3ID6C

Crystal structure of sulfolobus solfataricus nop5 (1-262) and fibrillarin complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
227
structure length
220
Chain Sequence
ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural organization of box C/D RNA-guided RNA methyltransferase.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
molecule keywords Pre mRNA splicing protein
total genus 58
structure length 220
sequence length 227
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3id6C01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3id6C02
4BDHA 2BRGA 3OWPA 2JFLA 3ZFXA 3M42A 4U3YA 1T45A 5DH3A 4FSRA 4PV0A 2PZ5A 3E93A 2C4GA 1YDRE 2OICA 2QCSA 4U79A 3KMUA 4ZLOA 3R9NA 5DWQA 1OECA 3GDHA 4FV5A 1R0PA 9MHTA 3O51A 4BYIA 3TKYA 3VC2A 3UMXA 3EKNA 3TZ8A 3BKWA 4XUDA 1JKLA 4CRLA 4DM3A 2RG6A 1W7HA 4QVKA 3D0EA 3P7AA 3CCFA 4BP3A 3CQEA 4QTEA 2XBMA 4GL9A 4UEUA 2QU5A 1ORIA 2Z6UA 2VTIA 5I9WA 5HIMA 2IH4A 3V97A 4Z7GA 4GMYA 4YUVA 3FAAA 3V6RA 5M4UA 2UYOA 3Q9WA 3C4XA 1Q97A 4IBMA 2JEDA 5J87A 3EQDA 4GUAA 4LL0A 4ZZNA 3NUNA 3KPWA 5CT7A 4UX9A 4EHVA 2ESMA 1PYEA 2E9NA 2XYNA 2WHBA 3A7GA 2VD5A 3H0YA 4GS6A 4J99A 4LMNA 3ZSHA 4BIBA 3LCOA 4BR3A 2R64A 5H8EA 2QRVA 3EMBA 4M37A 2C6IA 5IEVA 3VHKA 4GUBA 4B0GA 4M97A 2C5YA 3CTQA 4RIWB 2WTVA 5KYGA 4F9YA 2J51A 5IPJA 4QQKA 2ZV9A 5EYCA 5JQ8A 5EC8A 3SVZA 2J50A 4G3GA 4NJ3A 3CGGA 4JLCA 3U51A 3V01A 5EKUA 3A4PA 3BE9A 3PVBA 3ZDIA 2VWWA 4G5JA 5E9JA 2CN8A 5C9ZA 1IG1A 2UZNA 4MNEA 5LQAA 3SX0A 5AP1A 4F1TA 2J90A 2PMIA 3BCEA 4HVGA 3OXTA 4O81A 2G8NA 4AZTA 5ACKA 5E8WA 2WOUA 2B25A 1L3CA 3P79A 3ROYA 4YMGA 4E32A 5GJGA 2ETMA 2PUPA 2H9VA 2R3JA 4NL0A 1YFJA 3TFWA 2J6MA 5FXSA 3HM2A 3FHRA 1Q24A 5CU3A 3GWZA 3G2PA 5ANKA 2R5TA 2HWPA 2JLDA 4FT2A 5K3YA 4FEXA 4KNBA 5I9ZA 3ZCLA 3BYSA 4FSZA 5E1OA 3N4TA 3Q2MA 5KQRA 2OIDA 4JX7A 5BYLA 4AA0A 2WU6A 5HFJA 5I9VA 4GG5A 2EB2A 3MTLA 3SRVB 1K2PA 3PJ3A 3Q4TA 3U9CA 2B3TA 5I4NA 5BVEA 3ER9A 5KQSA 5KS2A 1FPUA 4II5A 1OUYA 3TZ9A 3PPZA 4DEHA 2UZUE 5IA3A 3IEIA 1LP4A 3MB5A 4TL0A 5FA5A 2O05A 1BYGA 2BIKB 4CCBA 3FTCA 2JDOA 5J1VA 1VL5A 1UV5A 2B0QA 3A62A 2K4MA 5FWAA 3KXNA 2NXEA 1R0EA 2W5AA 1F38A 7MHTA 3C5UA 1YW2A 3E63A 2C7PA 3ROCA 3F61A 1YHSA 2G1TA 1P14A 1Y8YA 4PTEA 1SZMA 2UW9A 4MXOA 3SHEA 4YJUA 5FM2A 4RFZA 3DB8A 4NIFB 5DEWA 2IN6A 4C0TA 2XVAA 4KSQA 3P9KA 2P0CA 1YZ3A 5K0JA 5LR6A 3OT3A 3TZMA 1JOWB 3SM3A 4FL3A 1YQJA 3EL7A 5J5SA 3ZTXA 4FIFA 4JIAA 2W4OA 5AUWA 1NKVA 3VQHA 5A4EA 1KE8A 2PT6A 1NVSA 4H39A 3VO3A 3W2CA 3RPSA 4BY9E 1MHTA 3ZS5A 5E92A 4CFNA 1M2RA 4LM5A 2HIWA 4ZAUA 1V0BA 4IVDA 4C4EA 5CSPA 3F9NA 5IA2A 5HILA 1PXKA 1XJDA 1W83A 4F6UA 4FK6A 2BZIB 4QMUA 4TYJA 3UOJA 2PUUA 3BYOA 4I1ZA 1B39A 3LMIA 1H07A 3FZGA 1GIJA 4GOOD 3KA0A 4F99A 3CQWA 2H96A 5HHWA 4POOA 3MESA 1SVGA 3HYHA 3HAVA 4IM0A 4RFYA 3E7OA 4UV0A 3DGKA 1WMKA 3NDMA 3NRMA 4HYIA 4P5QA 5AV0A 4ZOGA 3RAIA 3RWPA 5LVMA 5EEHA 5DTQA 2OXDA 3PDTA 5M51A 5EM7A 4RTLA 4O7LA 1H1WA 5E2BA 2Y1WA 2YIXA 4M7IA 5IH6A 1H26A 1Q5KA 2HZIA 3RZBA 2XK6A 3OROA 4LYNA 2NP8A 4CT2A 4F70A 3R00A 1QANA 3C0KA 3DXQA 4O2ZA 4JL9A 3FXZA 1R6AA 3V6SA 3O17A 2WQEA 2IPXA 1Q8WA 4NYEA 5LQFA 1XQZA 4FTOA 3DULA 3VBVA 1M6YA 1P91A 4X61A 4YV1A 4QTCA 2AOWA 3UJ7A 2ZJWA 2GS7A 2J2IB 5I9XA 4EZ7A 2ZLBA 5IZFA 2J5EA 2VTRA 3KXZA 4J95A 3TACA 2VS1A 3JR1A 3O31A 4Y2HA 3PVCA 2NRUA 1O6LA 3Q32A 1ZWSA 4G5PA 2I1MA 4PNEA 3POZA 4I93A 4U97A 1W82A 4YMJA 3DP7A 4V0QA 4FKUA 4W4WA 3AOXA 4QP1A 4RMZA 4PTGA 3A25A 4EQMA 4O0TA 3HV7A 5EOBA 4E6AA 4KIGA 2JHCA 4H58A 3FDNA 3UPZA 3COIA 1JQ3A 3G8BA 3EKKA 4QYFA 4BCJA 2EFJA 2ZBPA 1FMOE 4Y73A 3N9XA 3B3FA 4YMHA 5GHVA 2BFXA 2WTJA 3E3PA 5F2KA 2ZW9A 4ZTHA 3VS4A 5BVKA 3AMBA 2Q83A 2UZEA 5AADA 4G3EA 5DR2A 5HVKA 1MRYA 3PB3A 4ER3A 3WI6A 2B9FA 4I3ZA 2H34A 1H8FA 4QMSA 4B9DA 3CCNA 5GM2A 1Q3DA 4BCFA 3PJ2A 5EKNA 5LWNA 4FTAA 5IQAA 4C38A 5EOLA 1OI9A 4WG4A 4HG2A 3NCGA 4XRLA 4QPPA 4L43A 4LOOA 3GVUA 2I0EA 4KVZA 1UWVA 4MBJA 2UV2A 3JVRA 2ITXA 3UMWA 3BX5A 4MIKA 2XRUA 5T64A 2VU3A 4FKTA 3FL5A 4FTIA 5U4XA 3LCUA 3PLSA 3ZSIA 5EQJB 3OC1A 2PTKA 4TPTA 3CGOA 3Q9ZA 3QTSA 4DEIA 1RI3A 5E4HA 5B2LA 5A4TA 2G2IA 1W98A 3HMMA 3K0BA 3K3JA 3PWDA 2OJ9A 2YISA 3NUXA 4FV8A 2E9OA 1REKA 2J0IA 1ZARA 3NIEA 4FKSA 5DEYA 3S2PA 4H3PA 3M1SA 4L7FA 4O7TA 1P1CA 2JKOA 3P23A 3HNRA 3ZEWA 2F9GA 3FI8A 4GEOA 3NMUF 2YZAA 5IA0A 3KFAA 4DFUA 2ZAZA 3OU6A 3CY2A 2IW6A 4OT6A 5CY3A 4FSDA 3S68A 3A61A 3OD6X 4FKJA 4RA4A 4BCMA 5JK3A 1XXLA 2IBTA 3LCSA 2WMAA 2ITVA 5HCYA 3HV3A 3PY3A 3LAUA 2JIIA 1UNGA 4NM0A 4O2PA 2WTDA 4P7KA 1KV2A 4U3ZA 2ZBQA 2LAVA 2WMSA 1RJFA 2QOFA 4KDCA 4WD5A 3QRIA 3UA4A 3A7FA 3A8WA 1YKRA 2PSQA 5ANDA 4DG3E 4IAIA 4GYIA 2AOTA 5M4FA 3QTIA 4GK4A 1DI9A 4CLJA 4E2XA 4ZZOA 3VC4A 1PHKA 2BROA 2ITYA 5AX9A 4Y5HA 1IA9A 3KB7A 3ZBXA 4YC6A 5KMOA 3BBWA 4PIPA 4GEKA 3SXJA 3BWFA 5GP1A 5FUTA 2YHVA 4KIFA 5DIAA 4BDFA 4RJ3A 2XUUA 4F85A 4I92A 4A6EA 1ZOEA 3QWJA 4RFMA 3EQGA 1REJA 2GNGA 1URWA 4GIHA 1Y8GA 4RV9A 3EFJA 1JKSA 4QMOA 4ENYA 1U54B 3LKZA 4DG2E 3GU7A 2BR5A 4N0SA 4F4PA 3OVVA 3CJTA 3O23A 1T43A 1MRVA 3BRBA 5CZIA 3R0QA 4QP7A 2XIRA 1WBPA 4FKPA 1YWVA 3F69A 3LCVB 4H36A 4J96A 1QCFA 2V5QA 4C34A 4M68A 