZKA 4QYFA 2OIBA 3EL8A 1H1RA 3KQWA 3MCTA 3PXKA 1BL6A 2OB1A 5IKMA 5D1NA 3NYOA 4JAIA 2C6TA 1YDSE 3VUDA 5IA1A 3DB8A 3TNWA 4AE9A 3RWQA 4EH2A 2WOTA 2V74B 1WXWA 3THRA 4MX9A 4W4VA 2AC5A 5DHJA 5FGKA 5LMAA 4DEEA 4DFZE 3RMFA 3DTNA 3GGDA 3Q6WA 5FQNA 4JG7A 5EFQA 3FYJX 4AT4A 4PNKA 4M37A 5FA8A 2IW8A 5E9QA 4U45A 3SX0A 3NCZA 4OBWA 3OTUA 4YZ9A 4C2VA 4RTKA 4K6MA 2HZ0A 3ATTA 3ORPA 4FZ6A 5IQBA 2R2PA 3SR4A 3S0OA 2PUNA 5HGIA 4AN9A 4EH7A 1P5EA 2HZIA 4JRVA 4E4MA 2PX5A 2YHVA 4IAYA 3OU6A 4R7HA 4XRJA 5EPEA 4ATNA 3FXWA 2BFXA 3OE5A 5KQRA 4X3FC 1FMOE 4RPVA 3HL7A 4MWHA 3KQYA 2WMRA 5A4QA 4GVAA 3NYXA 3DKGA 4XV1A 3NR9A 5FRIA 4GRBA 5HD4A 1Z57A 5KX8A 3NW6A 3UNJA 3EGIA 3KHKA 4EORA 4IX4A 3R71A 5HIIA 4IV0A 1W7HA 3VYWA 5K0EA 3MTLA 2EU9A 3UC4A 4F7SA 3OE4A 4LGGA 1PF8A 3E8CA 3UZTA 4FTMA 4PF4A 3MGYA 4BLVA 1BL7A 3EQCA 2OICA 4OA5A 1SVHA 3P9JA 4Y8DA 3KPVA 4IBMA 4ZSEA 1LR4A 4APPA 5JSMA 4AZVA 3VC4A 5CEIA 1ZOEA 3WZKA 4BI0A 5EVJA 2WMSA 4MCVA 4BHZA 2J51A 2ONZA 3F61A 4KA3A 3BZ3A 4QP2A 3U55A 2CCIA 3DJ5A 4OTIA 4D4RA 3D7ZA 3ZTXA 1RJGA 3UFBA 4NM3A 3TV4A 1J7IA 1SQGA 3QRKA 3W10A 2GA9A 3SXSA 4YZNA 1QMZA 3CCFA 3QQKA 3U81A 4DT8A 3TN8A 4PCAA 4UEUA 2OFVA 3BPRA 2YM4A 2GMXA 3DGKA 3TXOA 4GIIA 2BM9A 4EC8A 3UJDA 3TMAA 2UVZA 3IOKA 5CZIA 5IQEA 2NP8A 3RM7A 2VTSA 3TZMA 4JAJA 4J98A 2YITA 5FBNC 4DG3E 4FGZA 3HV3A 3KC3A 3A7GA 4C7TA 4FR0A 1W84A 4GUAA 2PUPA 3ER8A 4IC7A 1CTPE 2UZTA 4U79A 3ZLSA 3GRUA 4Z7GA 5A4CA 2PU8A 3KREA 4XP3A 4N4SA 4AF3A 1RJFA 3ODZX 5DX1A 2IH5A 2GNLA 5IZFA 4G16A 2WIPA 2JG3A 4XP0A 3FHRA 3BU3A 3HNGA 4YJQA 4IDTA 3GB2A 3HZTA 4J71A 3ZC6A 3DV3A 5HBEA 5JQ8A 4AXAA 5LVPA 4U7TB 2V22A 5EI2A 4PP9A 4TYJA 2BRMA 2F2CB 4FC0A 4TYHB 5E8VA 5EDPA 1YZHA 2CWWA 3PYYA 4OTHA 3FI2A 3QQGA 4WO5A 1KV1A 5DPMA 5I9ZA 4U3ZA 3FKNA 4O6LA 2C5NA 5B2KA 5CAVA 3EYHA 3OS3A 4RZWA 4A4XA 3QKKA 1K2PA 3KMUA 5DI1A 5FTGA 4DEHA 1EIZA 2HZNA 3TUCA 3ROCA 2HNKA 3OXIA 2ZB0A 2GS6A 4XOZA 1JKTA 5IUIA 1SZMA 2PZIA 5CF8A 4CTJA 4FSQA 2C3JA 4K2RA 1KOAA 1X1AA 2G9XA 5J5SA 3FQHA 2Z6UA 3BT7A 2VTLA 4RT7A 2G2IA 4O81A 4GFGA 1XJDA 4KDRA 4ER7A 5K4JA 1VIDA 4FOBA 2ERZE 1JSXA 2YQZA 2C3KA 4HTFA 3L9LA 5H02A 4TWNA 4ZSAA 2JDVA 5EC8A 4DINA 4B7TA 3EWHA 2WTJA 3A2CA 3PJ1A 4FT5A 3ZCLA 2WQEA 1H1DA 2LD4A 1XDUA 3PB3A 4ASXA 5E2BA 2QR7A 4YMHA 2C5YA 3LM5A 4QQNA 4B9DA 2RFNA 5K05A 4QMNA 2ITVA 5CIYA 1DAWA 1FQ1B 2PJDA 5CUQA 2V7AA 2ZMDA 4YV2A 4FSDA 3LE6A 3OUNB 1R74A 3H4JA 4A6EA 3G5DA 4FTAA 2CL5A 3GEQA 4O22A 3M6XA 3CQWA 3OC1A 2C6LA 4EWQA 3BHUA 3L8XA 5ACBC 5IISA 3G89A 2ORED 3LCVB 3O4FA 3Q7EA 3E5AA 3NDIA 4P7FA 4G1WA 5I4NA 4FKTA 1E1XA 3W32A 1M2QA 3V5TA 5KMJA 1O9GA 3M6WA 1VR2A 4PGHA 4RWJA 4U6RA 4RX8A 4UWBA 4BCNA 2GS9A 2G1PA 3FLZA 3DFCB 4LOQA 4RJ6A 5BMSA 3QOWA 3CJQA 3KN5A 3BWJA 3EFLA 4EZ5A 2R0IA 2O8YA 4ERKA 1ZYJA 4XUCA 3R7EA 3F3TA 5EHYA 3TDVA 4ISCA 4RTJA 3R8VA 4ENXA 4RTOA 4F08A 2OH0E 3DK3A 5KMNA 4M0YA 2ZBPA 1XR1A 4EOMA 1FPQA 1ZHFA 2P3OA 2UYOA 4PIPA 3PPZA 3O7WA 5L2SA 4F1TA 3I64A 3KQOA 5M4CA 3DDPA 2A4LA 1PMNA 4CT1A 4YV1A 1REKA 5DA3A 4YGAA 2OKCA 2XCKA 5IA0A 4BDCA 4FZDB 5FUTA 3ORMA 1F3LA 3TR6A 5HI2A 3VJOA 3ZU7A 2HW6A 4MXCA 1AQJA 5P8WA 2ITXA 4CWAA 4PMPA 3JY0A 2BILB 4R6VA 4OTGA 3P71T 1UV5A 3IOPA 4X3FA 3UVPA 3T7RA 2C7PA 4O7NA 3DXQA 4O0WA 3PWDA 4ZTNA 3P9CA 3BRBA 2IP2A 4C03A 4K77A 4BYJA 4A9SA 2R3OA 3MY5A 4G5PA 4QYYA 3R6TA 4ZSJA 1U59A 3LJ0A 4BCOA 3R63A 3E62A 4A7CA 3FPJA 2PHKA 2OJ9A 5FCDA 2F7EE 5AUUA 3MSSA 4JIKA 4YZDA 5IH5A 3SOAA 4MK0A 2W5HA 3KVWA 2O2UA 3EFJA 3O17A 5HIDA 5ITAA 4UXLA 3OY3A 3JVSA 1O9UA 4I94A 5FBOA 1EAMA 1M17A 3EJ1A 3FY2A 5EYMA 1MHTA 3SC1A 5CENA 5L6OA 1OZ1A 2YA9A 2QG5A 4C62A 2ITTA 4XHKB 2UW7A 3V6SA 3VRZA 5LQNA 5IUHA 4DN5A 3GO4A 3C6KA 3OXTA 1IRKA 4EHEA 5E1SA 3CPCA 3MH0A 2CDZA 4ZY6A 2NPQA 3DS6A 4FIGA 4MWZA 4DCGA 3PIXA 4YU2A 4FG9A 2QHNA 1WY7A 3ELDA 5C26A 4E4XA 2GH1A 4DTBA 2XBAA 5CX9A 5DEWA 4O0YA 4I0TA 3BKWA 4NL0A 4KKEA 4KSPA 4KRCA 1M6YA 4ZZMA 2YTZA 3C4FA 1KE6A 3DLZA 5CALA 1CSNA 4BZNA 2JC6A 3L9PA 2OPBA 2PT6A 4K33A 3FTDA 2BRBA 1BX6A 4QNYA 4BI2A 2C4GA 5DBXA 1PXNA 3FMMA 2H1RA 3A4TA 5E1OA 2A0CX 3K6RA 3OCBA 1HCKA 1FJXA 2C30A 2X7OA 3ROYA 4ZK5A 3TNPC 2PE1A 5L2IA 2XJ2A 3PVUA 2FUMA 4ZP5A 3MAGA 4IAFA 3HA5A 5CVVA 5C8MA 2YCQA 2A2AA 4DEAA 3E8EA 3G15A 2J0IA 4IE9A 3RPRA 3PP1A 4RVMA 4DG2E 1G8AA 3LFDA 4YTCA 4ZJVA 3F4KA 3Q3BA 4W8EA 2OO8X 3NZ0A 5JGAA 4XCXA 4EBVA 3CR0A 3FUPA 5EQJB 2IBSA 3LCOA 2R7BA 1RW8A 4XG3A 4CQEA 3C50A 1G60A 1XQZA 3MFTA 3CEKA 2ZBRA 1UU9A 3P2KA 2VO7A 5KCVA 4O2PA 3OXZA 4ZSLA 2OZAB 2O57A 2Y4IB 2C6DA 4PTEA 1ZKDA 3P08A 5M06A 4NU1A 5AM7A 5EI6A 2QU5A 3OEZA 1LEZA 4J8NA 4DEBA 3B3FA 2I1MA 3NIEA 