3ID6C

Crystal structure of sulfolobus solfataricus nop5 (1-262) and fibrillarin complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
227
structure length
220
Chain Sequence
b'ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre mRNA splicing protein
publication title Structural organization of box C/D RNA-guided RNA methyltransferase.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
total genus 58
structure length 220
sequence length 227
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3id6C01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3id6C02
2NNWB 4K0YA 5L6PA 2QU5A 3NW5A 1FJXA 3G88A 4RTMA 5IQFA 1L3BA 4FP9A 2ITUA 3HUCA 5KE0A 1XBCA 5L2SA 5JK3A 2CN8A 5HORA 2YXEA 4FL3A 4DYMA 1W84A 1XH8A 1E1XA 4AGDA 4EUTA 5F2OA 3VRZA 5CALA 2VO3A 3G6GA 3LKDA 1OVEA 3W2PA 2IW8A 1AQ1A 4EOQA 2WQBA 4LUEA 4YUXA 3QOWA 2A4LA 3BGDA 3N4VA 1YOLA 5E9QA 4FV0A 4DTBA 5KUPA 4BCOA 1Y57A 3KXHA 4RC2A 2IBTA 5EYMA 1YVJA 2FSMX 2WQMA 4QTBA 3EL7A 3THSA 3V5PA 3SW4A 4F86A 5EQYA 4FTJA 1KYWA 3O8TA 1W98A 5EFQA 4CFFA 2W1ZA 2VNYA 5CVFA 4E93A 3SSNA 7MHTA 5AUTA 1GIIA 3FL5A 4F9WA 2O2UA 5CT0A 3CGOA 2K4MA 1H24A 3OZ6A 3OUNB 1W7HA 4JX7A 2FSOX 3ULZA 2XRUA 2E9NA 3SDJA 3IEIA 2FH9A 4R7HA 5JEBA 2W99B 2R3FA 2I0HA 4ACMA 4BDBA 3LLTA 3IV6A 3OU6A 3KREA 5BW4A 1G55A 4RIXA 4JR3A 4G56A 5EM6A 4S34A 3BCEA 5E9EA 1ZRZA 2VO0A 4MNEA 5HOQA 3LCUA 3D4QA 4QYFA 2B9JA 3O2MA 4UWCA 1UV5A 5DR9A 2PMNX 3VS6A 3C3YA 5DSTA 1HMYA 3OXIA 2BRGA 2ZM4A 3BBWA 5JZJA 4DEEA 5HE2A 3RK5A 3UIMA 4FTRA 4QTUB 3BGPA 5E90A 4OQDA 3RAIA 4I23A 4UZDA 5CU2A 4OTDA 3DOUA 4IWDA 4ZXTA 3KC3A 4ZMFA 2C3IB 4NCTA 4C7TA 3VBTA 4FKWA 5DLSA 5AP0A 1R39A 4M12A 4G3GA 2FB8A 2QY6A 3BLRA 4JDKA 1FOTA 3DNDA 3LQ8A 4UWBA 2E9UA 1PHKA 5A6OA 5BUIA 4NM3A 3U6HA 1W8CA 2WOTA 3CJFA 4YNOA 3RTPA 2EXCX 4ZSLA 2WELA 3DJ6A 5IQDA 3U51A 5L8KA 4DM3A 4DFNA 1PMNA 5AP3A 4PY1A 4ZY6A 4IDVA 4XX9A 4YUQA 2ONLC 2IPXA 1Z3CA 3R00A 5E8UA 1SVGA 1JQDA 5CI7A 1MRYA 4KRGA 