5DT3A 3FYDA 3I1AA 4QP6A 5CF4A 2CWWA 4OR5A 3SR4A 4EUTA 5LJJA 4HGEA 4E33A 2XNGA 1V39A 3I4BA 4LRKA 3TKAA 5ERGB 5DPVA 5JEBA 1GY3A 4DCGA 3O7LD 2CL5A 4M0ZA 5FP6A 2XNEA 4I24A 2X8DA 1Q8ZA 2FA2A 2QG5A 1JG3A 5BUJA 3DOUA 4JBOA 3A8XA 2FB8A 4XOYA 3AD4A 4FODA 4YUQA 3KK8A 5JRSA 3ZONA 3ORTA 2C69A 2OFUA 3SMQA 1XHAA 4GSBA 4L67A 4C4FA 2WTCA 3VS6A 3ACJA 4EH2A 1RJGA 5CAPA 2C5OA 5DBXA 1QMZA 3RW9A 4DH8A 2GHMA 4P7JA 1Y8CA 2YVLA 4XBUA 2OYRA 3WF8A 2IVTA 2EG5A 5HBHA 3OY3A 4IMYA 4AN2A 2PXAA 2VTMA 1ZYJA 2W4KA 2YACA 4B99A 4RIXA 1P39A 4FEVA 5FWDA 4L3LA 5IUHA 4HGTA 5FD2A 2ADMA 1JSZA 2HV9A 3P78A 3BYVA 4GQBA 5HOQA 4YJPA 2GCDA 4PNIA 4C3PA 3BKBA 4GK3A 5L8JA 3TNHA 4M0YA 2VTOA 3LCTA 4CFMA 3HNGA 3DTWA 4BLVA 5HICA 4BRXA 4IAYA 3BV3A 1BHJA 3EMDA 2X2LA 5EYMA 2NXNA 3E8DA 3R22A 2BKKA 3KRXA 3ORIA 4O7VA 3RMFA 4QOXA 4HRAA 5DTMA 3DZOA 4E5WA 4QMQA 3CEKA 4QPNA 4RX8A 3Q4UA 4BDGA 4C3FA 3AT3A 1UU8A 3EQBA 4WG3A 3VS0A 5I0BA 5JGBA 4WVLA 5IDNA 4YZDA 2PULA 3VS3A 3PX3A 3I79A 3GENA 4HZSA 2GHLA 3QBNA 3KULB 3QC9A 4RVTA 4RTKA 3R2YA 3FZOA 4Y83A 2YEXA 5LQCA 2R3KA 5E8TA 2VTPA 4BYJA 3QA0A 5D1NA 4AGDA 2H6DA 2C1AA 2J7TA 3CJRA 3TNQB 4G6LA 4QP4A 4EC8A 4Y85A 5ITAA 4EORA 3A4TA 2C6KA 4OTIA 4X60A 3IK3A 2QE6A 2BHEA 4FI1A 4OTQA 3SAYA 3UJAA 3U4UA 4DEBA 3AMAA 5EOVA 4ALWA 2ZVAA 4XCUA 2J0MB 2PX4A 5AUZA 3G7UA 3PIZA 1PRYA 5M55A 3ZUTA 5DM1A 2GNHA 4YHJA 2V7OA 2ZZMA 4K11A 3P7BA 2J9MA 5FTGA 3VRZA 4J7BA 4E4XA 2BIYA 5HVJA 4BZOA 1O9HA 2PMLX 2CGXA 4FMQA 3I5ZA 4WHZA 2VP3A 3F4KA 5CQWA 2YDIA 5K5XA 4E31A 1DCTA 2IZSA 2PE1A 2O8YA 5TF9A 2CNVA 2HZ4A 2VRXA 2XK4A 3GU8A 5H3QA 4N57A 2FH9A 4FT4A 1Y57A 3TTJA 2XJ2A 4M36A 2EXMA 3IW5A 2BILB 2R3HA 3ZO3A 3BYMA 4G16A 4GKIA 4CRSA 4MHTA 1QPDA 4KIOA 2WMWA 4DTAA 3PXFA 3IS5A 5D12A 5T68A 2ETKA 4FKGA 4U81A 5KHWA 1UFKA 3HCFA 4RVHA 5C4KA 3I5UA 3GUBA 3DQXA 2YAAA 4L44A 1ZG3A 3LSTA 3ELUA 3W8LA 2PE2A 3FZTA 5ETCA 1HCLA 4USFA 4I41A 4I94A 4MK0A 3Q9YA 5CXZA 2CLXA 4EK8A 4Q9ZA 1QPCA 2EWAA 3C0GA 3C5IA 4L42A 2ORED 1OPLA 2QODA 3QX2A 3W16A 5M57A 1LUFA 1U46A 3K54A 3R7EA 4EK3A 2O5KA 4EOSA 4F7NA 4UN0C 5K5NA 3LDGA 1G3NA 3HUBA 4ACCA 3FEGA 3NCZA 3FRHA 4X1OA 4YBJA 1XDUA 4D1XA 2EUFB 3GT8A 3AQVA 2WD1A 3FUVA 5LQNA 3EFWA 4XP2A 5JGDA 4EOMA 3OFJA 5K8VA 1OL5A 1YHWA 1VLMA 3MFRA 1V1KA 1NBHA 2OY0A 4ZSJA 5HD7A 5EZSA 4D2RA 4YV2A 5HZMA 3DTNA 2FRXA 1GOLA 3FUWA 3DXXA 5C1IA 2GNFA 3GC0A 4FGRA 4RX5A 4AU8A 3A7EA 3CVOA 3ENMA 3EHAA 3FSKA 5CSWA 4ALVA 3NGAA 4E5BA 5JSMA 3NW7A 4AAAA 3AC1A 2VDVE 3GO4A 4X7QA 4YZ9A 3G0EA 5IQFA 3BGIA 3E8SA 3PG1A 1OKWA 3U55A 3DPKA 2VTNA 3H30A 3IPHA 3GC7A 5BVWA 1F5QA 2VTJA 5CVEA 3E8EA 2RKUA 3WE4A 3QCQA 2OXXA 4IIRA 2UZVA 2X4FA 1YXXA 4U7PB 3F2AA 5GIOE 1JWHA 3VW6A 2GSFA 4R7BA 3GCSA 3E8NA 3DBQA 3I60A 3MVMA 4DEAA 4I6QA 4F0IA 4G34A 2Z7SA 2WTIA 2A0CX 4NSTA 4LG4A 4FSNA 3VW8A 3ZYAA 4CT1A 4JOAA 3AC3A 4DBXA 1WBOA 4Y72A 5CCXA 3FZPA 4Y46A 3NAXA 3UZPA 1CDKA 4FSMA 4J53A 4Z9LA 4FYOA 4CZUA 3QF9A 5EI6A 3I64A 3LCCA 5K03A 3FUPA 4EKKA 4L6QA 4QNYA 4WOVA 3L9MA 2VWXA 2XH5A 5IUIA 5M5BA 4C62A 2XZSA 1H25A 4BDDA 5KZIA 2I9KA 3FC1X 5JMSA 4YHFA 4ZY4A 2X1NA 2WMRA 2HYYA 2R3QA 4AT4A 4RWZA 4RYLA 2CJMA 3Q5IA 3QQLA 3EVGA 4CKBA 4G3FA 4QTBA 2YM5A 3CKXA 4X3FC 1ZZ2A 3LFNA 3DT1A 3D9VA 1VZOA 2BRNA 2R2PA 5FTOA 4ANQA 3D7ZA 4MXCA 2W9FB 4WXHA 3KRRA 3PP1A 2AN4A 3M6UA 1PMUA 4EHZA 1RDQE 4YO4A 2QOLA 4R1YA 2G01A 5FG8A 5E8ZA 3BYUA 3PJCA 3G5DA 2EXCX 4L3JA 4IJPA 4NKSA 4QMYA 2WNTA 1GZNA 4ZSAA 3DFCB 4FG9A 3MY1A 3MCZA 3C4WA 4E93A 5KMKA 1ZAOA 4DLJA 4YJSA 3G90X 2FSMX 5E91A 3WF6A 4BF2A 2XEZA 3HECA 4DFNA 5EI8A 5M4CA 2F7EE 2WXVA 4X2JA 1DM2A 1FP1D 3EGVA 1SMHA 4IAAA 3ORNA 4HJOA 4BI1A 4C4IA 4EJNA 1KPHA 3SD0A 3K6RA 5A3XA 3DCVA 3PPKA 3UVQA 4J98A 4C37A 4XEYA 3B3GA 4LGHA 4DA5A 1JR4A 5I5ZA 1CTPE 4AN9A 3QQGA 2QVSE 4PYNA 4FG8A 4HNFA 3EN7A 1SYKA 3PXKA 5BMSA 4NJDA 4C7TA 2WQOA 3PYYA 2BAJA 4C05A 5L2TA 2Q41A 1S9IA 1FGKA 2PVFA 4FICA 3CR0A 3R1NA 4V0GB 4CV9A 1IM8A 2PBFA 3HVJA 4C04A 2C7OA 2A19B 5IH5A 4MEDA 5CNOA 4R05A 3JYAA 4K1BA 3W55A 4RVLA 5D11A 1JQEA 1XCJA 4C03A 3R9DA 3G9NA 4QQTA 3R7YA 2VTTA 3ORKA 1XCLA 4JR3A 5BUIA 3CIKA 2BAKA 5AAFA 3LXPA 2XYUA 4F9AA 2FYTA 3BWYA 2OG8A 2YM4A 4RWIA 1GNGA 5CVHA 2W4JA 2G72A 3POOA 5AIKA 3EQCA 4CQEA 1HNNA 2B78A 3G6GA 2R6ZA 2OWBA 2GQRA 4FR4A 4BLUA 4U5JA 3GCQA 1VYZA 5CI7A 1JVPP 3SXRA 2I6GA 3MGGA 3DOGA 2Y6OA 3M2WA 4HVSA 2AN5A 4YSJA 2GNLA 4UXLA 5LMKA 4HH4A 4XLIA 3OWKA 3TJDA 3MVLA 2C6LA 2W0JA 4XP0A 4GOLD 3PXQA 2OH0E 3N4UA 4XOZA 3PSBA 2BAQA 3EQFA 4NM3A 1BKYA 4DCEA 4ERKA 2PKWA 4KBAA 4YUZA 3CC6A 4XH6A 4YZMA 5J9ZA 1N2XA 3FMKA 3UZRA 3ZFYA 3DJ6A 5CAUA 3O2MA 3UTOA 4DEEA 5LSAA 2QHMA 5JGAA 4FKIA 4JQ7A 3AMYA 4KBCA 3ORXA 4N70A 4OTRA 4TWCA 4D28A 3G5LA 2PU8A 1IA8A 4RTSA 2W1FA 2BTRA 1LR4A 2VWZA 4U45A 5IUGA 3ZLYA 5D41A 3HVHA 4I6BA 2GNJA 2JDSA 2WZJA 3E88A 3VJNA 5CIYA 3BGDA 3OXZA 2P41A 3H9FA 2UYCA 1KE7A 1OKVA 3DA6A 3TWJA 3VF8A 4GW8A 4ONAA 2PZIA 4ASEA 3HTXA 2NXJA 2OSCA 4I20A 5MHTA 4PL5A 1UU9A 1ZOHA 1FMKA 2PVKA 3R9HA 4BI2A 4FT7A 2P3OA 5KHXA 5JT2A 3E05A 5BXYA 3UYTA 5I9YA 4KAOA 1ZOGA 2VTAA 2F2CB 3DKOA 5M09A 2V22A 4DMGA 3ORMA 2CKQA 3IDCA 4G3CA 3ZZWA 3LBFA 4QP3A 4QPAA 1YFLA 2F2UA 5TO8A 3UYSA 5J1WA 