3ID6C

Crystal structure of sulfolobus solfataricus nop5 (1-262) and fibrillarin complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
227
structure length
220
Chain Sequence
ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural organization of box C/D RNA-guided RNA methyltransferase.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
molecule keywords Pre mRNA splicing protein
total genus 58
structure length 220
sequence length 227
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3id6C01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3id6C02
4QMYA 3ATTA 2PVMA 5L2TA 9MHTA 3GIWA 3R3HA 4JG7A 1NA7A 1YWRA 4GL9A 3KA0A 3ZRMA 4D0WA 1XDUA 5FA8A 3F3WA 4RX7A 1J3HA 3ERCA 3R8MA 7MHTA 3LMIA 2GNHA 3OC1A 3OCSA 4JX7A 3K0BA 3UJ9A 1ZYCA 1VP3A 2BUJA 2UZWE 4NKAA 3BYVA 4BTKA 4IANA 4AWIA 2YAAA 2WHBA 2BRMA 5CVGA 3VUDA 3ZRLA 3ZEPA 5TR6A 3D5VA 1JOWB 2JBOA 3P2EA 5E7RA 4I5MA 4QPSA 3O7LB 2JIIA 4CKEA 3KY2A 4E93A 3PT9A 4OT6A 1IEPA 2BDJA 2PUIA 5DOSA 1YQJA 3WYXA 3S1HA 1FPQA 2ITXA 4ZOGA 3VNTA 4AZSA 1G8AA 5J9YA 3JWGA 5D1NA 4RC4A 2G2HA 4AW5A 2W05A 3HAVA 1CKPA 2HCKA 1OPLA 1PF8A 4EL9A 1XWSA 4H1MA 3K5VA 4F9YA 4NKSA 2OZVA 4FS8A 3EGVA 3RM7A 4IMYA 4DBXA 2B78A 3TJCA 4FKOA 4ZJJA 4IZYA 4TWCA 2I6GA 3LPBA 5K0FA 2W9ZB 3OOGA 4JIKA 3I53A 3LHDA 3P2IA 1BI7A 4LWOA 1OUKA 2P33A 4U79A 4U97A 5DFPA 4ZTQA 1BX6A 4EOSA 1UWHA 3ZO4A 1KHHA 4X6RA 4HOKA 3G9NA 4C2WA 2BVAA 5J5SA 3DKGA 2WELA 5IUIA 2WTCA 3MHTA 2KULA 4BVUA 4RVLA 5BYYA 3LOKA 4MVFA 3SD0A 4RSSA 1G38A 5KHXA 2OLCA 4FGZA 4DEAA 1ZAOA 1SVEA 1ZRZA 4ITIA 4Y72A 5E1EA 3FLNC 4M84A 3NNUA 4GU9A 4BP3A 4YMHA 3A7GA 5D12A 3ELJA 2UUEA 5L8KA 2P3OA 1BLXA 1OGUA 1KSWA 4BCIA 3G5DA 5BVNA 5IEVA 4C2VA 4PMMA 4QRCA 3HV6A 2OF4A 3FUVA 4PYKA 4IB1A 2LAVA 4F9CA 4RQKA 2R3SA 1W82A 4CMOA 1R39A 4B99A 1XBCA 2UZBA 1KYWA 3LZBA 3DZQA 3BLQA 3I0OA 4BBFA 2BR5A 2PVHA 4YBKA 4AN9A 4PRJA 4XP0A 2BKZA 5HICA 3FV8A 5EYCA 3UA3A 3BKBA 3U6JA 1H1DA 4OX9Y 3DBCA 1EH4A 4FKJA 4KABA 2PV0A 3A25A 4AZEA 4MWZA 3UO5A 3R9XB 1Q8TA 3O7LD 1INLA 2C3IB 3P9KA 4J8MA 5CEIA 4QMLA 4FX3A 1WBOA 3A4TA 1AQJA 4DFYA 1MQBA 4L8MA 4RFMA 4NW5A 1EJ6A 5K0GA 3SGCA 2PVKA 3DTWA 5D7VA 4EOJA 2O2UA 3QQGA 5J9ZA 4IVCA 1KYZA 4KIFA 4DEEA 2XNEA 1N2XA 2OXTA 5HLNA 3EVEA 3R9HA 1H26A 4QO9A 5I4NA 2C7OA 3FE3A 1KP9A 2SRCA 2J4ZA 4LM5A 3EB0A 3Q3BA 3GOPA 5GWXA 2QLUA 4C08A 3DNEA 1QPDA 3LMHA 4WG3A 3C1XA 3WF9A 4AN3A 2VTJA 5CEOA 2VZ6A 4FV8A 3NVKI 2FK8A 4KDCA 5DX8A 1JG4A 4EMSA 4YJOA 3EMGA 2C6IA 4LGGA 4E4NA 3B7PA 1ZXEA 4YZDA 4MQ4A 2B3TA 5CVFA 3L8PA 4J96A 5HKMA 5K0BA 3QWJA 3LLAA 2PE1A 1Q41A 4XG7A 1G3NA 3G33A 4QMUA 5C26A 2JDTA 3COHA 5D41A 4HGZA 3E7PA 3R7YA 3E92A 4JIAA 4F9BA 5HBJA 4TL0A 3VN9A 1UWVA 3TM4A 5K09A 4RV9A 4OT5A 1PXKA 1H28A 4NCTC 1AQ1A 2HMYB 3KQVA 5GM2A 1YFLA 5HLPA 3R01A 3G2FA 4FKTA 3VBWA 4NIFB 5HEZA 5BQ0A 3TNHA 1OIQA 3MJ2A 1DI8A 2F7EE 4RVMA 4Y83A 3GNIB 3CGGA 4GEKA 1XH7A 4YV1A 4PUZA 3JXWA 3FMEA 4R7IA 4AUAA 2OPBA 4FG7A 1P4FA 1F3LA 4ER5A 3V8SA 4KS8A 3NUUA 1A48A 3TKYA 3E7OA 4C3PA 1FBNA 4BCOA 3PJ1A 1L3CA 4RWIA 4BI1A 2AOWA 4QPNA 4MAOA 3P9IA 1U59A 2BHHA 3EQGA 4FE2A 5L2IA 4LV5A 4LECA 4HZRA 4A6EA 4R05A 5C0OE 4MBIA 3PTGA 2J0JA 3F69A 5KHWA 3DFCB 4WNMA 2R64A 2UW3A 3ODZX 2BPMA 2ZTHA 3IOKA 1SVGA 5JFWA 4QQNA 4PGHA 3L9NA 5DR9A 1OPKA 1YXTA 2H9VA 3LFEA 2X0GA 4NFNA 4AF3A 2JAMA 1QAMA 3WBLA 1VR2A 3TL8A 3DOUA 3UJ6A 4BLVA 5E1SA 4C04A 3EOCA 4UZHA 5KYGA 5DRYA 4BZDA 5M51A 2VO0A 4Y95A 3GRVA 4EKIA 1OVEA 3BHHA 4XX9A 3F2RA 2B7AA 3SXRA 1FMOE 5DRTA 3LJ0A 3RI1A 3RPYA 1H0VA 1Q8ZA 3FLZA 5M06A 1OITA 5E4HA 3DTNA 3DXXA 1Q8YA 5CTPA 2CJMA 2XK8A 3M6WA 1WZNA 1E1VA 2WU6A 3QYWA 5KMKA 3QTSA 3R9NA 3BEAA 3KR9A 4FG8A 1M7QA 1OKYA 5EHLA 3UJCA 3NIEA 1U5RA 4FICA 2RKUA 2ITWA 2VUWA 3F6XA 1IAJA 1QCFA 1WBNA 4K33A 4U3YA 3OMVA 5CEMA 5LMKA 4C4GA 4HG2A 1OBGA 5A9UA 3FUTA 5IF1A 3PJCA 3GU3A 2WA1A 2ZBPA 3QC4A 4DEHA 3UYSA 5TKDA 3UJAA 1QL6A 4U81A 4CEGA 3KXNA 4E6AA 2GNIA 4UYNA 5AP2A 2HXQA 4LFIA 4BCFA 2FSMX 3HRCA 5JQ5A 3GDHA 3LCUA 4XUCA 3JWHA 5EMLA 3R8UA 3NDMA 3NGAA 1OL2A 3RHXA 4GFMA 4UWYA 3F61A 4I20A 2RG6A 3HMMA 4QMNA 8MHTA 4FGBA 4QDKA 4FSXA 4L44A 3TV4A 3D2KA 1H8FA 2C5OA 2DUVA 2BR3A 4DG0E 3DBQA 4CKRA 3P78A 1VJYA 4YZ9A 2I0YA 2VNWA 2VO6A 3VWAA 2K4MA 3AD4A 4DEDA 5HX8A 5JN2A 2E9OA 1H07A 3KPVA 3R8ZA 2XNBA 5L2WA 3KU2A 3HA6A 2CNUA 5CZHA 3ZO1A 3BHYA 3CE3A 3G0EA 5DR6A 2VU3A 3OWJA 4YHJA 4Q9SA 5HO8A 4D1ZA 3DJ6A 3R2YA 1NVQA 1WVYA 3SSOA 4DG3E 5J7HA 3TLJA 1IA9A 2CGWA 4ANBA 4RJ7A 1PRYA 2GCDA 4TKSA 4AAAA 4YR8A 2X8IA 3D5XA 4QQCA 3NR9A 4L3LA 4TW9A 5FLFA 3FDNA 2X8EA 4C3FA 4C33A 4F1OA 3DR5A 3G8BA 3IEIA 3UC4A 2R0UA 4EI4A 2DYLA 3SRVA 3W8QA 3LAUA 5CAPA 2ZWAA 2Z8CA 3FJQE 5BVWA 3M33A 4GQBA 2QOHA 4N70A 1XTPA 3C6KA 3MFTA 3FZTA 1RJEA 2XBJA 3AT2A 5LQKA 4PP9A 4ZSGA 4G5JA 4HPTE 4OBWA 3SXJA 1FVRA 3FPJA 2F2UA 1R1WA 4LG1A 5BW4A 5HE1A 1UU7A 4UXQA 5BVOA 2GS9A 2UW6A 4WHZA 4JQ8A 3EIDA 1U54B 3HP2A 2JITA 4X3FB 4EHZA 2BIYA 4L46A 4NL0A 3T7RA 1CMKE 4ZJIA 2W1CA 3UP7A 3QC9A 2ZM1A 3EN5A 4D1XA 5DM2A 3IDBA 3LCVB 2ZV7A 4G2FA 3TUCA 2AC5A 5IH6A 5IPJA 3NWWA 1L3IA 2YWVA 2ITVA 1EIZA 2R3KA 3V5PA 1FP2A 1WCCA 4JDHA 4JDJA 3NUPA 5EQPA 2ZBQA 