2PZ5A 2Z6AA 1QPDA 3GU6A 3UJDA 3DLCA 3M1SA 5TOZA 4KWPA 4ZTSA 3KRXA 3NCZA 4XH6A 4CV8A 1X8BA 3U6JA 5LMKC 2C68A 5M09A 1QZZA 3C0KA 4A4XA 3QCYA 3RCJA 3PUPA 4PX6A 2PWPA 3OWJA 4QMUA 1F38A 4ASXA 3C51A 4DH7A 5EMLA 3OXZA 4BIDA 2G71A 2HWPA 3FZGA 3LHDA 4IX6A 2FRXA 3S00A 4QTAA 4OA5A 5KMJA 1YOJA 5DLYA 2BR1A 1FINA 4FBXA 4IV8A 2QR7A 4IVDA 4B8LA 4PIPA 4XEYA 1KSWA 5K0JA 2YZLA 4BLWA 3KR9A 3DJ5A 5BMSA 2QOHA 4TYGA 3KY2A 1RI1A 1SYKA 4HNFA 3LCKA 4PYJA 2VS1A 5EZQA 2W5BA 3CQWA 4F1OA 4RVFA 4YSJA 4QNYA 3KQYA 3KQWA 1XHAA 4DFYA 3OT8A 3TXOA 4FTOA 5I9UA 2BVAA 3GDHA 3R9DA 3NDIA 4FV5A 2IH2A 1XR1A 2P3QA 5EG3A 4RX7A 4R1YA 4S30A 2UW5A 3R7OA 3COMA 1KHHA 3TDWA 4EWQA 1SKMA 5LJJA 4I6QA 3CVOA 5J7HA 2YQZA 4C07A 1YXVA 2JDTA 3UMWA 3QQGA 3PLAE 2PE0A 2ACXA 1JKSA 4Z55A 1VYWA 2X7FA 2R3KA 4QVGA 3OCSA 2G2FA 2AOWA 2H6DA 2WMBA 3OWKA 3I58A 3OROA 3C4CA 4EHGA 2VX0A 3QKLA 2Q0NA 3SV0A 2WMWA 3NRMA 5FP6A 4FKQA 3LM5A 2WMVA 5HTBA 4LRMA 1J1BA 2XA4A 4P4CA 4R7BA 3BHUA 3FLWA 3PVCA 3ZDUA 3NS9A 1PJZA 2XKCA 2C6EA 1X1DA 5AV2A 4FIJA 3NW9A 3CPCA 3OHTA 2CKDA 2J50A 3MVLA 2ITWA 3PA5A 4DG2E 3QZIA 3R8PA 4B8MA 3HTXA 1I4WA 3A8WA 5I5ZA 2ONLA 1PY5A 3LQ3A 4K1BA 4TYJA 4PCLA 3DCVA 4UYNA 5G1XA 3VBWA 3W2RA 2PKWA 3QV2A 5M56A 3ZXTA 5J95A 2VZ9A 3MS9A 4FICA 4YSMA 5I9YA 3HA5A 1RDQE 3QZFA 4AS0A 3FZPA 3F7WA 3DBDA 3PP0A 2GQRA 5ETIA 1Q3DA 2C5NA 2W4KA 2QM3A 2GTNA 3P9NA 5EVJA 5HNBA 4RTNA 4ZLYA 2BZIB 3K3IA 3PX3A 3ER8A 3KQ7A 3BX5A 3TR6A 3MTEA 3DK3A 1H1WA 3LKZA 4IVCA 4R8RA 4RTPA 4RMZA 5H2UA 3FUXA 5AA8A 4YMGA 4O91A 4LG1A 2P7IA 3A27A 3DXPA 4C04A 3DNEA 3EZRA 4YBKA 2W1HA 4IWPA 3PG1A 2BKZA 2ADMA 1YRPA 2XNNA 1ZXEA 4BCPA 4O7TA 3ROCA 3IW6A 2E9VA 5DTQA 1URWA 3UOLA 4BDJA 4QMNA 1M7NA 5M57A 1U5QA 2VTRA 4KRCA 1ZY5A 3UQCA 1AV6A 3D94A 4M8TA 1FGIA 1YXTA 3TUDA 3F5GA 5AP6A 5CI6A 3LJ1A 4EUUA 2UZVA 4J95A 2O05A 1T43A 2X7GA 4EK5A 3BGIA 4NYEA 4OLIA 5DEYA 4MTAA 4FT0A 4DFZE 3BBTB 4YUYA 3UNZA 3H10A 2I0YA 1PYXA 3O71A 3RPRA 4BN1A 3E8EA 4L3PA 2HY81 3DK6A 