5IF1A 3MBLA 1G38A 2UW7A 1NY3A 4GG7A 3R21A 4GH2A 1WBSA 4JDKA 4QP8A 4TYHA 3ACKA 5IG1A 4GC9A 5ICFA 5CT0A 5DHJA 2JFMA 4QQCA 4MQ4A 4CSVA 5K4IA 5KKRC 2BM8A 3UZTA 4FP9A 3NNUA 4O6LA 4RZWA 3KN5A 3KXXA 1P5EA 1TQPA 4NFMA 2UVXA 2W1CA 3JWHA 3CKKA 4D0XA 4EBWA 2YXDA 3G2QA 3A26A 2E9UA 5D1HA 5H9BA 2W7XA 2YDJA 2O63A 4TRLA 3BLRA 3KPVA 5D9HA 3MB6A 3FMLA 2UZOA 1APME 3Q2JA 2JJQA 4RTNA 5CCBA 2OJFE 2QOKA 2C0IA 1B42A 2R3SA 2YAKA 4V0RA 4AFEA 3OFMA 1G5SA 2OZVA 2XYRA 3COMA 5DTRA 4HSGA 4TYEA 3VUDA 2UYQA 2RFNA 3E3BX 4IKPA 4E30A 2JHPA 2G1PA 4F9BA 2ONYA 4YTIA 5J7HA 2F4JA 1STCE 5EW8A 2FYSA 2ZFUA 5IQBA 3ODZX 3QQKA 4XCXA 2XK7A 2O0LA 3HMPA 3R71A 4PWNA 3ZC6A 4NH1A 3VULA 4YLKA 3RAKA 4BCKA 1U59A 1ZXEA 3MH2A 3O8UA 3Q9XA 5GM1A 3R04A 3SV0A 3KQTA 4DITA 3RODA 4A6DA 2H00A 5L8LA 3FWQA 3PFQA 1X1BA 1I9GA 2YIQA 3K5UA 2ITNA 3P2IA 4F1MA 3I0QA 2JIUA 5GJDA 3RK7A 3KRWA 3RPVA 2HR1A 4YUYA 4WUAA 2JC6A 3F7WA 5DG5A 3SW4A 4ERWA 2Y6MA 1FP2A 5IKMA 4N4SA 5AP3A 3OHTA 5DE2A 4FSWA 4IANA 4XV1A 1X19A 3R28A 4PYOA 2AR0A 3QFVA 4S34A 3PZEA 3DKCA 2PZYA 2GLUA 4O7NA 5CSHA 5E8RA 2WU7A 2ONLA 2SRCA 2OKRA 3PG3A 4FKRA 3LBYA 2OB1A 3A7HA 1Q3WA 3E7VA 4F08A 5IQHA 2ZZKA 3EYHA 1RQQA 4JAJA 2WEVA 4QMZA 2YM8A 3ID6C 2CCHA 4X21A 3QTXA 4QRCA 5M06A 2XJ1A 1O6KA 1SVUA 3THBA 4YLLA 1OKZA 4RPVA 3ET7A 1OR8A 3BWMA 3MH3A 3QUDA 4ZLZA 3BHTA 5KBQA 3QOXA 4LV8A 1J7IA 3H0ZA 3GRZA 3R8LA 5CVJA 3DKFA 3ZLSA 1SVHA 3TUBA 3KCKA 4D1SA 1JG2A 2XKFA 4DEGA 4F64A 3EVEA 1R18A 4EKIA 2XP2A 3GRYA 4KSPA 2CKPA 4XUFA 4AW1A 1OL7A 3G6HA 1QPEA 3QGWA 5D1JA 4U41A 3S4QA 4O96A 5ANJA 2QONA 4JXFA 5A6OA 3F5PA 3ZFMA 2X81A 3KPYA 3ZO4A 3KGAA 3NNXA 4C4AA 2Y4IC 4QDJA 4OA5A 5J9LA 3MIAA 2B9JA 1OL2A 3OP5A 4IVBA 1SUSA 5HZNA 4C08A 1K3AA 4DF3A 3PIXA 3AXSA 4QPSA 5E90A 4MQ1A 4RG0A 5C8KA 3EH9A 4AX8A 1CSNA 4JI9A 4FUXA 2YCFA 4UY9A 1NBIA 5FBOA 3EOCA 3CY3A 3OS3A 4CFUA 4HPTE 1X8BA 2V62A 2YFXA 4YNOA 1SNUA 5CLPA 2O64A 2BDFA 3BZBA 1UNLA 1I4WA 2WMVA 2P2IA 4J97A 3TRKA 4BN1A 4U80A 3X0DA 3TV6A 5LQUA 5CWZA 5AFVA 4F7SA 4GVJA 5FHQA 5M53A 3OTUA 4AS0A 2HXQA 1OITA 2REIA 3HP5A 1NE2A 2YTZA 1S9JA 2QC6A 3P0MA 3NW9A 4CFFA 1N7JA 3IKAA 4H0NA 2QRVB 3KXMA 5EMMA 4PL3A 3P9IA 4EHEA 4ZTLA 5DX1A 2BRMA 2W96B 3NUAA 2AS0A 2UUEA 3LMGA 4GV1A 4DH5A 2NYUA 1XR1A 3I81A 2IFTA 3OY1A 3EQRA 4GVAA 1SUIA 3UFBA 3TNIA 2H11A 4BC6A 2XCHA 3P1AA 3UP7A 3UA3A 4L00A 2C6EA 3HRFA 4I22A 4TNDA 5AV3A 3RALA 3SXSA 1SNXA 5F20A 4ZTMA 4X0MA 3KQYA 4JDIA 2NPQA 2GMXA 4EOKA 5K01A 4C2WA 4YTFA 3DXZA 3DBEA 4PYIA 4GUEA 3THSA 1YDTE 1SKMA 3TUCA 1WBTA 3CJFA 3CD8A 5E1MA 5EW3A 4K33A 3AD6A 4O7ZA 2ZZNA 1H24A 4F0GA 2N47A 4I5PA 3M4XA 4FIIA 1A48A 4PGHA 2PVCA 4RA5A 2C30A 1RJBA 1KYWA 4YGAA 2B9EA 5AM7A 5AX3A 3D2IA 1NVRA 3D4QA 4G9RA 4BDIA 2CKEA 3DLIA 3H3CA 3OMVA 5E7RA 2HW6A 3GOKA 1UKIA 4IB3A 1Q8UA 4KABA 4IWDA 4WBOA 3R8PA 1YDSE 4FTJA 5AAEA 3U6IA 4I6FA 2QOBA 3VBYA 4R8RA 1KPGA 1RI4A 2Y9QA 3TJCA 3L8SA 3LVPA 4QMPA 5C8NA 4FV9A 5HX6A 2EJTA 4D4RA 4EYMA 2ZV2A 2QHNA 1X1CA 3P9NA 1UWHA 4X3FB 1PJKA 1FVTA 2X39A 5A4LA 5HGIA 2YIWA 3WYXA 3MTIA 1WCCA 2QLUA 3WZUA 4FTNA 3L8XA 3SG9A 2E9VA 2VDUE 3EB0A 3M11A 4E20A 2XM8A 3UC4A 2R3NA 3K2LA 4Z7HA 2ZDTA 5HLWA 3TIYA 3S95A 4RRVA 3OUKA 5IDPA 3FUXA 4TXCA 2Z02A 2IVSA 1YVJA 4FT9A 2ZMDA 5JFVA 4NW5A 2CMHA 3A7DA 3EVZA 3KR9A 3PT9A 1X1AA 3O7LB 3QXOA 2AOXA 2FK8A 4FGZA 4R6XA 5K0LA 4NWMA 2W1IA 2BZKB 4M15A 1TPYA 2FHPA 5K0BA 4JQEA 3TKUA 3MYGA 3TV7A 1ZGJA 3OUNB 3DK7A 3FPJA 3P97A 2C7RA 3JWIA 4WNPA 2ONZA 3HA5A 3CTJA 5HE3A 2ERKA 4RJ4A 2G2FA 2QI8A 3KU2A 4XV3A 3ZUUA 4QMVA 3MFSA 2EJUA 1GIHA 1H0WA 1Q41A 4FE2A 1O6YA 4M14A 3RP9A 2W1EA 4AA4A 2CGWA 5FXQA 4CG9A 3ANXA 3QTUA 3AC4A 3HEGA 3GC9A 5HO7A 1AV6A 3R9XB 4TWNA 3WZJA 5CASA 4FT5A 3TV4A 4E6CA 5BYZA 2AC3A 2WMQA 5HQ0A 1WS6A 2JKMA 3EFKA 3QQHA 3ZUVA 4EC9A 5IQDA 5FM3A 3LFAA 3LJ0A 3QTQA 2W05A 4U7ZA 4YNEA 5DOSA 3KQMA 5K0EA 3EQIA 1P2AA 4YBKA 3UP2A 1RI1A 3EVFA 3R8UA 2UVYA 5EGSA 4PRJA 5JRQA 4IAFA 3PX2A 5A14A 4PYQA 4EOPA 3WARA 1Q0TA 4BCGA 2RFEA 3FI2A 4JRNA 4CZTA 3I7BA 1YWRA 5HU9A 4NUSA 4ZLYA 1YXUA 4BVUA 3QV2A 3LLAA 3HGKA 4F9CA 3DDPA 1QL6A 2IJMA 4I0TA 4PNKA 2J4ZA 3VBQA 3R1QA 4G31A 4AW5A 2AUHA 3Q6WA 5E2AA 5JQ5A 4AOIA 5CAOA 1QAQA 2EVAA 5ICCA 3E23A 3MAGA 3MJ1A 4EK6A 2JAVA 5LVNA 4ZMEA 1IEPA 2CGVA 1L3IA 2ZIEA 2BALA 3BQRA 1AQIA 5FULA 5BUEA 3EN9A 4X6QC 2C0OA 5HBJA 1VE3A 4WIHA 3FUTA 4EOOA 2X7GA 3S1HA 3ERKA 3P4KA 3CPBA 3MFTA 2BMCA 3I7CA 3FTFA 2PE0A 2JDVA 2RL5A 4QQNA 1IASA 3P2KA 5C9CA 3SX9A 1KV1A 3SXFA 3WF5A 5H2UA 5ETIA 3OOMA 3BHVA 3FTDA 2JDTA 1VEBA 3FXXA 4KRCA 4X2NA 5HEZA 3N4VA 3UOKA 3F88A 4JDJA 1JSUA 1NT2A 4UWBA 3EZRA 2JKKA 3T8OA 4K18A 2J0JA 2X2KA 4O0RA 3CSVA 3F66A 4RJ8A 3UQGA 5HD4A 4RIWA 5DR6A 4EQCA 3QOWA 2Y1XA 4LMUA 4XUEA 3P7CA 2PVNA 2WB8A 3V8WA 2R7IA 4L46A 3WE8A 4CKRA 3JXWA 2PXXA 4F9WA 5M4IA 3UJ6A 1JAMA 3KL8A 1OPKA 1AD5A 2VNWA 2WO6A 3QKKA 1R3CA 3C1XA 4XG2A 1JTEA 3DMHA 3EFLA 4Z2YA 1SQGA 4BLWA 3VUGA 4FEWA 4ANSA 4CG8A 1WZNA 2P3QA 2PJDA 5BQ0A 4A7CA 2AOUA 2VGPA 2E9PA 1M2QA 3PE2A 4RJ6A 4OX9Y 4R6VA 4AG8A 1OM1A 2GQSA 4AWIA 3P9CA 4X2KA 3P8ZA 1MJFA 2CKOA 1PXJA 4GT5A 4NM5A 4MXAA 4QTDA 4O82A 3RCDA 3LCKA 2PX2A 3REOA 4YUWA 1H4LA 1GIIA 2HZ0A 3ELWA 