5HOQA 2XM9A 3OCGA 5LMKC 3GRRA 3V5WA 2VWZA 3ANXA 2B1PA 2I40A 2CKEA 1OBDA 3QGWA 4II5A 4GK2A 5J87A 5C8MA 4JBQA 2WTIA 5LARA 5ITAA 5JQ8A 2GS6A 4RVDA 1PMUA 2AUHA 5CEPA 4X2NA 3QLFA 4AUKA 1V39A 4AP7A 4DFNA 3SDJA 2ZDTA 3EL7A 4HZSA 3D5UA 3QYZA 4BTFA 4DFZE 3GI3A 4HYHA 2WAJA 3ENHA 4YJNA 4EK5A 4F7NA 2ONZA 4ZSAA 5DM1A 3DAJA 4ASEA 4DA5A 3MVHA 3RALA 3E8DA 3FMNA 1NW8A 2QG5A 3KQ7A 2B54A 4I0TA 4APPA 1RJGA 4F09A 4ZS4A 1CKJA 3D2IA 5M4UA 3GWZA 4QDJA 2G72A 1P4OA 2OZAA 5GJGA 2QY6A 3VC1A 3DQWA 3VC4A 2UZNA 4EH4A 1KE6A 4G3DA 3HA3A 2UZOA 3RPOA 5CALA 3VS5A 2QO2A 2CN8A 3Q52A 4YNEA 4A9TA 4QMSA 4BIDA 3RKBA 3F2NA 2C0TA 4C59A 1ZZLA 5GIOE 3HM2A 2X9EA 5T64A 4EVIA 4FIIA 3O4FA 2RGPA 4O2PA 3GU4A 4WNOA 5H8EA 1P2AA 3R7OA 2XRUA 2GQGA 1T45A 4A07A 3QTXA 5KCVA 5KMMA 1WMKA 4JR7A 4RTNA 2BMCA 4Q5HA 3EVCA 4R6WA 2PZRA 4U9AA 3A7FA 1WY7A 3HL7A 3RAWA 3F2AA 4ZTHA 2GPYA 1CTPE 5B1SA 4GFOA 2ZV2A 4M12A 4K6ZA 3UQGA 4YSJA 3GCUA 2PXXA 2Y1WA 3LDUA 3MTEA 3PS9A 4OQEA 4X60A 5CVDA 4U3ZA 3F88A 5HBHA 5EDQA 2XB7A 1STCE 3FZPA 3R02A 4GH2A 1J7IA 2VO7A 1UA2A 3EQCA 2HZIA 3OXZA 4HCUA 4LUEA 1SUIA 2O3PA 3IPHA 3AD6A 3ZBFA 5I9XA 3EEOA 2WTVA 2OG8A 4FL1A 4GIIA 2VRXA 1R18A 1RI3A 2HXLA 4Z55A 2VNYA 4C4AA 5IZFA 4MHAA 3ZUUA 3TZ9A 2QOKA 2GQRA 3N4VA 4CSVA 4FT7A 3U4UA 3P2KA 3O71A 4KWCA 2BDWA 5AEPA 2PJDA 3GU6A 3UZRA 1R0EA 4B0GA 5LMAA 4LOPA 2QHNA 5ANKA 5CT0A 2DULA 3VVHA 1OI9A 3WILA 2PMNX 2XIYA 5D11A 3U6HA 3KB7A 4O7NA 4O0VA 3ITZA 1VE3A 4FEWA 2WQBA 3EQDA 3DNDA 1OZ1A 5ICFA 3G89A 2ZYBA 1M7NA 4WNKA 2QU5A 4XV2A 2YCQA 3LKZA 2GFSA 1IAHA 2XM8A 1YXXA 4M68A 4QP8A 5CWZA 3MFUA 5EYKA 5IQHA 4MHTA 4GBED 3QZIA 5D1JA 3Q6UA 4EOQA 2OICA 4O7ZA 4I6QA 2B4SB 3UBDA 4ZTMA 4DCAA 3DZOA 3LKMA 2FSTX 2XIXA 5KQRA 4JLCA 5MHTA 3CJFA 3BV2A 2YJSA 1ZYSA 4CMTA 3GCZA 1QPCA 4AW2A 4R3CA 5CLPA 4I93A 3OPNA 5C27A 3D0EA 3L8SA 5E8TA 4U7TB 5KE0A 4NTSA 1P14A 2XJ1A 3OZ6A 3QD4A 4FNXA 4I5CA 3OCJA 4IFGA 3HMOA 4F86A 4O38A 4B8MA 1F5QA 4ZY6A 5KZIA 5FA5A 3TN8A 3QCQA 4V0RA 3KQYA 1X8BA 1H1PA 2R3FA 4J7BA 5DRBA 3UC3A 1KWPA 3BYSA 3ZS5A 4PYLA 2NNWB 4WSYA 1Z57A 5ACBC 5CAOA 2HWOA 1X1CA 3CP9A 3VUMA 3FI2A 3OG7A 3TIYA 3TZ7A 3W18A 2BM8A 4PYIA 2C3JA 2Y4IC 3BPRA 5BUIA 1YI4A 3ME5A 2JFLA 3BGZA 4R5YA 2X81A 5BMMA 5GOZA 4CG9A 3LFSA 4PL4A 3EN9A 4IAFA 4EBVA 3PVGA 3PY0A 5HNIX 2B9HA 5DR2A 3I1AA 2ETRA 2C1AA 2AOUA 4ZJVA 4FTKA 4O86A 1JSXA 3BIZA 1Z5MA 4LRKA 4EQMA 5AAEA 3E8CA 4O0SA 5DG5A 3P7BA 5ANJA 5DHJA 2Q41A 3GCVA 4R1VA 2RFSA 4QTUB 5EHIA 3OD6X 2WMUA 4M69B 5K0CA 3PVBA 4HNIA 3MIYA 2DWBA 2X7GA 2BZGA 2VO3A 2VDVE 4XUDA 3ORXA 5CNOA 4L68A 5FWAA 1G55A 4QP1A 3CVOA 4FMQA 1YXSA 3PIZA 1FGKA 4PYQA 1O9GA 1VPTA 4FZDB 4O0YA 4W8EA 5E2AA 3ZLSA 1F3MC 4CKCA 4EWQA 2AN5A 2PSQA 3CPCA 3LCTA 3ZONA 2PZPA 2BHEA 2YDJA 3O17A 3LW0A 5EHYA 5T3QA 4EK3A 5JSMA 5JT2A 4ZLYA 5M07A 3OU2A 5IKMA 4NWMA 2P2IA 3UPZA 1ZLTA 2OJIA 3L9MA 4WOVA 4N6YA 3E5AA 1JQEA 2C7PA 4M0ZA 3UE4A 4TPTA 1ATPE 2WGJA 4PWYA 4J97A 4S33A 4IDVA 5CVHA 3DXZA 5E2BA 2PMLX 2B53A 3DB6A 3GVUA 1GZOA 2F7ZE 3I0QA 3MFSA 3UOLA 4EC8A 2P1DA 1RI1A 5I9UA 1ZGJA 5FHQA 1AQIA 2WMTA 3JVSA 1UFKA 5LQUA 4G16A 4ISCA 3KQTA 3EFLA 2PT6A 1Z9XA 2BDFA 5L6PA 1OPJA 4ONAA 4DEGA 4GF5A 4USFA 2XNOA 4E4XA 2JKQA 4BHZA 2OIDA 4L3JA 4X2KA 1NV8A 4C4JA 5IA4A 3IW4A 4GK3A 3UG1A 1WBTA 1KPIA 4EORA 3ATSA 3TDWA 5DWRA 5FULA 1R0PA 2X8DA 3DU8A 4YHTA 3RK5A 2NXEA 1W0XC 5HIMA 1J91A 4PNKA 2XNNA 4B6LA 1RJDA 5T67A 4POOA 4JT3A 4RJ3A 5E9JA 5E1MA 3P7AA 5JEBA 3E3PA 4GVAA 3QAME 4TTHB 4CKIA 5DM4A 3SVVA 4O22A 5CVJA 5DE2A 4HVDA 3R8PA 5GIPE 2P55A 4HGYA 4RTLA 2VWVA 2CNQA 5C9ZA 3LXNA 4KSQA 4V0GA 2V62A 4IZ5A 2A0CX 4L42A 1DS5A 3VBYA 4IC7A 5U4XA 3PIYA 4RBLA 2Z7RA 2WQOA 3KXZA 3UYTA 4YUWA 4BDKA 4WBOA 1XBBA 3TXOA 5EIWA 5E8XA 3PVUA 4U41A 3UJBA 4PYJA 2XK9A 3H3CA 3PP0A 3T3VA 1Q3DA 3UIBA 3ZYAA 3KRJA 3FHRA 1ND4A 3PB3A 4PIMA 4MQ1A 4C3RA 3BHVA 4ASZA 4RX1A 4QTCA 4QQKA 3EFKA 4EHGA 4E1ZA 4ER7A 1JTFA 4YZMA 3C50A 3KMWA 4F9AA 3P86A 1LPUA 3C0GA 3ZO3A 2W96B 4A7CA 4F99A 4MWIA 5K5NA 3DJ5A 3FC2A 3QL8A 1XH6A 2EUFB 5AV0A 3C4WA 4ER6A 2BR1A 5CSHA 4D28A 4C35A 2XMYA 1Y6BA 3ENMA 4ANMA 5A4TA 3CSVA 1B42A 3OBGA 5B2MA 3TKUA 2PY6A 2WB8A 4EK6A 5EKUA 5CXHA 1JNKA 2RL5A 1U4DA 5E8JA 2XS0A 1RJFA 3FI3A 4TYGA 2YITA 4XRLA 3B8QA 2QR8A 2WQNA 3THSA 2HENA 2WMXA 3Q4UA 3FPHA 4RA5A 2Y1XA 4YJTA 4FSRA 2PU8A 2X1NA 4QTAA 3ZZEA 5DIAA 2OJGA 1UU3A 1ZMVA 3VBQA 4Y5HA 4ZXTA 4P7FA 3R7VA 4G56A 2RFDA 1KV2A 1XH4A 2R7BA 5DT3A 4PMTA 4ZSEA 3A61A 3MCTA 3AC8A 2BRNA 3VULA 4RIWB 4U43A 2XKDA 3VUGA 4BI2A 4M3QA 4X0MA 1REJA 3QTUA 3T8OA 2GA9A 2VP3A 4EOMA 1RJBA 3D7TB 3ZFXA 3TR6A 4BCHA 4RTRA 1LR4A 3IG7A 1M14A 3W10A 3DMGA 3KQOA 4CCBA 3I64A 4E70A 5CANA 3ORPA 5L2SA 3ZH8A 4DBNA 3KRWA 1JG2A 4IBMA 4RTOA 4EJ7A 4FIEA 3BYOA 3B89A 1FJXA 5KMJA 3PXQA 3MGGA 1YZ3A 1R6AA 2UV2A 2NXJA 4AGCA 5C4LA 2GH1A 3SA0A 1R78A 5BVKA 2VDUE 4R6XA 4NUSA 4DC2A 3R0QA 5DSXA 2JH9A 3KVWA 3RWQA 2IDJA 4O0XA 2CWWA 4KRDA 2H96A 4IHPA 4AFEA 2E2BA 2IZRA 3DXYA 3ELWA 4O83A 3TQSA 2IW9A 3PVWA 3DMFA 5LQFA 3L8DA 3OP5A 2QOFA 1W83A 1F38A 1YXUA 2R3LA 3EFJA 4UZDA 4O96A 4XBUA 4A9UA 3SOAA 1SUSA 3IW8A 3POOA 2CGXA 2YIYA 2OF2A 2PVYA 3A60A 3DA6A 3BHUA 3IGOA 3JUHA 4FV4A 4JX3A 1RI4A 