4PYKA 3VJNA 2QU6A 3TACA 3UYSA 4DCAA 5AUYA 3M6UA 2PX2A 4F08A 2B53A 3BYMA 1P4FA 3GENA 1WBNA 1AD5A 4W8DA 1GY3A 3UBTA 5BNJA 3I53A 1PRYA 3R6TA 2FUMA 3F2NA 2OZAA 3BHHA 3EN5A 3ZC6A 3OBJA 3PFHA 2OWBA 3I64A 4GEKA 3GRYA 2UYQA 3IDPA 3KRWA 4DN5A 1M7QA 2B3TA 2CNQA 5D1NA 1YI4A 1H0VA 3KRRA 3V97A 3JUHA 3LE6A 4YZBA 1O9GA 4M0ZA 3TV4A 3DDPA 4P90A 2YIWA 3CC8A 3CGFA 4DGMA 4CCBA 4IZ7A 3VWAA 4PDSA 2HWKA 4M97A 2XYRA 3SXJA 2R3JA 3ZBXA 4OTHA 3KPWA 3TM4A 5IKMA 3U4WA 3UJAA 2GFCA 2FCAA 3TOSA 3D7TB 5IQBA 3O17A 2WEIA 4XMOA 1YWVA 1JG3A 4K11A 4FV7A 2XKEA 4GS6A 5EHLA 3PSBA 4BLUA 4GC5A 1R18A 1NXKA 3LCOA 3ELWA 3MCTA 3LL7A 4D4RA 2R3SA 2B78A 1JNKA 4BDKA 1I09A 3TFWA 3PX2A 4H3BA 3R63A 3U55A 4HGSA 4R6VA 5EI2A 3FMDA 2YUIA 3KMUA 2WKMA 4YJNA 3ORHA 2OW3A 3MI9A 3QGYA 2YITA 5E1SA 3DKGA 3MJ2A 4GK2A 3S2PA 4IKPA 2ZZKA 4MHAA 3R1SA 3H0ZA 3G90X 2CGUA 4LV8A 2Y6MA 3AC5A 2ONZA 1F3MC 4GBED 4RRVA 4BICA 3TEIA 4ANLA 4E6QA 1P14A 3Q5IA 3EQGA 3ODYX 4X61A 4ID7A 1JSTA 2X6EA 3HLLA 2IP2A 4EKIA 5B2LA 4TYHA 3RGFA 3I6WA 4CKRA 1OECA 4KUJA 4CKBA 5AUWA 3MH3A 4AGCA 4KVZA 5KQRA 3UJGA 2VTIA 4M3QA 4U8ZA 4J96A 4I5HA 5IU2A 3FMEA 3AOXA 3BLQA 3CQEA 1EQAA 4QNAA 2O3PA 4C3RA 2PULA 4FTLA 3GGFA 3A4TA 1P2AA 4PL4A 3F9NA 3M6XA 2AC3A 3C4EA 3UOHA 2OB1A 3QL8A 2PMIA 3KQMA 2XNGA 4HYUA 2JHCA 5M4IA 4JL9A 4UEUA 1Q62A 2PLWA 3HL7A 1KOBA 4RVLA 4TWCA 4EOSA 4FGRA 4V01A 1WBTA 5H8GA 4BCQA 3UG1A 5ETAA 4RV9A 3IDBA 2WTCA 4WKQA 3EQIA 3KR0A 3LCTA 1X19A 5HZNA 3Q96A 1MJFA 3Q7EA 4LI5A 5EIFA 4I0RA 2ZULA 2J0LA 1QAQA 5AIKA 3OEFX 5CANA 2JKOA 4YTCA 1NBHA 5CVVA 2W17A 1X1AA 1BLXA 3BU6A 1IA8A 4FSZA 4FVRA 4GKIA 4DKJA 3GP0A 4F7NA 1H1QA 5CAOA 4QMXA 4U7TB 3ZEWA 3EVFA 1PXNA 4ZSAA 3K3JA 3UE4A 2WU6A 5F20A 4AZTA 4DEGA 4NL0A 4J99A 3BPRA 4MWZA 1VP9A 2ITXA 4BZOA 4X3JA 3KVWA 3FL4A 3DTNA 1URCA 2IVUA 3MH0A 3PJCA 2X7OA 5KQSA 3A60A 4H39A 2VZ6A 1SQGA 3W2CA 3G7UA 4H36A 1Q41A 4EZ7A 4RBLA 5G02A 2JC6A 1ZMUA 2JGZA 2RL5A 1XCLA 2P7HA 5A4EA 2GFSA 5J9YA 4FTAA 5CF4A 4X3FB 2G72A 