2OZOA 5GINE 2EB3A 2YJRA 5T67A 4JQ8A 4D4YA 3QZHA 5LMKC 3JWGA 2XF0A 4IEBA 2QQ7A 4PIMA 4UBAA 3T3VA 4QYGA 5DGZA 3DTCA 2JH9A 4A9YA 4I0SA 4PINA 4X2GA 4FKLA 4IH8A 5E8VA 2OJGA 4C33A 4J1RA 4EQUA 2XIZA 2QOIA 4YZCA 4AT3A 5LWMA 4E2ZA 3BQCA 3G0FA 4AT5A 1Q8YA 2ZCJA 4UB7A 5EM8A 4C59A 4PP7A 3MSSA 1PJZA 3FQEA 4RTRA 3HZTA 3MDYA 4G9CA 2UVZA 4B8LA 5H02A 4IADA 5IEXA 2XRWA 2KTYA 2PVMA 4ITHA 3W2SA 2C68A 2FK7A 3KXGA 3ATSA 2YIRA 3AT4A 5AIRA 3B8RA 2HELA 3DBFA 3GGFA 3OG7A 4FNZA 5E1SA 3V5QA 3ULZA 5EZQA 4GYGA 4R7IA 4O0SA 2VTSA 1I44A 5AEPA 4ZTNA 3GRRA 5C26A 2WELA 4C07A 2O2UA 1H08A 4V01A 4M38A 5DR9A 3F3UA 3QXPA 5IMEA 4MHAA 4ZXTA 3PJ1A 4UYNA 2P7IA 2BZHB 3QZGA 4HYHA 4E4MA 5FBNC 3R8VA 4DFLA 2WA2A 3R6XA 4KKEA 3UOHA 4R3RA 4W8EA 1J1CA 2IZTA 3LLTA 1FOTA 5F4NA 5IA5A 4RX7A 1T46A 4XG7A 1PYXA 4RC4A 3B8QA 3CQUA 4ARKA 4E26A 2XVDA 5CUQA 5EQPA 1UIRA 2ZMCA 3QX4A 5ICPA 1DUSA 4F6SA 3UJ8A 2GS2A 3PSCA 4PL4A 5ETAA 4ASXA 2GS9A 2IBSA 3ERCA 3ELDA 2UZWE 4HOKA 3BGQA 1L8TA 5LMAA 4DKJA 4TYGA 3KQOA 1Z9XA 3O71A 2W5HA 1H00A 2HWOA 4ER5A 3ZSGA 3AD5A 3QUEA 2R3MA 4HZRA 3C0IA 4APPA 3IW8A 2GPYA 2YUIA 4MKCA 4CFVA 5HX8A 4QP2A 4IZYA 1L3BA 2QOCA 2PHKA 1M2PA 3ER8A 4YJNA 1YXSA 2VTHA 4IJ9A 3GXLA 1NW3A 2B1PA 3GQLA 3U8WA 2XNOA 4EH9A 3QC4A 1TKIA 3ZDUA 3D7TA 2PWPA 2XM9A 4EOLA 4DCMA 4IB5A 5K0NA 3LX6A 2X2MA 4DLIA 2P55A 2P33A 5DVRA 5EHIA 4W8DA 5E8XA 4Z3VA 5ANIA 3LGAA 1J7LA 2JITA 4F6WA 4QVGA 1OMWA 2QM3A 3EEOA 1H1PA 3MV5A 3WZDA 5FEDA 5CF8A 5FHRA 4M8TA 2PVRA 3R7VA 4ZJJA 3LECA 2YN8A 3FRIA 2IW9A 4O0XA 4JVGA 4MQ2A 4XJ0A 3VQUA 4D5KA 3FTEA 2X4ZA 4WG5A 2XEYA 3TM0A 2VTQA 2UZLA 4RIOA 1ZKDA 3KKZA 4AZEA 1KHHA 3HVIA 4L53A 2WIHA 3RWQA 3M33A 4KDRA 4D58A 2R9SA 4K6MA 3ELYA 4K6ZA 3R30A 4K77A 4A4LA 3KQSA 2R3FA 3GGDA 3HA7A 2OO3A 1BL6A 2BR4A 2P8JA 5FP5A 2ERZE 1DAYA 3PLAE 2NNWB 3C51A 4MNEB 5HO8A 4AOJA 2XIXA 4IX6A 4EH3A 2PZRA 2ZWVA 4KINA 1F0QA 2OU7A 4A07A 1URCA 3UGCA 3BI6A 4EOIA 2IIPA 4W4XA 5DRDA 3FPGA 4RX1A 4E8AA 1XBAA 4DBNA 4MXXA 4BDAA 4EOQA 2BDJA 3OTVA 3OEZA 5K0GA 2IZUA 3PTAA 1PKDA 3FPMA 1OVEA 3KKVA 3SC1A 3OZTA 2B53A 2DYLA 4DG0E 2VO6A 3PXYA 5CSVA 3IHTA 1PF8A 3HLLA 4APCA 4AZVA 3B7PA 5AP4A 5B2MA 1OB3A 2IG7A 3UOLA 5JFWA 1P1BA 2Q0NA 4Y5QA 5AP5A 1AQ1A 3FZ1A 3EL8A 3LM5A 4PMSA 2V7AA 4ZK5A 4ZY6A 4EZ3A 5CSXA 3V5JA 3JY9A 3UIXA 4ID7A 5F9EA 4U9AA 4M7RA 5DM2A 2PYWA 5DN3A 2QNJA 4GU9A 3H10A 3BEAA 3LCDA 4MD9E 1VPTA 3L1SA 2JKQA 2PMNX 3LE6A 4KKHA 3TT0A 4DGNA 1KXZA 1MQ4A 5BW4A 4J8NA 4RJ5A 2X8EA 4FL2A 5AP7A 3UNZA 5L6OA 4FV7A 1BI7A 2R3OA 3FHIA 3NUYA 4FV0A 4LOQA 5EKOA 5HIBA 4BTKA 1JBPE 1ZZLA 4JRVA 4AW2A 4EH5A 4X63A 1RJEA 4P5ZA 3QLFA 3WOWA 2YM3A 3UDBA 3F3WA 5EDQA 2G70A 3VYWA 3FJQE 2YR0A 4RTQA 3LFEA 3BWCA 3VC1A 1GZKA 2VWYA 2X0GA 4GFOA 5CEQA 4IB1A 3VSEA 2A1AB 2GS6A 3NVMB 4YTHA 3R02A 4EONA 3B3JA 2YZLA 3IDBA 5KMIA 4ZEGA 1KSWA 3G15A 4ACMA 4A9RA 4BBFA 5JR3A 5TR6A 2PUNA 2PZPA 3ZXZA 4F63A 2A2AA 2RF9A 2VWUA 4PQNA 4JBVA 3GFWA 5CZHA 3QD2B 5KMJA 3OW3A 4MWZA 1WG8A 1H1RA 3TPZA 2VWVA 1BUHA 2O06A 1JSVA 4JX3A 3FKLA 4AE6A 1OIYA 4Y30A 2PUIA 1D2GA 4DQ0A 3V51A 2CNUA 3DLCA 4DA4A 2ACXA 3MN3A 4NM7A 5CX9A 3TXOA 5CU0A 2CMWA 1R00A 1YZHA 3SSNA 4R77A 5DLYA 3A2CA 3QU0A 4IWOA 5DT2A 2CN5A 1RW8A 4LGGA 1NW7A 2E5WA 5DLSA 4LV5A 3SGCA 2YWVA 3CE3A 5BVOA 3H2BA 1V0OA 3S3IA 4MWIA 1NW1A 2HAKA 3MCTA 1EH4A 3R83A 3FC2A 4WRSA 4HGSA 1RJDA 4ZS0A 3C4CA 1P4FA 3FY0A 4IWNA 5EKXA 4G2FA 2OGVA 3ITZA 3LHJA 4RC3A 1M7QA 1Q8TA 5AUUA 2PX5A 3EVDA 3DK3A 4C3RA 4A9UA 4C4HA 3K3IA 5CALA 2ZOQA 3OWJA 4S33A 1JQHA 3TMAA 1MUOA 3C13A 4D4SA 3GCVA 1VYWA 3H9OA 4IV8A 4HCTA 2Z2WA 4KIPA 4RWJA 4JIKA 4C4JA 1CMKE 5F2OA 4TTHB 1V0PA 3UE4A 1FPQA 4R6WA 3HCDA 3LKMA 3DJ5A 3DS6A 3NZ0A 4DGOA 3BLHA 3I6WA 4EZ5A 5M08A 1XH8A 4HCUA 4YSMA 4FS8A 2OXTA 4OUCA 2A4LA 3G8AA 4USEA 3PPJA 5DXAA 4KS7A 2C6OA 4RVFA 2JBPA 1Q61A 3BIZA 5A54A 4TN6A 4PTCA 4WA9A 5IA4A 3SOAA 4GC5A 1WFCA 5DX0A 1UU7A 4R5YA 2BDWA 2IZRA 5HTBA 4QTAA 5HE0A 3IG7A 2VV9A 3DFAA 1PMEA 4E73A 5CF6A 5EHLA 5DA3A 1IXKA 1KYZA 5CVVA 2XIKA 1A9UA 3TDWA 1LEWA 5CEPA 4B8MA 3A7IA 4OBPA 4IDTA 1KR5A 1ZYSA 2B9IA 5CYIA 3OWLA 3H4JA 3U6HA 1QZZA 4L3PA 4X6RA 4JJRA 3F3ZA 5KMNA 4BCOA 3C50A 2R7BA 3SSOA 3UJBA 4HCVA 4AUKA 2BZJA 3ORHA 2RGPA 3IQ7A 1M17A 2X8IA 4WSYA 3HP7A 3AGMA 3DLSA 5LQRA 2X9FA 1KE5A 3CPCA 5KKRB 1Z57A 3HCBA 5P8WA 2WKMA 3G51A 2CKDA 3JWJA 2C6DA 4C02A 3A27A 3A99A 3O8PA 5EM6A 3OZSA 4GU6A 3DBCA 4UZHA 5HCZA 3KK9A 3BZ3A 3VUMA 4CLIA 5HLNA 5AMNA 4NZWB 2YQZA 4NCTC 2J0LA 3IECA 4O0VA 1JKKA 4L9IA 3R8MA 4DGLC 1QAOA 2O07A 3E7PA 3BHUA 4JBQA 4V04A 5EIWA 3DB6A 5K4JA 4DFZE 1NV9A 2AOVA 2PY6A 1FBNA 3ORPA 4P58A 3FI3A 2KULA 3HVKA 5G1XA 5BPYA 4BCQA 3EVCA 3HDMA 2FVDA 2OW3A 4X3FA 4PDPA 4QMXA 5HNGA 2ITUA 4CTCA 4FIJA 3LDUA 2RG5A 5EPEA 2J0KA 4FTQA 5AUXA 4LG1A 2G2HA 4FA2A 2I7CA 3F2RA 4GFMA 5T3QA 4BCNA 5EMKA 4ER0A 3G2FA 1O9UA 2HNKA 3PZHA 4DC2A 3CBGA 3EQPA 3FBVA 2DQ7X 4HC4A 4DFXE 3LDFA 5HIEA 1R78A 1RI5A 1LPUA 2W1GA 3ALOA 4ASDA 4AGUA 2Z6AA 5HE2A 3EVBA 3RCJA 4PDOA 5LVOA 4MTLA 3HV5A 5C4LA 2BPMA 4YHTA 2BUJA 5KVAA 4IZAA 3QQUA 4LECA 4DHFA 4JG6A 2GFCA 3Q4CA 3GNIB 1YF3A 2VTLA 2HCKA 3PVGA 1UWJA 2OIBA 3FMEA 4MBIA 4CXAA 4IVCA 3UNKA 5HEKA 4PDSA 