3ID6C

Crystal structure of sulfolobus solfataricus nop5 (1-262) and fibrillarin complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
227
structure length
220
Chain Sequence
b'ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre mRNA splicing protein
molecule tags Transferase
source organism Sulfolobus solfataricus
publication title Structural organization of box C/D RNA-guided RNA methyltransferase.
pubmed doi rcsb
total genus 58
structure length 220
sequence length 227
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3id6C01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3id6C02
3G9LX 2JD5A 3I9FA 2X6EA 1MJFA 2GQSA 4AOJA 3DULA 2WO6A 3A2CA 3Q32A 4APPA 1Y6AA 2ITWA 4KSQA 5IA2A 5I9YA 1Z9XA 3FMNA 5DEWA 2I1MA 2YIQA 4H1JA 5BVWA 1XBBA 4CFMA 2XK4A 3R7VA 4GW8A 4G6LA 3FL4A 1WBWA 4FSWA 4A7CA 5E8YA 2WOTA 4GQBA 3FSFA 3MFRA 4AUKA 4EOPA 3EZVA 4YUWA 4FTUA 3T8OA 4YC6A 4MBIA 5DOSA 4W8DA 1UA2A 2ERCA 2WMTA 5DSTA 5T64A 3ORTA 4WXHA 5HEZA 4GKIA 1VBFA 2NYUA 5K0LA 3BBTB 1PXMA 5DWQA 3A7GA 1NW8A 5F2KA 3LCDA 3BPRA 4A9TA 4QQKA 3FQHA 4JI9A 4D5HA 4PYLA 3LFAA 2FGIA 3HV6A 3AT3A 4F64A 1NV9A 3LPBA 4IACA 4O91A 2YM7A 4AOIA 1PRYA 3ZEPA 4DCEA 1X19A 2OPBA 3I5UA 3QKKA 2P55A 3C7QA 3IDBA 4YJTA 3F3VA 4IDVA 2BH2A 3C5IA 5AUZA 4O29A 4QDJA 5DSXA 4QQ5A 2DPMA 4QP9A 4FZ6A 2RFSA 1YZHA 3GGDA 2OJIA 2W5HA 2BIYA 5ACBC 4DYMA 2I0HA 3DMGA 2IDKA 3TCPA 3HP5A 4PGGA 4O0SA 3RM6A 5LQJA 4D58A 4QP2A 2OG8A 3C3YA 4PYIA 5IUGA 5CZIA 1U54B 3KXXA 4R1YA 2AN5A 3VC2A 3R7EA 5JFXA 4RG0A 4M13A 4ERWA 3KQ7A 2GSFA 1VP9A 3C6KA 4O0VA 4EC9A 4LG1A 4CWAA 4R78A 5AP4A 2PUIA 4AGUA 1REJA 2GAFA 2NNWB 4B0GA 1L3CA 5DRYA 2BTRA 4XOZA 2VX0A 5FQNA 4AGDA 3ITZA 3OFMA 4S30A 2BMCA 3LFBA 1PF8A 4FI1A 4IX3A 2H6DA 1RJDA 1Q5KA 2HXLA 4G5JA 3IW8A 3O96A 4MH7A 3TKYA 4G3CA 3ENMA 3VO3A 2JFLA 4A9UA 4EUTA 3LDGA 3HVHA 4MNEA 2Z6AA 3BHUA 3CTQA 3H2BA 4KS8A 3FYKX 5HIMA 3A4TA 4QVKA 3UJCA 4O7WA 3NNUA 4RA4A 3P2EA 2VWZA 3I0QA 4WO5A 4TYHA 3R28A 2BR3A 1YZ3A 1H8FA 4O38A 4NIFB 4BCGA 1J3HA 1D2HA 2ONZA 5DI1A 4LL0A 1QPEA 4JDJA 3V5LA 2VTMA 5DXJA 4ZTSA 4HVGA 4PONA 4IHPA 3U4WA 4O6EA 1SVGA 3CVOA 4HGLA 3UVQA 4BBEA 3HMPA 4R3RA 4MXOA 3UJAA 4CLJA 2YXLA 1P1CA 3TG1A 2PSQA 4KDCA 4EHZA 4BDCA 4XG9A 1I44A 1OI9A 4FOBA 3CSVA 4E2YA 3A26A 1QYRA 5DLSA 4BDHA 5KCVA 2P3GX 3GEQA 3ZLXA 5CVEA 4KKEA 4DC2A 3HA8A 1DUSA 4KAOA 3T7SA 1I4WA 3WYYA 4MVFA 4HVDA 4RIXB 2W1CA 3U6JA 3R9HA 3UPXA 3HUBA 2O05A 2WK1A 1JSTA 3R22A 4HJOA 3S2PA 4ANSA 5DM0A 3GCSA 2XK7A 3T7RA 4RWZA 2QNJA 2I7CA 2HZ4A 1QAMA 4C4EA 1RI1A 1U5RA 3JUHA 3BE9A 3DK3A 3DAEA 2XYNA 4U80A 5ANKA 5G6VA 3RPSA 3V5WA 3WF9A 3BGIA 4GV1A 3DH0A 4R8SA 3LLTA 3PJ3A 5FUTA 4PX6A 4JBVA 5EYMA 2VTTA 3KMUA 4LG4A 4QMWA 2FK7A 5AP1A 3ZS5A 2XYVA 4POOA 3W2PA 2ZBPA 2IH5A 4BIDA 1R1WA 4U40A 5E1EA 3UG1A 4BF2A 3KXZA 3MQ2A 4YLLA 3EIDA 3FPFA 3AOXA 3I1AA 3OZTA 3IQ7A 4F7SA 3IV6A 5HEKA 3CC6A 3ENHA 4DINA 2UW7A 1YW2A 2GS7A 2HY81 2X8IA 3I79A 1N7JA 4E6DA 4KS7A 4AZFA 2XK3A 4EOLA 5C1QB 5LQUA 3G0FA 3KPYA 5EIWA 2PX2A 3JXWA 4HCTA 3CPCA 5DYJA 4BCQA 4EH8A 3AC3A 3GCVA 2X4FA 4YNEA 3KL8A 4FS8A 2V22A 2OBJA 3EKNA 4R5YA 4WG5A 4F9WA 3X0DA 1MRUA 3GQIA 2IVUA 3KCFA 4ENYA 4NWMA 2V7AA 4UWBA 3G15A 4FTTA 3OHTA 3ELJA 3EMBA 2Q41A 4EH9A 1HOWA 4XEYA 3QTIA 3TNWA 4E1ZA 3KR0A 4YZMA 5K4JA 4C4FA 2I9KA 2HELA 4YJOA 2QR7A 4Z55A 3EVFA 1WCCA 4BRXA 1U5QA 2XJ1A 3WF6A 3HVJA 4FKLA 2ZV8A 4ZY6A 3R9OA 2REIA 4AF3A 3QOWA 4FTAA 3L9NA 1ZMUA 4I6HA 4A9YA 5GM1A 3P7BA 3FYJX 4EK9A 2UZBA 4YUQA 3FPHA 5K5XA 2ZZKA 3UQCA 4DITA 4HYSA 2OXDA 5AP0A 3LW0A 5H8GA 1FPUA 1YI3A 4C02A 5DM1A 2GHLA 3CY2A 3GP0A 3FZRA 4O96A 10MHA 1H1RA 2PZYA 3OWJA 4HGSA 2C4GA 1JVPP 3IDCA 3BIZA 3BU5A 5H3QA 3C3PA 4EKGA 3N4VA 3DFCB 2JC6A 2X6DA 5HCZA 4AUAA 4F1MA 2RKUA 2BFXA 4ZLOA 5K9IA 4P58A 4FT3A 3UQGA 4AT5A 1JQ3A 2PXXA 3DR5A 3MS9A 2J0IA 3P7CA 4BBMA 2FYTA 5FQOA 5LVLA 3P86A 1UNHA 1Y8YA 4RJ6A 5EG3A 5EH0A 4XUFA 4HVIA 3EEYA 4IV0A 3HEGA 3HV7A 4FV6A 4UXQA 2EU9A 3G2OA 3TNIA 2Y4IC 3V5QA 4MCVA 5H8BA 4JRNA 2ZIEA 4OTRA 1NVRA 3ETAA 4FNZA 4RLLA 4L7VA 4LMUA 4R05A 1D2GA 4A4OA 5EMLA 3NIEA 4O82A 4CV8A 3IHTA 2WA2A 3OTUA 4WNPA 4IX4A 4JRVA 3JPVA 5A14A 3LFCA 2QI8A 3OBGA 4I92A 5CF5A 4PCLA 3TUDA 4Y30A 5J9YA 4BGQA 2XIXA 5DTQA 2AS0A 4M68A 4YZ9A 3GNIB 4G3DA 2CCHA 3L9LA 4YHJA 4O2PA 2W1HA 4MXZA 5E90A 4AACA 2C5VA 4CTBA 3G88A 5DXAA 4QMNA 4RX7A 1JQHA 3OE5A 1MP8A 3JR1A 4U43A 3NYVA 4X2GA 4ENXA 3KRJA 3O0GA 3K3IA 3V8WA 4HTFA 3FV8A 4Y2HA 4IVCA 1H00A 2ITNA 4I23A 5CVFA 1FINA 5E7RA 2YIXA 1ZYDA 2J50A 3OP5A 3QBNA 3R8ZA 3A7DA 4XCXA 5FGKA 4A4XA 3ATSA 3BLHA 4TYEA 4JT3A 1ZXEA 4KNBA 3ZHPC 3KXNA 2VTOA 5BUEA 4PMMA 2XBMA 4FE2A 5IQHA 4L67A 5EKUA 2I0YA 4H36A 4BVUA 4C37A 2VAGA 4K2RA 3R9DA 2XH5A 3VC1A 5HBEA 2YCRA 4QTUB 3O7LD 3QXOA 4FKRA 2J90A 4X0MA 4CEGA 5T6KA 1OL5A 4DH1A 1O6YA 2RF9A 3ID6C 3QXPA 4JL9A 1SMHA 1VYZA 5DX0A 1WMKA 4QMYA 4C4AA 2CKEA 5HO7A 4C4HA 2CGXA 2BAJA 4EOMA 1B42A 4KIGA 4WUNA 4Z7GA 4C34A 4KIFA 3POZA 3LM0A 3EVAA 3PVWA 4A6DA 4QNYA 3DOGA 3ER9A 3ZRLA 1M6YA 5JGAA 5IEYA 5JQ5A 1Q8YA 4G5PA 2R3LA 3G5TA 2C6KA 5GJGA 4O0RA 3EYGA 3MDYA 3UGCA 4N6YA 5EYKA 3PS9A 3I53A 3TPZA 3WZUA 5CF6A 2JH9A 5CVVA 3E5AA 