3GU5A 3EZRA 4HJOA 5F1ZA 3IQ7A 2ADMA 1L3CA 2YM6A 3AQVA 4LRMA 4XG2A 2UW0A 4JS8A 5AP5A 2HAKA 2ZM1A 2KW5A 2BMCA 4EJ7A 4BIDA 3BWBA 2ONYA 3BU5A 2IN6A 3Q96A 4KSQA 5LR6A 5HQ0A 5J9LA 2F7ZE 5HTBA 1SNUA 2Z60A 1OL1A 3FZTA 2AOUB 2ZW9A 2BRNA 3B2TA 2YIQA 3LVPA 4U41A 4PTCA 3U6JA 4CMOA 5HG7A 1A06A 3IDBA 4CKEA 1ZXEA 3V8SA 4QP7A 4TRLA 5EW9A 3ZYAA 4BDHA 4ZJIA 5LWNA 3AG9A 2AZTA 2AS0A 3MIYA 4YHTA 3ORKA 1ZYCA 5ETCA 5T6KA 2BVAA 3MPMA 4R3RA 3ERCA 4ERWA 3GU4A 4ER3A 2P2IA 2RFSA 5HG9A 3UQGA 3DZOA 3Q9YA 3CJGA 2J6MA 4I93A 2X6EA 4M13A 5ANKA 4ASEA 5HZMA 3I9FA 3BLHA 3F2AA 4UYAA 3R73A 4JDKA 5HIKA 2QYOA 5TR6A 2I0VA 2I6LA 5EMLA 3OEFX 3QZIA 5HCYA 3HDMA 3DQXA 3P1AA 2NRUA 1JSVA 5KQSA 4FK3A 4YC8A 1QPJA 4FIEA 2BZJA 3JPVA 4DKJA 2VP3A 5AAFA 2IDJA 3PE2A 4Y95A 4L46A 4RX7A 3LFNA 4D4YA 3SRVB 3QL8A 2W5BA 1IM8A 1V39A 5CEOA 3VUHA 3KRJA 2XBMA 3FUXA 5FEEA 4C0TA 3RODA 5TOZA 4BZOA 5C03A 1L8TA 3A7FA 3HP5A 3V3VA 2ITUA 3VO3A 1HMYA 2ZIFA 4FGBA 4KIGA 4Q9ZA 4ER6A 2IJMA 3HMPA 3ITZA 5HNGA 4NUSA 2LAVA 4WG5A 5I9YA 5AP7A 3SLSA 3UO6A 3FLSA 2Z7SA 2EB3A 4FIHA 4HNIA 3W16A 1AQIA 2GNJA 4O6EA 2EJUA 1XHAA 4O91A 2EXMA 2VDUE 3JY9A 1F0QA 2IBTA 5A4LA 3VNTA 5FHRA 4MQ4A 4JBPA 4AWIA 3BZBA 1OKZA 2R3QA 3OW3A 3C13A 4NTTA 5DG5A 5CNOA 5CSWA 3VJNA 4BBFA 5CEKA 3UNKA 3BUSA 5K0GA 2Z6QA 3K5UA 1GY3A 4FIIA 3BE2A 5FD2A 4AA4A 2XK3A 3TACA 5DSXA 2NO3A 3FMKA 4RTLA 2E9OA 4GT4A 5CANA 4QMPA 2YM5A 1F38A 5LCKA 3NNUA 4FKLA 3EVBA 4TT7A 3UJAA 3EVAA 2WELA 1RE8A 5EOBA 4XS2A 5DXAA 3HMIA 1MQ4A 4WT6A 5ANIA 2CKEA 3FI8A 1H1QA 3CD8A 4ITHA 3RK9A 3VS4A 3C3PA 4C08A 2R9SA 3G9NA 3QA8A 4ZLYA 3SW7A 1R6AA 4OUCA 3FUUA 4USEA 4ZTLA 5DT3A 5BVKA 5E1DA 2R3PA 3LJ2A 4D1XA 2BROA 2XNEA 3KULA 4PTGA 4AGWA 4BF2A 2C3LA 1KR5A 4BDEA 4ANQA 2P2HA 2ESMA 1R18A 1IEPA 2RKUA 2YAAA 5BQ0A 2E9NA 5DT4A 4Z3VA 2BZIB 3D7TA 1H4LA 1R1WA 3TZ9A 3A60A 4M3QA 1KWPA 3ZUUA 4EQMA 4HGEA 2RG5A 3VWAA 3RP9A 4EYMA 2PL0A 1OM1A 4O7TA 1VP9A 4FKPA 2FGIA 3P7BA 4NWMA 3FMEA 4PDPA 3RPOA 3ZBXA 4RVGA 4BTFA 2AC3A 2YZLA 5AV0A 5AUWA 2EJTA 1X19A 2PT9A 5K3YA 4FTQA 1MP8A 4DH8A 3UGCA 1YI6A 1NVQA 3GFWA 3UQFA 3TOSA 3P86A 2WGJA 3CY2A 2WTKB 4Q9SA 2YISA 2PVJA 3SDJA 4FTIA 3QTWA 4NH1A 5FDPA 1Y8CA 5BPYA 2HWKA 3UJ7A 3FWQA 4CFXA 4FV2A 4I21A 5KMIA 4FSXA 3W8QA 1FPUA 2X81A 1L3IA 3LDGA 3M1SA 2Y6OA 3QTUA 3EL7A 4X7QA 1QPEA 5EQYA 5EDRA 4BBEA 4QTAA 1J7LA 4RIWB 2CNQA 2W1ZA 4BR3A 3KXXA 5BVDA 5LJJA 5T6BA 4DQ0A 5A46A 2B0QA 5ICGA 4PQNA 3B89A 4WKQA 4DYMA 3NVMB 3K3JA 4FOCA 1A9UA 4BY9E 3LSTA 1UU7A 5DH3A 4J99A 5DLYA 1S9IA 2PZPA 2R3HA 2G8NA 3KQPA 5K5NA 4U7PB 3EHAA 4DM3A 3U51A 3F5PA 4V04A 4J95A 2GHMA 4YBKA 4W4WA 3G6HA 3VF8A 5DWQA 4XNEA 2R3SA 3ME5A 5G6VA 4Y85A 3WE4A 4DBXA 3AC1A 3PPJA 3Q9XA 4GW8A 4GU6A 3RWPA 3ZC5A 4CMUA 1SNXA 1Q41A 3F88A 3NYNA 4FTTA 4F99A 5EIWA 4FUXA 4B8MA 3AXTA 3ZO3A 4JR7A 4G6NA 4N70A 2JKQA 3CBLA 4HOKA 3DK7A 5ETFA 3ZZEA 3KPWA 1XO2B 2A14A 1XXLA 4GF5A 5D1HA 3DB6A 3HMNA 1XBBA 4IHPA 4XLVA 3EMBA 3B5IA 3PE1A 4I23A 5EZSA 2OZOA 3O71A 4JQ8A 4YP8A 5I5ZA 1RJEA 5DIAA 2QG7A 3EN4A 4I5CA 3DNDA 4FT2A 1I1NA 3GBZA 1Y8GA 2IZUA 3QHRA 2VTNA 1Y8YA 3MB7A 3QRIA 4KBCA 4DF3A 5HOQA 2VO3A 3R6XA 3DXXA 2QOHA 4DEGA 2B9HA 5CU6A 5AUXA 1KV2A 4RIYB 2E9PA 4FEWA 5LVLA 5IQCA 4RJ5A 5CTPA 2BAKA 2CKDA 4G3EA 4BDGA 2B9FA 3SG9A 1VYWA 3UJGA 2JH9A 4B17A 3VQUA 4DA4A 3GRZA 3A62A 4QPPA 3U87A 3P2EA 4E6CA 1KIAA 3D2LA 3EVGA 1VE3A 3R1YA 4E6QA 2HWPA 4RZVA 5GJGA 3MBLA 1M7NA 3D2KA 3RM6A 4C59A 1NW3A 2VDWA 5BYYA 4FV4A 2OBFA 4JT3A 4HYHA 3QYWA 3WZUA 3GOPA 3V04A 2FHPA 5G1XA 4EK4A 3ACJA 4UX9A 5JRQA 3QCYA 1GZOA 3GUBA 4YJPA 5AUVA 4I6BA 4ARKA 4DEIA 3U9NA 4TY1A 5L2TA 3C6MA 1UNGA 2C5XA 3E93A 3Q2JA 4C61A 2VZ9A 3EH9A 5FG8A 4U7ZA 5FM2A 4MHAA 5TKDA 3R24A 3VN9A 1YOJA 1J91A 3EQBA 2PX4A 3RPSA 3LCCA 3IONA 3GRVA 3KRRA 4U40A 4XCUA 2BRGA 2ITWA 1ZLTA 1ZY5A 5DPVA 4KWPA 3NMUF 1HOWA 4JX7A 3NSZA 4GBED 4CT2A 3OBJA 1S9JA 2WO6A 3DXNA 4XJ0A 4QYGA 5CAUA 3GJYA 5LQUA 1UU8A 3VUKA 4CFFA 4D28A 5LVMA 2JD5A 3FMNA 3ORTA 4UV0A 1QANA 3KB7A 3CGGA 4EK9A 3MTEA 2PK9A 2O64A 3GQIA 4F65A 3KXMA 4K9YA 4L3LA 5EEHA 3OCSA 4M0ZA 4NSTA 5E8RA 4PDOA 3F5XA 4IQ6A 4M97A 4XOYA 3PRFA 3UOJA 3A25A 3T7SA 4USFA 5E8JA 3PVWA 4UN0C 1IG1A 7MHTA 4RJ4A 5D1JA 4GK4A 1NBHA 2XCHA 3D15A 3QKMA 4I6QA 3WIKA 5M08A 3TKIA 2C1BA 2W99B 3EFWA 4V0RA 1CDKA 2ACXA 3QC9A 4Y73A 4MD9E 1XWSA 5CVUA 4TYHA 4BCMA 4DBNA 4E8AA 3ZO1A 4HVIA 3GU8A 1SVUA 5FWDA 5D10A 4E2WA 4EHVA 1ORIA 3SM3A 3NNVA 3QCXA 4CFUA 5AP2A 3QCQA 1RI3A 2OW3A 1LEWA 4FI1A 3VBQA 1H24A 4DFYA 5CCXA 4YUXA 4IWPA 3I0QA 4OQDA 4ONAA 5K0FA 1NW8A 2QOLA 4KKGA 3CGFA 4R3CA 5CT7A 5AV2A 4ENYA 5KKRB 2CMHA 4FTOA 5A6NA 4FR4A 