3QCYA 4H05A 4YC8A 1UNHA 5EYDA 4AXAA 3SGLA 4IV0A 1DL5A 2B54A 3RK9A 5EMLA 4RBLA 4HNIA 1U54A 3FI4A 3QAME 4RVMA 1NXKA 2O65A 2C3IB 5DM0A 1SVEA 4DE4A 1TQMA 3A7JA 4XV9A 1KP9A 4YLJA 2Z6QA 3SW7A 5J9YA 4S32A 1AGWA 4MCVA 3IDPA 4UALA 5IU2A 3HVCA 4FV2A 3VS5A 4RJ7A 4XHKB 3DH0A 4F0FA 5FQOA 3KRJA 3I53A 1ZRZA 1NW6A 1BMKA 3OPNA 3KQVA 3W2PA 1OKYA 3PVWA 4Q5HA 4MNFA 1QAMA 3V5LA 3WF9A 4NTTA 5HCXA 5A46A 5C01A 5LARA 4DINA 4GBED 4HPUE 3REPA 3HP2A 4FTLA 4S2ZA 5AP6A 2WA1A 5IH3A 4Y95A 1JG4A 4XP3A 3O7WA 1BKXA 2ZM3A 2H8HA 4QYYA 4FSUA 2AVNA 1OIUA 1M52A 4ITJA 2YIYA 3VUKA 4FUYA 1L3RE 4EH6A 1IY9A 3CD3A 3Q96A 2OPBA 4OBXA 2VAGA 3GC8A 5A6NA 2QURA 4D2SA 3ORLA 2G15A 2WTKB 3GU4A 5GIPE 4DFYA 2B9HA 4ANLA 3GRUA 5L2IA 4FG7A 3BXOA 4W4VA 5G6VA 4PYKA 4JNWA 3MWUA 4FTKA 3AJDA 3OBJA 2F7ZE 2VX3A 3W33A 2V0DA 1JG1A 3EQHA 2PY3A 3DZQA 4E2WA 4G6NA 4BIDA 2JHAA 5LQJA 3RPRA 1QPJA 2F57A 3NWWA 3VHEA 3DMGA 5CEKA 2QO2A 3F3VA 2DPMA 2PV0A 1F3LA 4HTFB 3D5VA 1M14A 3O0GA 4AF3A 2FSTX 2PL0A 1WBNA 4XUCA 3O8TA 4KS8A 3M6VA 1M0EA 5C03A 2W9ZB 3LM0A 3UVRA 1M6EX 2WMBA 2GA9A 3LOKA 3SOCA 2VN9A 3U4WA 3TUDA 3UJ9A 5AUVA 3D5XA 4V0GA 4EMSA 2F8LA 2YM7A 2FPOA 3SSMA 4J8MA 4B17A 3L9LA 4EQZA 4KRDA 3KMWA 3NYOA 5ANEA 5K09A 1IAHA 3D5UA 4YC3A 2FSLX 3QL8A 4ACGA 5IISA 3C6KA 3T9TA 3P2EA 4MTAA 3KU1A 4Y8DA 5EYKA 4BDCA 5CVUA 4QNAA 4AUAA 4LFIA 3GNLA 3QALE 3LQ5A 4RWLA 3JPVA 4AGCA 4AP7A 3SA0A 2I0VA 3MY0A 3ETAA 4IE9A 4N6YA 3LL7A 4JS8A 4A4OA 1OUKA 1YI4A 3LIJA 3PE1A 3QYWA 4WNKA 5EQYA 4AZFA 3WZEA 4CCUA 2HK5A 3P71T 3DV3A 4RSSA 4OBOA 4AQCA 3ZXTA 3R1SA 4EH7A 1NVQA 3KY2A 2UZDA 3HRBA 4FVPA 2GAFA 4HYUA 2YA9A 4F7JA 5CEMA 4RT7A 4FZDB 2WEIA 3C4EA 3FQHA 3MH0A 3ULIA 3WBLA 2JDRA 4YURA 5AA9A 2BM9A 3R7OA 3MQ2A 2AN3A 4I5HA 4CV8A 3ATTA 3BGPA 3PY1A 3PSDA 2ZM1A 3HDNA 3IW7A 3ORZA 4IWPA 1X1DA 4PYJA 5GJFA 5BW5A 3BU6A 3Q5ZA 1VR2A 5TKDA 1KOAA 3ZRMA 5DPMA 1BL7A 2XS0A 4FV3A 4NFNA 1TQIA 3BLQA 2C7QA 4WBBB 3UIUA 3UPXA 5HNBA 4ATNA 4X41A 4QMTA 3VJOA 4O91A 2DS1A 4PMTA 3U9NA 4EK5A 3ZU7A 1KUTA 2QU6A 3RAHA 3EEYA 1AQJA 2B55A 4FTCA 5EDRA 4BTJA 1U2ZA 1Y6BA 4IQ6A 3MVJA 4LWOA 2JH8A 1KWPA 4RIYA 5AJQA 4EKGA 2PVYA 3TOSA 3D83A 2ITZA 3LXLA 1JKTA 4KA3A 3P86A 2C5VA 4YV0A 3QRUA 5E9QA 3LFSA 3UQCA 2HZNA 1JLUE 4O27B 4P4CA 3TL8A 5D10A 4BDEA 4YJQA 5FDPA 5KCVA 1TW3A 4O29A 4FVRA 3NNVA 4J52A 2PT9A 5FCDA 1IR3A 3MIYA 2PX8A 3KVWA 4GJ3A 2GFSA 1H1SA 2UW4A 2XCKA 1RE8A 1IAJA 3DJ7A 4FZ6A 3EJ1A 3SG8A 4CMOA 2XYVA 5HLPA 2NP6A 4OA8A 4XYFA 2PK9A 4LOPA 3COKA 4FL1A 3MPTA 4EK4A 4XLVA 3ALNA 4EL9A 4TYHB 3KXHA 3GOPA 3RI1A 3KMMA 2R3RA 1H27A 1R8XA 1ND4A 5HNIX 3B2TA 1SG9A 3UBTA 5JFXA 5HG9A 4O0UA 4QTUB 4PMPA 2GB4A 1EJ6A 2ZIGA 4CKEA 1KIAA 1U5QA 5DRBA 3W8QA 2PLWA 4C4GA 2CNQA 2UW6A 3HUCA 4K0YA 2PVJA 1KOBA 4D1ZA 4UOEA 3CXWA 3HMOA 2XKEA 3N51A 5AV1A 2CHLA 2W1ZA 3Q53A 3FV8A 3JVSA 3QD0A 4FV1A 4MXYA 2W06A 2Z7QA 4UXQA 5HG5A 4YU2A 3E62A 2FSOX 5DSTA 4RZVA 5TT7A 5KUPA 5CANA 1VIDA 2GPHA 2VWIA 2XNNA 3GB2A 3E5AA 4QMMA 2ITQA 3UJDA 4YP8A 3D14A 2VWBA 3W2OA 4EBVA 1U4DA 4EHGA 2WQMA 4FBXA 4IX4A 4W4YA 3TM4A 4RTJA 3FZRA 5L2WA 1ZMWA 2XK8A 4O21A 2EU9A 4C06A 3FLWA 3LFQA 4LUEA 5LCKA 4WRGA 2A14A 3GIWA 1SQFA 2BRHA 3DLZA 4BBEA 3TQSA 5CAVA 3NJRA 3QUPA 4P7EA 5CVDA 4R8SA 4BDBA 4FZ7A 2UZ4A 2NRYA 3MW1A 3R63A 4R3CA 3ZLXA 3GP0A 4BBMA 2P1DA 3L8DA 1QYRA 3IOKA 5HORA 3OU7A 1ATPE 3AXWA 3MA6A 3TNWA 1YXVA 2XIYA 4PY1A 4FTRA 3V8VA 5HIKA 4MH7A 3U54A 2GQGA 3NSZA 3FMHA 3D2KA 4FSXA 2IH2A 1YB2A 3F2NA 4HYSA 5FTQA 1OBDA 3WIKA 3FZSA 4QMWA 1J91A 4CTKA 2GTMA 2QO7A 1TVOA 2WIPA 4RWKA 3MY5A 3H9RA 4C58A 4C61A 5HIIA 3EN4A 2WPAA 3GI3A 5DXJA 3PA3A 4RTPA 3FLSA 2VX0A 3PY0A 3VWAA 3PXRA 4KBKA 3TM5A 2YJSA 3W32A 2QO9A 2WQNA 3T7SA 1MRUA 2RFDA 4HW7A 4CVAA 5EM5A 3BE2A 2QKWB 1XVAA 3CBLA 1H0VA 2CPKE 4IWQA 3ZH8A 4Q9SA 5BVNA 3HX4A 3OF0A 4UWCA 5BYYA 1FQ1B 3WF7A 2ESRA 4DT9A 4G6OA 1BOOA 1OIQA 5LVLA 5E9EA 3DNDA 1G8SA 4NW6A 4ZJIA 2I0YA 5ANOA 5FEQA 3RKBA 2AZTA 3ZZEA 3FXWA 5IQIA 4CTJA 4TWOA 4ITIA 1Z3CA 1J3HA 4FKOA 3V5WA 4MAOA 2AC5A 2AVDA 4TKSA 3LKDA 3VN9A 3EYGA 5GWXA 3VRYA 5ICEA 4BGGA 1OBGA 1YRPA 2OZAB 3EZVA 5DYJA 3DK6A 4KWPA 4A06A 4OTFA 4YR8A 3NVKI 2JAMA 4ZTSA 1NW5A 3OE4A 4U7TB 4F84A 2OBFA 2I62A 3EPPA 4E6QA 3EWHA 3HV6A 4C36A 2YERA 3RAWA 2I7QA 4EH8A 2IO6A 2V7EA 2CLQA 2C5NA 3BU5A 2CSNA 2HXLA 5DSXA 4QTTB 1WZYA 4FV4A 4BHNA 2BH2A 1M7NA 2FO0A 1MQBA 3FMDA 4R5SA 2OO8X 1WXXA 3M6WA 1I1NA 1H1QA 2C1BA 4BZDA 3R3HA 3R24A 3E8CA 1E9HA 3FY2A 3BWBA 4RIXB 1ZLTA 4NCTA 3UODA 5AV4A 3QZIA 5LCJA 3OZRA 4IC8A 5H8GA 5FEEA 2GDOA 2ZDUA 3O50A 4G1WA 4ZSEA 3ZC5A 3BBTB 4DEDA 1JSXA 1DI8A 4FIGA 2BZGA 4XMOA 4P7FA 3NWEA 4FX3A 5JN2A 4FKWA 3ZO1A 5FA8A 3LPMA 4PCLA 4M84A 4OW8A 3F3TA 4WKQA 4GT3A 1R74A 4U43A 1XJ5A 1ZYDA 2WGJA 5EW9A 5KMLA 4YJVA 4RSRA 1INLA 4IACA 4DAWA 2OIQA 4Z16A 5H8BA 2Y0AA 3G88A 3LZBA 5EEGA 3WSTA 4FNWA 3HV4A 2IDKA 1G8AA 2OK1A 3OOGA 1YOLA 3BEGA 2P3LA 4PYLA 1OZ1A 4OBWA 1Q62A 4RX9A 2ZBRA 2VUWA 4FV6A 5HIJA 2ZB0A 3Q04A 2G9XA 2XA4A 1L9KA 4EH4A 4PUZA 2ITWA 1PXMA 3GQIA 3VNTA 4TZRA 3QZFA 4ZJVA 5JFSA 5L8KA 1XBBA 1XWSA 1FJXA 5IH4A 1Q0SA 4IAZA 4QO9A 3ZO2A 3LFCA 3PXZA 4U42A 2XVMA 4XG8A 1BC5A 4O7SA 2OF4A 3FMJA 4FEUA 2WMXA 3EVAA 