2UZOA 2J6MA 3OU6A 2UW6A 4EKKA 5DR6A 2R5TA 3BWFA 4W4WA 2OKCA 4YJNA 2QOCA 2A0CX 1KPGA 2PWPA 4HZSA 4CRLA 3UBTA 1SNXA 3S00A 1PHKA 1ORHA 2X7OA 2WTKC 3H9OA 4MBLA 4QT1A 3FXZA 2ZWVA 5KZ0A 2C5NA 2R3FA 2A4LA 4HPTE 5AX9A 3TZ7A 4ACCA 2YERA 2I7QA 5CX9A 4C4GA 4P7GA 3ER8A 3OOGA 2YACA 2AN3A 3ZO1A 2IIPA 3NNWA 4ZIMA 4IV8A 4EHVA 2X7FA 1SUIA 1WFCA 2GS9A 4E93A 1NA7A 4LWOA 4RJ8A 3VBTA 3DXYA 1VZOA 2XKFA 4CXMA 4I4EA 3UP7A 1WXXA 2GA9A 1ZY5A 3BYVA 4EH7A 3F5GA 4G31A 3KREA 5D11A 4BCOA 4CFXA 1WY7A 1ZHFA 2P7IA 3A25A 2BKZA 2WMSA 3FXWA 4USFA 4J98A 4XX9A 4EWQA 4F6WA 4YUZA 2PUPA 4XV2A 5I0BA 1F38A 5CT0A 4PYKA 3BYMA 1K9AA 1WVWA 2YIRA 3RWQA 2HV9A 4E2XA 4GVJA 2YDIA 1UKHA 3BELA 4H1MA 3ERCA 2HZNA 5HNGA 3AXWA 1ZOEA 2EXCX 3DKGA 3IECA 4TNBA 3DK7A 4MHTA 5JQ8A 4BCFA 4PMSA 3PPJA 1L1EA 3ZZWA 4MYGA 3SLSA 1H0WA 4APCA 3WARA 3CD3A 3QU0A 2JITA 4F70A 2OYRA 2P1DA 3LSTA 4QMZA 5FEDA 5IMEA 1XXLA 4ZK5A 3UNJA 4NM0A 4CV9A 4TL0A 3BKXA 2YIWA 3SA0A 5IKMA 2NPQA 3DKCA 3DB6A 4FTMA 5KZIA 4F86A 1JKTA 2B9IA 2QOFA 4HZRA 3IEIA 1SG9A 5GIOE 4JDIA 4TTHB 4DH5A 1Q8ZA 3MH2A 4FOCA 1YOJA 4GK4A 1QAOA 2IH4A 4RC2A 4RTOA 4IB0A 2BUJA 2JDVA 4V0QA 1CM8A 4ZEGA 1VE3A 2C6TA 3MY0A 4GC5A 4BLWA 5AX3A 1QAQA 3L8SA 1O9HA 2JAVA 4QPAA 5CEIA 4QQNA 5DM2A 3AGMA 3ZSIA 3DLZA 2J4ZA 4P7JA 3QV2A 3GFEA 5AUUA 4L44A 3ALOA 3QRKA 4GS6A 5JFWA 4GH2A 3QL8A 1EAMA 4QP3A 5I9UA 4LM5A 1CDKA 5AUYA 1HNNA 3KPVA 3UJGA 2VZ6A 2RGPA 4U3ZA 5FUBA 4DFNA 4RJ4A 4RZWA 1PW2A 4NTTA 4A6EA 1RJEA 2XJ2A 3JY0A 4QQJA 4RMZA 3VQHA 4EK5A 4ASDA 2A14A 1WBPA 2LD4A 3ULZA 3KR1A 2WTIA 3MV5A 4HPUE 4ITJA 1JBPE 3DGKA 3QQLA 4UXLA 1UV5A 4D9TA 3HAVA 4DT9A 5AAGA 4CTCA 3EGEA 1A48A 5ITAA 1OPLA 3CGGA 2E9NA 3CKWA 5BUIA 5E9WA 3P9KA 4I1ZA 2YAAA 4EH3A 2R0UA 2H11A 3QZGA 4B99A 5BMMA 2XIZA 4EOOA 4O7ZA 2B54A 3BHTA 3DTCA 3QUEA 4O22A 3ELUA 4E2WA 4X6RA 3E8EA 4C0TA 1JSZA 3PA4A 4BDBA 4F6SA 2CNUA 4IAAA 3ORLA 5AP6A 3FZ1A 2OI4X 2P8JA 2QRVB 5AUWA 4G6NA 4QPSA 4ALWA 2C3IB 1XH6A 2G1TA 1YHVA 5HCXA 4I4FA 3AMBA 2Y1XA 3FKLA 2E9PA 4EH6A 5KHWA 4BLUA 1YFLA 3C4XA 1PJKA 4IMYA 1BX6A 2XKEA 2I6GA 4F6UA 3U51A 2GTNA 3V5PA 2R64A 3RAIA 3VUHA 1O54A 3B8QA 3H4JA 4TWCA 2B3TA 2ZULA 1UWVA 2UW5A 3Q53A 3RAHA 4YUXA 4XH6A 3C51A 4KIOA 3UZTA 3M42A 1K2PA 2XNBA 4ONAA 3NDIA 4KABA 1JKKA 3GIWA 2JKMA 2AC3A 3P9JA 3FPMA 4L3JA 2OICA 3Q2JA 3EFKA 4XUDA 4BGHA 4EI4A 4FA2A 1F5QA 1JTEA 4FSYA 1FOTA 5IDPA 5DBXA 3R0TA 5M4FA 4BN1A 2JDSA 5FLFA 2HW7A 3F3ZA 2OJGA 3PG3A 5EK7A 4IAKA 5LJJA 3OEZA 4LYNA 4NZWB 4BZOA 3V8SA 4ZSEA 4AW5A 3KN6A 4XMOA 2H8HA 3OMVA 2W1EA 4GYGA 5F94A 5J8IA 5LQNA 1FVVA 2EVAA 4ISCA 2UYCA 3FLSA 3O17A 3UP2A 3TI1A 3DOUA 4C06A 1ZZ2A 1SVHA 3CY3A 4FX3A 3O23A 4X3JA 3UJBA 3FMJA 1P91A 4QYGA 3KR2A 3CLYA 1MHTA 2Z8CA 5A46A 3DAJA 3M2WA 4PY1A 4JQ7A 4BDEA 3R0QA 2WU7A 3FJQE 4O7TA 4C59A 2XVDA 2A2AA 3KVWA 3FY2A 3BZBA 2PE0A 4JBQA 4GT5A 4IAYA 5F20A 2QE6A 3Q2MA 3FZOA 2B9JA 3LCKA 1SUSA 3O8TA 3N51A 4PP9A 1JQEA 2FUMA 1OITA 3B8RA 5CU4A 5CU6A 3EQHA 3B5IA 1PMEA 1PMNA 3OWKA 3ZFMA 2CKQA 3QRIA 2GLUA 3ET7A 5BVNA 4RV9A 2ETKA 3SD0A 3TR6A 4LV8A 4BTFA 4E6QA 2QURA 5CANA 2BR5A 3CPBA 4OTQA 5LVOA 4PINA 4RJ3A 3TV4A 3W2QA 3BU3A 2FSLX 5FTGA 4CKJA 3RW9A 1KUTA 3VBQA 1VR2A 4U79A 5EM7A 1AF7A 4RFYA 3G33A 4IVDA 4J52A 3BV2A 3ELYA 3TDVA 1ZWSA 2PX8A 4FIGA 5EMKA 2IVTA 3DJ5A 4ITHA 5DG5A 2ZIFA 3BX5A 3DBDA 1X1CA 3DMHA 2FA2A 2VDWA 2I0VA 4PL3A 3LJ1A 3E62A 4XYFA 2NRUA 3C0GA 1JKSA 1YWRA 2VX3A 4Q2AA 4RQKA 1G8AA 5KMMA 4HNIA 3UOLA 4ZZOA 3FKNA 1Z57A 2YHVA 4FR4A 4PYJA 2QQ7A 4NJ3A 1YHSA 4D0XA 4XV3A 4JR7A 4YURA 4QMLA 1GIHA 2PY3A 4AW0A 2IP2A 2R7BA 3I5NA 2X2MA 2IW6A 4H3QA 4JIKA 5LVMA 3V97A 5IQEA 5E1SA 5CVDA 2VWVA 4WRSA 4ER0A 4XUEA 5D1HA 2WU6A 5K01A 5DH3A 5JRSA 3Q7EA 3GXOA 2YDKA 2B9EA 3CD8A 2PSSA 3D5VA 4BP1A 3CGOA 3B89A 2A19B 2QOQA 3O50A 5J7HA 3C4ZA 3T0IA 4RTPA 3NUSA 1ZKDA 4Y85A 3LXKA 3EMDA 1JNKA 1IY9A 5CVGA 5GP1A 4D2RA 2C3KA 2ZDTA 4IANA 4M14A 5KS2A 4XV9A 3OWLA 5IEXA 3MHTA 3KA0A 1OUKA 5FTQA 2W0JA 2X39A 4RWKA 4EBWA 4YZBA 4ZSLA 4CD0A 1ATPE 2HY0A 4RC3A 5A4QA 3SXJA 4C08A 1MRYA 3QTZA 1KR5A 5EHIA 2V62A 1QL6A 4U7TB 5CSHA 2VWIA 4RVTA 3G6GA 3P78A 1L9KA 4IAZA 2F8LA 3E7VA 4ACGA 1PMUA 4BY9E 3NNXA 3ORXA 4MKCA 2P3QA 2Z6UA 4IBMA 4BLVA 5KVAA 2R3QA 3R21A 4O86A 3GU7A 5IF1A 1JKLA 3CS9A 5AAEA 1VLMA 5K05A 5JZNA 1GZ8A 3DNDA 5CAOA 1U59A 4U44A 5LQFA 2UYOA 3V6SA 4CTJA 5DM4A 4YUVA 4RIWB 2WMWA 4FKUA 4OTGA 5ICPA 2XIYA 3LGAA 2AC5A 3UJ6A 3R8LA 4BBFA 5LXMA 3NW6A 2NXJA 2GNLA 2ORED 4I22A 5M57A 4Y83A 3KK8A 5A6OA 1G38A 3R30A 1OGUA 4LOQA 3MB7A 5FP6A 4AZEA 5CAPA 5EMJA 2CGVA 1VP3A 3T3UA 5LCJA 5KNJA 4DHFA 4I93A 3ZLSA 3U6IA 1FGKA 2C3LA 3CGFA 2WTCA 2ZBQA 5HO8A 3NWBA 3P71T 5CVJA 3NWWA 2DWBA 4LL5A 2PMNX 5B2MA 4JDKA 1Q0TA 3NLBA 4OQEA 2QO7A 3PSDA 2JBPA 4QDKA 3QF9A 5CCBA 3IK3A 4RZVA 3T3VA 4Y72A 2O07A 2PE2A 5AA8A 4LRJA 4DBXA 2WQOA 3F7WA 4QYYA 2BIKB 4CMTA 4ZMFA 3VBYA 2EJUA 4RTSA 2UVYA 4TPTA 5E1BA 3MVMA 1IR3A 2F49A 4HGEA 4EOJA 1NW5A 4V0GB 3D2LA 2PULA 3OBJA 3FPQA 2X9EA 1Y8CA 5CM2Z 5EIFA 4FG8A 5EHLA 2Z6QA 3AC2A 1OL6A 4IJPA 2XEZA 1U46A 3WI6A 4X2JA 1GAGA 4QQCA 3LX6A 5FDXA 2IW9A 2HMYB 3NW5A 3Q6UA 4CQEA 3HCCA 3NTVA 4RTQA 1F0QA 3OCBA 4C3PA 2NP6A 2HOGA 3QA8A 2UZUE 