5HX8A 3UO6A 2JDRA 5BYLA 3KK9A 4C2VA 3JY9A 2G9XA 3U9CA 1B38A 5HBHA 3PSCA 3RALA 4YJSA 1BKYA 4O6LA 3DBCA 1Q99A 1VEBA 3RPVA 2I6GA 5CS6A 2W1CA 3EQBA 1VJYA 2RG5A 1LUFA 2B54A 3MFSA 4KSPA 3SQQA 3NIEA 1L8TA 3GC0A 2REIA 3PPZA 1TKIA 4R78A 3L8PA 3EN4A 4YTHA 3I5ZA 3SA0A 2PJDA 3OPNA 3EVGA 2UW4A 5EM7A 4D2RA 4LUDA 4ZJIA 4QQTA 3UODA 4HTFA 3ACKA 4QTTB 4HRAA 3MVJA 3PXZA 2PBFA 3PS9A 2XCHA 5EOLA 4CTBA 3HV7A 5AV4A 1L9KA 1ZYJA 4PMMA 4F9CA 4IADA 4C35A 1ORHA 3P7AA 2JH9A 3E8SA 5FHQA 5IQIA 3D83A 3R83A 4V04A 2ZBRA 4LMUA 4MD8E 5BVDA 3HA6A 1KWPA 4DEBA 4J97A 4U45A 3AXSA 2AYPA 1XWSA 5JSMA 4L43A 2WQNA 4C02A 3WE4A 2QRVA 4A7CA 5L2IA 5C1IA 2GS7A 1OL7A 3WBLA 2DULA 2WA1A 2BAJA 4NJDA 4XS2A 5K0CA 1L3CA 4DE4A 3JWIA 3KFAA 3L9MA 5FQOA 2Z60A 5EDRA 5FG8A 2C6TA 4WXHA 4WUNA 1BC5A 1MQBA 5GOZA 4LOOA 5HNGA 3NUNA 5BP7A 5K8VA 1PXKA 3OE5A 5J1WA 2XM8A 5EKUA 4GFOA 5DT0A 5LQNA 5K03A 2HMYB 1YXSA 2X2KA 5JZNA 4MAOA 3HCBA 3LMGA 2Y8OA 1QPEA 3S4QA 3VS7A 4QMWA 2HENA 3HDNA 4O7WA 4DEHA 3ZLYA 5DG5A 2NRUA 4J71A 3ZRKA 4MK0A 5HTCA 5F4NA 2G1PA 4LWOA 2ITPA 3F5XA 1G8SA 1ZZLA 2H8HA 4B4LA 4EC9A 2JBOA 2O0UA 5HG9A 1U59A 1SMHA 2OFUA 4C36A 4CZUA 2CN5A 5T68A 2O06A 2RF9A 4FTTA 4PTEA 4FEQA 2AOTA 3K2LA 5FTQA 1M2PA 1VP3A 3OTUA 3DQWA 2VAGA 2PHKA 2V22A 4GEOA 4MYGA 2PV0A 4EBWA 4DINA 4GL9A 4AXAA 4FT5A 4JQ8A 1NE2A 4XV2A 3S1HA 1DAWA 5E8YA 4MF1A 3QWJA 4AP7A 3R2YA 4BDEA 2HZ0A 5JFXA 1YI6A 5AM7A 5E9WA 4QMMA 5FM2A 4NFMA 1Q3WA 2WTKB 5JQ8A 4GOND 3R2BA 3W2OA 4CFWA 2YM5A 4D4YA 2R4BA 3D5VA 2CCHA 3NZ0A 2QQ7A 2PX4A 4KDRA 4IW0A 1LEWA 1J3HA 4ZS0A 2J51A 5LQCA 4YJRA 3HVHA 4BBFA 5CU0A 5IISA 4K9YA 1JR4A 4FIEA 5A3XA 3BUSA 4NKAA 1A48A 2Q83A 3WF6A 3B3GA 2I40A 3PXRA 2OBFA 3QTQA 5KHXA 4QMZA 1EG2A 5IUIA 1WBSA 5M4UA 2F7XE 5LR6A 3T3UA 4FOBA 3E8CA 4GSBA 3PXFA 5CSWA 3C7QA 1GIHA 2HV9A 4ONAA 5LVMA 4AA0A 4M84A 3NSZA 4HCUA 2PXXA 1U2ZA 1JTEA 4EKKA 5M4CA 4PV0A 2Y0AA 4PNKA 4EOOA 5ANJA 1Y6BA 4R8SA 5CF8A 3F5PA 2WTWA 3D9VA 3NYOA 4YUVA 2WPAA 3BWYA 2UW6A 