4YJRA 4NECA 1PXOA 3LQ3A 3Q3BA 1KE9A 3UG2A 2ZWAA 3B5IA 1FVRA 1FVVA 4EYJA 4UZDA 5CU4A 4D9TA 2FUMA 2OJIA 1ZMUA 2XK9A 4TW9A 2VNYA 1CM8A 4L68A 5CENA 4C2VA 4DH3A 4EWHA 3HCCA 4TYIA 3MFUA 4U44A 1Q4LA 3PRIA 3KRLA 2I0HA 2ZVJA 3FYCA 4EWQA 3HAMA 5DI1A 3O4FA 4IM3A 4BTFA 2AOTB 3QQJA 2BFYA 3EMGA 3LPBA 4G3DA 3G33A 4FNXA 4GT4A 3BWJA 3T3UA 5E8YA 2CDZA 3FLNC 4M13A 3II5A 5BVDA 1PXLA 4FZVA 5DM4A 4MF1A 3NUSA 3THRA 3OCSA 5CU6A 4FTTA 3VBWA 5CVFA 3EGIA 3FLQA 4IB0A 2ZM4A 2ZSUA 2Y7JA 3G5TA 4O6EA 4WNMA 5K0CA 5E1DA 3RTPA 2ZV7A 4XG3A 5JH6A 2BHHA 2C5XA 4D55A 4DYMA 2C3JA 4N6ZA 5M56A 4JXJA 4WO5A 3FPHA 4I4EA 3PA5A 3RVGA 4C35A 5DRTA 3FMNA 4H3BA 3QTRA 2ZB1A 1H28A 2ZULA 3GCZA 2RIOA 4ZP5A 3IO7A 1EIZA 2RFSA 2ZTHA 2YCQA 2BVAA 3GJYA 3DQWA 3QCXA 3WILA 4AFJA 4BCIA 4K8AA 3WZKA 4FSQA 4HGYA 5JUWA 3QKMA 4IZ5A 4ANMA 3C0HA 1IRKA 2Z7RA 1A06A 2GHGA 1YHVA 3KEXA 5BX0A 1R8YA 1DS5A 3NW6A 4ISCA 5EVJA 4KRGA 3ENHA 2XMYA 2CMGA 2PSSA 1Z5MA 4UYAA 3JUHA 4PDYA 4TT7A 4F1OA 3LFBA 4CXMA 4GJ2A 4EK9A 3AC8A 3DAKA 3PJ8A 5HI2A 3UO4A 3FL4A 3R01A 2QOHA 3MA3A 4LRJA 2W5BA 3OCGA 3SVVA 3MPMA 3TNPC 1XH9A 1PMVA 3UO6A 4F09A 1ERKA 4IDVA 3NDJA 3OCTA 3B2WA 3QA8A 4JR7A 4XV2A 2VGOA 2P40A 4NTSA 3V8TA 5B1SA 2XBJA 4O7WA 5F1ZA 2X9EA 3OU2A 2FGIA 3ANRA 3QHWA 3OFKA 3BU3A 4EEVA 4A9TA 5KE0A 4BCHA 5LMBA 3IV6A 2X6EA 4H3QA 4IHPA 2Y4PA 4F65A 3FLYA 5FQNA 5CD1A 3PFHA 2UW8A 3KF7A 4JG7A 2VZ6A 2Q0BA 3L9PA 5L2SA 2OZAA 3QQFA 2YX1A 3R7IA 5CAQA 3DBDA 4EJ7A 3QTZA 3UG1A 4AZWA 4MWHA 5CF5A 3F82A 2OF2A 3GBZA 4FGBA 4ORKA 3BKXA 5E9WA 2XKDA 2HW7A 3JY0A 3UIMA 1ZYCA 3I58A 4IAKA 3SKCA 3W2QA 3QLGA 3OCBA 4KW7A 1XDZA 3DMFA 3D15A 3FYKX 3P9JA 4AZSA 5HE1A 4O0YA 4O86A 1JSTA 3VUHA 4ZTRA 2P3GX 3KULA 5EK7A 1OPJA 2JGZA 5ACBC 3PRFA 5CNNA 4I21A 2C3LA 4X3JA 3CC8A 4MYGA 4MX9A 1B6CB 1XH6A 2VO0A 4U6RA 4DN5A 4ZY5A 4UWYA 5KO1A 2W99B 3ANQA 1ZY5A 4MBLA 3VAPA 2A27A 2WTKC 3BHHA 4CMUA 2HWKA 2XNBA 5DT0A 2X7FA 3NWBA 3K5VA 5EHGA 2I6LA 5K0FA 1WVXA 4TNBA 3MS9A 2LD4A 1BLXA 1RI2A 3Q7EA 4FC0A 4FNYA 1XO2B 4U40A 1P4OA 4B7TA 4DZRA 3DXNA 3BHYA 1HOWA 3W10A 3FUUA 2V55A 4G56A 1F3MC 1ZQ9A 1U5RA 1BX6A 2ETRA 3BPRA 4GKHA 3V5TA 5CEOA 2J5FA 4QP9A 4YJTA 4EUUA 5A4CA 1CKIA 2PVLA 3B89A 5M07A 3UJCA 4FTMA 4ER7A 3DAJA 4MD8E 4PF4A 3Q52A 2YM6A 3HA8A 4JG8A 4OBQA 4QT1A 5AUYA 4YTCA 1R1WA 3EN6A 5BVFA 3M6XA 3TEIA 4CNHA 3C4FA 4R1VA 3KREA 4O84A 4AW0A 3DY7A 5DNRA 3U87A 2GTNA 3L9NA 4GK2A 3GCPA 3P08A 3KC3A 1EG2A 2OKCA 1E1XA 4IFCA 4ZZMA 2WMUA 3QWKA 4R7HA 3BUSA 2OJJA 3TR6A 3FYJX 1XH5A 3RIEA 3LQ8A 2ITTA 3Q4ZA 2QOQA 3PIYA 4FKQA 1L1EA 1WAKA 1N7IA 1JNKA 4U0IA 4E2YA 4X2FA 3P5KA 4USDA 1XDSA 2Y8OA 3V5PA 1G60A 3CS9A 1YOJA 4FTUA 2BR1A 4L01A 4R78A 3OBGA 2WFYA 2Z7LA 4PP9A 4BB4A 2NP7A 2PPQA 4LI5A 4E6DA 2AOUB 2C6TA 4D9UA 5DRYA 3NNWA 3OZ6A 4YPSA 5L6PA 3IW6A 4FSTA 4OTWA 5KZ0A 3T9IA 5K05A 5HG8A 3VF9A 5KMMA 3S0OA 5T6KA 4EVIA 1NA7A 3HMNA 3QRTA 1O54A 4OQEA 2QKRA 5HIDA 5AAGA 2CCIA 1HMYA 1YI3A 3HEMA 4I0RA 2IVVA 4YJOA 5E1BA 3D2LA 1EJ0A 2Y4IB 2OBJA 5EG5A 2W1DA 3PUPA 4FK3A 4HVHA 4HGLA 4E70A 3ZM4A 2YABA 2R3IA 3PS9A 4BP1A 5D7VA 4P90A 5AUTA 5FUBA 4RIYB 3ZM9A 4L7VA 2OFVA 4TY1A 3W2RA 4XRJA 3FMMA 3PA4A 4AOTA 3CJGA 5FGKA 4ACDA 5ICGA 4IZ7A 2HMYB 3GRVA 2OXYA 3LFFA 3VIDA 2IP2A 5IMXA 3KN6A 3RNIA 2R0IA 4ZIMA 2UZBA 2PWYA 3IONA 2DULA 2UW5A 4CD0A 3OW4A 3I9FA 3KQQA 3O96A 2H1RA 1YI6A 3MB7A 5LVPA 3C6MA 3NTVA 4TWPA 3EN5A 3U6JA 4XG9A 2G71A 2HOGA 3AGLA 1VP3A 5KX8A 5M44A 3T7RA 4XBRA 3C9WA 3MTFA 3HCEA 3NR9A 4LL5A 5A9UA 2OB2A 3S00A 2WAJA 2PGXA 4LUDA 5DX8A 4O7RA 1GJOA 3RINA 4BKJA 3MHTA 1PMNA 3CP9A 4OGRA 1KPIA 4XG6A 3MGYA 5IA1A 3KCFA 4OQDA 4ALUA 4A9SA 3RK5A 2ZIFA 3CJQA 2C0TA 2XB7A 5AP0A 2IW8A 3ZRLA 2FCAA 4RGJA 2YWPA 3QD3A 2ZV8A 3VS2A 5CVGA 4S30A 2EX4A 3KHKA 3AC5A 4PYMA 2OH4A 3A60A 5FQDC 5J95A 1W84A 1Y6AA 2WTWA 5AV2A 1O9GA 3C3YA 4LQMA 3R1YA 3ZBFA 4BGQA 4CKJA 5JKGA 4ZSLA 4NT4A 2C6MA 4ANBA 1Q99A 3SRVA 4FT3A 5BNJA 1WBWA 1FGIA 3R6TA 5EHOA 4PWYA 3I5NA 4WNOA 4RC2A 4Q5EA 3OEFX 3ZHPC 1J1BA 3VBTA 1ZY4A 5EHYA 3W18A 3RHXA 4IW0A 3E92A 5CEIA 4K2RA 4RQKA 3VS1A 2QG7A 5FADA 2B4SB 3ODYX 3M70A 1R39A 1NV8A 3G89A 2O57A 3PP0A 2YCSA 3NS9A 1B38A 5F2NA 5IQEA 4CKIA 2DWBA 4ZMFA 4EI4A 3PTGA 2R3LA 3MVHA 4I23A 4NKAA 2AYPA 3MERA 3MH1A 1FINA 3NW5A 4GIIA 1CKJA 2C3KA 3QYZA 4FOBA 4H1MA 2R3PA 3UVPA 1VQ1A 3KQWA 2UYHA 4BTMA 4KIQA 4O0WA 5EH0A 2B7AA 3V3VA 2UZTA 3RJCA 4J71A 4M12A 3KR0A 3LHDA 3QRKA 5HU3A 5LXMA 4ACHA 3UBDA 4ASZA 4CWAA 2LGCA 2ONLC 3UO5A 2UW0A 5FRIA 5HBEA 3SLSA 4AE9A 4E5AX 4RVKA 3AY0A 4FOCA 3PFGA 4Z55A 4OTDA 3KQPA 4BGHA 4IC7A 3QRJA 3BT7A 1ORHA 5LOHA 1UKHA 4FSYA 5L6WL 4LWPA 3PWYA 1G55A 3HRCA 4D0WA 5A4QA 4IVAA 5F95A 5E8UA 5CI6A 5DFPA 3TZ7A 1XTPA 1WVWA 2XJ0A 4CMTA 2JBOA 3OT8A 4ZTBA 4ZSGA 3GCUA 1MP8A 3GFEA 3TI1A 3FPEA 5FTWA 5EDPA 4FZFB 4Q2AA 2ITOA 3R2BA 1UU3A 3DU8A 2YCRA 2YXLA 4XS2A 4OTGA 2BR3A 3BELA 4S31A 4HTFA 5CTPA 1VP9A 2XKCA 4HVIA 4BDJA 5CS6A 4JDHA 3ZRKA 3LMHA 1D2HA 2IVUA 4QQ5A 1YWNA 2X6DA 5ETFA 1W8CA 2P4IA 1BI8A 3LXNA 5FLFA 2PXCA 4OTHA 3UJGA 5F94A 5B7VA 3IYLW 3Q87B 5K9IA 3I6UA 3GXOA 4R3PA 3FPQA 3GU3A 3W1FA 3CKWA 5G02A 3SDJA 4EKLA 2XNPA 3NAYA 2IGTA 2F49A 3F5GA 4FIHA 3E87A 3RPYA 10MHA 3F5XA 