3WF8A 2XMYA 3MJ1A 2ITPA 4GYIA 2OI4X 4CZTA 2QM3A 4MF1A 4YPSA 3R9NA 3I58A 5IEVA 2ETKA 2BHHA 4RIYA 1R78A 2IPXA 3K3IA 2JDTA 4OTWA 3FPGA 4EH6A 3HVHA 1FOTA 3OCTA 5FULA 3IW4A 2C6OA 2BHEA 3VF9A 8MHTA 3LJ1A 3Q2MA 2JEDA 3I7BA 4ZTRA 4EK8A 4YJUA 4HGLA 3HCCA 2PWLA 3UMWA 2A1AB 3R9OA 2P7IA 4XG4A 5HLPA 1WZNA 3ORZA 4AA0A 2F7XE 3IS5A 5DWRA 3MS9A 2WQMA 1XTPA 4GEKA 4MNEA 4PYNA 1PKGA 3PY0A 5ANDA 5EHIA 5E8WA 2CLXA 3Q60A 2YCRA 1NT2A 1KUTA 3ZEPA 4C04A 5ANOA 4XG7A 1DI9A 1WAKA 4IWNA 1W82A 2SRCA 2YWVA 4IV8A 5DEYA 4IX5A 1V0BA 3A4OX 5HE1A 4X60A 5G02A 3CQEA 2CN5A 3ANQA 3F9NA 5H2UA 3G8AA 3KU1A 2I7QA 3WILA 3S68A 3VS5A 3R1SA 3FTCA 1H1SA 3RTPA 4BYIA 3I6WA 3UG1A 3ZLYA 4EH8A 3R9DA 4FEXA 2DUVA 4I6HA 2YXDA 3V8TA 5JGBA 4UB7A 3R8ZA 2J90A 4KS7A 4AP7A 3DBCA 4FV8A 2VTHA 4QP6A 1MJFA 3DTCA 3RAWA 3DP7A 3KR0A 3SAYA 2WTDA 1N7IA 4P4CA 1H25A 4O7YA 4K8AA 5LQKA 3UTOA 2VO6A 3NAYA 4FKSA 3FUWA 3F7ZA 3P23A 4DLJA 4OLIA 4U81A 4RVHA 4FSNA 3M6UA 4EUUA 3IW7A 3KA0A 3LXPA 3KRWA 5EH0A 3FC2A 2X0GA 5DE2A 3TQSA 2UZLA 3VS3A 3HKOA 2R3FA 2BAJA 2WB8A 5GP1A 4BP1A 5CVHA 3AD5A 4WNKA 5EHOA 1QYRA 3MERA 3T0IA 2AN4A 2AVNA 2H11A 3Q53A 2Z8CA 2WD1A 5EW8A 5M56A 3CY3A 1VPTA 2XK4A 1QZZA 5AMNA 5IH6A 3PLSA 2PVMA 2UZDA 2YR0A 4JX3A 2HMYB 1WBVA 5GIPE 3CTHA 4CGAA 1OL7A 4RGJA 2AOTB 3MQ2A 4IIRA 3LQ5A 3SG8A 5EGSA 3DK6A 1IA8A 1U2ZA 2CGVA 1XKKA 3KVXA 3CCNA 2W1IA 5EYKA 4F6WA 5IPJA 4OT5A 3FQEA 3SVVA 4UWCA 2G2HA 5CSXA 2OIDA 3V01A 5E7RA 3UP7A 3HUBA 4PV0A 1KYZA 4R3PA 4LL0A 3QZGA 4QP3A 2WMBA 4WHZA 3BBWA 4AS0A 4EH9A 3HGKA 2F2UA 4LV8A 4PL5A 4YJSA 3ZONA 4J52A 5IF1A 1XJ5A 5HCXA 4NFMA 3BE9A 3U8WA 3D4QA 4ZEGA 4B99A 3AOXA 5EW3A 1YXTA 4FV5A 5BUIA 1WBPA 2E9VA 3DULA 4XV9A 1YQJA 5C0OE 5JT2A 3UOHA 4GJ3A 2HTEA 2ONLC 4H3BA 5T3QA 5I9UA 4ZMFA 4J97A 4UWYA 5LARA 4F6SA 1MRUA 5A4TA 3ZRLA 4I6FA 4TNDA 5EM6A 3W2QA 5L3AA 3QA0A 5KKRC 3R21A 2BKKA 3ORIA 4MIKA 5JGDA 2BALA 3IK3A 5IA2A 1YDRE 3R8LA 5K03A 2CLQA 2OSCA 5F95A 4F0FA 1H26A 2V7OA 4HW7A 4H58A 2JBOA 1FINA 2ETRA 2Y4PA 1Q99A 2VD5A 2HZ4A 1TVOA 4BRXA 4PMTA 3ORHA 2CKOA 4MXAA 4ZLZA 4XG9A 4FT3A 4IWDA 3MVMA 1OECA 4KUJA 5HIBA 3RCJA 2YABA 2CGWA 4II5A 4U42A 4W4YA 2HWOA 3C3YA 3RIEA 1YHVA 2PBFA 4DH5A 5E8YA 1PXOA 1EJ6A 2XKEA 4NIFB 3E8SA 4F4PA 2J0LA 3BV3A 1SVGA 3MWUA 3C0IA 3G0EA 3PFGA 1YXVA 2GFCA 2I0HA 5LWMA 4E32A 2P4IA 4NK9A 3COKA 5CNNA 4A4LA 3F3VA 2AOXA 4XUDA 2QNJA 1R3CA 2FB8A 1IAHA 2H6DA 2W1CA 2W1GA 4U3YA 4YJTA 2QODA 4L8MA 4F7NA 3KXZA 3U4UA 2B3TA 2WA1A 4NKSA 5FXRA 5LQCA 3D5UA 4AZWA 2G70A 4K6ZA 3M6VA 3MB5A 3G2PA 5DTRA 1DAYA 2PY3A 3AGMA 4YJVA 3U6IA 2C47A 1WMKA 4DGOA 3QC4A 4CG9A 2YUIA 3G5TA 3F2RA 3RALA 5IQHA 4OX9Y 3P7AA 4QYHA 4FKIA 2JHCA 4IDVA 5E8UA 5BUEA 3W2SA 4J7BA 5HVYA 2FK8A 4OR5A 2C7QA 5HFJA 4KVZA 4L68A 4MVFA 4ER0A 1OUYA 3DMGA 3G88A 4X3FB 2X8IA 3FYKX 4HH4A 2GHGA 1YI3A 4GCJA 4NJDA 3RI1A 3ZO2A 4MH7A 3R28A 3B8QA 4U9AA 4QTBA 5D11A 4IVAA 4BI1A 4DTKA 5JKGA 2C0TA 3PY1A 3BYOA 5KO1A 2BIYA 4BCKA 2PX8A 3SSNA 4AGCA 2I62A 4C07A 3G2MA 2QY6A 4MHTA 2VTTA 3ENMA 4L00A 2XYNA 5EM7A 4C4IA 2CMWA 5T68A 3OD6X 4FSMA 4A9UA 5M07A 4FTJA 3OG7A 5KZ0A 5AP3A 4RTPA 3NUYA 3DMFA 3FTEA 4PIMA 3FSKA 2QCSA 4IAZA 2QVSE 2XYUA 3KXHA 4RIWA 2P41A 3TIYA 3FI4A 3ZS5A 4PYIA 3NNWA 1PXLA 3R7OA 4IJ9A 3CTJA 3WSTA 3P7CA 2PSSA 3B2WA 2C7RA 1NW5A 2YX1A 3FI3A 3O7LD 4CFVA 5AAGA 2H8HA 3R2BA 3A7HA 1W0XC 3A7JA 4YNEA 3ZM4A 1T45A 4M69B 4AZFA 4C2WA 2WHBA 5C4KA 1IAJA 3S00A 2AN3A 3KXNA 4RIXB 2XNMA 2AR0A 3FYCA 2HY0A 3QQUA 3QQLA 3R1QA 4B0GA 2ZDUA 5M57A 2I0EA 4JLCA 4OT6A 2UVXA 2UW5A 2FSLX 5HE3A 2W1HA 5JN2A 1D2CA 2ZTHA 3HRFA 3SVZA 4ZLOA 5EKOA 2BUJA 3PVBA 4C3PA 4BLUA 3FMDA 5KNJA 2PPQA 2BR3A 5JFVA 2R3KA 3GOKA 3ELUA 3DBDA 1JLUE 2R4BA 2YCFA 1YKRA 3ULZA 2ESRA 3FJQE 5LMKC 4IWQA 4ZAUA 1L3BA 1W98A 4QMWA 1RI2A 1EG2A 4X6QC 2ZSUA 2PZYA 3HMOA 4PP7A 2W1EA 5DRYA 3BKBA 4HCUA 2OXDA 4WRSA 1STCE 2UZVA 3BYVA 4Q5EA 4RIOA 4F9AA 4H0NA 3LMIA 1ZARA 5DOSA 4HZRA 4AAAA 1H01A 4F86A 1P1BA 4IB1A 1ZG3A 1IR3A 3SV0A 1Q3DA 1E9HA 2CN8A 1YVJA 4M8TA 3OOMA 1JNKA 1QL6A 2R3NA 3F6XA 3IO7A 3E3BX 3R8MA 3UO4A 4ANLA 4BKJA 4D0WA 3CGOA 3KQ7A 4D9UA 4RC2A 4DHFA 3FKOA 3M33A 4H1JA 3TTJA 3ORXA 2PKWA 3UIMA 3TNIA 3BWYA 4U43A 3VBTA 3PDTA 3Q4UA 2AOWA 3I5ZA 5CASA 3R9XB 3KY2A 5CAOA 2YIWA 3LLAA 2GNGA 5JMSA 3E92A 2NXCA 5GNKA 3GU6A 2R5TA 2XJ1A 3DKFA 3FPHA 4PMSA 3FUVA 4QMVA 1PMEA 2OF2A 2IFTA 3A7DA 4QP4A 3KK8A 5FTWA 3OZTA 4FVRA 4OA8A 4IM0A 5FP6A 5CLPA 3C0HA 5EG5A 3MI9A 1KE7A 3R02A 2XNNA 4ZTHA 3O2MA 4YLKA 4APCA 3FYDA 4KKHA 4TPTA 4Y83A 2VWIA 4S33A 2LGCA 4D1ZA 3KRLA 1RJBA 3UOKA 1URCA 3N9XA 2PE0A 3ZDIA 4AE6A 1EJ0A 3EPPA 3D5VA 3G2QA 3LDFA 