4FKOA 3QD4A 4CRLA 2ZVJA 2YN8A 3ELUA 1XDSA 5GIOE 4YHJA 1EAMA 3FRHA 3FPEA 4FOCA 4YLJA 1RI5A 4F9BA 3EVAA 4RSRA 2Z7RA 1Z57A 4HG2A 3KGAA 4I5CA 1RI4A 4U41A 4CKEA 3LFAA 2CJMA 2XJ0A 3NTVA 3C1XA 4CNHA 2YAAA 4YMHA 2Y1XA 3LPMA 2OFVA 1NW6A 2WA2A 2BZGA 4D1SA 3KL8A 3KU2A 1LEZA 3AD6A 4MWHA 4O21A 2WAJA 5HU3A 4IWOA 4UOEA 2QHNA 1TQMA 3T9TA 4XV1A 3RINA 3RP9A 5HD7A 4CG9A 3HV5A 2NP8A 4ZTLA 3R0TA 3Q3BA 1YXUA 4FI1A 2H9VA 5EGSA 4C0TA 3KQSA 4U6RA 3SOCA 5FDXA 3OWLA 2WU7A 3QLGA 4MH7A 3PZHA 3VUGA 4QQCA 1HCLA 1OIQA 4RQKA 4FTIA 1CKJA 3IQ7A 2BAKA 3CE3A 3QCQA 5DT4A 3WZJA 4DFLA 5DN3A 3MH1A 3TNQB 4FSWA 3TTJA 5CQUA 5M51A 5JFVA 2VTOA 4IBMA 4FSUA 4DC2A 3GUBA 4S32A 4QYGA 2FA2A 3NDMA 5FBOA 3G51A 4V05A 3AC3A 3H3CA 4W4XA 3GO4A 3S68A 4R05A 3QD0A 3FYDA 5D1JA 2R0UA 3DU8A 2J9MA 4FSXA 3BWJA 4OBQA 2VTAA 3B5IA 2W05A 5HIIA 3CCFA 5KHWA 4JBVA 3AD5A 4OTGA 5FRIA 3QHWA 4CXMA 4RJ7A 3HV6A 4O27B 3GOKA 4M14A 3HP5A 1XKKA 2YHVA 3WE8A 4G5JA 5F1ZA 2C1AA 4X6QC 2GHMA 2UZ4A 3P9CA 4FA2A 2JFMA 2P3LA 2CNUA 2J0IA 5KS2A 3NW6A 3RAWA 1H25A 3PA3A 3E7VA 3E62A 4YO4A 4PWNA 3T7TA 2N47A 4D5KA 2R3LA 3M33A 5CXHA 3F3TA 2QI8A 3KQQA 4EI4A 2QE6A 4ENYA 2Z7LA 3RJCA 2PK9A 3ZLSA 4YJPA 1XBAA 4DAWA 3IW5A 4U79A 1UNGA 1GJOA 2EG5A 5DGZA 3HA7A 3W10A 4D0WA 2X8EA 3ATSA 2WB8A 4MXZA 4FV1A 3WIGA 3A2CA 1VZOA 4X0MA 4O6EA 1WY7A 2XYQA 5M55A 4I22A 4E5BA 1MRVA 4F7JA 3GRZA 2W9ZB 5DRTA 3PZEA 5BW5A 4MD7E 4EOPA 1R6AA 2IVTA 4TPTA 2CGWA 2YDIA 4RQVA 4YNEA 2OU7A 4X2JA 5IUHA 1JLUE 4FZVA 5DX0A 1A06A 1Q8TA 5LWNA 3LDUA 3UC4A 4C05A 3HEMA 2ERKA 3UDBA 5D9HA 4BTJA 3JPVA 4MCVA 4EJNA 5CASA 3GU8A 4A9UA 3A62A 3R01A 1ORIA 1KYZA 3MY0A 1KE6A 1EJ6A 3FPFA 4MXYA 1I9GA 4O2PA 3GXOA 5CTPA 2UZUE 2AOXA 2BCJA 5HGIA 2OO8X 5EOVA 4A9RA 3O51A 4LFIA 4AUAA 4RJ5A 4E32A 1SUIA 4J7BA 2VWYA 4FGBA 3MGYA 3QRJA 2WQOA 4EQMA 4MD9E 3CQUA 2XK3A 3ACJA 2V7EA 2QO2A 4FNYA 2ZYBA 3OBGA 4DFXE 4N6ZA 3EN9A 3Q6WA 2C7PA 3GFWA 4QPSA 5AP4A 1NY3A 3A7GA 4FSNA 4QP1A 1Q0SA 3AD4A 4WO5A 3VS5A 4E2ZA 