3QWKA 2IJMA 4FTUA 4QQJA 1PXIA 4IM3A 3TACA 4ACMA 4CMUA 3A4OX 3BEGA 4J53A 4ZTSA 2X4FA 1XQZA 1WG8A 3M70A 3TOSA 3LFQA 3OT3A 1W8CA 2YM5A 4ARKA 2CKQA 4QYGA 5IQCA 2BFYA 1KR5A 2UYOA 2QODA 2ZDUA 5HVYA 1JVPP 5E8ZA 2Z6UA 4RLKA 3LQ5A 3LBFA 1JKKA 3K5UA 4U45A 3U4WA 4ZMEA 3SXSA 3U55A 5GINE 3FL5A 3MY1A 3SOCA 1T43A 2QRVA 3HCAA 5AFVA 4GOOD 4D1SA 3DP7A 4ERKA 3GC0A 1MRUA 3LIJA 3RNIA 4L6QA 3LFNA 4P58A 3QTRA 3HVCA 2V22A 2Y8OA 3QUPA 4L00A 5AV3A 5IQIA 5IMEA 3GJYA 5EOVA 4EH9A 5GM1A 5HX6A 2C5NA 3UG2A 4XRJA 2ZM4A 3VC2A 4NFMA 3WE8A 1RI2A 4BLUA 2A27A 4O7SA 1UV5A 4BR3A 3PSCA 2ZZNA 3KMMA 3I5ZA 1FOTA 2VTQA 3R30A 4FEVA 4JJRA 4S32A 2VTHA 3HRBA 1UNHA 4PGGA 3QA0A 4V0GB 1WZYA 5I0BA 3UNJA 5M44A 2BIKB 4BCQA 3ZM4A 4F64A 2JKOA 4YHFA 1YB2A 5KMOA 3VRZA 2XNGA 4X41A 3GCPA 3HRFA 3OCBA 4GUEA 2H8HA 5CEQA 4NU1A 2CDZA 2PSSA 5K03A 4UOEA 3DKCA 1PXNA 2W1IA 5HG5A 3PXZA 3GEQA 4MNEA 4TRLA 4KRCA 3G51A 3G90X 4KKGA 4KS7A 3VUIA 4F63A 5F1ZA 3WF7A 4FKIA 3WIGA 2HOGA 1UKHA 3CY3A 1KPGA 5LMBA 5EW8A 3OWLA 5KVAA 2ZBRA 4R8RA 3EYGA 4BB4A 5I9ZA 5ANOA 2C47A 4S2ZA 1B6CB 3H9FA 4ZSLA 3HUBA 2XVMA 1B38A 2YDKA 3I6WA 1GZNA 1ZHFA 5AJQA 3AWIA 2O0LA 5F2NA 2YEXA 4MXYA 4JOAA 4ASDA 4FEUA 4CTBA 3G7UA 3AC4A 2F8LA 3CIKA 5KUPA 5CVEA 5D10A 2RG5A 3VS6A 4YNOA 3S4QA 2F4JA 2BAQA 4YGAA 4DTBA 2QKWB 5CU4A 3L9LA 5L6WL 3R63A 2C3KA 4IM2A 4JS8A 3DLCA 3FUWA 1Q61A 4QMWA 2IH5A 4G1WA 4AE6A 4C36A 3R28A 5FRIA 5K4IA 3HNRA 4CVAA 5L6OA 1H24A 2JJQA 3PVCA 2IN6A 3NVMB 3QQFA 4YTCA 2YCFA 3DDQA 2WMQA 4R7BA 1J1BA 1XDZA 3F3ZA 4QMPA 2YXEA 1S9JA 3SV0A 2JHCA 5FCDA 5HVKA 4YUVA 4PDPA 2VV9A 3QKLA 2JDOA 4C02A 3UOJA 1PXLA 1Q99A 4ZEGA 3M1SA 4RJ5A 2C6MA 5D1HA 3KL8A 3MVJA 1ZOEA 5EDRA 2ZIEA 4DA4A 2C7RA 3CQWA 3PLSA 4RLLA 5DX1A 3HKOA 1NVRA 1M2PA 2Q83A 2ZZMA 3PXFA 2PZ5A 4OTHA 2XKEA 2FHPA 3EVBA 3KF4A 1JSZA 1JWHA 2XKCA 4JXFA 1F0QA 1Y8GA 3FC1X 5BP7A 4Z16A 4DLJA 3EQHA 2QR7A 4RVGA 1WVXA 4RWLA 3COMA 5AV1A 4FT2A 4MXCA 4DFXE 3GRZA 2YXDA 5DXAA 3WYYA 3SSMA 4MNFA 5FG8A 3OWKA 4AE9A 5DVRA 5C9CA 2R3RA 3HA7A 3QA8A 2IDKA 3CBGA 3BELA 3QRTA 3EGEA 3FXXA 4MXZA 3NAYA 1HNNA 4D55A 1G6Q1 2AOXA 4LI5A 4DGLC 1M6YA 3FZRA 4PYNA 2F2CB 3MA6A 4X3FC 5IISA 4ALVA 3Q4ZA 5IMXA 3HV7A 3NDIA 4GT5A 4O6LA 2JLDA 4GG7A 2IH4A 4UWCA 3DAKA 3EVGA 2CHLA 2E9VA 4S30A 5GNKA 3W16A 4MKCA 3WF6A 3Q4TA 4HVGA 4DGNA 4L01A 2YQZA 4O6EA 2WMBA 4AQCA 2WXVA 5FDXA 5JK3A 4BF2A 1FVVA 5E9EA 2XK7A 3VS0A 2XH5A 5IU2A 5EIFA 5B2LA 4QTBA 2FGIA 3UJDA 4IVAA 1ERKA 2Z60A 1OMWA 1EQAA 3S0OA 1QAQA 4RTJA 5A6NA 3EVFA 3DV3A 4APCA 5M5BA 3KPWA 3OW3A 4OBXA 1AGWA 2C5VA 4XBRA 3Q96A 3QTQA 4O81A 4HPUE 1YI3A 5CU6A 4EWHA 5AA9A 4RWZA 2B52A 4IWPA 4A9RA 3CJTA 5ICGA 4BRXA 2A14A 3MH0A 2EFJA 4M15A 2PVLA 1M52A 4YJSA 1S9IA 3QZGA 2ZLBA 2UVZA 2JDVA 2UW7A 2R3HA 3OUNB 4HGEA 3NCGA 3PWDA 4N0SA 4N57A 4RJ8A 4IH8A 5EG3A 5IA2A 5EQJB 1QPJA 3NNWA 2XEYA 4EKKA 4D4RA 5FHRA 4YP8A 4M37A 3E8NA 3W2RA 1YZHA 3PXYA 4GKHA 4IZ7A 5EW9A 4HTFB 4KUJA 5TT7A 3AD5A 1VYZA 3KGAA 2YABA 4IDTA 4DM3A 3EKKA 2QRVB 4WUAA 1PJZA 5HG9A 3TUBA 4ZP5A 2AOTB 4FV0A 5ANIA 3ER8A 4L7SA 2FB8A 4I92A 4PNEA 4NM0A 5K3YA 3BYUA 5DGZA 5BNJA 2P7HA 5HVJA 3QFVA 4O0UA 3EWHA 3HEMA 5DWQA 3G6HA 3W33A 3ZUVA 1XCLA 4UWBA 2VDWA 1U46A 2A4LA 3LM5A 4NM7A 5HESA 2ORED 3SM3A 4BBMA 4DH3A 3VF9A 4PONA 1KE8A 4Q5EA 2OH4A 4BDFA 5DN3A 3C4EA 3FBVA 4GYGA 5FP5A 4RX5A 1KUTA 2RIOA 1P1CA 1VL5A 1SZMA 4I6HA 3B5IA 2YX1A 4PDOA 3JWIA 1OL6A 3OXTA 4AG8A 1I09A 4WD5A 4EUTA 3AJDA 3T7TA 5LQJA 2R3IA 3FKOA 4W4XA 3VO3A 4BDJA 2CN5A 3FPEA 3FMLA 3Q32A 1ZZ2A 3C4ZA 4BGQA 4FV5A 4E8AA 1NW6A 3TNPC 4U80A 1YDRE 5GJFA 3AMAA 4AW1A 3AGLA 2PVCA 2V7OA 2VAGA 4AT5A 3E62A 4AS0A 3RK9A 5EOLA 3GRYA 4F6UA 2PT9A 3P08A 1QPEA 3E8EA 3KEXA 2HNKA 4CXAA 3CQEA 3AXTA 1R00A 4WBBB 4O91A 5L8LA 5LXMA 4QP9A 3TZMA 4CFMA 1IR3A 2IH2A 4R3PA 3BWMA 3U87A 3UJ8A 4RWKA 4FV9A 3D7ZA 1JR4A 4GOLD 4XV1A 3R6XA 4KKEA 1UNGA 2G01A 3AMBA 4M14A 4TYIA 3H30A 2QC6A 4XP3A 3EL8A 5CS6A 1E1XA 2OZOA 3RAIA 4AT3A 3HNGA 2PVNA 1O6LA 4IWOA 4O7WA 2IW6A 3E7VA 2J50A 3F7ZA 3POZA 4GMYA 5K9IA 1NE2A 1PKGA 5BW5A 2YUIA 1FP1D 2HR1A 5GHVA 3AC2A 3PJ3A 4PCAA 4E6DA 2AOVA 3VQHA 5HO7A 5I5ZA 1GZ8A 4AZVA 3Q87B 4FP9A 3KPUA 2JGZA 3QX2A 2QU6A 4AX8A 4CRSA 2O05A 3HEGA 4U40A 3QUEA 2GTMA 4I5PA 4IZAA 1H1WA 3I81A 4DYMA 4ZIMA 2FPOA 2BRGA 3EJ1A 4LG4A 2V7EA 4GK4A 4FT9A 3KQQA 4E32A 1SNXA 4DHFA 2WQEA 4L53A 4XG8A 3U81A 1CDKA 4GUBA 3M4XA 3LFAA 4PY1A 2C5YA 3H4JA 4DTAA 3RIEA 4YUZA 3R21A 2J9MA 3C4XA 1OB3A 2WO6A 2CGUA 5CSXA 4BDEA 5LOHA 3O7WA 2ZJWA 1BKXA 3HCCA 3MESA 2F7XE 2UVXA 3PWYA 3H10A 2DS1A 3MBLA 4UYAA 3PZEA 4JVGA 2WEIA 2R3MA 1L8TA 3FQSA 4QMXA 4QTEA 3D14A 3ZLXA 2ADMA 2VTRA 2LD4A 1YDTE 1PKDA 3NNXA 3LBYA 3MDYA 2EVAA 4ITHA 4OGRA 5AIRA 3CBLA 4TY1A 3S95A 1JQDA 2AVDA 4P5QA 3VBXA 4EBWA 3GO4A 3N51A 3IECA 3AG9A 5EM7A 2ITPA 3ODYX 4KBKA 4BYIA 3FLYA 2GHLA 5IQFA 5KX8A 4JAIA 4GOMD 3B8RA 4Y8DA 1OIYA 4IB0A 4MH7A 2PKWA 4QYYA 1ZMUA 5ACKA 4NM5A 2XCKA 2PTKA 5DT2A 1Q4LA 2OIBA 5JH6A 4RJ6A 4ACCA 2EWAA 4PINA 2G9XA 4YSMA 5G1XA 2VWYA 1Y91A 3MA3A 2W4OA 3OF0A 1JSVA 3U51A 3VBVA 3VW6A 3Q9YA 2Q0NA 2PX8A 3CQUA 4CLIA 2XYUA 1W84A 2R0IA 2J0LA 4RIYA 3E93A 4A9YA 2WA2A 3X0DA 4FTTA 3W1FA 3S00A 4D4SA 