1RI4A 4BCPA 2OO3A 1JWHA 3A99A 5GHVA 3UA4A 1GJOA 1Q8WA 4HCTA 5H3QA 3HEGA 2X39A 4GT5A 4WOVA 1GIIA 2UZNA 3KMMA 3PPKA 3QRTA 4G34A 5LQFA 1PW2A 4GT3A 4UZHA 4BTKA 2VTMA 3HCEA 4MQ1A 4FYOA 4FZAB 3S1HA 3PJ8A 2IVUA 3OCJA 2O07A 4B8LA 4FTRA 4AA5A 4FL3A 4NFNA 5EG3A 3SX9A 4C05A 3WYYA 2OB2A 4QPSA 2VWWA 4IX3A 4QMYA 5CSHA 3NWEA 4FV0A 3R3HA 5DX0A 1TKIA 3QXPA 1M14A 2W5AA 2R3MA 3CKXA 3TM0A 1NW6A 4P2KA 4KRGA 4CXMA 4FTKA 4WD5A 3P97A 2AOTA 3I79A 1OKYA 5KYGA 3UVQA 3HAMA 3EZVA 3PIYA 3S95A 5AAEA 2QE6A 4YTIA 3TM5A 2NP6A 2ETMA 2J4ZA 4K0YA 2IW9A 5K5XA 3DXYA 5DSTA 5FTQA 4AW0A 3AXWA 2X8DA 3M70A 1V0OA 2JKKA 5JRSA 5EKXA 4GK3A 3QHWA 5CVEA 2UZUE 3KN6A 4JQ7A 3R1NA 4PYKA 5ICCA 3VULA 1O54A 4UYNA 4A07A 3T7TA 1M2RA 5KVAA 3WBLA 4O0SA 1E1VA 2YACA 2OG8A 3BI6A 4FZ7A 4MAOA 5AX9A 2C3IB 3AT4A 1AF7A 4CFNA 3GDHA 2XRWA 5LQRA 2KTYA 2QR8A 3ID6C 4E2YA 2C0OA 1ZWSA 2I40A 3BYMA 5HVKA 3LMGA 3MTFA 4FTCA 9MHTA 1LP4A 4QNAA 5HNIX 1VP3A 4EC9A 2Z02A 1MRVA 5K09A 3FL4A 1HCLA 4XEYA 5DM0A 5JZNA 1YHWA 5CY3A 1XH7A 3VS7A 4E4LA 3GCZA 4XG6A 3GU3A 3D0EA 3TKYA 1G5SA 4QMSA 3COMA 3QUPA 1PXPA 1Q24A 3QQJA 2ZZNA 3PSDA 1SMHA 3O7LB 4ZY5A 4PINA 5IA5A 3GCSA 3DBFA 4OBPA 1XCJA 3LHDA 1AV6A 4IAIA 4MEDA 3NUNA 3ER9A 2X2LA 1CKIA 4HYIA 4JVGA 3FMHA 2C6EA 4FV9A 5KMMA 2UYQA 2IZSA 2Z7RA 4BDDA 4OW8A 3VQHA 4TYIA 3JWJA 5T64A 3OHTA 5AP6A 1T43A 2UW9A 3B8RA 3TG1A 3ULIA 2PVCA 4U5JA 2FSOX 2R3RA 3TNHA 2JLDA 4PMMA 2PULA 4DEDA 3H9RA 4L42A 4C38A 2J5FA 2VGPA 3DXPA 3GVUA 3HDNA 2VRXA 4IFCA 5HG8A 2OU7A 2ZMCA 5AIRA 5C27A 4E26A 4EH4A 3ANXA 2ITYA 3JYAA 2FO0A 3DCVA 4CSVA 5FEDA 3KL8A 4QMMA 4WNPA 4X61A 3QKLA 3PP0A 4CG8A 1SQFA 4IB0A 1P91A 2ZWVA 1OBGA 5CU3A 3NTVA 3ZRMA 4S34A 3DQWA 4M12A 3TEIA 5B2MA 5KS2A 4AZSA 4EKGA 3GGFA 2E2BA 3QX4A 4MTAA 3HCDA 3KQMA 2VWXA 2OXYA 3SD0A 5F4NA 1TQMA 3A4PA 4I4FA 4ZZNA 3RHXA 3UPZA 1QAMA 1WS6A 4FTLA 4UBAA 4FE2A 3LCSA 4JL9A 4D0XA 2RFEA 2VAGA 3BGZA 3D83A 3JWGA 3MFRA 4DZRA 5JK3A 4XLIA 4DITA 1NW7A 1FGKA 1WBNA 1YFJA 3L8DA 1BKXA 3BBTB 2WQOA 4PDSA 2ZV9A 1WBSA 3C1XA 3A8WA 3KMWA 3P4KA 4EEVA 2C0IA 2FCAA 4KBAA 4EJNA 5B2LA 4P90A 4QDKA 5AM6A 5C01A 2XS0A 2QOOA 3ZZWA 4CTCA 5LXMA 4ACMA 3UA3A 2WMVA 3ZLWA 3MB6A 3PXYA 4E33A 5EZQA 4CFMA 5IA4A 5JUWA 2PV0A 3AMYA 1UWVA 5CQUA 3KGAA 3ATSA 3FHIA 4G6LA 4ACHA 3AC2A 4R1YA 3PJ2A 5HIEA 4EH5A 3OF0A 3ELJA 3BLQA 1OL2A 2W9FB 3CE3A 3K2LA 3SA0A 3EGVA 3Q32A 3GRYA 4IZYA 3FMJA 4H05A 1IY9A 2ZYBA 4DGNA 5L6WL 4DH1A 3ZUVA 1XDZA 4BIBA 3BIZA 4GMYA 4CEGA 2XKCA 2F9GA 4A9YA 3ORNA 4X6RA 5BYLA 3W55A 2X6DA 3ELYA 2BDWA 4GFMA 1Q3WA 1T46A 2CGUA 2UZBA 3LHJA 1X1BA 2NXJA 4GYGA 4RWZA 3TLJA 5M53A 4RTQA 4JBOA 3NWWA 3PG3A 3MH1A 4IFGA 4CCBA 1W83A 2XK8A 3UDBA 4BLWA 3MPAA 3ODYX 5F2NA 3EEOA 2YCSA 4RTSA 3ET7A 4RWIA 5DFPA 1BUHA 3UVRA 4CD0A 4EKIA 2OXXA 3DU8A 1BOOA 3LFCA 2IDKA 4GK2A 3OZRA 4AGDA 1G55A 4QTCA 2V7EA 4WG4A 1WBTA 3JWIA 3G8BA 3ANRA 4RWLA 5L8LA 4JBQA 3QZFA 1URWA 2B1PA 4FKRA 4YJRA 3K54A 5FLFA 4BDKA 2RGPA 4CKRA 3LCTA 1L9KA 3HX4A 2XBJA 2AUHA 3GC7A 4FL1A 1VZOA 4FSYA 4LL5A 5KUPA 1NKVA 3BWMA 1ZRZA 5AP0A 1REJA 2HENA 2WXVA 3NYVA 1KE8A 5ANGA 4ZTBA 4XV2A 4C4FA 2AN5A 4EZ3A 2NP7A 5CF5A 4WXHA 3LCDA 2F4JA 1DUSA 1JQEA 1WZYA 3P79A 3DMHA 1O6KA 4DH3A 3FLYA 5GM1A 1YB2A 3QFVA 3HA3A 3GU7A 4OTRA 5IEYA 4Z16A 5CU0A 3TRKA 2VX3A 5KBRA 2R3JA 3N4TA 4GV1A 1J1BA 3G33A 4XG8A 3MYGA 2B7AA 4TWOA 3RGFA 1GOLA 1OIRA 2CHLA 3OY1A 4JXFA 5CF6A 3QTQA 2W1DA 3TUBA 3S3IA 3AMBA 2PUIA 2XA4A 3PXRA 4TN6A 2VTOA 5M55A 4PX6A 5K8VA 3V5LA 3OWJA 3R0QA 3Q4ZA 2GFSA 1JSZA 2XH5A 4FUYA 5F9EA 3P9NA 3BWFA 3RAHA 2ZV7A 2QURA 4U80A 5HO7A 5GM2A 5KMLA 3TI1A 3II5A 4FBXA 2RIOA 4M38A 2K4MA 2ZAZA 3QTRA 4MNEB 4ANSA 3GQLA 1QAOA 2W4JA 3S2PA 4FYNA 4HC4A 5CCBA 3KF7A 3N4UA 4FGRA 4L67A 1RQQA 1VYZA 5HHWA 4ZTQA 3O96A 5M44A 1X8BA 4NCTA 4ITJA 2W4KA 4WBOA 3UE4A 1BLXA 4O84A 5AP4A 2BZHB 2XYQA 5HX6A 5AV3A 2HK5A 5GIOE 4HGYA 3KFAA 4R1VA 2X9FA 5BXYA 4EOJA 5D7AA 1PXIA 5FXQA 4ZXTA 3M2WA 3IW5A 5AUZA 1YOLA 3MA3A 4G5JA 4PDYA 2J0MB 4FT9A 4HPTE 4IMYA 3NWBA 3VHEA 5ICEA 3CC8A 5ICFA 5BW5A 3GCUA 4BCQA 2QHMA 3FLQA 4UXQA 4WBBB 3VAPA 4C4HA 3KRXA 3SQQA 3CJFA 1UNLA 4NM7A 4NT4A 4D1SA 4FT4A 3LL7A 4E73A 4GJ2A 3QXOA 4BZDA 4Z7HA 5HZNA 2WMAA 2G1TA 3HAVA 3S4QA 3VC2A 4RTNA 2BCJA 3P5KA 4CLIA 3P2IA 4YUVA 1H0VA 2ZV8A 1YHSA 3O8UA 3CKWA 1NV9A 4PNEA 4ZIMA 4R5SA 4D4SA 3FAAA 4NKAA 2X4FA 5H8BA 5IDPA 3F66A 3R0TA 1OITA 1OMWA 3MH2A 2HIWA 3TM4A 2IO6A 3AD6A 1PMVA 4PCLA 2UW3A 5U4XA 4FT0A 5I9XA 1P39A 4G9RA 3CTQA 4J53A 3H10A 4KRDA 5HCZA 1BC5A 1UIRA 2J0JA 4RFYA 5L8JA 4EK6A 3DLSA 1IASA 5HU3A 4CFWA 4NM0A 4X2GA 4HGTA 4Z9LA 2XRUA 2YFXA 4ACGA 4O7ZA 4RVTA 1APME 