2FVDA 3ORXA 2QOBA 5EKXA 4FKTA 1NW5A 5CM2Z 3FZSA 4WT6A 3DKCA 2JITA 4I6FA 5DWQA 3NX8A 3SXFA 5P8WA 3ERCA 2BPMA 3ROYA 3O7LB 4TZRA 2Z7QA 4TW9A 3DLZA 3DH0A 2ZVAA 3CPBA 4F64A 3ET7A 2XP2A 2OIDA 4YHFA 1BMKA 2OJ9A 2J5FA 4R77A 5CU3A 3EGIA 2XEZA 4HPUE 3DKOA 4USDA 3VYWA 3BHVA 3P7BA 4HVSA 3VUMA 2JIVA 1W83A 3QA8A 1XH7A 1ZY4A 5LWMA 3BV3A 5DRBA 1YZ3A 4FMQA 5CU6A 4RVGA 4R3PA 2W0JA 3UJ9A 2LAVA 4KINA 3E92A 4U40A 5LQJA 3QCXA 1NA7A 3KA0A 2X8IA 4ARKA 3I0QA 2QVSE 4L00A 4ASEA 3C9WA 4BCIA 5FDPA 3UIXA 5CCXA 4G6OA 4O7YA 1PXLA 3GT8A 5EKOA 3VO3A 4M38A 3BZBA 4IAYA 5DR2A 5FQNA 3K5UA 3F3UA 3NVKI 5ITAA 3HKOA 2ZV2A 3UQFA 3R8ZA 1YHWA 2UW7A 4R1VA 3TLJA 1PXMA 3HV4A 3NNUA 1D2GA 2IZSA 1ZOGA 2X0GA 1OL6A 3W8QA 4U81A 4AN3A 2I6LA 2CGXA 4OTRA 4YV0A 3KKVA 2ITTA 2HYYA 4KIOA 4PGGA 5ICGA 3QUDA 4MIKA 1OKVA 4YGAA 3DR5A 3Q87B 3PE2A 3UQGA 3AGLA 3GVUA 5CENA 1FVVA 4R7IA 3E8NA 3V04A 2VTQA 5GJDA 2XM9A 5HVKA 2ZLBA 2H96A 4FSTA 2BM8A 4IC7A 1OB3A 4IACA 3ENMA 1F5QA 3R7VA 5ACBC 4KNBA 1SVHA 3QC9A 3C50A 2FYTA 4JI9A 1JQ3A 2R3PA 2DYLA 5IEXA 4PYLA 4USEA 3PE1A 4I20A 3MY5A 4PDOA 2PU8A 1IEPA 3ALNA 3GQIA 4E8AA 2X8DA 4OBOA 4ANQA 1GNGA 1QYRA 3DMGA 4F84A 4YJTA 4JX3A 3DPKA 1U4DA 4FK6A 3PJ8A 3AT3A 1WXXA 4FODA 5FA8A 3TKAA 2OJGA 1FGKA 4CMTA 5DFPA 2ZMCA 4OUCA 3MVMA 2BRBA 1M17A 4AFJA 1QAOA 1PXOA 5CUQA 3TDVA 4L45A 2VX3A 3NNVA 4D55A 5IQCA 3TZ9A 5B0XA 4HCVA 2BKKA 4DBXA 4IVAA 3SSMA 2IDKA 3GCVA 1RJBA 5E1MA 2E9OA 4UZHA 4BB4A 4FSRA 5IF1A 3DULA 3GNIB 4FTCA 5J9LA 2X9EA 3RZBA 3SX0A 3QUPA 2ITYA 4KRDA 5D41A 3HA3A 4IWNA 3RPOA 2GDOA 5JT2A 3BWCA 3EQCA 2P35A 2R3RA 4GUEA 2Y4IB 2GPHA 5KMIA 4O29A 4F63A 4ZS4A 1BL6A 5CZHA 4RIXB 2QONA 4FVQA 5MHTA 4G2FA 5HICA 3DXZA 2PY3A 2XKFA 2HXQA 4DLJA 3D2KA 2XIYA 2Z02A 2YTZA 2VD5A 5CAUA 4E6CA 3CSVA 3FZ1A 4N0SA 4BGGA 3VBQA 4YP8A 2HW7A 4EOMA 2R3NA 1VPTA 2YISA 1PXPA 3P1AA 5A4CA 3QBNA 2YIRA 1KV1A 2ITQA 3FMLA 2R0IA 2HZNA 3C4WA 3GEQA 3NYVA 3VUIA 3UZRA 2BH2A 4GIHA 1NVSA 2WHBA 4XJ0A 3FY0A 2QO7A 3V01A 4FT7A 