3QTZA 3A7IA 1ZKDA 4M38A 4QP7A 2JBPA 2HK5A 4RMZA 5AIKA 5KQSA 1RE8A 4GV1A 4P4CA 4QNAA 3R00A 3QV2A 2QI8A 1KOAA 4WRSA 2GSFA 4QYHA 2ITTA 4B8LA 4D9TA 3W2PA 4GRBA 1BOOA 4ZTBA 4FUYA 4I23A 3GC9A 4PL5A 4UXLA 2R3OA 4X2JA 3FEGA 4OTIA 1NBIA 3IS5A 2PXAA 4C06A 1M6EX 5K0EA 4DGOA 3MCZA 1PXPA 3QKKA 2LGCA 4JR3A 5K0LA 4A4OA 2G70A 4X2FA 3HVKA 3Q9WA 2W1DA 2E9PA 2Y6OA 4L7FA 4L7VA 5GP1A 1V0OA 1NT2A 2PE2A 1XJDA 1CKIA 4YURA 3MSSA 3H2BA 3EKNA 4FBXA 5TF9A 3E3BX 2EJTA 2ZB0A 2FRXA 2PMOX 3AQVA 5A4QA 4YLKA 4YZCA 3THRA 4FVPA 2VWBA 3UNKA 3FRHA 5EOBA 3OE4A 3NW5A 2OH0E 1JKLA 4NW6A 2UZLA 5F4NA 2B9EA 4DFUA 3GGDA 1LP4A 3NPCA 4PWNA 4HTFA 2NP6A 4WG4A 3CY2A 3OE5A 1ZMWA 2X6DA 3DULA 3R0TA 4WKQA 4D2RA 2I0VA 5LVPA 5IA1A 3C3PA 2VGOA 3NUNA 5CAVA 2QOOA 1I9GA 3QXPA 3MV5A 3RCDA 2I0HA 5HU3A 1UIRA 4OTGA 3ALOA 3A7HA 2JIVA 2YCSA 4CGAA 2R2PA 4BCGA 3BKXA 3P5KA 4X63A 3CXWA 4M67A 3V5TA 1BI8A 1AF7A 2AYPA 1SNUA 1O9UA 3SAYA 3TM0A 4F65A 3RAHA 3FZ1A 4F08A 1IY9A 4RG0A 5KZ0A 3WOWA 3SVZA 5LR6A 5BUEA 4E5WA 3JS2A 3R9DA 2JH8A 3P71T 4LRJA 4YUXA 5DXJA 4FNWA 1ZYDA 2F9GA 4IEBA 4FR4A 3HGKA 4J95A 4HCTA 3SG9A 3MTIA 3DOGA 3CD8A 4OR5A 3UBTA 4PX6A 1OL5A 4A4LA 1XO2B 5A4EA 5E8UA 1DAYA 2YM6A 3VS1A 1M2RA 3GUBA 3PSDA 1V0BA 4GYIA 3VS3A 3FRIA 3SC1A 3DPKA 2OZAB 1O9HA 3DT1A 2B25A 1H1QA 1KE9A 1MQ4A 1UWJA 4K2RA 3EVDA 2NYUA 3REOA 2FO0A 3O8PA 3FL4A 5ANGA 3HVIA 4O7LA 4EK4A 1GIJA 3AGMA 3CR0A 3DJ7A 4IVDA 5JRQA 3G2QA 2NP7A 3TM5A 3ORLA 3G15A 2HTEA 4ATNA 5CASA 4KIOA 4RZVA 1YW2A 3NYXA 3GFEA 4Q9ZA 3LL7A 1ORIA 3ZSHA 4EH8A 3NAXA 2BZKB 3DMHA 4X61A 4O82A 2VN9A 2UZEA 2BZJA 4NSTA 4CQEA 1JQHA 2HV9A 1H27A 2JAVA 1J7LA 4FKUA 3BWJA 3QCYA 2O0UA 3ZZWA 5DTRA 4V0QA 4IV8A 2FYTA 3ZTXA 2YXLA 2W06A 2H6DA 3T9TA 3PY3A 5EEHA 3L8VA 3R04A 3PE2A 3BBTB 4R7HA 4ORKA 3VHKA 4MBLA 3DBFA 3F5GA 2OSCA 3GC7A 5DT0A 5EYMA 4AACA 4BICA 4I4FA 1H1RA 4C61A 3PX2A 4Y30A 4WT6A 3KQSA 4P2KA 3CC8A 2Q0BA 2ONLC 2HWPA 3E88A 3Q53A 3LLTA 5CENA 3PA3A 5KMIA 4H3PA 3FPMA 3K6RA 2UZTA 4J99A 4EOPA 3UWPA 4QNYA 4DEIA 4XEYA 2Z6QA 4DAWA 2CCIA 4ZY5A 2GS7A 2VX0A 3KN6A 4FT0A 3ELYA 5DM0A 4UN0C 1XKKA 4H58A 3SQQA 1KV1A 4BCKA 5KKRB 4XCXA 5FBOA 3K2LA 4ID7A 2G1PA 4FSZA 5HIEA 3MERA 3MVLA 3IDCA 3ORZA 4M13A 5EQEA 2Y4IB 4EEVA 1Y57A 4XUFA 5CU0A 2X2KA 3CKKA 3NEWA 2HAKA 3ORHA 2ZB1A 1ZYJA 3N4TA 2X2LA 5M08A 5AA8A 1UKIA 4H05A 2GDOA 4E6QA 4FV6A 5JMSA 3CCFA 5JRSA 4RYLA 3IYLW 4EUUA 1VIDA 4JQEA 3OXIA 4IE9A 4R6VA 3EVAA 1G60A 4X1OA 2GNJA 4XG3A 4YZBA 3LXKA 1X1BA 2F49A 1NKVA 5CSVA 5DEYA 3R1QA 3VS7A 1YXVA 3FLSA 2ZULA 4ER0A 3QHRA 3F3VA 3M6XA 2GNGA 5G6VA 3H0YA 5E91A 3M6VA 1O54A 3TNQB 3KQMA 3HA8A 1YFJA 4V04A 2HY0A 4ALWA 3T0IA 1NV9A 2ETKA 3CJGA 3KRXA 5FM3A 2Z6AA 5J8IA 4YBJA 1NY3A 3TUDA 3KQWA 4GOND 4BDBA 5E9WA 2QQ7A 2VX3A 3MH1A 4QTDA 4PDYA 1XVAA 2KW5A 4E2YA 2GQSA 3R83A 4FTOA 5ERGB 3A8XA 4H3BA 3Q9XA 1URWA 5HORA 3P1AA 5EI8A 1NW3A 3HMIA 3ZXTA 5CUQA 5CD1A 3ANQA 4FG9A 1MUOA 2PVFA 3OWPA 4HYUA 3SSNA 3GBZA 5HHWA 2YACA 3SRVB 4CKJA 3UA4A 4RJ4A 5K0JA 4F0GA 4HYSA 4ASXA 2JFMA 4QMZA 3MPAA 2I62A 5B7VA 3FI4A 4USEA 2G2FA 2ONLA 3OBJA 3R71A 5L3AA 4MIKA 3ZDUA 4R1YA 4EK8A 5M4CA 3I58A 4CT2A 2QE6A 4YMGA 4B17A 3EQFA 1H4LA 4NZWB 4G9CA 5BMSA 3Q2JA 3EMDA 3HCBA 3UZTA 4RTMA 4U6RA 3V51A 2VGPA 5AP5A 5IH4A 2O64A 2WQMA 2YZLA 2OW3A 3Q6WA 3QF9A 4NH1A 2X6EA 4BC6A 2QOIA 5AUYA 1HCLA 5LVLA 4FT3A 2RF9A 4D58A 5H9BA 2YIRA 5AM7A 5E8SA 3KPJA 5K0NA 4F85A 3GFWA 1L1EA 3BWCA 1WS6A 2RFEA 4UB7A 3ZFMA 4F7LA 4WO5A 5FTQA 3ZC5A 3R24A 2WTKC 1VYWA 5EVJA 5HILA 2ZV8A 3LM0A 4FKGA 1TQPA 3PPKA 4G3GA 4MF1A 5DH3A 3GRUA 1UU9A 5IQAA 2OWBA 3OFMA 2XEZA 4J8NA 4XNEA 4YJQA 5EW3A 3SMQA 1MP8A 2WZJA 2WK1A 3TRKA 4H39A 4TT7A 1VLMA 3LE6A 3KRLA 4LGHA 1P39A 4AOIA 3QTWA 5HG8A 4IB3A 2CL5A 5M55A 1WFCA 3BU5A 2V7AA 4FKPA 5ANDA 2W17A 3MW1A 4OBQA 4RX9A 4X3FA 3SR4A 4K8AA 3S68A 4RTPA 1E9HA 1URCA 3HP5A 4EOLA 3KPYA 1JBPE 1PYXA 3LSTA 5EMMA 5HIKA 3LFFA 3UQFA 2XYVA 2YISA 3AC1A 3R9OA 5TO8A 3TV7A 2UZDA 1P1BA 3HP7A 3WF5A 4XUEA 4BP1A 1YDSE 4CNHA 3P9NA 3HDMA 2YIXA 3ANRA 3HMPA 4RIXB 2WPAA 4TYHA 3BKWA 1WBSA 4P7JA 4Y85A 2W1GA 1EAMA 4FEXA 3DGKA 3JR1A 3R8LA 1JSUA 5EKXA 1L3RE 2XIZA 4NM3A 5HNBA 3G8AA 4P7KA 4GS6A 4C38A 2OYRA 3OVVA 1Y8CA 4CKBA 4USDA 4OQDA 4FNZA 1SQGA 2NXCA 2B9FA 2UYQA 3O31A 4A9SA 2PWPA 1FGIA 4FKWA 4PCLA 4UALA 1JSTA 3LXPA 1VBFA 5LSAA 4BLWA 5ETFA 4AZTA 4RIXA 2X39A 5FXQA 3OY1A 4TYHB 4BYJA 1KIAA 2ZCJA 2GB4A 5A3XA 3A99A 3BGDA 3KXGA 5G02A 5J1VA 4E2XA 2CMHA 3A2CA 4G6OA 4AZWA 3A7EA 3QRIA 4A4XA 2OKRA 3O0GA 3M6UA 1ZARA 4QVGA 2PULA 2UW5A 4FTCA 4MX9A 5LQRA 4U8ZA 4D5KA 3W2QA 3QQJA 2GMXA 3C5UA 4QT1A 1H08A 3LVPA 3UODA 4KIQA 2O07A 5K8VA 4DH8A 3PDTA 3BQCA 4F6SA 5JZJA 3FXWA 4FIFA 5CCXA 4RTKA 3CKWA 3LXLA 4CTCA 2GLUA 1CM8A 3V8VA 4IACA 3FMMA 4WG5A 3W2CA 5IH3A 1XXLA 1PXMA 4LYNA 5AP7A 3TV6A 3R1SA 3QHWA 3QD2B 4CFFA 5E8VA 4O21A 4C58A 4DE4A 3IOPA 1XH8A 3RWPA 3QD3A 3HVJA 3ZC6A 1NVSA 3TKIA 1DUSA 5L8JA 3ORTA 4E26A 3JVRA 4L9IA 4GFGA 4XLIA 4YJUA 3LGAA 5FTWA 3REPA 4EK9A 3TDVA 3W55A 4NECA 4GC9A 2J90A 4YC3A 4Y5QA 4QMQA 4FC0A 3ZLYA 3O50A 2G1TA 2E9NA 2VD5A 4FKVA 3BU3A 3E87A 4YO6A 3KR2A 3MB5A 3DKFA 4KIGA 3BZ3A 2FVDA 3G88A 5HZMA 5DT4A 5EZQA 5M53A 