3L8DA 3MCTA 5DLYA 5EPEA 2PVJA 2GDOA 3SC1A 3LPMA 2O5KA 4NSTA 2HWPA 5JT2A 4OW8A 3R6XA 4TYGA 2Q0NA 4BTKA 5CEOA 1BLXA 2BZJA 1GZKA 3VULA 1J91A 4YHFA 3H0ZA 4CZUA 5A9UA 4MQ1A 1Q41A 4ANMA 5KKRB 3WILA 4KKHA 5D10A 5L6WL 4CVAA 2V55A 3FYDA 3P8ZA 4HGTA 3OT3A 2YUIA 5IU2A 4FIHA 5E2BA 3W32A 1LPUA 3KPJA 5LQKA 4R7HA 3OZSA 2W96B 4V0RA 4GOND 4FTOA 1Q8WA 3A99A 3PY3A 3OD6X 3OC1A 2W4KA 4X3FC 2ZSUA 1AQ1A 1H1PA 3B3FA 3GU5A 3E7PA 4ASXA 2YCSA 4XRJA 4EVIA 1OL1A 3PFGA 3GXLA 5CNNA 4EOIA 3IYLW 1KV2A 1CSNA 1OPKA 3C4WA 3QRTA 2W1IA 4NU1A 3RMFA 2FPOA 2PL0A 4JIAA 2R3MA 4FEWA 1U54A 5C8MA 3C5UA 3DU8A 5I9XA 3BYOA 2W99B 3B2TA 1OIUA 2IPXA 3QRUA 3R04A 3VS0A 4BZNA 3GJYA 3OZ6A 4ZTRA 4NKSA 3UIUA 3NSZA 1YQJA 3TZMA 3VN9A 4CMUA 2CKOA 2ZMCA 2CDZA 1OIQA 1PYEA 3C6MA 3HCEA 4M12A 1YDRE 3TDWA 4RTLA 4DFYA 4LQMA 3FMLA 4HTFB 7MHTA 1W7HA 2QOBA 2XRUA 1RI3A 2W4OA 3OS3A 2O06A 1AV6A 4AA0A 2RL5A 4FSXA 3KXHA 4OA5A 3VVHA 5FWDA 5C0OE 3Q4TA 3DBCA 1FGIA 3TQSA 1OKZA 3CJQA 5EFQA 3W2OA 4BCJA 3PA3A 2R9SA 3NVKI 1EJ0A 3SXSA 4EQZA 1M2QA 3F88A 4IC8A 4ZJJA 4A9SA 1I1NA 4PYQA 1PY5A 3MN3A 1G8SA 4JOAA 4C03A 5E8WA 4PUZA 2XJ0A 4C3RA 3QCXA 3V5TA 4V05A 2QOIA 3OT8A 4C58A 3AY0A 4O7LA 4DGOA 3BWCA 1L8TA 2X8DA 3VUIA 3D9VA 5A4EA 4FP9A 5FULA 3D83A 3F6XA 2XK8A 2VGOA 4Z16A 4FL2A 4BCKA 2I62A 4IDTA 4XG6A 5FP5A 4CKCA 2XNOA 3V51A 3S0OA 1V0PA 1APME 3A8XA 3P4KA 1BKYA 3DS6A 1H25A 4PDPA 4Y73A 3TUBA 4HYIA 5HNIX 2AVNA 2KULA 4UZHA 4KW7A 1NW6A 2JKQA 3K2LA 3LIJA 3DPKA 4NFNA 3O8PA 1PKGA 2F9GA 5ETIA 4IZAA 4D1ZA 1S9JA 4G2FA 2G72A 4U3YA 2BRBA 3W8QA 3WF8A 5CSVA 5K0NA 4DCMA 3FUVA 5IH4A 5BUJA 4XG2A 3KRLA 4AA4A 3F61A 3KR9A 3SXRA 1NXKA 3DNEA 2IZTA 3TMAA 2GB4A 4HYUA 2X2LA 4AW2A 2WIPA 5IDNA 4EEVA 2O8YA 3QA0A 2JIIA 2PVFA 5J9ZA 3JWIA 4DEGA 1TPYA 4DEDA 5AEPA 5CSPA 2NXEA 4FT4A 1SQGA 1XJ5A 4KA3A 4TXCA 4FC0A 4RX8A 4C61A 3MTLA 4PNIA 1H01A 2ADMA 2QG5A 3G2MA 4FV1A 4DTBA 2QOOA 3EN9A 1F3LA 3UWPA 1I09A 5HTCA 2YN8A 4E4MA 4NL0A 2CGWA 2X7GA 3I0OA 4YPDA 4PDOA 2W7XA 5K5NA 3ZSHA 3W18A 4YTFA 4YGAA 2XA4A 3MESA 1ZYJA 3L9MA 2PVNA 4NYEA 5TR6A 4FSTA 3TIYA 3BGQA 1KPIA 2IN6A 1XDSA 3LKDA 2GNJA 3PLAE 1JLUE 3VHKA 3O7LB 4L43A 4H3PA 2NO3A 5CLPA 2CLQA 4BKJA 4NJDA 1FBNA 2PBFA 3SVZA 3HP2A 2Y9QA 4C2WA 4ACHA 4ZSJA 5CQWA 3C4CA 4FIFA 4WSYA 2LAVA 1KOBA 2JKKA 4DEIA 3C4FA 5K0FA 5C03A 3AMAA 3GOKA 4O7YA 1EJ6A 4HGYA 3OXTA 4O6LA 3NMUF 3L8XA 2NP8A 5GNKA 4DGNA 5B1SA 4DE4A 3R2BA 4MD7E 1G5SA 4PV0A 3TTJA 4L3LA 3DQXA 3SDJA 4EBVA 4Q5HA 3VIDA 3CQUA 3A62A 3PIYA 4YTHA 4S2ZA 3D4QA 3KMWA 3BCEA 4GFGA 3Q5ZA 2ITOA 3M6UA 2VTHA 3JVSA 1FP1D 1JSVA 1Q8TA 3GUBA 4FKOA 3GC0A 4QYHA 5IA4A 4EK6A 2OH4A 2PMIA 4FUYA 5IA1A 3MGGA 4F84A 3ZONA 1F3MC 2UUEA 1U4DA 3U8WA 3FTDA 2BROA 1RW8A 3ZRMA 4DLJA 2ZW9A 5K0EA 5ERGB 3BHYA 2W05A 3DKOA 3UBDA 3UQFA 5HIIA 2FSOX 2WQMA 3UJ8A 1SZMA 3TLJA 4BP3A 1JOWB 3OF0A 2P3OA 3ZYAA 3EQCA 2HYYA 5CALA 5BXYA 1DAYA 3QQHA 4FV2A 4PDSA 3THSA 4DQ0A 3SSOA 5EMMA 3P79A 4B17A 2O63A 5EI2A 4DZRA 4CFFA 2OZAB 5A54A 3OWPA 5EW8A 1KE9A 2RG5A 2OXYA 4A4LA 2R2PA 2UW8A 4RIYA 4R6WA 1FMKA 2GFCA 4CFNA 2Z7LA 5EKXA 5FRIA 5BVOA 3EVBA 3F5XA 4F0IA 3QQFA 3QQGA 3WE8A 5I9VA 1R78A 3EVGA 5EW3A 4Z9LA 2R3NA 3E64A 3R7IA 3TL8A 2NXCA 1KE5A 1ZY4A 1N2XA 2VDVE 3BGDA 3O4FA 2JHCA 1XJDA 4L52A 4R3PA 5A6NA 3C9WA 5A3XA 3KGAA 2IVSA 2GCDA 4OGRA 4ZS0A 3RNIA 3KMMA 5JZJA 4I24A 1ZMWA 4QMVA 1NW7A 2V74B 2YFXA 4FV3A 4B8MA 3HCFA 3O8UA 5CNOA 2PVHA 4WHZA 5AAFA 5CASA 3SX0A 3KQVA 3QKLA 4FEVA 2AYPA 4L68A 5EOBA 4KWCA 4ID7A 3U87A 3ZFYA 3DXNA 3PX3A 3LXNA 5DX1A 3BYSA 5AADA 3PXZA 3GCZA 3G90X 1E1XA 5E8SA 1Q62A 4MXYA 2PY6A 3RVGA 2PWLA 3HGKA 1Q99A 3RIEA 3NX8A 3Q3BA 1XQZA 3R8MA 3A4OX 4IX6A 3R71A 2QOHA 3G7UA 3L1SA 4O0WA 1M7NA 2IFTA 2BR1A 3LVPA 1DAWA 3MGYA 2IG7A 4PRJA 4RBLA 3NUAA 4JG7A 5HGIA 4QQTA 5HX6A 3OZRA 4FT2A 3GB2A 3A8WA 4C3FA 2PVRA 2WIHA 3ORKA 2UW4A 4M8TA 2VNWA 1OR8A 3CKKA 4K1BA 4FT7A 3S1HA 3VWAA 3ZCLA 4E33A 1W0XC 3THRA 3FPJA 4S34A 5K8VA 3JWGA 5KE0A 3I5ZA 5KMKA 3MIAA 3WYXA 5HVJA 3PPZA 4X61A 3U4UA 3KKVA 2OF2A 4RRVA 4XV1A 3EN5A 3NDMA 1PXJA 4QP1A 4WBOA 3WIGA 3ZC6A 4ORKA 2GNIA 2ETMA 4RTMA 4BDDA 2F2UA 3R63A 2ERKA 3UJ9A 1YWVA 1YXTA 4QMXA 5AV0A 1V1KA 4B8LA 4BI1A 2DULA 5IG1A 4GYIA 1KPHA 4XG8A 2PMOX 5I9ZA 2QODA 2EFJA 5CAQA 5MHTA 3PVBA 2PK9A 2YZLA 4MXCA 1A06A 2I6LA 3ERKA 3L8VA 4PTGA 4FBXA 5HICA 3RWPA 2YCFA 2HWOA 5HIBA 1WAKA 3QQUA 3UIMA 1P14A 1L3BA 4FUXA 4RWLA 3S4QA 4DTKA 3O31A 3MTIA 2BRMA 4LMNA 2JDRA 5JKGA 1VQ1A 3LFNA 2CKDA 2PGXA 3EGVA 4JDHA 3KU2A 3SXFA 1XVAA 5EZSA 4X3FA 3VS6A 5KMNA 3KB7A 1O6LA 3FMKA 4L6QA 4LGHA 4BDAA 2ITYA 4G3GA 4K33A 1NVSA 2F4JA 4HGZA 4HRAA 4JG6A 1Z3CA 4K77A 3T7TA 2DUVA 1PKDA 4AX8A 1KXZA 4O0UA 2JIVA 4GKHA 4YBJA 4CFUA 2G71A 1R74A 2OW3A 3PG1A 2IGTA 3TKHA 1VEBA 1U2ZA 5C26A 4K9YA 5EEHA 3R8PA 2GHGA 2UV2A 4FICA 5DEYA 4D4SA 4BCPA 4JX3A 4OT6A 3FQSA 5AMNA 2ZB1A 5DFPA 5ETCA 4RVKA 4QTDA 3QGYA 4LUDA 4IVAA 4O7SA 5BQ0A 4YPSA 5T68A 3KPWA 3DLCA 3PWYA 3NAYA 3F7ZA 2BZGA 3HA3A 4E32A 5EC8A 1G6Q1 5FBOA 1EG2A 3KQYA 2PUNA 2FCAA 5U4XA 2VWXA 3CBLA 2C69A 3CTHA 3G6HA 4LGGA 4TKSA 4YNOA 2B7AA 5HE2A 2PT6A 5E1OA 4EKIA 3DJ7A 4J71A 3EQGA 3NCGA 3D15A 2UZLA 3GENA 4OTFA 5ANGA 3ZM9A 5KMIA 1NW1A 