4JJRA 2X7GA 5JFWA 3A27A 3Q6UA 4HVGA 1Q8ZA 3OWLA 3R7YA 2JGZA 4DT9A 4FEUA 4TWCA 2F57A 3SGCA 4QMOA 4MD7E 3FZPA 3NUAA 3OROA 4I41A 3BYSA 4NM5A 3GWZA 4QTTB 5C9ZA 3AC8A 2VX0A 4L7FA 5EQEA 4I3ZA 3OT8A 2OK1A 4NW5A 3R2YA 2Z7QA 4WRGA 3VHKA 2F8LA 4IKPA 2GTNA 3OMVA 2B52A 4EHGA 4EQUA 2PWPA 3OCGA 1KE5A 1B6CB 3N51A 1YI4A 5LOHA 1QCFA 3EQDA 3WARA 3FBVA 5BYZA 2B25A 4XV3A 2IG7A 1JG4A 3AJDA 2PVRA 2JIIA 4BDFA 2QOBA 4IM2A 2PSQA 3HVIA 4JRNA 3H9OA 3AY0A 4U44A 4FX3A 4KS8A 5ICPA 3WOWA 1SVEA 1P2AA 5FWAA 3GRRA 4C3FA 2BR1A 3LOKA 2C6MA 1P1CA 3EN7A 4UZDA 3AWIA 4R8RA 4WNMA 5ETAA 3UP2A 2W06A 3FDNA 5K0LA 4D9TA 4H3QA 2ONLA 4FV6A 3T9IA 2EB2A 5AFVA 3TTIA 5CF4A 3HM2A 3HVJA 3HTXA 5FDXA 1KSWA 4CNHA 5BX0A 4BHNA 1OI9A 2WFYA 3R22A 2VGOA 4YPDA 1OR8A 2V55A 3KR2A 1JKSA 4CCUA 2JIVA 4MXXA 2VTQA 3F3WA 2XJ0A 4N57A 1G6Q1 3VS0A 2WTIA 1SUIA 4DA5A 4FVPA 1M0EA 1UNHA 2QO9A 4O82A 3W2RA 1V0PA 4YSMA 5LVNA 3BGDA 2O3PA 4LUDA 2E9UA 3TWJA 3ZSHA 4RC3A 4DLIA 2A27A 3DOUA 4FNXA 4MBIA 3AXSA 3UO5A 2FH9A 2Y1XA 2XB7A 4I92A 4XBRA 4W4XA 3G2OA 5EYDA 1JPAA 3RPYA 5AIKA 3PVCA 2DWBA 1EQAA 3DLCA 1PRYA 4KIPA 4C34A 5JZJA 1Z5MA 1ZAOA 4N0SA 2XZSA 4I5MA 3LPBA 2R6ZA 2PWYA 4R05A 3V97A 3F5UA 4BDIA 1G38A 4EMSA 2VNWA 1NXKA 3A7EA 3LQ3A 3VIDA 3C4CA 3IGGA 3BELA 4R5YA 1OKWA 4X2NA 4F9YA 5DM4A 1I4WA 3FC1X 5HICA 3FLWA 3UYSA 2PMIA 4BP3A 3FRHA 4LG4A 2WIHA 2YDIA 2W05A 3NW7A 4LOPA 4AQCA 1OB3A 2EXCX 3LXKA 3QX2A 3R04A 5L8KA 4QTDA 3QWKA 4FT7A 3DXZA 5FM3A 4BB4A 1JR4A 3MESA 3PFQA 3O0GA 4X41A 3FZSA 2YM3A 4LV5A 1XDSA 4FMQA 3SRVA 2ZULA 4HZSA 2VN9A 3IYLW 3FLNC 3QD4A 4DE4A 3FKLA 2IVSA 2CMGA 2OJFE 4V05A 5HD7A 5EM8A 4AZTA 3BHVA 3QWJA 3W2OA 3LKDA 3F2NA 2CNUA 2YAKA 5GWXA 2B55A 4XH6A 2JHPA 4L9IA 2XK6A 4FEVA 4HCVA 4L53A 2QKWB 4Y5HA 1CMKE 5IUGA 2AOVA 2H9VA 3W33A 4AT5A 5L6PA 4B6LA 5EM5A 3UJ8A 5HBHA 3POOA 5M4FA 5CU4A 2YM7A 3THBA 2P7HA 4V0QA 2GQSA 1XVAA 2WMXA 4GL9A 4O86A 3NNXA 2UZ4A 2JITA 3GC9A 4RIXA 3VBYA 5HX8A 3ALOA 4TYEA 5AWMA 2EFJA 3GNIB 4YO4A 2OYRA 3C51A 1F5QA 2XIRA 2JAMA 1AD5A 4GSBA 4X3JA 4M14A 3AT2A 2FK7A 2XIZA 3Q04A 4NJ3A 3ZLXA 4CKJA 1R00A 4PUZA 1RJDA 1CM8A 3ZFXA 2HYYA 3PG1A 4S31A 4GOMD 1R8YA 2J0KA 3UQCA 3IECA 4J96A 4EHZA 1KXZA 4IC8A 4MWIA 1TW3A 4D2SA 5B1SA 5AUYA 3ZUTA 2JDSA 3OOGA 3KQVA 4QDJA 3EQPA 4PYOA 5DRDA 2XF0A 1FMKA 4D55A 3P78A 4BCGA 4YR8A 5IMEA 2JKMA 1SYKA 3T3UA 2P3QA 1VEBA 2EVAA 3FV8A 3EQGA 2XYVA 1UKIA 1RI1A 3WZEA 4G17A 4MD8E 4U8ZA 2O05A 1XH5A 1GNGA 3MY0A 4L44A 5KZIA 4Y2HA 4POOA 5F2KA 4LQMA 2VX1A 3C4WA 4FG7A 3FTFA 4MYGA 2UZWE 4R6WA 3PT9A 3M11A 5C4LA 4C4AA 4YNOA 1YOMA 3IDPA 2PVFA 2NYUA 4YUZA 3G0FA 5DYJA 2OZVA 3KQTA 2IIPA 3GIWA 3EVFA 3UC3A 3HCAA 5M4UA 3RVGA 3UZRA 1WG8A 2Y9QA 1ZGAA 3IW6A 4EOIA 1Q8YA 5DN3A 4GVJA 2JJQA 3I1AA 4TTHB 4BN1A 4HVSA 1X1CA 5K0JA 2IH2A 5DNRA 1BMKA 3CIKA 4GUEA 3G6GA 4BC6A 4XMOA 2J50A 4ZJJA 5J9ZA 5AADA 2QC6A 3GCQA 4HVDA 3HVKA 4BVUA 1JQ3A 3H2BA 2O0UA 3D5WA 4RJ3A 3P9KA 3R83A 4E4NA 2BRHA 2GNIA 3DY7A 3QLGA 2WTCA 3DAKA 3WI6A 4RYLA 3BHYA 4EBWA 3Q52A 3O23A 3PSBA 1PY5A 3MDYA 2PZ5A 2P8JA 5DTMA 4C58A 4CRSA 3I6UA 4DCEA 4CVAA 2P40A 3MGGA 4CKBA 4WSYA 1EH4A 4D4VA 1OPKA 4FKJA 5CAPA 2HY81 3E7OA 3BGQA 4P7JA 2OWBA 3F69A 4RVLA 1JTEA 4CV9A 3I60A 4C02A 2IH4A 2WTKC 4YSJA 1B39A 3C4EA 4TZRA 5EKUA 3I0OA 4QYEA 4CKCA 5M5BA 3JVRA 4NECA 5IU2A 2OY0A 1Q97A 3PTAA 2YWPA 4AT3A 1OUKA 1Q8UA 1DS5A 4FNYA 4GU9A 4O21A 3NS9A 4PY1A 3RZBA 4AG8A 4ASZA 3D7TB 4X2KA 2WU7A 5A4EA 2QRVA 2ZIEA 3O31A 2J5EA 5EQPA 5FEQA 3DAEA 3VBVA 4RVDA 5E1MA 4EOLA 2IW6A 1SM2A 4L7SA 2ERKA 4S30A 3POZA 1PYEA 3OU2A 4BGQA 3VBWA 1SKMA 3RK7A 2WA2A 3HRBA 3RAIA 4A06A 2PXCA 2VTAA 1I44A 4PL4A 5CXZA 3LDUA 4V0GA 4GOLD 4MNFA 1NY3A 3GFEA 4I20A 3PTGA 3KEXA 4D5KA 5HIMA 2HXQA 3EKKA 1R8XA 2G2FA 4RLLA 1K9AA 2ZJWA 2PZRA 5AEPA 2B53A 2QOQA 3U9CA 3LFQA 4IX6A 3WYXA 1YXSA 4AX8A 3LFFA 5DRTA 4BDBA 4G3CA 4KABA 3SXJA 1ZYSA 4JOAA 5CQWA 4YJNA 1MQBA 4AW1A 1YXXA 5E1EA 4F85A 3EQRA 3KF4A 3EFKA 4IVCA 4DCMA 3MY1A 2GCDA 5FHQA 5LQJA 3TFWA 2JAVA 1YZ3A 4LRKA 3H0ZA 1WBWA 2PVHA 4YUYA 3MW1A 2GHLA 5HLNA 4FKQA 2ZZMA 4EH3A 2B78A 5IA3A 4NTSA 1UWJA 1Y6AA 3G51A 2VZ6A 1P4OA 4H36A 3H9FA 3KKVA 3R7IA 1OIYA 5JH6A 1RI5A 2PXXA 3NW9A 2XM8A 4QPNA 3R01A 3SMQA 3TKHA 2WU6A 2PMOX 2WEVA 5LMBA 2B54A 2FSMX 1XH8A 3GI3A 5DRBA 3TKUA 3ZBFA 3FUTA 2VU3A 4QMTA 4QVGA 5JR3A 2ITOA 2PYWA 1PHKA 4IB3A 2X1NA 2ZFUA 5CYIA 5KBQA 5E2AA 1OL6A 4MBLA 3PUPA 1W8CA 5HEZA 3VSEA 5H8EA 5D41A 5EMMA 4TXCA 2OIQA 3VBXA 3H30A 2VO0A 3QTXA 5D9HA 3ZH8A 5BNJA 5BMMA 5C8NA 4ALWA 2BAQA 2BZKB 3E23A 3REOA 2B9IA 3UNZA 3TPZA 2PVYA 5KMKA 3UIUA 2YDJA 5IEXA 5J1VA 3QTIA 3LFEA 4DTAA 2N47A 