4YTIA 5HG7A 3T7RA 2BDWA 2NXJA 4JBQA 3OTVA 1VE3A 4LRJA 3BELA 3FPJA 1S9JA 3OVVA 2GNFA 2GS2A 4XRLA 3E3BX 1DCTA 5JQ5A 5HQ0A 4PF4A 4FSYA 2VP3A 4PL3A 4S33A 4IM3A 3ZOSA 3MB6A 3B7PA 3QWKA 3MFUA 4RWIA 4UY9A 3EIDA 5AFVA 1LP4A 5BYYA 5E8VA 4RTSA 4AW0A 3UO5A 4YTFA 3R8VA 4CT2A 4G3CA 1M6YA 2YCRA 3M70A 3EVDA 4O96A 5HVJA 3OP5A 3G5LA 3M6VA 4ZY4A 1NV8A 4FR0A 3LFDA 4OT6A 4G3DA 4B99A 2PZRA 3KMWA 2ZAZA 5D11A 5FP5A 2JLDA 2DWBA 4CD0A 4S2ZA 4KS8A 4XOYA 1WMKA 4RFYA 4CKIA 4BBEA 2EJTA 5HX6A 3VN9A 5AP5A 4DTKA 3QC4A 1E9HA 2WNTA 4ANMA 3I7CA 5FWDA 5DM1A 4C62A 3RHKA 3CXWA 3LX6A 4N57A 3QAME 5JUWA 4S31A 2JKMA 4U9AA 3SG8A 4GQBA 4PUZA 4E4MA 4ASZA 2X4ZA 3P2IA 2R3MA 4RA4A 4RWKA 4MWIA 3R7EA 4AWIA 5LQKA 1Q61A 4IEBA 4OTFA 3H9FA 5M53A 4NECA 4AZWA 3RCDA 4Q9ZA 5LQUA 2OPBA 1XH5A 2FSLX 2C5OA 4FL1A 3VAPA 4RTOA 2F4JA 3WZEA 5HIDA 2OF2A 3GXLA 3QRKA 4PCAA 3FPMA 2AN3A 1DAYA 4UALA 4LV5A 1WG8A 5AM6A 5HIMA 4G3EA 4AN9A 2B2CA 5HZMA 4FE2A 3FRIA 2C3LA 5CZIA 1BI8A 1KIAA 5DTMA 1J7LA 4G31A 2WTIA 3O8UA 3QUEA 4R3RA 4V0QA 3PVGA 3BYVA 3FJQE 5FD2A 5LMAA 4Y85A 4JS8A 3EGVA 3CTHA 4AZFA 2OXTA 2QC6A 3PJ3A 3IOKA 5D7AA 3THBA 4D9UA 4IWQA 2R6ZA 4F70A 4FV2A 5FUBA 3RMFA 4XBUA 3DTCA 2NXNA 2QOKA 3COHA 3WZKA 3G2FA 3UVRA 5IEYA 2OH0E 2ZSUA 4E30A 2PMLX 3AC2A 5JH6A 5DSXA 3VS4A 3QX4A 1LR4A 2YM7A 3PTGA 3FSFA 1WVXA 2VTMA 2WD1A 4IHPA 3PY1A 3C4ZA 5HESA 3G5DA 1AQJA 3NLBA 4PDPA 5JR3A 4YC8A 4X2GA 1NV9A 5AJQA 3R73A 3ORIA 3TM5A 2C3KA 3VS2A 3DQXA 3OW4A 5L8JA 3REOA 4PDYA 5KKRB 3B2WA 1GOLA 2UZBA 2BZHB 5GNKA 3HZTA 1OITA 3MTIA 4QRCA 1OKZA 2NP7A 1Q8ZA 3ZH8A 4E4XA 4JIAA 5EDPA 4M15A 4XP3A 1SNUA 3O23A 1KE8A 4G9CA 5H9BA 4AG8A 2OIBA 5HO7A 4YZMA 2GCDA 5HILA 4NM7A 4QPPA 5DPVA 4X2FA 4IE9A 3LOKA 2X2LA 4NKSA 4FKUA 4IB3A 2G15A 4M0YA 3ZC5A 5KMMA 3A4PA 4FZDB 4EYMA 2EWAA 3OXTA 1OIYA 3FUPA 3FLZA 4WHZA 4FG8A 2CHLA 4QP8A 3LPBA 1KR5A 5A6NA 3NUSA 5C27A 2YWVA 4RVTA 5H3QA 3EFKA 4G5PA 3QTZA 3LIJA 3QTRA 2XNPA 3HYHA 4GK4A 1YB2A 2J0MB 3BHTA 5HG8A 3LCCA 