2PX4A 5CVUA 5CU2A 5C9ZA 1OL7A 4X3FB 3UA3A 2OSCA 1YXVA 5IMXA 3ORMA 2QOKA 3O2MA 2VO3A 3TIZA 2HZ0A 4QTBA 2R3OA 2IZSA 4RIOA 4RGJA 4ZP5A 4QTCA 2PUUA 1B6CB 2BZKB 1MUOA 2XM8A 3HRCA 4GG7A 2XKDA 3FDNA 4FODA 3NUUA 5DPVA 3S95A 3C50A 2VTQA 4JNWA 2F2CB 4QP8A 5FA5A 2YM5A 4C4IA 3HDNA 3MPTA 2VZ9A 4QMUA 1PXLA 2JDOA 1S9IA 4F1TA 4IAIA 4F9AA 8MHTA 5HQ0A 5IUHA 2X81A 4IWNA 2NRYA 3GI3A 3HVIA 3N4TA 4RFZA 5D41A 2ZM4A 4QOXA 3RHXA 1BC5A 5I9WA 1CTPE 3ZO4A 3MFSA 4GG5A 4JXJA 3MERA 2BDWA 4BZDA 3FI8A 3PA5A 2W9ZB 3DQWA 1V0OA 3FEGA 3ZC5A 5ICCA 3SW7A 5AM7A 2ITUA 3EFJA 3Q5IA 4JLCA 3MTFA 4H39A 2C0TA 4ZLZA 3ZXZA 5ICFA 5D7VA 2VN9A 3UC3A 2WEIA 4Z2YA 1YB2A 3CJGA 4CFWA 3R7YA 4EHGA 4CG9A 5HOQA 2AOWA 3O51A 4XP2A 5M55A 3C4EA 4RWJA 5E2AA 2W1DA 3K54A 1WBVA 2J51A 3C13A 5IQDA 5IQFA 1G55A 3HVCA 3QFVA 2QKWB 5LVPA 3RPOA 3UE4A 4OQDA 9MHTA 4FGBA 3P9IA 5IA0A 4II5A 4JAJA 2XP2A 3E7OA 4BTJA 5L8JA 1XWSA 4E6AA 4ZLYA 3CJRA 2RFDA 5F2NA 3GGFA 4RVLA 1NBHA 3FI3A 3FYCA 5FEQA 3JWJA 4KDRA 2C5YA 3BHVA 4I5HA 1OKWA 2CNVA 3C0HA 5EKNA 3PSBA 4ER5A 2PT9A 3Q4ZA 4E4NA 5J5SA 4O84A 2XNEA 2R3HA 3EN6A 4B4LA 3R8VA 2GNFA 3MSSA 4F0FA 1PYXA 3HAMA 4PYNA 4JG8A 4J7BA 2RFEA 4U97A 3EVCA 3FBVA 3Q96A 5AIKA 5L8LA 5FADA 1KHHA 4P7FA 4F99A 2ZBRA 1DCTA 3KRRA 3MYGA 1GZNA 4NT4A 4FKQA 2VO7A 1A9UA 1T45A 4FTNA 4OBXA 3W16A 2GS6A 2Y4IB 3I6UA 5BYYA 1UVRA 2IVVA 4XP0A 2YIYA 2EWAA 2PU8A 4A9RA 3W10A 1AQJA 2HR1A 4ANBA 4MWHA 4ANQA 3IONA 5HG9A 3F5UA 1UU7A 4JJRA 1AQIA 2B1PA 4L42A 3P2KA 2C7QA 3DT1A 3A7FA 1UWJA 3LFDA 4GUEA 3WZDA 3F69A 4FIEA 5M51A 2ZTHA 2ZJWA 3EL8A 5EM8A 4AP7A 1H1DA 1UNLA 2VWYA 3E93A 4FV9A 3LKZA 1T43A 3F2NA 1ZLTA 4FZ7A 2VTIA 2YTZA 2CCIA 2WMRA 3VRZA 1WG8A 4IM0A 5FHRA 2OB2A 5EW9A 5FDPA 4MAOA 3Q6WA 4E4LA 4BGGA 4V04A 3ZTXA 3OCJA 2XBJA 5B2KA 3ORZA 3QD4A 4CXAA 2UZ4A 3NYOA 1RI2A 4Y8DA 3LFFA 3IOPA 5CAUA 1TQPA 2JFMA 1XH7A 2VTAA 2Y6MA 3DDPA 4R7BA 4A07A 5C1IA 4F4PA 3QOXA 4KWPA 4K6MA 2ZCJA 1JWHA 3MA6A 3DLSA 4D1SA 4I6QA 1RJGA 3CCFA 3RKBA 2ITPA 4RA5A 4G9RA 2OJFE 3R6TA 4HCVA 3QC9A 3GRUA 2OF4A 3UO5A 2Y6OA 2SRCA 3ZSGA 4E8AA 5E8TA 4IADA 1H07A 1RDQE 3AJDA 5C8NA 3UOJA 2X9FA 2ZZNA 1YFJA 4O7RA 5LOHA 4K18A 1LEZA 2CN5A 1IAHA 5IQIA 3KQMA 2B55A 3M70A 4FSQA 5CT7A 3NUYA 3ORHA 4X1OA 5HILA 3I81A 2JAMA 1ND4A 2QHNA 1L3IA 1R18A 2VX1A 4U5JA 2QYOA 2ZLBA 3KVXA 2YM6A 4EJNA 3GCPA 4BDGA 3FWQA 3P9CA 1BOOA 5FHQA 3UTOA 3RODA 1NKVA 4AOTA 3ELWA 1QMZA 5CSWA 5LSAA 3KFAA 3DCVA 5EDRA 4EK8A 3KQWA 4O27B 2YJSA 2I0EA 2Q83A 4PL5A 5HE3A 2E9OA 4F65A 4CT1A 4J95A 2B9HA 3IO7A 3HMIA 3A7JA 5DT4A 3EH9A 2R3IA 5CWZA 5EM5A 3ZU7A 4L00A 3FHIA 3GU6A 3SGCA 1G60A 4PCAA 5AM6A 1YXSA 4IWOA 4ARKA 3OY3A 4GUAA 4F1OA 5AFVA 4C04A 4G16A 3FZSA 4BR3A 4Y46A 4Q5EA 5E8VA 2RIOA 2W9FB 4U8ZA 1W98A 2WNTA 3VS1A 3PZEA 3FE3A 4E31A 1W84A 3TNHA 1H4LA 5L6OA 2UVZA 5IUIA 5EDQA 4M7IA 5CY3A 4ZS4A 2C6LA 3CEKA 4YJSA 5AA9A 3IGOA 2UZEA 2CMHA 1TW3A 3BI6A 3QUPA 4FL1A 4GU9A 5F1ZA 3EL7A 4BTMA 2NXNA 3UVPA 3FSKA 2BHHA 1XH4A 2R3RA 2P2HA 4FVQA 3HKOA 3N9XA 4QTEA 2WFYA 3G51A 3PVUA 1GY3A 4UWYA 1BI7A 4XS2A 4MQ2A 3ANRA 3RPYA 3VUDA 5L2IA 4BHNA 2FHPA 3UJ7A 4FV0A 1Y57A 1PMVA 3KEXA 5KBQA 5L2WA 1J7LA 1P1BA 2IBTA 2WMBA 3AQVA 3LAUA 3KRXA 1WS6A 2IDJA 3AWIA 2O65A 4RX9A 1H0VA 3UMXA 1TQIA 3LKMA 3IDPA 5K3YA 4BI2A 3PE2A 1YRPA 4EKLA 3CTJA 5E9EA 4D28A 5TOZA 5CTPA 4AW1A 3LE6A 4N4SA 3A60A 3F9NA 4TWPA 3KQSA 5EDPA 2C6IA 4JXFA 3WE4A 3LM5A 1OMWA 1OKVA 3NGAA 4E6CA 4EOSA 3SHEA 2C47A 4CCBA 4RSRA 4X6QC 4DEAA 1R6AA 3AC4A 5EEGA 3Q9ZA 4UB7A 4ZTHA 5ACKA 4PIPA 2QD9A 3AC5A 2FSTX 3BZ3A 5C8KA 3MFUA 4IH8A 3CBGA 3LZBA 1XBAA 2R3PA 2XS0A 1URCA 5FG8A 2BCJA 1KYWA 3R1YA 4XG7A 4F7LA 1RQQA 2B9FA 2PVCA 3LCVB 3EN7A 4G3EA 4YZCA 3U54A 3BEGA 3G5LA 3FZTA 3PTGA 4RPVA 3E8CA 3NJRA 4RVGA 2R3KA 4D4YA 4DT8A 3RK9A 3JWHA 2WA1A 4L53A 2AOTB 5FXQA 4GOOD 5HCYA 3OXZA 2OKRA 2WGJA 4PYOA 2HAKA 4OBQA 5CXHA 3HTXA 3ODZX 3E88A 3MWUA 3ZDUA 2ZM1A 3MPMA 4IWDA 3QKMA 3H3CA 3FLNC 4GIIA 1XDUA 3LJ0A 3UIXA 4AFJA 3MH3A 5K03A 3ALNA 5IEVA 3D7TB 4RYLA 1XH5A 4XBRA 5LWMA 4RVDA 3HM2A 2WTKB 3KXGA 3AC1A 4GFMA 1XH9A 1TVOA 5ANOA 4HH4A 2A1AB 5FA8A 1CKIA 5HNBA 3B3JA 1H24A 1YWNA 2ZVJA 2C6OA 2OXXA 5BW4A 3RINA 2OJJA 2WAJA 4RTJA 2EB3A 1L3RE 2OZOA 5IQCA 3OUKA 3WF7A 1SQFA 2CWWA 3UZPA 1IA8A 5M53A 2GU8A 4J97A 3KCKA 2BAQA 1R0PA 3U6HA 2FVDA 5HESA 2FK8A 4AZVA 3MH0A 5KBRA 2YR0A 4RTRA 3H30A 2QLQA 3HVKA 5HIJA 2ZV9A 4FNWA 4EOQA 4ZJVA 2AZTA 2DS1A 4M15A 2Z02A 2WEVA 5JRQA 1FVTA 2PMLX 3SG9A 3DY7A 4CT2A 2E5WA 4GOMD 2X0GA 3CKXA 3ORPA 1P4FA 2Y4PA 3Q9YA 4GEOA 3QALE 3KF7A 3QD2B 4U6RA 4D4VA 1WVYA 4UOEA 4OA8A 5BX0A 4K6ZA 3QTUA 3LMHA 4JAIA 3E05A 5HVKA 2VWWA 2OXTA 4FKTA 4ZJIA 5HG8A 2YAKA 5IQAA 2P33A 3C1XA 4JS8A 4RIYB 1OM1A 3R7OA 3RHKA 2YITA 1UNGA 1M2RA 4MHAA 4H58A 3ORIA 5DRBA 5C9CA 3A7EA 2OZAA 4LI5A 3DXZA 1RE8A 4FSDA 4NW5A 2OU7A 3SVVA 2HENA 3ROCA 4LOOA 2XF0A 3VS7A 3EQIA 4MWIA 4EK3A 1M7QA 3AG9A 4JQ8A 4YMHA 2ITQA 2PVMA 3R9RA 3K6RA 5DR9A 3ME5A 4BCIA 4AS0A 5ANEA 1OZ1A 4KD1A 5CSXA 3KULA 4V0GA 4B6LA 2GNGA 2OB1A 3KPUA 2C7OA 3PJCA 4IB1A 4YV1A 2PHKA 4IFGA 1WBTA 1STCE 3DA6A 3SAYA 3SW4A 4AN3A 5IZFA 4CKIA 1XO2B 3GRVA 5M08A 1MQBA 2QCSA 4ZZNA 2H96A 1VIDA 4U45A 4EJ7A 4E5WA 