3EZVA 3LCCA 3KC3A 3UO6A 3MYGA 3H9RA 2XK4A 3MH2A 2C7QA 5HIJA 2YM8A 4Z7HA 5KBRA 2XNMA 4FKLA 3QOXA 1H1SA 2XBMA 1YI6A 1YOMA 2OJJA 2XNPA 3E05A 4GT3A 4I0RA 4JL9A 4YJVA 2BTSA 2VTIA 3PJ2A 4EH7A 4KKHA 4HVSA 3KN5A 2WMWA 4QPAA 1Q24A 3NTVA 3FMDA 1I4WA 3V6RA 2IVUA 4AA4A 2O5KA 1NXKA 2PUUA 4BKJA 3TG1A 3MH3A 1ZOHA 1XHAA 4I24A 2F57A 3EZRA 5CZIA 2GFCA 2CKDA 3CC6A 3G5LA 1LEWA 2FYSA 3KU1A 1XDSA 3DXNA 2CMWA 5CVVA 2AN3A 3MFRA 5BVFA 3TTJA 2XIRA 4JNWA 5D7AA 3G0FA 3NIZA 5AP4A 2ONYA 2PUNA 4CFWA 2O65A 4RIYB 4DINA 4DH7A 2J5EA 2HY81 4AT4A 4YMJA 2ITNA 3FZGA 3IV6A 5LQCA 4FNYA 3GOKA 4FSYA 3BGIA 3IO7A 2R3QA 2P7IA 5DSTA 2ZSUA 4OTRA 3EHAA 2HZ4A 4JI9A 1JKTA 3UIMA 4J52A 4E2WA 5JFXA 3UFBA 3DB8A 1A06A 4KBAA 3O8TA 3FTCA 3HZTA 3RTPA 3C51A 3LQ8A 4FTRA 4HGSA 3RCJA 1LUFA 3V5JA 4FYNA 1QANA 5ETCA 2W1HA 3CKXA 4MCVA 5IDPA 3JWJA 5HG7A 2ZW9A 5F2KA 2N47A 3PPJA 5EMJA 2HIWA 3DS6A 2J5FA 4GU6A 2PE0A 4C0TA 3FHIA 2ACXA 2ERKA 2AN4A 4C05A 1SYKA 4L67A 3DXPA 4RC2A 5EM5A 3NLBA 3UIUA 4O0WA 4KW7A 2JIUA 2QHMA 2W1EA 4IQ6A 4ACDA 1QZZA 5E8RA 3GGFA 4DQ0A 5FUBA 3NYVA 2JKKA 3EFWA 5FEDA 3VSEA 2PK9A 4ZSJA 3ER9A 2IIPA 3MQ2A 3AXWA 3EQRA 5DEWA 2VWWA 1JAMA 2C68A 4RVTA 4D4VA 4IJ9A 1PXOA 4IM0A 5EKOA 5AMNA 4CZTA 2CLXA 3P23A 5JGBA 2QVSE 3WF8A 3HV5A 2QO9A 3QCSA 4AGUA 5LCJA 2GPHA 2H34A 4DEBA 4YPDA 4FI1A 4GG5A 4JBVA 3QZHA 3HDNA 4IX6A 3TTIA 3G5TA 4MEDA 1U54A 3M11A 3P97A 2AOUB 5AP1A 4UBAA 4R5SA 4J1RA 5M4IA 3GT8A 3KULB 2NO3A 4WVLA 4JDKA 1Q8WA 4L3PA 5HQ0A 2VTNA 2YAKA 2ERZE 3GQLA 4YUQA 2IP2A 3I6UA 4FZ6A 3UIXA 3VYWA 4PNIA 2OIQA 2J0IA 4FIJA 3FMHA 4FSNA 4I4EA 5HE2A 2ESMA 3DLZA 4LOQA 3MY0A 2G71A 3F82A 3LFDA 2GS2A 1VP9A 3NX8A 4NYEA 4U7PB 5KMNA 3WE4A 1TQMA 4GW8A 2FUMA 4ENYA 4LRMA 5LVMA 3FI8A 1G5SA 3F7WA 4KRGA 4L43A 3TT0A 5F9EA 4R8SA 4JBOA 2OGVA 4Y46A 1OL7A 3TCPA 4Z2YA 4DMGA 3BCEA 1ZQ9A 2H1RA 3QTIA 5H8GA 3IDPA 4DTKA 2JEDA 3N4UA 5AAFA 3NYOA 4BDCA 1D2HA 3UOHA 4KD1A 2BR4A 1TKIA 2ZVAA 4ALUA 5CF5A 5HZNA 2E5WA 1Y8YA 3EH9A 4E5BA 3EQPA 3K54A 3NWBA 3OOMA 2C30A 2PZIA 1KPHA 2R6ZA 2ZFUA 3TKAA 4CXMA 3CLYA 2PXCA 1OM1A 3MWUA 5EQYA 3SKCA 3PZHA 4F6WA 3BWYA 3VIDA 1JLUE 3VRYA 3FMKA 5I9YA 3Q5ZA 2WU7A 3G2OA 3NJRA 3D94A 4RC3A 5DTQA 2OBJA 1WXWA 4OTQA 3P4KA 5CM2Z 4G3EA 2WKMA 3BT7A 1GAGA 5BUJA 5AAGA 1ZOGA 4FYOA 4P90A 4JDIA 5JKGA 5BXYA 4FSTA 3SG8A 4XJ0A 2UZUE 4HGLA 2PX4A 3QD0A 2VWUA 2QM3A 2PYWA 1U2ZA 5DLYA 3TPZA 4XOZA 3ORMA 2XVDA 1Q3WA 3DBEA 4IX4A 4X3JA 5DLSA 4PV0A 4EZ5A 1X1AA 1HMYA 4FV1A 4HC4A 5KNJA 4DZRA 2UW0A 4FL2A 1P91A 1XH5A 5K5XA 4CCUA 4KWPA 3U8WA 3LCDA 4LMNA 5J1WA 3BLRA 4TZRA 4FSDA 3ZFYA 2XF0A 5HBEA 5F95A 4PYMA 2ERCA 2CPKE 3OTVA 4IAIA 5HI2A 4BY9E 3ZEWA 3HV3A 3FXZA 3BZBA 4HW7A 4OW8A 4O7VA 3QQLA 3BUSA 3FTDA 4ZLOA 4M7IA 3PXRA 2Z2WA 3G9LX 1DAWA 3H0ZA 4FODA 5KBQA 4LL0A 4YC6A 3ZM9A 2P41A 3LKDA 1TW3A 4H1JA 3GU7A 2WMVA 4C4IA 2ZM3A 2R3GA 3TKHA 3ZXZA 5ETIA 3C5IA 3SLSA 1SM2A 3IONA 4F7JA 4K0YA 1GJOA 1DM2A 2CNVA 4MBJA 5M09A 2WTWA 4J98A 2BKKA 2REIA 2Y9QA 4N4SA 2GNFA 3KRRA 4RZWA 1D2GA 3ZMMA 1LEZA 1R74A 4YTIA 4FA2A 4TN6A 1WVWA 2WNTA 3EYHA 3Q9ZA 5T6BA 3SGLA 4DITA 1H25A 3VQUA 5BVDA 3TZ8A 4CRLA 3LJ2A 3KQPA 2OFUA 1XH9A 2QLQA 1GIHA 1HCKA 2YHVA 4UEUA 2IPXA 4QMTA 3VJNA 4XV9A 4ERWA 2XYQA 5DA3A 2PX5A 3CJQA 3F3TA 3LMGA 5EI6A 5FM2A 4CV8A 1Y6AA 3P79A 3IHTA 4NJDA 4AZFA 1MHTA 2YN8A 3P7CA 4M36A 4QPPA 3KXHA 2WMRA 2P3QA 3RAKA 5AP3A 3UVQA 2IVTA 3RHKA 1IXKA 1PYEA 3II5A 5AV4A 3E8SA 4FKRA 3ZDIA 2EX4A 4MD9E 3DK3A 4RIWA 4FTAA 2HWKA 2VTOA 4F1TA 2OFVA 5EI2A 5GJDA 4GJ3A 5CAQA 2ZZKA 3VS4A 4CD0A 3BGQA 4OTWA 1YRPA 5B0XA 5HLWA 3KULA 2ITUA 1OUYA 1KXZA 4FIHA 3DH0A 3C4CA 1APME 2Y4PA 4BIBA 4C4EA 2W99B 4QQTA 1OIUA 2YFXA 4FR0A 1PMVA 5AX3A 4FGRA 5HCZA 5AADA 3GNLA 3AC5A 5HD4A 3F3UA 4X6QC 1GZKA 5M56A 4ZAUA 2FK7A 3ZUTA 5LQAA 2AC3A 2W5BA 2ZWVA 3OY3A 3RPRA 3M2WA 4BGHA 2A1AB 3MB7A 5LCKA 1ORHA 3R6TA 1SKMA 4PF4A 1PXJA 4IAZA 4K1BA 3CTJA 4D4YA 2OO3A 4AW0A 2EB2A 3EEYA 3HVHA 4EHVA 5A46A 1YWVA 2BTRA 2BRHA 4QMOA 1X19A 3JPVA 4IX3A 1JPAA 4FSWA 4E4LA 2Z02A 2J7TA 4GUAA 1TQIA 2R3PA 4O7RA 4ZY4A 2W1ZA 5CU3A 4BCPA 5HCYA 4CFXA 4DFLA 2AOTA 5ETAA 2ZMDA 4HVIA 3V5QA 3QALE 3AY0A 3NYNA 2BAJA 5IDNA 3QXOA 3HECA 3PA5A 4QP4A 4O0TA 5DPVA 4BHNA 3VHEA 3PTAA 4RQVA 3MN3A 3BX5A 2IFTA 4YV2A 3RINA 5FGKA 3FYJX 4QP3A 5FXRA 3O96A 2QCSA 5AM6A 4OUCA 3B2WA 4EQCA 1YHVA 2YM3A 3WZKA 4I94A 1YOJA 2AS0A 3O23A 5H2UA 2CMGA 3FQEA 1GNGA 2BILB 4I1ZA 2PWYA 2IZSA 4CLJA 3DY7A 5KO1A 4ER3A 4QYEA 3GB2A 3T9IA 4KBCA 4F7SA 3TMAA 4EYMA 4EQUA 3FYDA 3ID6C 2WTJA 4DKJA 4DH1A 2ZIFA 3NRMA 2OXYA 5CEKA 4DCMA 3DTCA 1ZY4A 3WIKA 1N7IA 3IW7A 1T46A 4IAKA 3VUHA 5CF4A 4EOOA 4KSPA 3TWJA 4FEQA 3CEKA 3CGOA 3HUCA 1Q0TA 3EQIA 3D9VA 5LVNA 3OZTA 4Y73A 2W9FB 2OXDA 3D83A 2ZOQA 3V8TA 3O2MA 2Z7QA 3QRKA 4EZ3A 4TWPA 4HH4A 2C0IA 3FLQA 3EVZA 4WUNA 5TOZA 5B2KA 5HIBA 3LCSA 5FEQA 4O27B 3WI6A 4C4HA 4L52A 4M8TA 4XG9A 2B55A 2AZTA 2Y0AA 4YLJA 4AA5A 5HIDA 1Z3CA 1M17A 4XP2A 3OEFX 4W4VA 4CZUA 3RW9A 4RIOA 2ITZA 3F5UA 4BCNA 3TEIA 4PIPA 2AR0A 3LJ1A 2HELA 3IKAA 4YZNA 4EH3A 3WZEA 3NZ0A 2J51A 2XA4A 4HNFA 3OW4A 4TWOA 1V1KA 3F66A 4YTHA 4UX9A 3QQHA 2IBTA 5E8YA 4BBEA 3BGPA 2C3LA 5FADA 5EH0A 4I6FA 2B2CA 4IV0A 