3RAKA 4BICA 1JAMA 1NVSA 4M15A 4ASDA 3FZOA 1KE9A 2YN8A 5IQDA 4I22A 5ANJA 3VS6A 5JQ5A 4A4OA 4DC2A 1KPGA 3EQHA 5CI7A 5J8IA 4H39A 2P33A 2X2MA 4QOXA 5A9UA 1N2XA 3BKXA 2O65A 1PKDA 4QRCA 1ORHA 3AC3A 3IW8A 2XUUA 3FE3A 4KD1A 1NW1A 2QU6A 3RHKA 2QOKA 4FK6A 1VQ1A 4C4GA 3PRIA 2I7CA 4UOEA 1WFCA 3HA8A 3PWYA 4RTMA 1M2PA 4AFEA 1YUBA 3W8LA 3KR9A 4RSSA 1IA9A 4TKSA 4GQBA 3KXGA 5M51A 2ZM3A 2R3IA 4BCHA 5EKNA 2EG5A 5AJQA 2QOCA 4CZUA 2GQRA 1ZMUA 3V5QA 2PTKA 1WVWA 4E6DA 4K18A 5LSAA 4O0RA 3GC0A 3EB0A 3QAME 3QQFA 4K11A 4RA4A 3IKAA 3LLTA 4GG5A 4I24A 2Q41A 1JTFA 2PUUA 3PVGA 2V62A 3EQFA 5LVOA 4BGGA 2HELA 3CKKA 4GKIA 5AP1A 3OP5A 4V0GB 4RJ7A 3RCDA 3N4VA 4IH8A 5CVFA 1KPIA 3O50A 4TL0A 4GFOA 5CZHA 3CBGA 3QZHA 2GNFA 1DL5A 5CM2Z 5GJDA 3CLYA 3W2PA 3TV6A 2HOGA 4NZWB 3PJCA 1TPYA 3PA3A 4PONA 4WG3A 3JXWA 1M7QA 3W1FA 1YWRA 2WTWA 3DKOA 3OTVA 3FXZA 3HVCA 3V5JA 2GQGA 3MTIA 5E91A 3FPQA 5HU9A 4ZS0A 4IVDA 3F82A 4O7WA 4JQEA 3CS9A 4TYGA 2IGTA 3E87A 4HSGA 5DT2A 3SSMA 4D5HA 1Z3CA 4BBMA 2BTRA 3QCSA 5CEMA 4ER5A 2AYPA 3RK5A 2Y8OA 4YV0A 3TDWA 4E6AA 3PLAE 1HNNA 3HNRA 4FS8A 4FZVA 4Y30A 2CJMA 3SXRA 2XKFA 4ACCA 4OBOA 4AOIA 5J1WA 3KPJA 3RPVA 5HORA 2O0LA 4F09A 5ERGB 2QOIA 3G7UA 4FTUA 3V8WA 3WE8A 2Z6AA 5AV1A 3ZM9A 1KOBA 1UFKA 1AGWA 3B7PA 3EKNA 5F20A 4M7RA 3Q4CA 3EYGA 1H8FA 1ZMWA 5F94A 3R00A 5ACKA 3TCPA 3ZFYA 3ZHPC 3ZDUA 2XVMA 2GPHA 2W0JA 4CV8A 3WIGA 4IZAA 5BUJA 4BCIA 4HG2A 3EN6A 1AQ1A 1Q8TA 3VRYA 2WMTA 3SHEA 3TL8A 2A19B 1OGUA 4A9RA 4DFUA 4EI4A 3PX2A 4HGZA 3MVHA 3C4ZA 4FG8A 1PXKA 4YURA 1Q62A 3KCFA 1FVRA 4OGRA 3ZRKA 4EWHA 3NUSA 4IJPA 1H27A 4YC6A 3U6HA 5EEGA 4I0RA 3HYHA 3PXQA 2C5OA 1O6LA 3FY0A 4YZMA 4O7SA 3H0YA 2JHAA 2OGVA 3FPFA 3GT8A 2YIXA 3KPYA 2R64A 3OUKA 5A3XA 4BTJA 4GC9A 5C1QB 4I4EA 4QQKA 3MHTA 3TJCA 2YXLA 4JXJA 2XIKA 1VJYA 4NCTC 4CMTA 5K9IA 5E1BA 4EKLA 2QKRA 2FVDA 4JIAA 3ZMMA 3NVKI 4L43A 4Z2YA 3JUHA 2CCHA 2WQNA 2P35A 1U4DA 3I7CA 2JFMA 4YTHA 4L7VA 4MXZA 3OU7A 3AC4A 3QGYA 4Q5HA 1YWNA 5CI6A 4F63A 2VDVE 4O29A 3DOGA 3TZ8A 4R6XA 4PYJA 2BH2A 3MIAA 2ZIGA 3BWCA 5CXHA 2HR1A 3VW6A 3QF9A 4U97A 3B3JA 3Q87B 5KE0A 3GXLA 2Y0AA 3G90X 4OQEA 5IQGA 1WVXA 4E5BA 4FZFB 3UMXA 3W18A 1XH4A 4XP2A 5FP5A 5E4HA 4E2ZA 3QBNA 3P8ZA 2OXTA 3QALE 3UZPA 4RJ8A 3SSOA 5EK7A 2P0CA 2H00A 3CD3A 4FSUA 4GUBA 1Q0SA 4IZ7A 3AGLA 3EIDA 3FEGA 3QGWA 3R7UA 5BVOA 1X1DA 1YF3A 4G3DA 1PMUA 4USDA 4Y46A 3QTZA 4EOQA 4EK3A 3LM0A 4UALA 5KMOA 4NW6A 3CJRA 1ZMVA 4HNFA 2J2IB 2O5KA 4IAKA 2PY6A 3LFSA 5BVFA 4EOSA 1O6YA 3U4WA 3BQRA 3VUMA 2VTRA 2WOUA 3GENA 2C7OA 3UJCA 4I5PA 1UVRA 4FEQA 1GAGA 5ANEA 3A7IA 4YUQA 3ALNA 3D14A 4DFBA 3DJ7A 2B9JA 4RQVA 1M6EX 2O06A 5MHTA 3PZHA 2WK1A 3LIJA 1P4FA 5EOLA 1K3AA 4G56A 2UW4A 2UZEA 3ZEWA 3V5PA 4HTFB 5FQOA 3UJ9A 3B3GA 4QQ5A 3NCGA 5J87A 3QOXA 4S2ZA 3E63A 3TJDA 3QUDA 4IB5A 4QPAA 3OZSA 4FL2A 2JDOA 4YZCA 4KINA 4O7VA 4YC3A 5HLWA 1D2GA 2ZLBA 3BGVA 4P5ZA 3T3VA 5B7VA 4QMUA 3WF7A 5JFXA 5AV4A 4L52A 3KQSA 3MA6A 3EQIA 4RV9A 3SKCA 2GS7A 4IM3A 1G3NA 4JG6A 1OIUA 5CU2A 2QOFA 4E5AX 1LUFA 3OPNA 4ZOGA 1FVTA 3HA6A 2YIYA 3KK9A 4CRLA 5LMKA 5E9JA 4IACA 3VS1A 2DQ7X 3LFBA 4I1ZA 1JVPP 4FICA 2BKZA 2WNTA 4YO6A 3NUPA 4PNIA 3UIXA 3NRMA 4PL3A 3CVOA 4RG0A 3WZJA 4O27B 4EVIA 2O63A 2JFLA 2BPMA 3BQCA 2PMNX 3NIZA 3L9MA 4G6OA 1ZOHA 2CKQA 2H34A 2IVTA 4JDJA 5EYCA 4D58A 4AUAA 2GAFA 3BXOA 3EVCA 3FRIA 5CD1A 2NNWB 5F2OA 1GZNA 1I9GA 5DX8A 1OL5A 3I4BA 3P0MA 1Y91A 4FSZA 5E90A 2YDKA 5CSPA 4EL9A 4FIJA 4YBJA 3DR5A 3NPCA 4TNBA 3VUIA 5EHGA 3FQSA 4IVBA 5EI8A 3AT3A 4H3PA 5C9CA 2BDJA 4NYEA 5IQFA 2W96B 2XVAA 2ZCJA 3ZXTA 4X63A 3IHTA 5DGZA 3BLRA 5TF9A 3UJBA 3BYUA 3C7QA 3FSFA 4WVLA 3DH0A 3FPEA 3NJRA 2GTMA 3QTSA 4FSRA 5HTCA 2UZOA 3IPHA 2X8EA 2VWYA 1J3HA 3COIA 5CEPA 3R8PA 1MRYA 2V5QA 4AW5A 2UYHA 4QMQA 3LBYA 4RTRA 4ZTMA 4RMZA 1OKVA 4EK5A 4AW2A 4MXYA 4AU8A 4FV3A 4YLJA 4QVKA 4BDJA 5CWZA 1NV8A 4GOND 4LOOA 5HG5A 2IWIA 2QRVB 2HV9A 1XBAA 2BTSA 4AUKA 5KHWA 5K0CA 4HYUA 2OF4A 5BVWA 3SXFA 3TUDA 1ZOGA 3GC8A 3OFKA 5CSVA 3JR1A 1XCLA 2KULA 3QLFA 3A61A 3CSVA 2ZM4A 5EOVA 2GDOA 4S32A 2ITQA 3UJ6A 5K01A 4FKGA 2QI8A 3PIZA 1LPUA 4L3JA 3ZOSA 2XYRA 3DUWA 1H1PA 3HA7A 3E7VA 1JBPE 4J1RA 4E30A 3LECA 2QO2A 2ZV2A 3OFMA 4RFZA 4E1ZA 3EGEA 5BW4A 5HE0A 2NRYA 2BM8A 1ZY4A 4DFNA 2C6KA 2PMLX 2XIXA 5AX3A 3PX3A 4FV7A 4C3RA 3CC6A 3CPBA 2XEZA 4K1BA 3DNEA 4O0UA 1ZZ2A 2OKRA 4L3PA 2UW8A 3V5WA 3WZDA 4OTFA 2UV2A 4IW0A 4JDHA 5L2WA 3LCKA 5FQDC 3SOCA 3DA6A 1FP2A 1FGIA 1YXUA 1ZZLA 1CKPA 2XEYA 4ALVA 4YMJA 2P3GX 4FKOA 5CS6A 3I5UA 1O9HA 4G2FA 3T9TA 5TO8A 5HVJA 5GINE 5DXJA 3DT1A 3O8PA 1U5RA 4BCJA 3MV5A 3FMLA 4M36A 4QP8A 3Q5IA 4YTFA 3EMDA 