5KUPA 2OBFA 5E1MA 3T9IA 2GFSA 3BEAA 2WPAA 3E23A 4G56A 1JSXA 2PJDA 2BM9A 1UU3A 4IZYA 3W2SA 4F9BA 1UIRA 1SYKA 4IZ5A 4RSSA 4X41A 4GOLD 5DTRA 3FUPA 3GU4A 2WMAA 5HE0A 4NM3A 4NUSA 3R9NA 2ZAZA 3BYUA 3U9NA 1I9GA 3RTPA 3G5DA 5ETFA 1YF3A 3BLRA 5DT0A 1NE2A 5J87A 4G17A 4G9CA 1TW2A 2OO3A 4OTWA 3ZM4A 4QP7A 1AGWA 4WT6A 4YSMA 4FK6A 1SM2A 1E9HA 4NKAA 4O7NA 4WA9A 4JBOA 4RT7A 4YJVA 2AVDA 4BC6A 2IJMA 3PB3A 4MIKA 1V0BA 3QQKA 4ER3A 4J8MA 4M84A 2AOXA 3TRKA 5DIAA 5M06A 5HI2A 3KQOA 1OIRA 1DI9A 3MJ2A 2J5FA 2J0JA 2O2UA 4RIWA 1YVJA 3RCDA 4GEKA 4ERKA 3OROA 2B0QA 3VS3A 5H02A 5D12A 3SMQA 5IPJA 5JFVA 4MX9A 3Q52A 3CXWA 2HW6A 2BRGA 4GL9A 3HCDA 1IA9A 5BP7A 5KQRA 3R3HA 2B53A 3NPCA 4RC4A 2JH8A 5IQGA 3OTVA 3FUUA 3FUTA 5P8WA 5I5ZA 3TZ9A 4UWCA 4M3QA 4DEBA 3MTEA 5EQPA 5ANDA 3PTAA 1X1AA 1SVUA 3RAWA 4HC4A 5CEPA 3HV5A 3TXOA 3W55A 2CJMA 1IRKA 4CNHA 4F7NA 3NW9A 4MTAA 4GMYA 4FL3A 2YWVA 2H00A 3VSEA 2YZAA 3FQEA 1R00A 4OX9Y 5EHOA 4C33A 3IW6A 5K09A 2QO2A 3DK6A 3D5WA 1OPJA 3VNTA 2KW5A 1Q97A 4FMQA 3VJOA 2P3LA 1M14A 4M37A 4RTNA 3HMNA 4S31A 3SRVB 3UMWA 4QPNA 3NR9A 5CF8A 1DL5A 3QLGA 3F3TA 4YHTA 5BMSA 5KKRC 1ZZLA 4CCUA 2BM8A 3M6XA 5FTWA 4W4VA 4ACMA 4P4CA 3RALA 1NVQA 4GJ2A 5ICEA 3FPEA 5KX8A 3ZXTA 5EG5A 2JIUA 2UZDA 3QAME 5M4CA 3HA7A 3F3WA 3TNPC 1R39A 3UNZA 4WG4A 3BGPA 5LMKA 3LMIA 4AE6A 3O71A 2O57A 2QY6A 4IJ9A 3DAKA 4AFEA 5BPYA 5GWXA 1R3CA 5CEQA 3Q9WA 3TKIA 2PLWA 2XK9A 3HYHA 4ZTQA 2UW0A 2R0IA 5CU0A 5L3AA 3PY0A 5I4NA 4IWQA 4TW9A 4E2ZA 3EMGA 5AV2A 3U9CA 5E92A 2BILB 1ZQ9A 2QG7A 4FEXA 1T46A 1Y8GA 3E3BX 4WIHA 2E9UA 3ZUTA 2G70A 2C5XA 3FUWA 3P2IA 4I20A 5AP3A 3MVJA 4AWIA 3BKWA 3UOKA 4G6OA 4DG3E 4UEUA 5E1DA 1E1VA 1CKPA 2XK6A 3PY1A 3HA5A 3PFQA 3FTFA 1WBSA 3C0IA 5JSMA 3ANXA 4NW6A 4IE9A 3FKOA 1CKJA 2JDTA 4NM5A 3H9RA 4ANLA 3R2YA 4D5KA 3FLYA 4HNFA 3LCCA 1Q61A 3VF8A 2BVAA 4XLIA 3LMGA 3OCSA 4NH1A 4TT7A 5LCKA 3WZJA 5J9LA 1QPCA 4QMQA 4FTJA 4KB8A 3GO4A 2H1RA 2GH1A 2R3SA 2VTNA 3LCOA 1NBIA 2UZTA 5FXRA 3GRZA 1JG1A 3UODA 4EZ5A 3DZQA 2C6DA 2DQ7X 3DXPA 3IW4A 4YMJA 4RTKA 4YZDA 1M0EA 4ER7A 2OH0E 2AUHA 4RVHA 3NWEA 3G8BA 2PXAA 4Q9SA 5LQCA 5FBNC 2NP7A 3VC4A 4FV5A 4LFIA 4Y5HA 3I7CA 3PXFA 1Q3WA 5L2SA 4WRGA 5IISA 3SR4A 5CCXA 5ANIA 4ITIA 4C38A 4FSUA 1FPQA 4G1WA 4GUBA 4U0IA 3VRYA 1P39A 1VL5A 5HZMA 4FGRA 4FSZA 4BIBA 3BLQA 3NYXA 4PWYA 2KTYA 3D94A 4TWOA 1J7UA 5HTBA 3O7WA 5DWRA 4R77A 3VBVA 4QVGA 2LGCA 3BT7A 3EZRA 2RFNA 3COMA 2HTEA 4O0XA 3I64A 1OECA 2PZ5A 5AIRA 4HSGA 1QPJA 5M09A 3OCGA 4D2SA 4I0RA 4I3ZA 3E3PA 5EQYA 3VS4A 4BI0A 5C4LA 3R01A 4TNDA 2GQGA 5KMLA 3BGZA 2OFUA 2B2CA 3G8AA 2VWUA 3CJFA 5TF9A 5JUWA 2IW8A 1REKA 4CKEA 3AT2A 2VUWA 5AWMA 3UYTA 4PP7A 1Z5MA 1RJFA 1KOAA 1RI4A 3OFJA 2Z7RA 5CF4A 4FV8A 3UZUA 2A27A 2G2IA 3H0YA 3TKUA 1QZZA 4J8NA 4IQ6A 2CSNA 3H10A 4X7QA 2AOUB 3G2PA 3IG7A 3OFKA 3HCAA 1BL7A 3K5VA 4XHKB 4TYJA 1YKRA 4Y95A 5FM3A 3FXXA 4DG2E 4ATNA 5D9HA 4PL4A 3R7UA 2XIRA 5TKDA 4YLKA 3ZZEA 4F08A 2QRVA 3DUWA 4U7PB 5FCDA 2YM8A 1ZAOA 2QONA 4O0TA 1ZGJA 2P41A 4I6FA 3COHA 1YI6A 4NTSA 5LARA 2Z2WA 4RJ7A 4CGAA 1XR1A 3AXTA 4XP3A 3M6VA 3P9NA 3PFHA 2JBOA 5EQJB 2UZNA 2QO9A 2VD5A 3QTWA 3QZHA 3ZH8A 1ZG3A 4WKQA 3RP9A 2ONYA 5DN3A 4DA4A 3OVVA 3TFWA 3MCZA 1WBOA 3A4PA 3TM0A 3SSNA 4RLKA 4PWNA 4CTKA 2BZIB 4DEHA 3OEFX 1H27A 4CG8A 3AMYA 3LCUA 4MXXA 3PIZA 3EQRA 3RK5A 3BQCA 4J96A 2R3JA 4I0TA 4ZZMA 4BCHA 4WG3A 3GU3A 1UWHA 2UW9A 1VPTA 5LWNA 3D2KA 3IPHA 3C0KA 4ZTNA 5CIYA 1JG4A 4FVPA 3MA3A 3UPZA 2B4SB 2W1GA 1QANA 3V04A 2RG6A 3VW8A 3EKKA 4AZSA 3QCSA 1EQAA 3HP7A 3R00A 3R1SA 3I7BA 4TZRA 4DFUA 3SRVA 3RPRA 3TN8A 2OWBA 4DH3A 4EONA 2ACXA 4RJ5A 5BVDA 4QO9A 3GVUA 5ANJA 4C35A 1WXWA 2BR4A 3EFLA 4FIJA 3IW5A 5KYGA 5DR2A 3M1SA 1X8BA 4DH7A 5CVHA 3PXYA 2PE1A 3FLWA 3MPAA 4FKVA 5HD7A 4AZWA 5AP7A 1ZOGA 2YEXA 4AA5A 1YOMA 5E8XA 5T6BA 2JGZA 2DYLA 3LQ5A 4Q9ZA 1NY3A 3SV0A 3OU7A 3QWKA 2ZV2A 1Q4LA 3G2FA 3FUXA 4EL9A 3FHRA 3R24A 4X2FA 2WQEA 3LQ8A 4C36A 2CMGA 3UA4A 3PE1A 3GC9A 3QWJA 4FK3A 4YZNA 1M17A 1NV8A 1UU8A 4P7EA 1QCFA 3ZLYA 4ZY4A 5GHVA 3FTEA 2QR8A 3KQTA 2PVKA 3CQWA 3EQDA 2ZM3A 2BZHB 2EUFB 3A27A 4MEDA 2WMVA 3PSCA 4ZTLA 5IA5A 4EWHA 3PYYA 3QUDA 3PLSA 2G01A 2PZRA 5HU9A 2O0LA 5E9QA 2WHBA 3BUSA 3FTCA 2ITXA 2JKOA 4FSMA 4M97A 4PTCA 2BRHA 3SOCA 1GNGA 2IZRA 3LXPA 3ZBFA 4E4XA 5B0XA 4RVMA 5EYCA 4PNKA 5KHXA 3NDJA 1XKKA 3PP0A 3Q4UA 5LQRA 3JYAA 3EB0A 1YXXA 2C0IA 3N4UA 4RX5A 5K0GA 2IBSA 5T67A 4GCJA 4U9AA 5F95A 4IZ7A 4I0SA 2H34A 2ZB0A 5F4NA 4IC7A 3VJNA 3GRRA 2HCKA 4E7WA 2F57A 3HEMA 3K0BA 5ICGA 5M5BA 1O9UA 3MB5A 5BVEA 4X2KA 3PWDA 3BRBA 2WTJA 2WMUA 4PMPA 1N7IA 5JR3A 5J1VA 2VTPA 2VTLA 3EPPA 3TEIA 3VBXA 3NNVA 4DFZE 4HW7A 4EMSA 1GIIA 4E26A 4FYNA 1OL2A 2J7TA 3G0EA 2WTDA 3A7IA 1FMOE 4WNOA 3EFWA 4FZAB 5EI8A 1OUYA 3HV3A 3PRFA 3GDHA 2EXMA 4M36A 5AUTA 3KULB 4PDYA 5AUXA 4MNFA 4UYAA 2ETRA 1YXUA 3VW6A 4P2KA 3IGGA 5DT3A 2OIBA 3DBFA 3CE3A 3Q60A 3LFSA 5M07A 3KHKA 5FWAA 2Z7SA 5CEKA 3OU2A 4B7TA 4FKSA 4C7TA 3AD5A 2GHMA 2W4JA 3D5UA 3QTXA 3QZFA 4P5ZA 4CKRA 2VTJA 1J1BA 3GOPA 2AOUA 4B9DA 3M33A 3PX2A 3CP9A 2ERZE 4JX7A 4WUAA 3JS2A 4R3CA 1ZYSA 2PVYA 4M0ZA 5AUVA 3VUMA 3PJ1A 1BL6A 2YJRA 5FEEA 4C62A 4CZTA 2GPYA 5DTMA 4DAWA 3DTNA 