1O6YA 3L1SA 3MGYA 4B4LA 5IA0A 3RK7A 5FP6A 4EH6A 3TJDA 2BZIB 3C0HA 5K4JA 1IM8A 3I7CA 3PUPA 1RI5A 3NMUF 3R2BA 4JBPA 2C6DA 3I79A 3I5UA 5IQGA 4JAJA 3C3YA 3DUWA 5T6KA 4IAAA 1BL7A 5C4KA 4FZFB 4MXOA 5A4LA 2JC6A 2O8YA 1GIIA 4XH6A 3FQHA 3PG1A 3PXKA 4FTMA 4RGJA 1UU8A 3N9XA 1M2QA 2OU7A 3A27A 5CCBA 3FTEA 2PY3A 2W1FA 4IX5A 5AP6A 2JG3A 4D9UA 2IG7A 4KIPA 3PYYA 5CY3A 1YWNA 3GCQA 2I9KA 4ANQA 3AT3A 5EM6A 4YUYA 4Z9LA 3HV4A 4WRGA 4E4MA 5IUGA 2ZVJA 3NUSA 2NPQA 5IUHA 3BWBA 4LWPA 4O29A 2RFNA 2VWIA 3NW6A 4G3FA 3CGFA 4ITJA 4QQ5A 4RVKA 3S3IA 3PPZA 4QMVA 5C8NA 3TFWA 3GCSA 4D0XA 2OBFA 1IA8A 5CU2A 3UO4A 5P8WA 2UZ4A 4YPSA 4MXXA 3HCDA 3COIA 5HE3A 3DLSA 4G34A 3UVPA 3LQ3A 2VTSA 3VW8A 3C6MA 4TWNA 4E30A 2WIPA 4HYIA 2KTYA 4M97A 3LPMA 1XR1A 4RTQA 3PFGA 2VTLA 1W98A 4E20A 3I9FA 3OU7A 3P8ZA 2YIWA 4IKPA 5EEGA 2CLQA 5FBNC 1Q97A 3G6GA 3FMJA 3IW6A 5HE0A 2OKCA 3QLGA 3PP1A 1VEBA 4GT4A 1ZGAA 1K9AA 2WTKB 2Z7SA 3PRIA 4HJOA 2CSNA 2P40A 2XRWA 4FT5A 2UW8A 4ACHA 4NJ3A 2PWLA 3IQ7A 4BTMA 3MVMA 5DX0A 2DPMA 3R1YA 3U9CA 4G6NA 1FVTA 2ITQA 5E92A 4RSRA 1KE5A 3K3IA 4C37A 2BM9A 3BE9A 2X2MA 5IA5A 3TIZA 3OFKA 3MTLA 4XS2A 4FSQA 3MPTA 4QOXA 5EDPA 4YTFA 3OT8A 4DLIA 5DBXA 1EJ0A 3WSTA 4I6BA 5HTBA 2YZAA 3QZFA 4A6DA 3FYCA 2C5XA 2VTTA 4D2SA 2QD9A 3PA4A 4G6LA 3COKA 2XK6A 4FOBA 4C07A 5HD7A 4BGGA 4CFNA 3VBTA 3IW5A 5FQOA 4G5PA 4E7WA 2FCAA 2UVYA 4FK6A 3KFAA 1VQ1A 4NCTA 2CGVA 3L9PA 3CPBA 3NW7A 5DPMA 4F9WA 1CSNA 3R1NA 4LMUA 5DNRA 3HX4A 3HAMA 2X9FA 4ZTNA 3TI1A 2C6LA 4RWJA 1DI9A 2J0KA 4MK0A 4WIHA 3ZCLA 3VUKA 2CKOA 3B3FA 2YDIA 3UZUA 4C03A 4BTJA 4NT4A 3ELUA 1ZY5A 3TNWA 1FMKA 3H9OA 3W2SA 2QOQA 3A7JA 3DK6A 3LCOA 4N6ZA 4BDHA 5J95A 4HGTA 2GHGA 4ZK5A 4CFUA 5EGSA 2QONA 3V8WA 1BUHA 2FH9A 4FUXA 2Z7LA 5CYIA 4F0IA 5I9VA 4O0RA 2WD1A 1REKA 2CKPA 2P35A 4G9RA 3ZOSA 3UJ7A 4FVRA 2XK3A 4D5HA 4AU8A 1YUBA 3BI6A 2WIHA 3OZRA 5EZSA 2YM4A 4RVHA 4BCMA 1DCTA 1N7JA 4MD8E 5C01A 4MTAA 4C62A 3LX6A 4I0SA 4FKQA 4K6MA 4B7TA 2GTNA 2IO6A 4CG8A 2JHPA 3E23A 2EXCX 2PZYA 4LUDA 4FV3A 3JY0A 2WTDA 1PMEA 2VTMA 3KXXA 2R5TA 4OBOA 1RW8A 3V5LA 3V01A 1L9KA 3BXOA 2IZTA 4FSMA 5LWNA 4XMOA 3GQIA 1TW2A 2O06A 4MTLA 5EPEA 2GHMA 1BHJA 2ZV9A 2QOCA 3K3JA 5E8WA 3SW7A 3BQRA 2I0EA 2C4GA 3E64A 4XV3A 3QU0A 3W8LA 1NW5A 3FPGA 4JQ7A 3ERKA 3U54A 2FA2A 4DCGA 1WBPA 1TPYA 4MXAA 3MIAA 4RFYA 4UV0A 5CNNA 4IIRA 4C34A 5KKRC 2AVNA 1SG9A 1M0EA 3KR0A 2JD5A 2XKFA 3DFAA 3VJOA 4ACGA 4GCJA 5M57A 4P7GA 1KE7A 5HCXA 4S31A 4V01A 3UOKA 2GAFA 3RMFA 3ULZA 4BIEA 1KOBA 2OO8X 3DK7A 3A62A 5A54A 1JQ3A 1R8YA 4I41A 1H0WA 3PSBA 5BYLA 4FL3A 2WFYA 1VZOA 4LV8A 3UNZA 3EN6A 4KNBA 3V3VA 3OZSA 2OJFE 3LFCA 4FTQA 3Q7EA 4RVFA 2R7IA 2W0JA 2UW9A 3ALNA 2XCHA 3AT4A 4P7EA 1R8XA 2VTAA 2YVLA 4YO4A 1JKSA 2E9UA 4ZS0A 1AV6A 4EKGA 3OFJA 2EJUA 4J71A 3LHJA 3V04A 4CV9A 5ICPA 3WARA 4I3ZA 3ROYA 1MRYA 4Y2HA 2UYHA 4QP2A 3PY1A 3GU8A 1NW1A 4RA4A 2QOLA 4OA8A 4EJNA 4ANSA 4JG8A 4O2ZA 4BI0A 4KVZA 4BDDA 4IFCA 1YOLA 3DBDA 4EH5A 1FQ1B 2ITOA 3UPXA 3UZPA 4DGMA 3FSFA 2PLWA 3QRUA 3HTXA 3CTQA 1PW2A 4W4YA 5CXZA 3B3JA 3ZSGA 4EHEA 5F2OA 1K2PA 3V97A 1ZG3A 2PHKA 2XYNA 5FTOA 2QYOA 4L45A 5FWDA 2YCRA 1YHWA 2OJ9A 5I9WA 4NTTA 3I7BA 4OBPA 3ACJA 3B2TA 1PHKA 3FY2A 3FAAA 3DDPA 4EOIA 5IQDA 2VTPA 2PX2A 1TVOA 4IJPA 4R78A 3ZLWA 4YV0A 1AD5A 2XJ0A 2YWPA 3EN4A 3HLLA 4AA0A 3UGCA 5D9HA 5C1QB 4LOOA 2C69A 2PL0A 2I1MA 1YHSA 2H00A 5LQNA 4ZZNA 2FSOX 5JFSA 2HW7A 2PVRA 4GEOA 4DG2E 3CTHA 4PYOA 1UNLA 5C03A 2A19B 3QBNA 4U0IA 4ZZMA 3DAEA 3MI9A 4H36A 1J7UA 3AXSA 1G8SA 3FZOA 4DH5A 3O8UA 4OLIA 2HW6A 4OA5A 1YKRA 1D2CA 4HSGA 2G15A 4DF3A 5M4FA 1MRVA 5IQBA 3UJGA 4XG6A 3R7IA 3CCNA 3PE1A 4U7ZA 3KHKA 4EH2A 2PMIA 2PUPA 2UW4A 3EQBA 4R3RA 3ZHPC 2QURA 3PJ8A 1J1CA 4FTLA 4XLVA 5CX9A 3OROA 5HIIA 5A14A 3A7DA 3BV3A 4PTCA 1NW7A 3DKOA 2BROA 2HZ0A 4EZ7A 3ETAA 1ZWSA 3O51A 1QYRA 5CI6A 4XCUA 2IWIA 3BU6A 3C4FA 4BDGA 3KREA 3UMWA 2WEVA 2OK1A 4AGDA 3UVRA 2P4IA 3KMUA 4QYFA 3RJCA 1GY3A 4H0NA 3BBWA 4W8DA 3QRJA 3R7UA 4BDIA 4CT1A 5CF6A 1XCJA 5CVUA 4RTSA 3D15A 2VX1A 4E2ZA 2JKMA 3L8XA 4FSUA 3SW4A 4FTNA 4KDRA 5AUWA 5CIYA 2BH2A 4GIHA 5LWMA 4K11A 2C1BA 2V5QA 5BPYA 3KR1A 5CQWA 2P0CA 3FY0A 4RPVA 3OCTA 5EFQA 4YJRA 1P5EA 1BYGA 5FQDC 2DQ7X 4PTEA 4KINA 2OXXA 3GXOA 3QQUA 4PDSA 3RGFA 1QAOA 3F5PA 4E73A 4V05A 3Q5IA 2EXMA 2QG7A 3VAPA 4ZZOA 3AC3A 3OEZA 2P3GX 3FWQA 3QCXA 5E90A 3W2OA 2OY0A 3SX0A 3I5NA 2QKRA 4ZLZA 2VZ9A 2IVVA 4F4PA 5CF8A 4I21A 3FKLA 3RZBA 4JRNA 1O6KA 3SXFA 1NBHA 4EQZA 3MS9A 3DQXA 1U5QA 4O7YA 2IVSA 4X7QA 3ROCA 4MQ2A 5IEYA 3T7SA 4BZOA 3THBA 3PLAE 5ICEA 1WBVA 5F20A 2BALA 3S2PA 5FDPA 2BAKA 5CI7A 1YF3A 3E63A 3KCKA 4U5JA 3VS2A 4F0FA 1X1DA 2C6KA 3OU6A 3A8WA 5IEXA 5FD2A 4QP6A 5DRDA 3LFBA 3WZDA 3RP9A 5LVOA 2V0DA 5AUZA 4KAOA 2ZAZA 5CT7A 3NSZA 3AOXA 4U44A 3BHTA 2FSLX 3RPVA 3U9NA 3UP2A 5A4CA 5J9LA 1DL5A 2ESRA 3ELDA 3QOWA 5KMLA 2C6TA 3FUUA 3GC8A 3M42A 3KK8A 3W32A 5K05A 3JY9A 2WMAA 4PQNA 4YJPA 4AN2A 3LDFA 4TYJA 5C8KA 2ZMCA 3D5WA 3OS3A 4MD7E 1Q62A 2BFXA 3KCFA 5EG5A 3C0IA 3BYMA 2OB1A 5F94A 3UTOA 3VF8A 2WOUA 4FZ7A 1L3BA 3P0MA 3RM6A 4HVHA 5EYDA 5AUTA 4PMSA 2HZNA 2YIQA 2PBFA 1PY5A 3ACKA 5T68A 2G8NA 4E33A 3FZSA 3C13A 4S34A 4E31A 5JUWA 2NXNA 