2NXCA 2I40A 4D5HA 4ZTQA 5I9UA 2GNIA 5DT4A 5AP2A 1VJYA 1SM2A 3NUPA 3QTWA 4MD7E 2PMOX 3PVUA 2B52A 4L8MA 3IGGA 4NU1A 1XH4A 4M67A 4E7WA 5HTCA 4YUXA 4DTKA 5CM2Z 3NYNA 3IGOA 1H01A 2GU8A 3KPUA 2OI4X 3KR2A 2P2HA 4I4FA 4WT6A 3NDIA 4BZNA 4B4LA 1UVRA 4H1JA 5TOZA 5IQCA 3F5UA 3DR5A 4KWCA 2JIVA 4IFGA 1DAWA 4FZAB 4DGMA 1PKGA 2HY0A 3NUUA 4M3QA 4QMLA 4JAIA 3DAEA 2XK3A 5EFQA 5FDXA 3TKHA 3ZEPA 1OGUA 3OCJA 3DDQA 2B2CA 1PY5A 3E64A 3BV2A 4FVQA 4RQVA 5E8SA 3D5WA 3L8PA 1GZ8A 2BTSA 3GEQA 2NO3A 3TDVA 4YPDA 5L3AA 3KPJA 5LQKA 3LJ2A 4O83A 3RM6A 1EAMA 5E1EA 3RM7A 3WIGA 5AM6A 4HGZA 4BHZA 1YOMA 4I5MA 3RGFA 2UW3A 5GOZA 1LEZA 3AC2A 3G2MA 3KVXA 4B6LA 3G2OA 4E1ZA 5C27A 5T6BA 4ENXA 4HVDA 4RVDA 5C8MA 1Y91A 5HVYA 1JQDA 3HKOA 2QYOA 3OXIA 3Q6UA 4DCAA 3LFDA 4FT0A 4RLLA 1H1DA 2R4BA 4DH7A 4BICA 4CTBA 4A4XA 2C47A 2KW5A 3MI9A 3COHA 2DUVA 3G9LX 3ZLWA 3HCAA 3OE5A 4FIEA 3VVHA 3BGVA 2WQBA 4I6HA 3ME5A 3EIDA 3ZOSA 4CFXA 5FXRA 4QDKA 1KE6A 2HENA 4KB8A 5JZJA 3DNEA 4ZS4A 3QGYA 3TG1A 4E4NA 1ZHFA 2V74B 1I09A 3A4OX 4YZBA 1WVYA 1K9AA 3NPCA 4DT8A 2P7HA 4ER6A 5EG3A 3KQ7A 4IX5A 1YXTA 3R8ZA 4AA5A 4GRBA 3FSFA 2JG3A 4XG4A 5HG7A 1XKKA 3NYXA 3MTEA 2Z60A 2VO3A 3LXKA 3U81A 3NEWA 3UWPA 2HY81 4D4VA 4RTMA 1WBVA 2CGUA 1GZOA 3R0TA 4CEGA 2XYQA 4GOMD 1G6Q1 4GFGA 3Q60A 4P2KA 4DTBA 2IWIA 4V05A 5C0OE 1XH7A 3FKNA 4BCPA 2QOOA 4XNEA 1JTFA 4L52A 1PXPA 4DH1A 1JPAA 5E8JA 2WMTA 3R73A 5EQEA 3SQQA 4G17A 4PONA 3DKGA 3QD4A 4JBPA 4YO6A 4AGWA 1D2CA 1J7UA 4M69B 5D7AA 1PW2A 3C4ZA 3RHKA 3TTIA 1VBFA 4OT5A 3C7QA 1AF7A 2PWLA 4E4LA 2HTEA 3AXTA 4GOND 4I5CA 4DFBA 3TIZA 5DWRA 1HCKA 2VZ9A 4QMNA 2GH1A 3CGFA 3AWIA 3IW4A 3NIZA 1GAGA 2YITA 3LW0A 3HA3A 4IX3A 3F6XA 3UZUA 3FLZA 2IH5A 5KNJA 3HL7A 4BI0A 5BP7A 3FQSA 2X7OA 1XBCA 4FYNA 4XX9A 4CKCA 3VUIA 2R3GA 4L7SA 2YDKA 5JZNA 4O22A 3I0OA 3UC3A 3WYYA 2VDWA 4EOJA 4KUJA 2O0UA 3D7TB 4LRMA 4O38A 5HKMA 1OL6A 2BCJA 2W1HA 2Z8CA 5J8IA 4BDKA 4RTOA 4IM2A 2WK1A 1WXWA 2PVHA 2IDJA 3UIBA 4PCAA 1ZGAA 3QHRA 5B0XA 1EQAA 2W17A 2QR7A 2ZYBA 4JT3A 5CXHA 3V04A 5EI2A 4F86A 3UQFA 1PXIA 4WUNA 3ZMMA 2E2BA 4P7GA 3MJ2A 4DGGA 1WY7A 1TW2A 5AWMA 3R7UA 3GU6A 5IEYA 3T7TA 4CGAA 4CFWA 3D94A 4NK9A 5EMJA 4O7YA 5HESA 4GF5A 3FPFA 1UA2A 2QD9A 3L8VA 2QR8A 2QLQA 4RLKA 2XBAA 3F7ZA 5CQUA 3R9OA 3CLYA 4PX6A 2ERCA 3C3PA 3GU5A 3QCSA 3QKLA 2OLCA 4OLIA 3NYVA 3RPOA 4KKGA 3KR1A 1NW8A 3T0IA 3NX8A 4RVGA 1W0XC 3TN8A 2R0UA 4MVFA 5CU2A 3FKOA 3VBXA 4QYEA 5IQGA 1YUBA 3EGEA 3TLJA 3IOPA 4QYHA 3TCPA 4U8ZA 3FE3A 2O3PA 3DXYA 1ZMVA 3JS2A 4AACA 3LJ1A 3V8SA 3TKIA 4YZNA 2VO7A 2WOTA 2VX1A 2XNMA 5GNKA 3HMIA 1OIRA 3MPAA 2BRBA 4FEQA 3AG9A 5C1QB 4QQJA 5BMMA 2P35A 4PGGA 3DUWA 5ANGA 2YXEA 3CTHA 2F7XE 3HA6A 5EIFA 3NLBA 8MHTA 3AT2A 4MXZA 3ELJA 1PXNA 3UNJA 4BIEA 4F7LA 5AA8A 1E1VA 2QY6A 3VS7A 4KD1A 1CKPA 3R9RA 4GCJA 1OL1A 2BKZA 4FR0A 4K9YA 4L45A 5B2KA 2ITPA 3KF4A 4AN3A 5KBRA 3BGZA 3DXPA 4PMMA 2JD5A 4FKVA
chains in the Genus database with same CATH superfamily
3OWPA 2C2HA 4U3YA 1C1DA 5KO2A 3PNPA 3HFJA 3CLTD 4BTEA 3VC2A 3RS3A 3UMXA 2A5LA 1EFPB 3GRCA 3SJAA 1R0WA 4IDPA 4DR1B 5TMPA 2PMWB 4G0XA 4GPAA 2EBWA 1YR9A 1CKEA 3BHIA 2R64A 2WVJA 1FNSA 5EYCA 3A6EA 3V01A 3PVBA 2VWWA 4Z4HA 1KQPA 2IVZA 1OPRA 2G83A 1I7PA 2H2AA 4FNAA 1DOZA 4ZOLB 3NCTA 3EDRA 5C53B 1PAUA 3ZHOA 2NOAA 4KGDA 4LV5B 1OUYA 3TZ9A 5TC4A 2Z5FA 2B0QA 2G4CA 4RVOA 7MHTA 4TZ0A 2D0OB 1Y34E 3ITDA 4K9KA 5IUJC 2NYAA 2BMJA 4PQYA 1G6HA 1YQJA 3L06A 3EMKA 2C2OA 4XPIA 3VO3A 4FDUA 2BZSA 1R10A 1J2EA 5IA2A 2AL7A 5I7HA 1CZUA 2PNJA 1H07A 3N6RA 1VL0A 1XMPA 4UBOA 5LDDC 1WMKA 2OXDA 2W0SA 2XK6A 3NVAA 1M1UA 4JL9A 3RRMA 3V6SA 2Q8NA 2KLHA 5DI9A 2XIQA 4X61A 1T2FA 4ZYUA 1G3IA 2VTRA 2GDJA 1PFWA 5H0IA 4LBVA 4NE9A 1QKKA 5TGTA 3U13A 4I93A 4YMJA 1V7PC 4YCDA 1E4VA 2JHCA 3UPZA 1V5EA 1CR2A 3EIXA 3EKKA 4JUDX 4IIEA 3VQTA 3INRA 5DR2A 1MRYA 1QGUB 4M55A 1C41A 5I8PA 5EOLA 4AG5A 2BJWA 2D00A 3I9NA 2X5KO 3OX3A 4R3UC 5IN5A 3OEED 5BW8A 4JSYA 3PZBA 2NZYA 4FNGA 4C6RA 3AUAA 3FHOA 1U8CB 4EI2A 2Q0XA 3S68A 2QLTA 1JLMA 4E08A 1IHUA 1FNNA 2GJSA 5HKOA 1YVPA 5C8YB 1IHXA 3U4IA 1TCUA 4EZEA 4PO9A 4CKWA 3GLHB 4GICA 2WIJA 1MDBA 3OJXA 3A04A 3V34A 1TU0A 3IVMA 3V8PA 4FMDB 3EY4A 4G5OA 1L5MA 3P2JA 4DCGA 3DOUA 4QECA 4BFTA 3KK8A 3I0NA 5A5VA 1U7HA 2C69A 1QVZA 3DOIA 3OC0A 4NU0A 3O26A 3GARA 3WVNA 2QL9A 2EARA 2QMEA 3P78A 3DPUA 3BKBA 2X4DA 2C31A 4CFMA 2F2TA 4PLVA 3ORIA 3RMFA 4BDGA 1Z0DA 5MFZA 4YAGA 2VTPA 4BYJA 3HJAA 4AGDA 4BQFA 2C03A 2JKYA 2CJWB 3U19A 2I2WA 4JENA 5AVOA 5F5NA 4IUDS 3W8EA 1TIKA 4F4UA 1FOEB 5CPFA 5AUZA 4X7MA 1LDEA 4E4XA 3A4NA 3TXAA 2B1JA 1R1DA 2CSUA 2IZSA 1S1MA 4Z2AA 2FH9A 6Q21A 4YAIA 2JJMA 1SZCA 3ZY3A 2ETKA 4PAQA 3QX7A 5CXZA 2IOFA 3V8QA 4L42A 1FLVA 4FE7A 4ZO7A 4IS3A 3PGKA 1GTMA 2OFFA 1IHDA 4FHDA 3N8IA 1JQ5A 1J2RA 1PNRA 4B76A 1VLMA 2BFCA 4DYVA 4ALVA 2J3DA 4AECA 2J7PD 2PHZA 3MVMA 4M1QA 3UW3A 1U2SA 2X8JA 1PFYA 3LCCA 3I6BA 4QNYA 4YYZA 3EVGA 3D9VA 2R2PA 3TIFA 4XJVA 3HWX1 3BYUA 4ZSAA 2EXCX 2WNTA 2CBGA 1Q7RA 3Q40A 3MD9A 1ZAOA 3IQEA 5E91A 3K3PA 3HECA 1GAWA 3GNSA 1KPHA 3UVQA 5ED0A 3B60A 5ALGA 4PYNA 4HQOA 2QAGC 5AW0A 4Y7DA 3PYYA 4M9RA 2GRAA 3W0NA 4MR9A 5CNOA 1H5NA 1SBNE 2WT4A 2HFJA 1YS7A 