4F7LA 2ITZA 2R3LA 2RF9A 2VNYA 5FA5A 4FNZA 3MN3A 3LZBA 4Q2AA 3DAJA 2AVDA 1UA2A 4AACA 3KPUA 5HILA 2WMWA 4X2FA 5E9EA 4DFXE 2BZGA 4MKCA 1B38A 3OWKA 5A54A 3KULB 1H1WA 5IH3A 2XIYA 4M84A 3RJCA 3KQQA 4F9CA 2VS1A 2UYCA 5IQAA 1U46A 3MH3A 3BV2A 3VVHA 4EOPA 2FRXA 3PSCA 5E9WA 1BHJA 1ND4A 3O51A 3BGPA 3L8SA 5I0BA 1GIJA 2HXLA 4GG7A 2QLQA 3NDJA 3GNLA 3QD2B 3M4XA 3EVEA 3QD0A 1PXMA 2C5VA 3Q9WA 5J7HA 4L45A 3TNQB 2PE2A 2XNPA 3D2IA 4LGHA 3KKZA 1PJKA 1SUSA 4PGGA 4AGUA 3ZSIA 4E7WA 4ZMEA 5LQAA 4YHFA 3LAUA 1NE2A 3A8XA 4MQ2A 1JSUA 1TW2A 4ITIA 2OJJA 3LXLA 2XKDA 1GZKA 4QO9A 3VS2A 3BGIA 2XK7A 2Y6MA 5H8GA 3UPXA 5ETIA 4MTLA 1G8SA 4C06A 3UIBA 1BKYA 4PWNA 3LX6A 2VWUA 2YZAA 2J7TA 3HRCA 4GKHA 3KR1A 1JG3A 1ZGJA 4E5WA 1TQIA 3FZ1A 4ANBA 3DBEA 3LCUA 4RRVA 2W9ZB 4BTMA 5C1IA 1GIHA 2PVNA 5CEQA 4OBXA 2VWVA 4HPUE 3TKAA 3C9WA 4X1OA 3VC1A 4M67A 4Y5QA 2OZAA 2OFUA 2R7IA 2P3LA 2CPKE 3EN9A 2GPYA 4PYMA 1A48A 1BYGA 2X7FA 3G5LA 5FUBA 4ID7A 5J95A 2CGXA 1PJZA 2Q0NA 2YERA 3C0GA 2BFYA 4QMZA 3NUXA 2ZVAA 3IG7A 2GB4A 4P7GA 4E2XA 1M52A 4DGMA 1JSTA 4XX9A 4KBKA 4YLLA 2C1AA 5H9BA 4R7IA 1XH9A 1FP1D 4U0IA 4JNWA 3IEIA 5EMKA 4ACDA 5EMJA 4BCFA 2NXEA 2QO7A 4G3FA 5DR6A 5CAQA 1V1KA 4HGSA 3GCVA 4AFJA 3DLIA 1JOWB 4C4JA 5A6OA 5DR9A 4F64A 2HCKA 1DI8A 4X21A 2DPMA 2X4ZA 1ERKA 3HV7A 1JKLA 4AOJA 4RSRA 4FKUA 2BR5A 4WUAA 3K0BA 3THSA 4FODA 2G71A 3NEWA 4A6DA 2OJIA 3U54A 3TV7A 1QPDA 4JDIA 4DAWA 4RA5A 4KIQA 5D7VA 4CXAA 4N6ZA 4MXOA 5IDNA 3R9HA 4F70A 3V51A 1D2HA 3Q9ZA 3EMGA 1Y6BA 3DKCA 3ETAA 3ZSGA 1H07A 1QPCA 3QYZA 4A9TA 4LMUA 4OTQA 5I9WA 4G3GA 4WA9A 3HCFA 4C37A 3CJTA 5JFSA 2OLCA 3AD4A 1QAQA 1F3MC 4RFMA 3DTWA 3QRJA 4JI9A 5IQIA 4ZSGA 3EOCA 5B0XA 5HO8A 1KYWA 4XUEA 5AA9A 2DYLA 4X2JA 4XBUA 1DCTA 3G2FA 2RL5A 3TIZA 3UG2A 1U54B 1L3RE 5E8XA 4PRJA 2ITNA
chains in the Genus database with same CATH superfamily
2RFDA 1PJSA 1BD3A 4I50F 2R3GA 2Z09A 3H86A 4QFBA 2HW7A 3UWKA 3K1ZA 3QNWA 3M89A 5AH0A 3OC6A 4UHHA 3R9RA 4IADA 4D2RA 4TYNA 2FGJA 2D3TA 4GS5A 4EKKA 4O7LA 1PK7A 3NDMA 1AQ6A 1RAAA 1FBNA 3U4QB 3DBOB 3EBOA 4M1OA 3IDQA 2AI1A 3GEDA 4MW9A 1OPLA 2R8EA 2C2MA 2EEPA 2J3DA 3I2HA 4TTTS 3QYJA 4Z9FA 4Q9DA 2GPAA 3VZCA 3WFIA 1Z2NX 1H08A 3QXHA 4LK2A 1SVWA 4O2ZA 3PYMA 3BHHA 5LMUB 3F7WA 2E5WA 2G72A 3IQHX 3VI3B 4EUHA 2D5BA 4RS3A 4CU5A 4O96A 4X7BA 3G9LX 2HMWA 5HK8A 1EWKA 5KBYA 2OCBA 3ABSB 4I4TF 1OXSC 3VVCA 2HMUA 5IYZA 1U3CA 2C8KA 4A9AA 1QR6A 1GRCA 2PVKA 1WHSB 2FR8A 4C3ZA 3IE2A 4MKGA 3Q5ZA 2GSFA 2FHSA 1W36B 2AMYA 3HUFA 3PA4A 1WMBA 2XMPA 4X00A 3N9IA 2A0UA 3NOVA 4NOKA 1GZ8A 4D6PA 3QUEA 3QOFA 4O38A 5LU9A 4X45A 1LSSA 4N7BA 1NRJB 1JQHA 3SYRA 1NA7A 2JDID 4GDMA 5BNTA 3HV4A 4DGLC 5JQGF 3OVVA 3O92A 3HJAA 3QE9Y 4RKQA 3HP2A 2FSTX 2BCGY 1SCKA 2XZDA 2QXYA 3BG5A 4MV3A 4YUAA 4YACA 4V01A 6REQB 2XXAB 1SZJG 2HKIA 4F7JA 2R751 4REQA 4F7WA 3AF4A 3T5BA 1F2TB 1IFXA 4XLZA 3F5GA 1OGYA 5BNZA 3DDQA 4L6QA 2B37A 2PD6A 5BVEA 3NLLA 4NV3A 3W2CA 2C03A 3V8BA 4XWOA 3VUDA 1OQAA 4RL6A 1HV8A 5AKYA 2GF0A 5EFQA 2GRJA 3FYJX 3LQKA 3P2JA 1V7PC 4U45A 3ATTA 3ORPA 3JCZA 3AG6A 3PFKA 1XK7A 5EPEA 2GN1A 3JQBC 5JPIA 3NR9A 4OXYA 5HD4A 1E3LA 3UNJA 3FDXA 2ASVA 1K6MA 5K0EA 1IZYA 3I9NA 4AKTA 4X5OA 3RHZA 2AGVA 2GZSA 3WZKA 1JIJA 4IJUA 1RJGA 2YTZA 3ZIAD 1XZEA 3VTAA 3A37A 5L3QB 3SHQA 5A5EA 4I46A 1NI4A 3L0BA 2NP8A 5FBNC 3LUBA 3SYKA 3EB9A 2X5NA 5GGYA 2W11A 4UAJA 5KB3A 1W0KD 2Q2OA 1QH1B 4IDTA 4G9EA 4KK4A 5JWOA 3PYYA 5DPMA 4UW9A 1UK7A 1J2JA 1MJ5A 2HNKA 2D0IA 5DHPA 5K4JA 4FOBA 1C80A 1HLPA 1JSXA 3TVYA 1SXJA 2YOHA 3C3EA 5A71A 2PH3A 2V7AA 1DS6A 1QZUA 1FP7A 3KM0A 3IRUA 3LCVB 1ACMA 1TQDA 3Q7EA 2NN3C 2IVZA 1PQUA 4OGFA 1O9GA 4QKQA 1GUDA 1N4DA 4YT5A 2G1PA 3RC7A 1YR6A 1HKHA 2O8YA 1IN4A 2RIRA 3VZRA 1J6UA 4N65A 1YA4A 1Z45A 1JVSA 4WK0B 3AKCA 3KQOA 2XCKA 5SYAA 4CCYB 3U4IA 1IJFA 3CUWA 4ETWA 4X3FA 2C7PA 1AGYA 2Y1FA 4KR6A 3TQQA 1Y5NA 4A6XA 3T1TA 1WAMA 2B4KA 3OLWA 2O2UA 5EQDA 1Z12A 1M17A 2C00A 1RZVA 4Q18A 3SHFA 1EWQA 3OXTA 4J3JA 1G4HA 3OIWA 1WY7A 1W5BA 2JFWA 1Z6YA 2JD2A 3RRXA 4KKEA 1IAQA 5CALA 1YIOA 4BZNA 3OOJA 2UZ1A 4QDXA 4LRSB 5DBXA 3O4JA 1XEXA 4BXOB 2OCGA 4KUHA 1FJXA 1HCKA 3PJRA 2X7OA 2FUMA 5L3QA 3HA5A 2ASEA 3M4YA 5DNAA 1SMKA 3I52A 3FDIA 1JFVA 2OZAB 2BI7A 4DJEC 4LBZA 1LJUA 2JW5A 2PKXA 1BCSA 2QUBA 2W22A 5I9MA 1Z17A 2HAKA 3C8MA 3BU5A 1TMKA 3S1AA 3NDRA 4B32A 4F4FA 1FVHA 2ZRKA 2VFAA 3S29A 2AZTA 4YHTA 2ILTA 1OHHD 4DV1B 5I4CA 1US8A 4RIFA 2J6MA 3GLVA 3QZIA 5DB4A 3DQXA 4Y95A 4MGHA 3V2HA 3UT0A 1X9HA 2SHKA 2AW5A 2XBMA 2O0JA 2IJMA 5HNGA 4Z2AA 1AQIA 1DBIA 3JY9A 4Q1BA 4BBFA 2A9FA 1ZCZA 3UK0A 3FCSB 1LW6E 2GHRA 3SE7A 1I24A 1IBMB 4TT7A 