2VS1A 4PTGA 5A6OA 2C6OA 3QKMA 3GP0A 4E6CA 2H11A 3P9JA 4FTJA 3LDGA 3MAGA 4M7RA 5C1IA 3FYKX 3T3UA 1RDQE 2V74B 1BMKA 4MWHA 2JDRA 4I5HA 3MJ1A 3V6SA 2C0OA 3LCKA 1OKVA 3PG3A 3QUDA 4U42A 4ZMFA 4F84A 3ZBXA 4RFZA 4RT7A 3C7QA 5CSWA 4YU2A 1WBWA 3Q60A 5FTGA 4ENXA 1WXXA 3Q4CA 4DN5A 4EKLA 4LQMA 2OB2A 2IW8A 1EG2A 2B9JA 5EHGA 4F1MA 3JYAA 1QMZA 4G3CA 3G2PA 3R73A 1SVHA 5ICCA 1GOLA 1HOWA 5E1BA 3OHTA 3ORIA 5FQNA 2YTZA 3KK9A 5HU9A 2XIKA 2YA9A 4O7TA 3OUKA 2XVAA 4DT8A 1OL1A 3CS9A 3FKNA 4FK3A 2EG5A 5CSPA 4XOYA 4QTTB 2IBSA 2UYCA 4FKSA 2GU8A 5FUTA 2B0QA 5JGAA 3P9CA 4Z3VA 5DI1A 4I22A 4ZTRA 1I44A 3C9WA 3FUPA 3GENA 3IGGA 2YM7A 3R9RA 3D7TA 5EM8A 5DYJA 2X4ZA 3KXMA 2EB3A 5EK7A 3FSKA 5BX0A 2J0MB 1OECA 1IRKA 5AWMA 4DGGA 3R8VA 2YJRA 4WA9A 3FUXA 5BVEA 3NUYA 3QQKA 1OKZA 3HYHA 1R3CA 2X7OA 5JZNA 4IVBA 2A2AA 3Q04A 4OTDA 5IQEA 5H3QA 2XYRA 1H00A 4QVKA 2IZUA 3DLIA 4GVJA 3SX9A 4RRVA 3CD3A 3UDBA 3AMYA 4FTIA 4X21A 1SMHA 4GSBA 2XUUA 2B9IA 2NP8A 2W5HA 2Y7JA 4IWDA 4JG6A 4IW0A 4P5ZA 4JRVA 4QMMA 4GJ2A 4K18A 3MB6A 4RX8A 4TNDA 3BWFA 3PFHA 4JXJA 1V0PA 3A4PA 3NNVA 3QX4A 4CTJA 3HCEA 2P2HA 2X7FA 5BYZA 2R3NA 2GNLA 1WAKA 3KF7A 3ZSIA 4O84A 4CTKA 3DCVA 4G17A 5AX9A 4BZNA 3BGVA 2ETMA 4FOCA 2BRBA 3NUAA 1JTEA 1SQFA 4TYEA 2W4KA 5EHOA 3TNIA 3BRBA 4IC8A 3EN7A 4DT9A 4AFJA 4MYGA 5AUUA 1BL6A 3KKZA 4IWQA 4Q2AA 2ITYA 5HNGA 3UMXA 4EONA 3U6IA 5HEKA 2YR0A 4NK9A 4XG2A 2C6EA 3ORKA 2R3JA 3A26A 5EC8A 4IAYA 1JG1A 1YVJA 1OKWA 2XBAA 1XJ5A 1MJFA 3NW9A 3FPFA 2W4JA 3ULIA 2V55A 4K77A 5IA3A 10MHA 4OTFA 5EMKA 3DXQA 4FT4A 3RPSA 4Z7GA 4BCJA 4FIGA 4PMPA 3NWEA 4DFBA 3ET7A 2I7QA 3B3GA 5K01A 1IASA 3IK3A 2QO7A 4A06A 4FVQA 2W5AA 3ZU7A 4BDAA 4F70A 5JFVA 5KS2A 5FXSA 4EOKA 1Q8UA 5LJJA 3MY5A 3WZJA 4GC5A 2Y6MA 2PPQA 1K3AA 3FLWA 4LL5A 4YC8A 4C7TA 1XBAA 5AUVA 2YERA 3R22A 3EMBA 3FPQA 4HRAA 3D4QA 4XG4A 5H02A 4IADA 4FV7A 3KKVA 5AUXA 5AV2A 4AGWA 4E5AX 5IH5A 4FZVA 2UZVA 2NRUA 2I7CA 2JHAA 2O57A 2P8JA 2CCHA 2WOTA 3KVXA 3BLHA 1RQQA 2R4BA 3PFQA 5CQUA 3RVGA 3MPMA 4M0YA 1BKYA 1SVUA 2R9SA 3CJRA 5FEEA 2NRYA 2QNJA 3ORNA 4YLLA 3NS9A 4DCEA 4CFVA 5HFJA 2J2IB 4ANLA 1A9UA 1FINA 3GXLA 1Q0SA 1BC5A 3MTFA 5IG1A 2XJ2A 4MNEB 4CWAA 1FPUA 3HCFA 1Q5KA 2J6MA 2W7XA 4G31A 2O63A 3ZRKA 4EYJA 2I6LA 3R7EA 1I1NA 4R77A 4FZAB 3FTFA 4IB5A 4XHKB 3D2LA 2XZSA 2PVJA 4GKIA 4ZTLA 2JDSA 5EKNA 1OR8A 5E1DA 4PL3A 3RODA 2VWXA 1OIRA 1JG3A 3NDJA 3QGYA 4C4FA 5HTCA 3ZO2A 2QOBA 4AXAA 3G2MA 4IWNA 4K9YA 3EGIA 4HCVA 3Q2MA 3PIXA 1IG1A 1UVRA 4WNPA 2PGXA 4TNBA 3NCZA 4BN1A 4EC9A 3I60A 2G2IA 1PMNA 3OTUA 4TXCA 2XP2A 5HGIA 3PRFA 3WZUA 5DTMA 3I4BA 1H01A 2IGTA 3F5XA 4H3QA 2BZHB 5H8BA 4PP7A 3PX3A 2BCJA 2WMSA 3F9NA 4FV2A 2ZIGA 3C0KA 5JR3A 4AOJA 5E1OA 2P3LA 3GU5A 4X2GA 4UY9A 3SHEA 3NUXA 3HA5A 4KB8A 4AOTA 3BE2A 3UQCA 1PJKA 2EU9A 4XYFA 5JGDA 4WXHA 2OI4X 5CAUA 5E9QA 5ANEA 4KA3A 3LECA 5AP0A 2HYYA 3EPPA 3F4KA 3HMNA 4W4WA 1W7HA 1B39A 4B9DA
chains in the Genus database with same CATH superfamily
3M6IA 4KAXA 3IUYA 3VU1A 1NFFA 3OZVA 1V45E 3F3WA 2W6QA 2OWDA 4I9NA 3LMIA 3WWYA 3MTGA 4KFSA 4QPSA 4HLQB 2PX6A 1GZDA 2ITXA 2II6A 3E1SA 4R9UC 4AW5A 1ZU5A 4U7DA 1PDVA 4YH1A 2AN1A 4IVQA 3CPJB 4U97A 2OD2A 4X6RA 4PZCA 1ZIYA 5IUIA 2QLFA 1GNPA 1SBCA 2OLCA 3VPBA 2ZYHA 5JHHB 2BFMA 5IEVA 2K87A 3F3MA 4CBVA 4IQ0A 4C78A 5LWHA 1XMPA 2WG0A 5C4MA 4AN9A 2WFMA 4XP0A 2BKZA 4MWZA 2CNBA 3GA0A 1B0ZA 2P9EA 4R1QA 4KQCA 4U7FA 5CFPA 3T3OA 4WG3A 2C78A 2QRPA 4FV8A 3R7WA 1Q1QA 3QLUA 4JEMA 3SZOA 1AKNA 3U5TA 3L43A 4O3MA 2O5VA 2P6RA 1RYDA 3P45A 1CF9A 1H28A 3N6VA 4V0LA 1UKBA 3TAHA 1K2VN 5L3ZA 3PHCA 4NRDA 4AMVA 2PV7A 5TARA 3RT9A 3PJ1A 1P7WA 3EQGA 4FE2A 3O95A 4LKRA 2G88A 5H9VA 3ODZX 1WHSA 3LF1A 4F2DA 1VG9B 4UZHA 3F2RA 2B7AA 3A4IA 3AC0A 3QP9A 1W5TA 1R16A 5CTPA 3U49A 3QTSA 3R9NA 1IB0A 1XG5A 2ITWA 4U3YA 3WNVA 2P67A 3TRIA 1FMLA 2P62A 5TKDA 1F6BA 5D7NA 3NDMA 4RFVA 8MHTA 3DVLA 3TV4A 3OBIA 2ZWIA 4MI1A 3ZE0B 5L3QA 5L2WA 5FO1A 3HA6A 4AWXA 4QQRA 4M9CA 2NZWA 1ZKMA 4DG3E 2VSNA 4EHNA 3ORQA 5A4DA 2G0NA 5EZQA 3FJQE 3JD2A 1A9RA 4KDFA 3RWOA 2BCEA 1R1WA 1UU7A 1DPGA 2YJ4A 1NXXA 3SJZA 1DZ3A 4HUTA 1D4FA 4Z3OA 1XMXA 1W4BA 4J9UE 3BL9A 2A7XA 1I7SB 1FP2A 1Z0DA 4QE3A 4DA0A 2YASA 4R69A 2QTHA 2VNAA 4HDQB 4U3JA 5A0FA 4NTZA 3I2IA 3OTGA 2IBMA 4ZSAA 1MC8A 1FYWA 2QG5A 3Q7IA 3LY8A 4G1BA 2QY6A 2GYWA 3DTVA 1U7OA 4KN9S 3D6FA 2YW9A 3Q52A 2GKSA 3SNHA 4QWWA 3K0FB 4O2PA 4CCBA 2D5AA 2Q3EA 3FOEC 4MJ3A 2FZGA 2AV6A 1WY7A 3FKSD 4X60A 1FBTA 4MPJA 4J2HA 4MPPA 5TQ0B 1E4YA 1YJ8A 2XBLA 3WBBA 4LUEA 4QDXA 1E20A 3OXZA 3LYHA 1TYCA 2WTVA 2EU8A 3H1TA 3LS2A 1E63A 2VNYA 5CA0A 5BWLA 1J2TA 5TQ0A 2BDWA 2UUBB 2VTBA 3U6HA 1Y42X 2ODQA 1MOZA 2PT7A 1SY7A 5AD1A 3QZIA 3N8GA 1E79D 3RJMA 1BXKA 3HBAA 4RD2A 2I6SA 5AICA 2H2FA 1L7PA 4WK2B 4E1VA 1YZYA 4CMTA 3FNBA 4BLQA 1QPCA 5JCJD 1T8TA 4HEHA 4OSOA 4L6CA 4ECEA 4YJHB 3MGKA 5BWOA 4EHLA 1AO0A 2M1ZA 4M76B 4B8MA 1F5QA 3BYSA 1WEHA 1Y8RA 3Q88A 1XELA 4R3UC 4MP6A 5DH9A 3FMVA 4PL4A 4MYSA 1J25A 1F5SA 1SXJC 3UHOA 2ECPA 4ZJVA 4UVEA 2AHRA 1JSXA 2BJHA 4O0SA 2QTRA 1CUGA 4CM4A 2QB5A 2F7SA 1M76A 2DBQA 2QUZA 2WMUA 1SZJG 2LKDA 2DWBA 4Y1EA 2FOXA 4QP1A 4FMQA 3RANA 1FYVA 5D6NA 1XMSA 3MMSA 4ZU1X 3LCTA 