3DXXA 4PIMA 1KE7A 2UVXA 3CJTA 3FRHA 5AP2A 3Q87B 5CYIA 3P5KA 4XJ0A 3V01A 2WMXA 3ORNA 4L01A 5GINE 2O3PA 1EH4A 3HNRA 2I40A 4PF4A 3R02A 4QYFA 2QKRA 4QRCA 3DTWA 4GT3A 4U81A 2WXVA 4G34A 2X1NA 4IX5A 3WBLA 4O7VA 3ZMMA 1ZRZA 3LFQA 4CMOA 1HMYA 1M6EX 1O9GA 2OY0A 3PJ2A 2YXEA 4FT9A 1OIYA 3PVCA 3SOAA 3QX4A 3VHEA 4DN5A 2G1PA 4IEBA 2OLCA 4DGGA 2FB8A 2XIKA 5DA3A 4YR8A 2Q0BA 3A61A 3PPKA 1PXIA 2ZFUA 4FGZA 2Y7JA 3JVRA 2P7HA 4BCNA 4IB5A 3I58A 3FAAA 2C7PA 3FZGA 3TV7A 2JEDA 3UZRA 3W2RA 3SGLA 3NEWA 4DH8A 3D7TA 2O0UA 3HNGA 5EM6A 1HCLA 1LR4A 3P7AA 4EOKA 5IH3A 4E73A 4PNEA 3EQPA 2Y1WA 3OW3A 3MH1A 4BHZA 3HA6A 4DF3A 3G2QA 5D1NA 3FI4A 5EVJA 3KKZA 3GU8A 4DMGA 3HCBA 4FTKA 4R5SA 5T3QA 4UX9A 2J9MA 4WBBB 4FKWA 4YC3A 1WZYA 3QCQA 3QYWA 4I94A 5JFSA 3SSMA 2ONLA 4YJUA 5CQUA 1LEWA 2HZIA 3D0EA 1VJYA 3MIYA 4DGMA 4DFXE 5K0CA 3T9TA 1NT2A 3CCNA 4G3FA 4KRDA 3WF5A 3ROYA 5TT7A 4ZMEA 2XCKA 4CRSA 4WNMA 4V01A 3TM4A 1H1SA 4R6XA 2UYHA 2P4IA 4LUEA 2HWKA 4AXAA 4RX1A 5LR6A 5HBHA 3ZBXA 1GOLA 5A4CA 1OBDA 5KMJA 2P35A 1KWPA 4ZXTA 4FZDB 3BWYA 2G9XA 3GQLA 3TNQB 5IA3A 1BYGA 4FNXA 3EQBA 3REPA 5HD4A 4UALA 4NM7A 4LECA 2C3JA 4J99A 2YABA 3W2CA 2QOLA 4BYIA 3DDQA 1H1QA 5HE1A 2XYUA 5LMKC 1MQ4A 1GIJA 2XZSA 4USEA 2HNKA 3P0MA 2UYQA 3TOSA 5L8KA 2B52A 5F9EA 3VS5A 4BDKA 2J0LA 5HBJA 5FQDC 4HVHA 5G1XA 3REOA 3S3IA 4L3PA 2H9VA 4FTLA 3LL7A 3BWJA 2G2FA 4TYIA 4USDA 4C07A 2J0MB 3F5PA 3ZRKA 5CZHA 3FMEA 3PZHA 5EGSA 2YA9A 3KU1A 2OIQA 4IKPA 2FRXA 4C05A 4X21A 2VNYA 4OTHA 2WKMA 3GCQA 3NZ0A 2E9VA 3PIXA 4WOVA 1IASA 2IO6A 4YBKA 3GFWA 4OLIA 3I60A 5B2LA 3A7HA 4FV4A 3TV6A 2PYWA 4GRBA 3W1FA 3EVEA 4U42A 1H1WA 1LUFA 1M2PA 4OTDA 2CKPA 4BCMA 3PRIA 4XLVA 1W83A 3BKBA 3HMOA 3NCZA 4LOPA 5A4TA 3QD0A 4AE9A 3FZPA 4IB3A 4M38A 4AU8A 3OE4A 4I41A 4N70A 1TKIA 4O2ZA 3U55A 2C30A 3BQRA 2CN8A 1WZNA 1RI5A 4XG4A 3QLFA 2XNGA 3E8DA 4KIQA 3VAPA 3DMFA 2W17A 4EH5A 4YV2A 4JR3A 2ZV7A 1PXPA 2G2HA 4QP6A 5J95A 1X1DA 1JTFA 1G3NA 3GT8A 1FJXA 5D7AA 3ZO3A 3AGLA 1J1CA 1WVXA 5HLPA 4ASZA 3AXSA 4XUCA 3LJ2A 5EI6A 4Z7HA 3WSTA 2UZVA 1OBGA 1VYWA 4UZDA 3UYSA 2AN4A 3GNLA 2YXDA 2GNHA 4MD8E 5EKOA 5G02A 1CMKE 3OY1A 2FH9A 5KMOA 3E8SA 3SX9A 2F7ZE 4PGHA 1H26A 1YOLA 4UY9A 4MTLA 4L8MA 4F63A 4D4RA 3UNKA 3AD6A 4C4JA 2YVLA 4QTTB 4DEEA 2O64A 2Z60A 4KVZA 3V5JA 4E70A 3TWJA 2PZIA 4FZFB 4O83A 3AC8A 4KBAA 4KBKA 4C2VA 5BYLA 3GC7A 2J0KA 3KQPA 4YV0A 4FT0A 2V7OA 2XYRA 5HIEA 2BAKA 2EX4A 3Q4CA 4PTEA 2ZMDA 4K8AA 2CNQA 5EYDA 4HVSA 3GC8A 4FKPA 5TO8A 4XOYA 5CXZA 5AP5A 2W5AA 5JH6A 3OXIA 3LXLA 3MW1A 4S32A 4YSJA 2P2IA 1W8CA 5JN2A 4H0NA 3R8UA 5CENA 3UC4A 4KSPA 5B7VA 2BHEA 1JQDA 4YJQA 4F9YA 2X2KA 4E20A 5AV3A 3MI9A 3QCYA 3V6RA 1KE6A 4IVBA 4CKBA 3UOHA 1KP9A 4RQVA 2C7RA 1MRVA 4MD9E 2GS2A 3HUCA 5C27A 2XNMA 1TQMA 4GK2A 3V8TA 4Z3VA 4M7RA 4BIEA 3ANQA 3FLQA 4QTAA 4YTCA 4FV7A 1XHAA 3P23A 1X1BA 2N47A 1OB3A 2CPKE 3TZ8A 4AAAA 2XB7A 4RVFA 4MQ4A 2C68A 4I21A 1YI4A 3PXRA 2X4ZA 2YX1A 2YISA 2VO6A 3P1AA 4EYMA 3ELDA 2G15A 3S68A 3RM7A 1RJBA 2IZUA 3WZKA 3EWHA 4EHEA 4QNAA 1YDTE 4QMSA 3QTQA 3R73A 1JSUA 4TWNA 4YJRA 2OJ9A 3ATTA 5JGBA 4GF5A 3NUXA 2VO0A 2XUUA 2GPHA 4FNYA 3KRWA 4FIIA 4P5QA 2OZVA 5CD1A 3OOMA 3EHAA 3SQQA 4D9UA 1OVEA 1UU9A 2XKCA 2BDJA 2Z7QA 2C6MA 3KC3A 3LLAA 1Q0SA 3LCTA 5GOZA 4KIPA 3BWMA 4OBPA 4WVLA 4CFVA 4OBWA 2XRWA 4E5BA 3D14A 4I5PA 3HX4A 2CHLA 3OG7A 3TJDA 4EUUA 5LQAA 5DRDA 2WELA 1P2AA 3QX2A 1FQ1B 2W1FA 4R1VA 4L45A 1XTPA 5CS6A 5M4UA 3AD4A 2YDJA 3AT4A 3FPGA 4FG7A 5AV1A 4ZAUA 5CUQA 5HORA 4YJPA 4ASEA 1R8YA 2ITZA 1YDSE 3F3UA 4P90A 3QHRA 4EZ3A 3ZOSA 2FYSA 4KBCA 5BNJA 2VTSA 1SKMA 1K3AA 2EB2A 2R3GA 4Y5QA 3NW7A 2J2IB 4ZY5A 2W1ZA 3BGVA 1Q3DA 4FKJA 4DTAA 5DT2A 3UJDA 1BMKA 3M6WA 1BI8A 4OBOA 3QTRA 3DZOA 2WOUA 2AOTA 1UKIA 1ORIA 4EQUA 4QMOA 4BB4A 1B38A 2XYQA 3ULIA 4F9CA 2PZPA 2XNNA 5HVYA 3E87A 3SKCA 1OKYA 2FO0A 4W4YA 1XBCA 2AOVA 3B2WA 3HL7A 5L2TA 3OPNA 4IAFA 3F4KA 3Q04A 5KQSA 1P4OA 3BE2A 3E63A 4GT4A 2W5BA 5EHYA 2QU6A 3ZFXA 5CI7A 4S33A 3RJCA 4AN9A 4M67A 4M69B 1BKXA 4TN6A 2JG3A 1KV1A 4ALVA 1EIZA 1UFKA 2VGPA 4FTIA 1JG2A 1D2CA 3LHJA 1Q8UA 2V0DA 2XCHA 2WQNA 2P0CA 3FC1X 3NS9A 4KUJA 5C01A 1FVRA 2C6EA 4U41A 5HU3A 1JPAA 2ZYBA 3HECA 1O6KA 4J53A 1BHJA 2C5OA 3D7ZA 5M56A 2PXCA 3FRIA 5GJDA 2CMWA 4OT5A 4J1RA 1PXKA 3PXKA 3MY1A 3MY5A 4ZSGA 3WIKA 3K3JA 3LFEA 4IM3A 3E8NA 3RZBA 4GBED 1ZOHA 3F66A 3QQJA 3BBWA 3CIKA 4QP4A 5E91A 3ACKA 3DV3A 5HKMA 4KRGA 3HZTA 3RAKA 2X8EA 5EHGA 4F09A 4NK9A 4W4XA 4AT3A 1W82A 4HCUA 4EH4A 1JR4A 4YMGA 2XM9A 2ZDUA 4OR5A 3K5UA 4DLIA 2WQBA 4EQCA 3HMMA 4D1XA 2OK1A 4FKGA 4WNKA 2VDUE 2GTMA 1KE8A 3EVDA 5GIPE 5DHJA 3SM3A 2EG5A 5DGZA 3R1NA 4EC8A 3ZUVA 2PPQA 4UYNA 2IH2A 1M52A 5L6PA 5EOLA 5EOVA 5HIKA 4AGCA 5HZNA 4LRKA 2ITTA 4DCAA 3D2IA 2WTWA 4NFMA 2BRNA 3ODYX 2FSMX 2HK5A 3MB6A 4W8EA 3KK9A 2VTRA 3RI1A 3VUKA 3VUGA 3FY0A 2ESMA 5H2UA 5CEMA 5KO1A 3FC2A 4I5CA 3TUCA 3BWBA 3UIBA 4H05A 1ZMVA 4AGWA 5GM2A 4YU2A 2WB8A 5CI6A 4YUYA 1H08A 3W33A 4XG3A 4F0GA 1YUBA 2B78A 2GMXA 3QD3A 4XBUA 2C1BA 3COKA 3H9FA 4GSBA 5CU3A 3NAXA 1NW3A 5DPMA 4D55A 3RPVA 2VS1A 5K0JA 2G8NA 3UFBA 4FVRA 5F2OA 2YCQA 3U81A 2WMQA 4X63A 2CL5A 1JG3A 3UVRA 3ZDIA 2PKWA 2UW3A 4DKJA 4KKGA 1KIAA 