2WELA 1WVGA 2PRIA 3EXFB 3L0SA 1SCUA 2A9KA 4DIEA 3NAQA 3ZCPA 4I1RA 2X14A 5PNTA 3BF8A 4USEA 2ECQA 1U8AA 3KFLA 1KR5A 1R18A 2YAAA 3TQHA 5JFGA 3UXYA 2VNAA 2PL0A 3O8OB 3BE6A 2YZLA 1G4AE 5K3YA 4HGQA 2GOYA 4Z0NA 2WTKB 3G8DA 3R74A 4RK7A 1EZ4A 4I9UA 4FSXA 3WMXA 2BSXA 5EQYA 2NVUA 2CNQA 4LC9A 2D2XA 2AI2A 3ESZA 3HCNA 4PO9A 3Q9XA 1UQTA 4IOLA 4FTTA 4LSGA 4JR7A 3DK7A 1AKVA 1ECFA 4GF5A 3V6MA 3PE1A 4I23A 2PGDA 3O71A 3RUPA 4U6QA 2WYOA 3EGXB 4J2OA 5CU6A 2Y77A 2CKDA 4TN5A 1AUOA 2NO1A 4BDGA 4AM8A 3KTOA 2OCYC 5AESA 1YVRA 3I1YA 1NW3A 3PNVA 4G1UC 3QYWA 2JAOA 3PQ4A 5BOSA 5G1XA 5KHAA 3VR5H 5L2TA 2XUOA 1NR1A 1XMQB 3KVNA 4AMYA 1MGPA 1ACJA 4MITA 3WB0A 2ODQA 3NSZA 4WFIA 2O8BA 2J4CA 2Q27A 4TVBA 4PFSA 2JD5A 4L1KA 7MDHA 3QEBZ 3T95A 3S8MA 1MENA 3EODA 3ZHTA 3QTLA 1CZRA 5FOTA 1TYDE 1SVUA 3GU8A 4HDKA 3CRMA 1HYBA 1NF2A 2F67A 2ENUA 2PS3A 4FR4A 2WBLC 5C3MA 4NYJQ 3PFIA 1JALA 5HKBA 4EK8A 1XEWY 3WL5A 2CF6A 1GCAA 1T6ZA 4EI7A 3BICA 5TPWA 1CY0A 1JEQA 2XGGA 1CY2A 4NOJA 4B6JA 2DUUA 2HZBA 4FFOA 4EH8A 2DUVA 3DBCA 3BJEA 5JZSA 3UTOA 1ZM4A 1TVEA 3PJEA 4OXRA 5EH0A 2P1ZA 2X0GA 1LK7A 2BAJA 2B1IA 3MERA 3GPDG 1V1RB 3EG9A 3VNSA 3PLSA 2CHEA 4XPIA 3FCCA 2AOTB 4BN5A 5EYKA 4HLDA 3ZNQA 3V01A 1SUFA 2PSHA 4U6NA 2CDRA 5C8ZA 2BHLA 3U8WA 2YJZA 1XRSB 5JMTA 3RHFA 3C4VA 5ALOA 2W2TA 3HBNA 3OZIA 5A4TA 2F4VB 5EM6A 4KLZA 3PDIB 3ORHA 2WYIA 4PMTA 4BNYA 2ZJ2A 1IEWA 1KJQA 4UATA 5LYJB 3ZS8A 4OVKA 4NRDA 3F71A 4NK9A 1R3CA 4QWWA 3PHLA 2J87A 4KE6A 2WB2A 1CQWA 4KVZA 4MVFA 4NJOA 4EG3A 2H2IA 3RI1A 4GCJA 1UDAA 3W7BA 4REOA 2CLLB 5I9LA 4G6ZA 1T1EA 1VE9A 2VTTA 4WACA 2XDQB 2CMWA 5T68A 3NUYA 2FRDC 4KIWA 2QJRA 2FPPA 2GEUA 3NNWA 2W2OA 1C3JA 1CJUC 2C7RA 1BO6A 2MJLA 5AVXA 1R50A 4AZFA 2ID7A 3HDYA 2I6XA 4CLHA 2CGEA 2QTZA 1CEQA 4BP9A 3ZV4A 1ZICA 4JLCA 2WU4A 5JWHA 2FSLX 5BMVF 2Z57A 4MA5A 4M9ZA 4BLUA 2G0TA 2DQKA 1Q84A 2O07A 2IPOA 4ZAUA 5K3SA 3OEWA 1SC3A 2HWXA 5H59A 2UZVA 4F9AA 1NUHA 4B80A 5DOSA 4AAAA 1HYQA 2C0QA 1KJYA 5L7YA 3UW3A 4D9UA 3KQ7A 1OIXA 1IRXA 1QSGA 4GKBA 1GV0A 3ONNA 2EKDA 3QU5A 5BV7A 3DKFA 2W9XA 3GGSA 3NJ8A 1G20B 3WKBA 3R02A 1KE7A 1QH9A 3COVA 3N9XA 1EJ0A 2IXAA 3G2QA 4B6QA 1Q8WA 2UZNA 3S8YA 2O5EA 4JSRA 2IVUA 4I1PA 5CSHA 1OGJA 3WL7A 3QXPA 5CPBA 3SE0A 3QXCA 5T57A 1EBBA 1Q7GA 3D7LA 2PVSA 2J4ZA 4K0YA 5FTQA 2ZXUA 1N2CE 4LRWA 4Q9HA 1QG2A 2J3MA 1ODTC 3WBLA 1L5GB 3AT4A 2QLTA 1JVBA 4KR7A 5HNIX 5EUMA 2Z02A 3ZHVA 3ZD9A 5C7IO 2JLBA 2TYSB 4UNPA 4DOMA 3NBYC 3KSAC 1SMHA 4TZ6A 2OV6A 4X64B 2BL4A 4MYTA 4HYIA 4FV9A 1SRRA 3QVTA 2JNWA 3A58B 5AP6A 2V9CA 4PMMA 5CCXA 5C27A 2ZMCA 4PHTA 3S1LA 5AOAA 4MDFA 4N3CA 1ICIA 1CD5A 1KZ7B 1Q6YA 5B55A 3O75A 5AXAA 2GKOA 1OAOC 3KJFA 1JHRA 1J21A 4KQFA 5ALPA 1DKOA 1IZ9A 1CY4A 4K05A 4R1YA 5BSMA 5BWLA 4NAHA 3VJLA 1FMTA 3MTBA 3RK1A 1K0FA 1GCOA 2BGTA 3NP9A 4A9YA 1WBDA 2XCLA 4B43A 1EE2A 3ZKWA 1V5WA 3E2IA 3EEOA 3WVNA 1IYZA 1GNVA 1OZGA 4DSUA 4QELA 5CVCA 2IXTA 1JAHA 4JL5A 3GC7A 1AVTA 3UICA 1GGMA 4WXHA 1GZUA 1U2QA 3L8FA 4Z16A 3ZCSA 1MB0A 4G36A 3RS5A 1AO3A 2A88A 1M6VA 2JGDB 4U63A 3R7WA 5K8VA 4Y98A 3RUIA 2GEVA 4Q01A 5FEMA 4FUTA 3C74A 3II5A 5H9WA 5B3JC 2AWOA 4WLVA 5F5NA 3EXHA 2G82A 2V55B 4MRPA 4F3RA 3WMFA 5AUZA 1YVUA 2J0MB 2IWRA 3CSUA 2YFQA 1LPMA 3LUFA 4BV3A 3R0ZA 2PUVA 1FA9A 1JDTA 3S1AB 4P4UA 5H7XA 3LXRA 4LW8A 2N46A 3VGPA 2CLIB 4LWZA 4QDOA 2GF9A 1P39A 1MG5A 4U7PB 4EK6A 4X2GA 1D1QA 3BDIA 3MSCA 3O4RA 3A27A 2W2KB 4RF5A 1YQQA 4L72A 3VHKA 3OCYA 5C5DA 1JT9A 4QL3A 1C9MA 4KLAA 1NOKA 2B25A 3CVUA 4XA8A 3KBOA 1QVRA 1J97A 3DEHA 4LE1A 2C6MA 1OLSB 3S55A 2YQ4A 2FN4A 4OL0A 3IQZA 3HVJA 4CNHA 3WGJA 4KMRA 4JXZA 1T26A 3OD1A 1UOQA 3H5OA 4QODA 3K8YA 4O82A 3BGDA 3ZK9A 1V5IA 1LJLA 3L49A 2FKNA 2XB7A 1WQ3A 4WQMA 4CIAA 4B8YA 5JSYA 2BHNA 2PWYA 4F9GA 5BPFA 4X2NA 2FPKA 3NW7A 4H08A 3DXZA 2OLJA 4BB4A 2P77A 3FZSA 3R7AA 3SRVA 4HZSA 5AFSA 2PRZA 4HR7A 3FKLA 1HF3A 3B36A 1OI4A 1NN1A 1ORWA 3BHVA 3VDMA 1U9IA 3OA2A 4LRTB 1RYBA 1XZLA 2JHFA 4JI0B 3TQCA 3ALOA 4YO4A 2OYRA 4KR3A 2J5XA 3WIUA 1ZBQA 3ZFXA 4TUYB 1TW3A 2H2HA 5DRDA 1KGDA 2OCXA 4U8ZA 1X39A 4MIEA 5F2KA 3FTFA 2ZRNA 1BKDR 4L3VA 1NP7A 5HKKD 3WLHA 2WM3A 1WX1A 5HM8A 4TTHB 2AB0A 1SIWA 5G0VA 2VOJA 3RYIA 2X15A 2HA6A 1PGPA 5IBCA 1IWOA 4CKBA 4D4VA 2XLCA 3H5LA 1JTEA 1Y82A 5BT8A 3D3NA 1OUKA 3NTOA 4X2KA 1Z0JA 5B7PA 4NENB 3U1BA 1I2MA 3UHPA 1V45E 3GFEA 3QE2A 4NBVA 1KF0A 4M98A 2HXQA 4PZCA 1R8XA 3RSOA 4HDSA 1RAIA 3SXJA 5LQJA 4LSWA 2CBZA 5A02A 1TO1E 1N8KA 4AZ0B 3R7IA 5J4LA 1SCNE 4BZQA 4U7GA 3NXKA 4D8VA 4QMTA 5E2AA 3G17A 3DEYX 1H22A 3JVVA 2BAQA 5KMKA 4G65A 1RWBA 4O4JB 5TY0A 5CI7A 3F74A 2P33A 1EK5A 1V37A 4KD1A 1WHSA 4RSSA 2XV1A