4IH1A 1VRVA 2HXSA 5AWFC 3W2GA 2NSYA 5CVHA 4MCAA 2B53A 2GTPA 3QVSA 1W581 2BDFA 5AHOA 2ZRIA 4LYAA 3AW8A 4QULA 3WOVA 5K3SA 4UNRA 5H4GA 4POOA 3BZUA 4B6LA 4RJ3A 5E9JA 2P0EA 1G5FA 4EKNB 4TTHB 4CKIA 3SVVA 3LW7A 3AFIA 2RB4A 4UFOA 2VEOA 3VBYA 2MSNA 3RCBA 3BBPA 3CPHA 1Y3DE 1XA0A 4BFXA 3V3KA 4ASZA 1XYVA 3C4WA 2VJNA 4QHYA 1RRMA 1QKJA 3O9ZA 4OB8A 3VNBA 3NT2A 4OCZA 1WA5A 4A4DA 5F3WB 4PFJA 2GMWA 3B60A 3Q4UA 1VG0B 3T5PA 5DB4A 2QJRA 2R1VB 2KJQA 3KIPA 3MCTA 3VULA 2D5BA 5HIAA 2BPOA 1L8QA 1BGWA 2XDQA 2M2IA 3RU2A 4RTRA 5LU8A 1YACA 4M60A 4IBMA 1DCKA 1Z6XA 1NWCA 1R6AA 1HZZA 4D3FA 3KTAB 2WFLB 3W7BA 1D7OA 4D0GA 4B4VA 1J70A 5T41A 5LQFA 5DN9A 1YR6A 4J1NA 1C1DA 2X4FA 3L0BA 3WQBA 3HCRA 5A3SA 1KR5A 1DFHA 3HGQA 4DSZA 3RUHA 5GINE 5H68A 3RNIA 4L00A 2GYUA 4G97A 2VTHA 3GLUA 2QP3A 5D3MB 3WFJA 4UOEA 4KNYA 2BZ0A 4I99A 4NU8X 4KS7A 5DOVA 4KKGA 1R1DA 1OWNA 1ZYUA 3WF7A 3HKEB 3ZDRA 4FKIA 2OHGA 3ZHZA 1QPBA 3SEAA 5KIAA 1GZNA 4RHUA 2H9IA 3O8QA 3ETEA 3BB4A 3AC4A 4LSMA 4BGUA 3D7RA 3FUWA 4G1WA 3ZE8A 4CVAA 3O8QB 1PW7A 4BCCA 1T29A 2NVUA 2DX7A 5DISB 4ZEGA 1KERA 1ZOEA 1ZH6A 2HDOA 3TKLA 2Q83A 4Q4HA 4BO0A 5SY4A 3JQRA 3WMRA 3UT6A 4JWTA 5I7OA 3P26A 4Q1BA 3WK6A 5C9CA 1NF2A 1G6Q1 1XKXA 4OMCA 4Q05A 1CLUA 1L7DA 4GWKA 2QQ5A 1C0PA 3PC7A 3QU5A 1XTBA 2CHLA 5GNKA 3Q0IA 1N3LA 2WMBA 3ZZ0A 1VZ2A 3VS0A 1YQ9A 4ZO4A 6NULA 1TIPA 3UWSA 4EECA 1HYBA 9ABPA 1SGWA 2FMXA 2A67A 1LBEA 4OGGA 1Z22A 2JDVA 1YVDA 1YDWA 3IJ5A 2KWIA 4JX8A 4G5YA 3WFZA 2AOTB 4AP5A 4I1SA 1XCLA 1XCOA 1G9XA 2JZCA 1CYEA 1IHOA 1MLDA 4X85A 2IUFA 4MV8A 1J1ZA 1O6ZA 3Q32A 2OCKA 3S27A 3BRWA 2J9FA 3NAMA 3AMAA 2PVCA 3EIEA 2O1WA 4Y6QA 4OLJA 1O4WA 4MCJA 2Z2IA 5LXTB 3TZMA 4RPKA 2W2NA 4AT3A 3LNCA 2QLNA 2C9ZA 3B1JA 5BV1A 5DN6D 4W8GA 2B1GA 3PJ3A 3VQHA 4CIAA 1YRAA 3DLTA 4MRSA 5REQB 2GTHA 4DV4B 2V7EA 2OXIA 3A04A 1TOAA 1L5KA 4DCCA 3H10A 1J49A 1U0NA 2VTRA 3A37A 5FJJA 5AIRA 5IQFA 4KBKA 2E18A 5BSUA 2OIBA 4JXZA 3E8MA 3MA3A 2W4OA 4R81A 3M1LA 1WMSA 2WKWA 2YV3A 1ENYA 2ANCA 3FY4A 4D9HA 1UR5A 3I5AA 4CM9A 4MUBA 1UJ4A 4KI0A 5DHAA 1XT6A 4JMQA 4U2GA 2ETXA 4RULA 5KHLB 3EZFA 2FRXA 1IJFA 3FRHA 2QUIA 5F4NA 4QOFA 3ANSA 2X6DA 3MWKA 2P6UA 3W1VA 1BE0A 4KO4S 5CLGA 4J75A 4PFKA 2Y1EA 3A7HA 2J0VA 5LKRA 5LZ8A 3L7CA 3IUPA 1IN4A 2IYVA 4IEBA 2WYUA 3EF3A 1G6KA 1WNFA 3O7WA 3VS1A 5C1DA 1M2RA 3PSDA 3NIBA 1LV8A 2F17A 4ZQFA 1LJUA 3EVDA 1EJBA 4IVDA 1WKVA 5CASA 3K1JA 4FCVA 1X9IA 2H29A 1S02A 3FB4A 2NZXA 1DCMA 3IEKA 1JLRA 3WICA 1P1KA 4MV3A 2YXLA 2DJ5A 1MX1A 2E0IA 4MBLA 3DBFA 5EYMA 3KQSA 4P2KA 5F98A 3Q53A 3CLSD 3PA3A 4J99A 3W2FA 4OI1A 3I2GA 1MT0A 5DT9A 4XCXA 3ZQUA 3M6AA 4B7UA 3IDZA 1U0GA 3GG2A 4DCSA 4XUFA 4OHKA 4TLCA 4C87A 3DE7X 1Y3BE 4E6QA 1VIDA 4R6VA 1VLVA 1LJ8A 4M0DA 5FUMA 1XL1A 1CUWA 1KAHA 3FLAA 4N7MA 2JGFA 1YFJA 4BFVA 2HIHA 3WNCA 1NX9A 5AVJA 1O0SA 1VZ3A 3TLGA 4BWFB 4GKJB 4HFJA 1YWGO 2Y68A 1YVPA 3SRVB 3UA4A 4I9UA 4LRXA 1G4HA 2FZVA 4PEVA 1TEHA 3M4NA 3O90A 5F35A 4AVYA 5IJZA 2PRZA 1QFXA 5IH4A 1C9EA 3IO5A 2LIVA 3OLCX 2W6PA 3V6MA 3NHZA 1A9XA 3OFMA 1E1LA 1ABFA 3LE6A 2XRZA 4RACA 4LDTA 1TA0A 2XA1A 2EF1A 1URCA 1Y1TA 3RBVA 1PG5A 5LL6P 2BI7A 3MLBA 4HNHA 4DJAA 3OE1A 1Q1BA 1V71A 2Q29A 4USDA 2APJA 4UALA 1C7FA 2HU5A 3INYA 3VDRA 4TYHB 5T3YA 1TTQB 1V3TA 4EDHA 3SMVA 1VSTA 2UW5A 4MX9A 3SQLA 4RD4A 1R0WA 3BQCA 4FIFA 4JS0A 4LF6B 1QHHA 1NF3A 3CKWA 2UXDB 1G8YA 3E03A 3FGPA 1PXMA 5E8VA 4O21A 2IHBA 4TLEA 4L9IA 3ZBQA 4HGOA 4FKVA 4ZTUB 4MKFA 3NHJA 1QYCA 3VR3A 4UM8B 3UO6A 4DLLA 2QTTA 5FEUA 2BTSA 4HVSA 2B1IA 3D6VA 3GFSA 2F57A 5CZIA 2FYSA 2IYTA 3AFNA 4HEJA 1GUFA 4MW5A 2O65A 5DSTA 1P29A 2HZ4A 1QR2A 3V00A 4J52A 4NV3A 3DAGA 1DRWA 4A8JA 1G3QA 3IUEA 4HAYA 4GU6A 2AUTA 2X6TA 1V4BA 3H2IA 1DO2A 5FUBA 3ER9A 4KNWA 2F00A 3VSEA 4KPYA 5CK4A 3B70A 4IM0A 2C9CA 1C1DB 5BUQA 5DYNA 3CUVA 1IRIA 2XZLA 3M11A 3U62A 4TTQA 4QDOA 4UBAA 3GT8A 4JDKA 4KGXA 5I7AA 3IEXA 5E4JA 3S1AA 1ESNA 4C3UA 3AU8A 3QOYA 1WMEA 4G1UC 1MB2A 1U4OA 4A5OA 1W59A 4D4JA 4DTKA 2JI4A 1TQ6A 3PC2A 2DCUA 5CW1A 4FJ0A 3HR8A 4UMDA 3A1VA 3R6LA 3BWYA 3D94A 4RC3A 4US0R 2HHJA 4G5QA 4UUBA 4RZ2A 1M33A 2GJ8A 4Z4QA 4XJ0A 1XU4A 4GG1A 3EEBA 4XOZA 3DBEA 3L07A 4DZRA 2UW0A 3TAUA 2OC4A 4NZ9A 5J1WA 4DLUA 3UV6A 1X1EA 4HDSB 4JT9A 4HKTA 2A1TR 2DWPA 3WL8A 3N8KA 1CUJA 4QJ3A 1GNRA 3TD6A 1Z0ZA 2PMWB 2BHSA 2PEZA 4FZJA 4MBJA 13PKA 3GBSA 2WTWA 2C84A 3AR7A 4OL9A 2WAOA 2IV3A 3MMZA 4LTNA 4FWIB 4MVJD 3LJ2A 4FR2A 5JCXA 2HU8A 4N5NA 1GSHA 1BROA 1MHTA 4M36A 2HCFA 2UUCB 2HLNA 3RAKA 2EX4A 2FG7C 1H4VB 4I4CA 4OQQA 1J33A 1SCBA 3GPLA 4UVDA 2CCJA 1VLHA 3QLUC 1BX1A 2A1AB 5LCKA 1PEDA 4C6TA 4FWBA 3HJTA 4AW0A 4BBPA 3ZDCA 1PJRA 4HNAA 4A7PA 2AOTA 4DDWA 1YMVA 3CVVA 3QXOA 1I5OA 3OIGA 3TZCA 2YVAA 1QOQB 1RXYA 1Q91A 4OUCA 3ETDA 3FOBA 2HU2A 4R1UA 3WZKA 4GI2A 2GPBA 3DCYA 3U2QA 5KJ6A 1YZTA 5GJBA 3DC2A 4EYMA 1KAEA 3L82B 4DH1A 3AZQA 3KSUA 3WIKA 4EOOA 3CGOA 4WADA 3EQIA 3OZTA 4WAUA 2N0SA 4PG4A 3ZH2A 3ZW7A 4X7MA 4DCUA 2C03A 5B2KA 2QTLA 5LB4A 3E22B 4C4HA 4X66B 2ZIXB 1AKEA 2IHVA 3WDKA 1UPCA 3LPLA 3T0FA 1B1CA 1SR8A 3NH9A 3S5UA 4D8VA 5E8YA 3C24A 5EH0A 4B75A 1E3EA 2X8JB 4D3YA 3PEYA 3L2OB 3MXTA 1EE9A 2AEJA 4FZFB 3GQBA 2F43B 4KR0A 3PXKA 4FTMA 1RAHA