2WTVA 3LECA 3THBA 1PXNA 3HLLA 3OUNB 2JJQA 3FMDA 4MF1A 3LDFA 5BVFA 2YWPA 2XBAA 1P5EA 2BDFA 5HG7A 5HG5A 4ACDA 2K4MA 2C1AA 3NUPA 4AG8A 3EVZA 3IS5A 5JEBA 4AN2A 4ZOGA 3VF9A 1XDZA 3HRBA 4PQNA 5E9JA 3DLIA 1XCLA 3BXOA 4DFBA 4XRLA 4FZVA 3D5XA 3MJ1A 2ZWAA 2BKKA 3CQEA 4GC9A 1R0EA 2YQZA 3KY2A 2R7IA 2OO8X 3VBWA 5J1WA 4YTIA 3GRYA 4NCTA 5AV4A 4MK0A 3P97A 1IEPA 3QZIA 2HIWA 3GBZA 2E2BA 4O21A 3M11A 4JBPA 4XNEA 4DCGA 4E30A 5LMAA 4FKIA 3PVGA 4GK3A 1URWA 4ER6A 3TT0A 4TRLA 4X2NA 5D1JA 2VU3A 2ONLC 4RIXA 2V7EA 3G9NA 3NUNA 3PP1A 4EH2A 1DM2A 4KINA 4ZTMA 5FM2A 3Q9XA 5IH6A 3QTSA 5K0BA 3EOCA 5EZQA 1SVEA 2QVSE 4MXAA 4IW0A 2R6ZA 5E8RA 3F82A 4IFCA 4R8RA 5E8JA 4UBAA 5E8UA 3TTIA 3ZO2A 1IM8A 2ZVAA 4L7SA 1B39A 1IG1A 4HYHA 3DBEA 4HOKA 1AD5A 4JVGA 1DS5A 5E8ZA 4N6ZA 3TACA 4QMTA 3TJCA 4XCUA 3TKAA 3MBLA 4FSNA 5HHWA 5JK3A 4PYMA 4QMMA 3RCJA 4TYHB 3V3VA 3TM5A 3M4XA 3ZUUA 5BVKA 5HX8A 1J7IA 2Y0AA 1YHWA 4O81A 4GFOA 3B3GA 3L8PA 4ALUA 4DA5A 4DM3A 4I5MA 4MNEB 3F2RA 5DE2A 1ZARA 4P7KA 3EQFA 3FI2A 3KF4A 3R1QA 4BDIA 4PMTA 2JHPA 3W8LA 4H3BA 2OIDA 2ESRA 5BYZA 1JAMA 5M4IA 2J5EA 4L9IA 5AJQA 3EEOA 2V5QA 4NCTC 3PUPA 1Q24A 4YO6A 4CSVA 5A4LA 2XVMA 5JMSA 3NYNA 2VRXA 2BTSA 3BV3A 1LP4A 4L7FA 5DNRA 2XNPA 4L46A 1IXKA 3LHDA 3FMMA 2ZOQA 3P08A 5FXSA 3DKFA 4BDFA 2F7XE 4MWZA 3BHHA 4YC8A 5FD2A 3UO6A 4BDJA 2XMYA 2VP3A 4FR0A 1XCJA 3DBQA 5E4HA 1IAJA 3PJ8A 3L9PA 2QLUA 2QU5A 3DFAA 3EN4A 4DG0E 2P40A 4GJ3A 2ZIGA 2ITVA 4KRCA 2XEYA 3ACJA 3QC4A 3UO4A 2QM3A 1BUHA 4YO4A 3LBFA 1WBNA 4TY1A 2R4BA 4I6BA 2VWBA 3BU6A 1KSWA 1PXOA 4DGLC 3CR0A 2QHMA 3OCTA 1HCKA 4OTIA 5GJFA 4EZ7A 3KQQA 2ZZMA 1KYZA 3SG8A 1R8XA 4FEQA 5DVRA 5H9BA 4E5AX 3KN5A 2OFVA 2CLXA 2WD1A 4IWPA 2WZJA 3PXQA 2OGVA 3LOKA 4EK4A 3OW4A 4GU6A 1GJOA 1FP2A 4M0YA 3NIZA 1H28A 3R83A 4RFMA 4O0YA 3UG2A 1V39A 3I4BA 3PDTA 2YM4A 3NRMA 4QYEA 3ZEWA 4MBJA 4A06A 1DI8A 2PTKA 5DRTA 4EQMA 3NVMB 5EQEA 3MAGA 3MFTA 3GWZA 4D0WA 4IIRA 3DB8A 2F7EE 1ZYCA 3QRJA 3II5A 4FSRA 4RWIA 4AQCA 3COIA 3MVHA 3RGFA 2QC6A 3ZLWA 5M44A 4X60A 3POOA 1QPDA 4FEUA 3F2AA 3EGIA 3LQ3A 3MVLA 1GZOA 4LRMA 2VV9A 5HIDA 3VQUA 3QYZA 4CLIA 2PV0A 3CC8A 4FTRA 5ETAA 5HLNA 4ZSAA 3LDUA 3GCUA 4YLJA 5FTOA 4AZTA 3IW7A 3EYHA 2PVLA 5K4IA 4ZTBA 1XH8A 4DBNA 4FG9A 4FTQA 3KXMA 4EYJA 3WOWA 3V8VA 2YM3A 3VYWA 3VS2A 1ZGAA 3JY9A 3IOKA 3B7PA 4F85A 2HXQA 3FL5A 2XVAA 5LMBA 3FLZA 2B25A 2CGUA 3PT9A 4NECA 3FMHA 4QMPA 2BALA 3I6WA 4R7IA 5IQBA 4FTCA 4U7ZA 2AR0A 3RK7A 2JLDA 2IWIA 1Y6BA 4GVAA 4UN0C 4K0YA 4EORA 2EJTA 2C0OA 3G89A 3QHWA 2Y8OA 5C4KA 2UZWE 4FYOA 2BPMA 5DX8A 4N0SA 2W06A 4FT5A 3DP7A 4K11A 4UV0A 3UDBA 1INLA 5IH5A 5HFJA 3DXQA 5H8EA 1Y91A 3QGWA 2GQRA 5CAVA 1SNUA 3WZEA 4N57A 4YP8A 3HV4A 2PX5A 4QPPA 2PWYA 4R6VA 3E92A 3EJ1A 5JGDA 4JQEA 4IM2A 4BYJA 4BICA 3LBYA 4HG2A 3IKAA 4F7JA 4DFLA 3DJ6A 3LCSA 4LV5A 5HLWA 5LVNA 1PJZA 1ERKA 5BW5A 4GIHA 4LWPA 3HRFA 3R9XB 2BFYA 3HDMA 2JHAA 4WD5A 4OUCA 4AT4A
chains in the Genus database with same CATH superfamily
3AY6A 2ZP1A 3OCJA 2GBPA 1O1YA 1ZVQA 2ZRDA 4CFMA 4RCZA 3IP7A 3ZD7A 1FYXA 1UH5A 3VI3B 1K6MA 1XMOB 4AURA 4W8DA 5DSTA 3LD9A 3OF3A 1VBFA 2F55A 1G3RA 3BPRA 4QQKA 4WAUA 4JI9A 2Q8NA 1NV9A 1NOJA 4NAUA 2PWAA 2VZEA 3O5AA 3C5IA 2DPMA 4N5LA 3GGDA 2RFSA 4F12A 1NC3A 1LLFA 1XP8A 1NJ8A 2OBNA 1KNQA 4R78A 2BFOA 2B4KA 4AGUA 1IWPB 1RQXA 2VX0A 3I8OA 4L9AA 1TRKA 4GIBA 2QSJA 1BDIA 1KFKB 2HXLA 4G3CA 3SC2B 3BHUA 5I9BA 1T3HA 4WO5A 3QMVA 3QKSB 3V5LA 1IM2A 2PZKA 4WQMA 1P1CA 2O59A 3HBAA 5FL7D 4IIUA 4S2EA 4YCAA 1GGJA 1THGA 3T7RA 4RWZA 4ETWA 4PXYA 2HZ4A 1H1TA 2PO5A 1CUEA 4N7JA 2DWQA 4LY6A 4BIDA 3AOXA 2AC7A 2D5LA 3CC6A 3WFIA 2J6CA 1YW2A 1TJ4A 4FGUA 4L3WA 4FD3A 4N6NA 2JGJA 2X4FA 3KL8A 2V22A 4CUZA 4C7BA 4AMYA 4P4SA 4Z55A 1WCCA 4FTAA 3CT4A 4FCCA 4E5MA 1SB8A 2ZZKA 2YHAA 2VI5A 2KMLA 1BWSA 3LXRA 1ECBA 4KLRA 3I73A 1BHQ1 5HCZA 1RAAA 2YJNA 2G67A 1V5WA 4M1EA 2IIQA 3NIEA 2QUHA 3JPVA 1NY6A 3WYEA 1DJLA 1B6RA 2HJRA 3ZWAA 1DE0A 4M0PA 5CYPA 4FFDA 5AVRA 5DTQA 2R60A 5BUCA 5EI5A 1H1LB 4R71A 4HVLA 4CFZA 5CJJA 4NU5A 2VBIA 2QW8A 1ZXEA 3KXNA 5BUEA 2GEDA 4H36A 3IKTA 2UXBB 5HBEA 3NLLA 2Y93A 2C5FA 1KEKA 1U0FA 4DH1A 1II8B 4XEHA 3A2LA 1GPBA 5H9VA 2WD9A 1CQJB 3EVAA 4FEAA 3GARA 1E6LA 1X9HA 5LZ5A 4MO2A 2FWAA 4J3NA 4NZNA 3KZKA 4C21A 2PCJA 4C2AA 2ZWVA 4XDYA 2R3FA 1N5IA 4LBZA 5AKIA 3OZAA 4KN9S 2CLIB 4P7GA 1Y4UA 7ABPA 1IQ0A 4LWOA 2C4MA 1WXXA 1UFVA 1A9TA 5DYIA 3A25A 4JFAA 2VP9A 4AMUA 4N5IX 3HWRA 4LHXA 4EVSA 2W2VA 3ZCRA 1ZOEA 1Y7IA 3LSTA 1N8TA 1U65A 3UNJA 4FTMA 1T2NA 2B9IA 4CNQA 2C54A 1BCRB 1TFUA 4TTJA 2DB3A 1XMLA 4IB0A 1W5TA 3OI7A 4ZEGA 8ADHA 4MW0A 5B4TA 4DBZA 2CNKA 1KI6A 3UJGA 4O4HB 1X0XA 1JWLA 5IJ9B 4JVSB 3EGEA 2E9NA 3W2GA 3QY9A 4KUGA 2P8JA 2VHVA 1CUHA 1ZEMA 5A2GA 1GAQA 3DBHA 4K1XA 4BLUA 4BV3A 1U7ZA 3H4JA 3AOEC 3C51A 4XPIB 4NH4A 3IRUA 3VC3A 3E1GA 3BL9A 2JKMA 2GCOB 4DQUA 5B3JC 2Q3FA 1YR6A 2VBGA 4FSYA 3KFVA 2OM6A 5AXDA 9GPBA 4B4KA 2Q3EA 1FVVA 1ZZ2A 4OK5A 1PWEA 3R0QA 3GH1A 3EMKA 4JHLA 4IAYA 3GGPA 4A23A 2B9JA 4PP9A 1ZCFA 5A4MS 5C81A 4AQ7A 3K0KA 2HU7A 4LV8A 1LI5A 1IEVA 3W1VA 4R2LA 2YS6A 3DS8A 1P9NA 3FOEC 1G2QA 4D9MA 3KZ1E 1I2ZA 1R10A 4P34A 3MCUA 3RHSA 1QTIA 2IITA 4LTMA 1KI4A 2ILTA 