1KR2A 2Q29A 3WGQA 2AB0A 3DEHA 5CTJA 4UHKA 2B34A 1W5FA 2XCUA 4BX0A 4P4SB 4CQLA 5JAMA 4YJHB 2JJ1A 1UP4A 3CC6A 1VSQA 1SG0A 3FMKA 1T1SA 2YHSA 2WQ7A 4FKIA 4PXSA 2R9VA 4TWCA 3QW4B 3SK0A 4I6BA 2UYCA 3P45A 4X20A 2RHDA 5LCXA 2JCGA 4DHIB 4XVCA 3CPJB 4XLLA 1GEEA 3HKEB 1R0ZA 5DOVA 4P3XA 1DQSA 5KKRC 3I30X 2KX7A 2I7XA 5JS2A 1GXSB 4EBWA 4HAOA 1WPQA 3PDWA 1IK4A 2LIPA 2VI5A 5TEVA 3ENKA 1BQ4A 2JJQA 3L8EA 2C0IA 3KQLA 5DGTA 2RAFA 1M8KA 4EJMA 2JHPA 3U3JA 4M9SA 3GH3A 4KPUB 3R71A 4NH1A 2VTDA 3WMEA 1YDEA 4YK7A 3TNJA 3T3GA 5CM9C 4U39A 4QPPA 4AK9A 4XV1A 3NC0C 3EB9A 4CLRB 621PA 5C35A 3GLIB 4B48A 4HX5A 1MV5A 3PTLA 2N9UA 4P32A 1B43A 2G06A 3ET7A 8GPBA 4ZLZA 5GQSA 3GRFA 4UE3S 2YV2A 1DP4A 1L5GB 3EDOA 4XUFA 1XA4A 1Z6AA 3UAVA 2RGUA 3KPYA 3BXGA 1U1GA 1D2MA 5HZNA 4RPKA 1K3AA 3OURA 3HBFA 1MQ9A 2SBTA 2DOKA 2PA3A 3FYHA 4CFUA 4JCCA 1I4WA 2P2IA 3X0DA 4XTCS 2Q4EA 3SLGA 3HR8A 1U7DA 5H80A 2ISCA 1N7JA 2QRVB 3EAGA 3DE1X 3AGQA 1F0KA 3TYXA 2FNAA 4HAWA 1XDBA 5F20A 4CI0B 3SZMA 5TT1A 4KE6A 1X39A 1UXOA 2QZSA 3SIRA 1CDZA 3VKVA 3ZDZB 2F1RA 1GZDA 3ESAA 4IIDA 4EZBA 1A48A 3AJAA 2BISA 4ZFNA 4DR4B 3ROZA 3AG5A 1KS2A 3TJCA 1NR7A 2QF7A 1AY0A 3G5MA 4FLMA 1NMXA 3WYXA 3SG9A 1AOXA 2FETA 4MS3B 4X6YA 4Z7HA 4II7A 3WKBA 3UANA 2PBLA 2FX2A 3A9UA 2PGIA 4XXHA 2PMFA 1P18A 4KPGA 4KQ9A 3ANLA 3GC9A 5FX2A 1QRTA 5HQ0A 2GN9A 4J4TA 3QTQA 4YNEA 1P2AA 4CM6A 1T6YA 2UVYA 2GCIA 1P9WA 3VTZA 1QTRA 4B6PA 3IUEA 4G31A 3UUWA 5AK4A 5CAOA 3NBFA 2XQFA 1X15A 3J81A 4JJFA 4AM8A 1IOWA 1SOAA 2BKEA 2PZKA 5LWQA 5LMCA 3WF5A 5ETIA 1OYOA 1XI2A 4MYRA 3P7CA 3JXWA 5FOWA 5KYVA 3HY3A 3KXKA 1W47A 3VFDA 3BE5A 1Q91A 3P8ZA 1MJFA 3LW7A 4GT5A 1RZRD 3R7AA 2PRZA 3IOYA 2C1EA 4QYGA 5ALHA 1OI7A 3WQHA 4BC0A 1MGPA 4MXDA 4AT5A 4OIFA 1LBIA 4NLLA 3ZWCA 2IYQA 3DCJA 2CFSA 3OUUA 5LL6P 3RARA 4B0PA 3L7LA 2CNWD 4I9HA 5F64A 3RKSA 2GVDC 4BV2A 2JFGA 2XVDA 3WTBA 5C18A 3QX4A 2GS2A 5ETAA 2GS9A 4YEDA 3KQOA 4ZJZA 3QQ5A 1M6WA 3IW8A 1KU6A 3FHCB 3U8WA 2VHJA 3NHYA 3G79A 2P33A 4Z3VA 1J7LA 3TEJA 3JD0A 3HGMA 1JHOA 1J0DA 3CZ9A 3TZCA 4AZEA 2HO4A 4TMVA 2WW8A 4K6MA 1EDBA 4RZUA 4G0YA 4KHPB 2HMUA 5KIAA 4FX5A 2B94A 4E8AA 5J1TB 1XBAA 3CH6A 1K66A 5LA6B 1OVEA 2J0EA 2VO6A 4APCA 5CSXA 2GSWA 4LZLA 2G09A 1KXZA 1Q11A 3T4PA 1E9SA 3ZD8A 2XDQA 1R3DA 1DMSA 5LP6F 2WICA 4F4JA 5EDQA 3ILHA 4YMUA 3LFEA 4GFOA 3R77A 4COKA 3WV5A 1E99A 4QFCA 2I22A 1DQZA 1W5BA 2MTBA 2VWVA 4YY3B 4AE6A 3RBZA 2WM8A 2JW5A 3ZZ0A 1FFCA 3FD8A 4XVQA 1OXKB 4J0HA 4KVFA 1M6NA 1NW1A 1ESEA 2FJUA 5EKXA 1E8NA 4EEKA 3W06A 4LHXA 1Z0ZA 2Z2WA 4MYUA 3H4TA 3D6MA 3UATA 2HQ1A 1UKEA 2VHXA 4USEA 1F2DA 1L8QA 1WUKS 4LHZA 1JG6A 2RGBA 4QTAA 4P3PA 4P92A 4ISBA 3SSOA 1I3NA 4J90A 4YBZA 4FBLA 4AUKA 5A02A 2ZRLA 5KJFA 2XYGA 2AC2A 3Q8MA 2DT5A 3T52A 3OZSA 3A99A 3K9HA 3QWAA 3PPWA 4AX4A 3H99A 1JDZA 4DGLC 3DB6A 4MUAA 1VKHA 1WPGA 4BCQA 1HR0B 1TJPB 1EIWA 2G2HA 2EKBA 4IG4A 1EB8A 1WA5A 1DAFA 3V1TC 1PFUA 5DTIA 1G18A 4Z9YA 5LVOA 2BTQA 1Q92A 1RM5A 5TT0A 1Q22A 1TU3A 2B54A 4IICA 2HDNB 1BW9A 5GJCA 4JASB 2GHQA 3IAHA 4XHKB 5DE3A 121PA 4KI7A 4MNFA 2JI6A 1FTSA 1FXUA 4GPD1 2A3NA 4X7PA 4KQMA 3H8SA 3JD1A 2P9BA 2JFXA 4J0GA 2CXSA 3FI0A 2PY3A 5BWCA 1GGVA 3KZKA 4KLRA 3NWWA 5KNBH 1KI6A 4YGYA 1XL0A 2VN9A 2GEKA 4CKXA 4RK7A 4QXPA 4YP0A 2YJTD 1NVEA 2DKFA 1F5NA 3EVTA 5TPZA 4K03A 1WDWB 2OFXA 1DB3A 2PKYX 4NMHA 4V03A 1V7QA 5IT9A 4P7FA 5BNZA 3PE1A 4CCUA 1AKRA 3MJVA 3KOMA 4NYIQ 3R1SA 3A1UA 1UADA 2H1SA 3LUBA 5AHRA 5IBCA 1MNQA 4NU8X 4OOFA 3OEEA 1VJ0A 1ZD4A 3ZHCA 2WE7A 1JFVA 2CGEA 4C4RA 3X1YA 4PMTA 4EK5A 3P52A 5BWLA 2YYSA 2XOKA 4KN9S 2R00C 4PZCA 3TOSA 1JLUE 4O27B 3TL8A 4LDJA 2XCKA 2HT6A 1PL0A 2PUCA 3TLYA 3F4BA 4D9IA 3RI3A 3KOWA 4DDIA 2QSUA 3L41A 3LK6A 2FSPA 5BV3A 4MA5A 5JD3A 4EDHA 4QUGA 2VTBB 2Q45A 5FDFA 2MSNA 1NR5A 4D1ZA 1O03A 3F5QA 2XCTB 2W06A 2QX9A 2WG1A 4QARA 4EHGA 1CJMA 3EQ9A 1XQYA 4C06A 1BFUA 1NQTA 3NJRA 3IVRA 1HY3A 4LYGA 3MA6A 2PIAA 4Z3OA 5FTQA 4AMBA 3HCWA 4AQKA 4CTKA 4C58A 5JXIA 2AQHA 1NUSA 2ID8A 2YJSA 3GJQA 5CTAA 1QYCA 3DLAA 3CONA 4M9ZA 3BE2A 3SEQA 4F6LA 4BP9A 1XLWA 3QEMA 5FEQA 2NIPA 4BZXA 4XJSA 2V7BA 3NC1C 2CL6X 3KCQA 4KWPA 3NO4A 4LMPA 4JA0A 1T1JA 1GU7A 5IKEA 2YERA 2B2XA 2CSNA 1PUIA 2H2IA 4BHNA 5DT9A 1L5OA 1ILWA 1U3UA 4KVGA 2W71A 5CPBA 3JQRA 4KQCA 2GN4A 3VO8A 2EHDA 3QZIA 4ZO9A 3O50A 3TIIA 1N8TA 5FA8A 1GR0A 4CNBA 4GT3A 4U43A 4B31A 2Z56A 2HZ7A 2EZ9A 2NNLD 1QQBA 3GEMA 3DOHA 5EEGA 2WKSA 2BDUA 4RCVA 1QU2A 1YOLA 2JATA 2PV7A 3BDAA 5IJZA 4PUZA 4OLBA 4ZJVA 4UULA 4X6UA 2R25B 1YQDA 2VBGA 4FEUA 1HK7A 2XGMA 1SQ6A 2FE4A 2COUA 1A9PA 4D9TA 2FUMA 4UNNA 1HE2A 5CENA 3DCNA 4U44A 3PRIA 1DCKA 2G6BA 3MRSA 3SQXA 1N2IA 5DI1A 4A03A 3LPBA 3OAAD 1ISMA 5DM4A 3PD0A 2J9RA 1W4AA 3IXQA 2JL1A 5CU6A 4ARUA 5CVFA 3AIIA 3FDZA 2ZV7A 1ND5A 3FPHA 4H7FA 4MMZB 3PJEA 1C9YA 1F20A 3P0FA 3ND7A 5T57A 2IZ5A 3T5CA 3WILA 2YBDA 3WZKA 4P3NA 3W5AA 4HQLA 2HJVA 3LNTA 4MV7A 3OTOB 1PT6A 1A0OA 3MA3A 2XF2A 2WHEA 1GYQA 4C0BA 4UHJA 1UT8A 5SY9A 3MGAA 5HK8A 5FQNA 4IHPA 2OD7A 4FXPA 1DC5A 3VNUA 4PHTA 1X86B 5L2SA 3R7IA 2GCGA 5HJ2A 2VHCA 3LE8A 2VNAA 3W2QA 5K6RA 1M0SA 3UUGA 1E1NA 1Y37A 1U0OC 2JFZA 1GU0A 4L5JA 1MT3A 3Q9LA 3F9IA 1GT91 4CBVA 5J3JA 1KAOA