3ZWBA 4ND1A 1WMAA 3CLKA 4I5DA 4AW0A 2I7VA 2CUKA 5DH3A 4ZPXA 5JRSA 1Z0JA 4Y85A 3AIKA 4KQ6A 1TUEA 3K70D 4IXTA 3VKFA 4RETA 2IHYA 1GOTA 3AVQA 4CDRA 5T41A 3WLNA 5CSHA 1HG0A 4BAUA 2R3QA 3ZTWA 2OVFA 4ZK2A 1NMXA 1GA6A 5JZNA 3F3MA 3TDNA 2BLLA 4AP5A 4RIWB 2C8LA 2ZPAA 3R8LA 5M57A 5EJ7A 3W5HA 1GCIA 5LCJA 3EXIA 2Q3BA 5CVJA 2J85A 1K7EB 2A94A 4ZI7A 1A9XA 1OB5A 2OV6A 3F7WA 2D2VA 1O94A 2PR7A 3MOSA 2PULA 5EHLA 3ASYA 4V1CI 1GAGA 2RGYA 2G77B 2R5FA 6CHYA 1TUBB 3ICPA 4QBKA 1LTQA 2Q0NA 3SQXA 3I45A 3MWFA 4CVAA 2V55A 3RRYA 3PD7A 5E2BA 5JPIA 2ZBUA 1U1CA 4L2IB 4DV6B 3DKRA 2XCTB 3CZ5A 3O3MB 1KMIY 2VAMA 2LUOA 1C9MA 1A5BB 4WCFB 3KAPA 1DO0A 2VHTA 1K6IA 2B98A 1Q19A 5AJXA 2ZMCA 1UK8A 4RTLA 4AD8A 3NORA 4Z7JA 3D3JA 2Q45A 4ZTUB 3T99A 4QASA 4D99A 2BDEA 2ERXA 3UO8B 5EFQA 3PA3A 1C81A 1SVLA 1OZ0A 2UUOA 4PUZA 4X0EA 2CJYA 4OJQA 3ISTA 5DGIA 2QOIA 3BWCA 1L8TA 2X8DA 1ZC4A 2VJLA 2VGOA 1SC9A 3SBEA 5LQMA 1ULZA 4IDTA 4XG6A 1E1YA 1KEUA 5C8XA 2XA9A 5IABA 3OZXA 5DNAA 4BJJB 2B8WA 3DPKA 3BTUA 1EAYA 5AKEA 1W2GA 1ZONA 4BNXA 1CUZA 2IS2A 4DEGA 2ADMA 2QVYX 3ZDAA 5HTCA 4NCKA 3MJRA 2I2FA 2VXOA 1JWAB 3G68A 4G5OA 3W18A 2IEZA 3L9MA 2PVNA 2K6GA 4W5RA 1TCUA 2QN9A 3PLAE 3VHKA 4O8ZA 1NQTA 2VNIA 5F9MA 4C2WA 4BWYA 4KE6A 4OUKX 3V1TC 5GJVC 5THXA 1A9ZA 3FPKA 4JUAA 2ZSEA 3GC0A 3ZONA 1L5SA 1U4DA 4KO3S 1SZMA 4IW3B 3TLJA 3EQCA 4PDSA 2OHIA 2XQVA 4CFNA 4AT1A 5FRIA 1YDFA 5B5SA 4F0IA 2HC9A 3QEOA 2IEYA 1VJCA 4OHVA 1URPA 3C9WA 1TKCA 1XTBA 1WW3A 3HYRA 1ESZA 1XZQA 1M2NA 4B6RA 1Z16A 5DBOA 3QVTA 3LXNA 3KNZA 3BGOS 5F1KA 3W6PA 4P3PA 3NX8A 4IX6A 3R71A 3DNPA 3H6HA 4AIIA 1L1QA 4IDPA 1O97D 2IDZA 1RKXA 4OP3A 3S1HA 1ZH4A 5K8VA 3OP4A 3QX8A 3V48A 4HEHA 2JD2A 1Z12A 3R63A 1YI0A 3Q3EA 3UMRA 1NMEA 1IHUA 3GGOA 2DRIA 3V3TA 4PTGA 3SP1A 4LDJA 4MQEA 1L3BA 1CW2B 4LMNA 2VTBB 1CK4A 4Q9HA 4XDGA 1A9RA 5L7YA 3JZIA 4UPEA 4L4SA 1H8EA 3IA2A 2GDZA 5BQ0A 3HM9A 5CD9A 1G6Q1 1DKMA 2HU8A 4NF2A 3H9UA 2UZLA 3JS5A 4X3FB 2OSCA 5IMXA 1YR9A 4LISA 4RIOA 3RI3A 4QHSA 2VTQA 3AU8A 1WO8A 1C14A 4C78A 3RS7A 1RYDA 1LSJA 3LBIA 1BC5A 4EW6A 4LZWA 5I9WA 2HU5A 2YC4C 1SHZA 4J1QA 3ZC5A 2BPOA 1J0DA 3G2HA 1KYTA 5D7VA 3V8BA 4MZDA 4JZKA 4BE4A 5AVUA 1MH1A 4MLDA 5CDFE 4E6AA 1XWSA 4M1WA 1YQXA 2O5VA 3IV7A 2GUGA 2O3QA 1EUDB 3ZC3A 1NN1A 3R8VA 2KJQA 5JMWA 4JG8A 4J7BA 1KWGA 3FBVA 3QI2A 4L57A 3TTYA 5DKFA 3W16A 1W1IA 4R2IA 3QY0A 3DBOB 1AQJA 3IOBA 5HG9A 2IY9A 2AKYA 4ZI3A 4DBLE 3A7FA 4LZLA 3M70A 2UUBB 4HNVA 3WWOA 4ZQEA 3VRZA 5BVGA 1NBAA 3UV7A 4IM0A 2OB2A 3JAKA 2I3AA 3PWKA 3ZTXA 3R23A 2XBJA 1KQPA 5CAUA 2Y6MA 1AY0A 4YRGA 4KL8S 2R8YA 3CCFA 4G9RA 2FPWA 2QTAA 3OZBA 1RDQE 2WUFA 2AE1A 3DMDA 3EF3A 4IRMA 4HNGA 3P9CA 2ZB8A 3RAJA 1SJ9A 1NVFA 4WKGA 3CIFA 4U3JB 1TUIA 2WT8A 2I0EA 2Q83A 2E37A 3WKEA 3OAAA 4QYTA 3OY3A 2R2AA 1NQXA 4BQPA 2DPHA 1D1PA 1DLJA 3L7YA 1RQ2A 4M1TA 4M7IA 1GY8A 1TRHA 3SU8A 3BJZA 1U0RA 2GD6A 3EL7A 1USGA 4MQ2A 1PMVA 1JB1A 2NO0A 4M7OA 4BI2A 3VPCA 5HUQA 3CTJA 4UM9D 4JXFA 3NTOA 4K26A 3VJKA 2FSHA 1SB9A 1TQ8A 5ANRB 4DEAA 3AC4A 5EEGA 4LXUA 1G0OA 5T4HA 4YJGB 3I2JA 2R3PA 4KVFA 3LCVB 3EN7A 3BEGA 3I8XA 4PLTA 3NJRA 4GOOD 4L6CA 2DR0A 1WPQA 1U2EA 3E53A 4QJIA 4I2NA 1L7NA 5J2UB 2C6OA 5FLEX 4D0NA 2QX6A 3WF7A 2B8JA 3VTAA 3QJYA 4CG3A 2RHOA 4HDRA 3V4LA 3NXKA 5HESA 1E2MA 1P61B 3HVKA 3EZGA 3SG9A 2JJ1D 3WLFA 3LKBA 2PUDA 4LVOA 2YOGA 1JIIA 4DB4A 3G79A 2B9VA 4LX0A 4RM2A 2PLNA 3D4IA 4TL8A 4W4TA 1H05A 5J9FA 1CUSA 5JH7B 4G1CA 1CJTC 4EP1A 3EQIA 2E2WA 5JQGF 3KULA 3INTA 1F17A 3N3BC 4OUDB 1S2OA 4QLOA 1Z5OA 3M5CA 4S1VA 2OLEA 5LP1A 4E5DA 3V9PA 1JSXA 4KB5A 3DW1X 4YPFA 4QP7A 3HDJA 4ER3A 4M84A 5DIAA 1DVRA 3KJQA 4JI4B 3I62A 3SMQA 2ZM6B 4EECA 2NVUB 5BP7A 5D6NA 4ASUA 4MS4B 1G66A 1LC3A 5EQPA 4CT4B 4Z9FA 4S1NA 3RAWA 2CFRA 3QTTA 1HZZC 2FFRA 4Z1OA 1C1XB 3M6XA 4BYGA 4P4CA 1J9GA 3F3WA 4GR4A 3TCKA 5HF5A 4Z4CA 1BA3A 3LLVA 4M60A 4GZ5A 4FNOA 3VFDA 3VVBA 3E3BX 4OREX 1GAWA 3Q7SA 3FIUA 5BSHA 4N7RA 4EX7A 5I9IA 1E1VA 2VPXA 1K06A 1WVGA 4J16A 3L8MA 2JIPA 3LMGA 1W0CA 1XJQA 2IS4A 2WJPA 5TARA 1F1JA 5HW0A 1JX6A 2GK3A 1DJOA 1ZN9A 3R6DA 1DV1A 4GLFA 4U0IA 1R88A 4ZOBA 1TT5A 3L8GA 2HTEA 3ZU5A 4X66B 4H16A 4XX0B 1V45E 3L0CA 1XLUA 1I0LA 3UZUA 2VJDA 1EUCB 4FMPA 1GDHA 1BO6A 1UCFA 1NXVA 2GR9A 4M0FA 1XR1A 2BHSA 1SBHA 2H1LA 4H3VA 5DN3A 4DA4A 4H7IA 3T1HB 3OEYA 3B53X 1I3KA 3MA3A 2H9IA 3R00A 2P67A 3TX2A 5D85A 2VDRB 2XF2A 3G2JA 2GF9A 5HSGA 4AZWA 1U8ZA 5L45A 3BHNA 5E8XA 4XFKA 4FZJA 5HUJA 2ZV2A 3TW8B 2AC2A 5IX8A 2HI0A 4X7PA 2J5RA 2EKPA 3FTEA 2QR8A 3EQDA 1OA0A 2OLKA 1Z63A 3QE2A 2WHBA 5C5IA 2ZE8A 3CX8A 4D3XA 3EB0A 4A15A 2LWIA 5IBCA 3BRBA 1TZMA 3ZLVA 3NGMA 4HW7A 2HUPA 2YHBA 4RY0A 4E5VA 4XYMA 1C8LA 2R48A 3SZUA 4OI2A 2BGJA 2WHXA 3UAZA 3IGGA 3KJEA 1G20A 2VDOB 1ZYSA 3VUMA 3AIMA 1CVRA 1SRRA 1BWPA 2DSTA 4PIMA 4C4RA 1U8TA 1XQ6A 2ONJA 2Q1XA 1GRRA 2ZK7A 1WCV1 1HMYA 5D5QA 1BFUA 3VHEA 3QWAA 3L4SO 5BV2P 2Y7JA 1GPYA 5H0IA 3NPMA 3OG9A 2MSNA 1E4VA 2ZUFA 3PHIA 2W8ZA 4IXNA 5D1NA 2WIGA 2C31A 3IOEA 1JAXA 3M89A 5F5LA 2QUKA 3GNQA 2C61A 3T9TA 4TV9A 3OX3A 1JS1X 2DFPA 3QFFA 5IAGA 5A4CA 4ZAFA 4ZXTA 3T5CA 1T0PA 3MWLA 3FCCA 5HD4A 1T36B 3FYSA 3IILA 3CLVA 1WCXA 2HNKA 4C01A 2CHFA 5HBJA 2D6FA 4FTLA<