4B7TA 5K09A 4KIFA 2ZTHA 2P3GX 2C1BA 5L6OA 4E20A 1X1BA 4AGUA 3GU5A 3EMGA 3AG9A 4OQEA 2WQEA 3B8RA 2IZUA 3Q2JA 2VTTA 3EVEA 2PL0A 3BGVA 1ZYSA 2YVLA 3QQHA 5ERGB 1D2CA 1KPGA 1ZAOA 3FXWA 1W0XC 3TKIA 1RE8A 1KUTA 2XKDA 3V6SA 2PVCA 5AP2A 2RIOA 4LL5A 3B89A 3ZM9A 3FDNA 4NTTA 3MJ1A 4EK4A 4EC8A 1B6CB 3F5UA 3O4FA 1Y8GA 3ZDIA 4TL0A 3W33A 4TRLA 4XLVA 3MY1A 4O7LA 2QODA 1WBPA 3FV8A 2WMTA 4BHNA 2YAKA 3JR1A 2R3GA 3NNXA 4EH5A 5KZ0A 2W9FB 3NJRA 2IH5A 3CS9A 4BZDA 1DI8A 4JDIA 3U81A 1V39A 4R3CA 4XG6A 5H8EA 3PDTA 2UW3A 2XNMA 4AFEA 4DCEA 5ANKA 1R78A 1JVPP 4XV3A 1JQHA 4F7LA 4IM0A 1OMWA 5DBXA 1GIJA 4N6YA 5LVPA 3DT1A 2B55A 2YA9A 3FYKX 3T9IA 5BVFA 3DBEA 4XG7A 4USFA 3Q5ZA 3ELDA 4MBIA 2ZZNA 3TJCA 2UZOA 2WMUA 5H8BA 2ETRA 2WMXA 2EB3A 2X2MA 4EK8A 1FPUA 4U3ZA 3A4OX 4L7FA 3FC1X 2ITVA 5KCVA 4U97A 5IMXA 3BE2A 2CDZA 4YUWA 5IA4A 3GGDA 2YCSA 4DEDA 3FYCA 2XJ1A 4ISCA 4RTLA 3DKFA 5AP7A 2AVNA 2PVKA 5LARA 3O8PA 1P4OA 5E8SA 5C9ZA 2BMCA 4I0SA 1M52A 2H34A 3CJRA 4AW5A 3EHAA 4PYNA 3MCZA 4O0UA 1MP8A 2NO3A 4LOPA 3HRCA 5KMKA 4RVHA 3RWQA 4XUDA 2W1FA 1FMKA 2GTMA 2GH1A 5T67A 4MHTA 2OKRA 4RTRA 1JWHA 3L9PA 3PJ2A 2PUPA 4FIIA 1YF3A 4LOQA 1O9HA 4UXQA 3AMYA 3E93A 4NIFB 5LQRA 4RLKA 5EH0A 3RI1A 2YZAA 3D14A 1O9UA 4TYHB 3IYLW 1OI9A 3TZ8A 2C6IA 2CLQA 4EOJA 3QYZA 2EX4A 5FTWA 4MX9A 1CDKA 4RJ3A 3UJ6A 1ZGJA 4I21A 3V5QA 4MQ2A 2IGTA 4IZ5A 1YWRA 3BWMA 2HXLA 3FYJX 2J90A 5GJFA 2B9IA 2CKEA 4O0TA 1AQIA 3QQJA 2YDKA 2BTSA 3Q52A 1IY9A 4IB5A 4P7FA 5FGKA 5CVHA 3BQCA 3HGKA 3SKCA 4W4WA 4QP2A 4U80A 1GZOA 1APME 5BVEA 4ACCA 4QQJA 4P7KA 3B2TA 3ID6C 4K6ZA 2QNJA 4BDFA 4C4GA 3AGMA 2W96B 3AWIA 3GBZA 2PSSA 4HVDA 3EQPA 5C4KA 2KW5A 5DTRA 3MYGA 4QYYA 2VX1A 2C4GA 3NR9A 4QMPA 1YW2A 2B25A 1JSUA 4J52A 3WOWA 4IZYA 3KN5A 5CYIA 2CMHA 3Q53A 1Q97A 2HR1A 3EYGA 2UW8A 3KF4A 1XH6A 3PG3A 5CQWA 4W4VA 4YPSA 4C2WA 3OS3A 3TG1A 4FVPA 1FP1D 5EYCA 3DGKA 1OR8A 2BFYA 2JHPA 3VUKA 4EOIA 2IIPA 4RX5A 5ETFA 2CCIA 5C8NA 4DFUA 5HD4A 2GHLA 3DAEA 5K5NA 3ZSIA 5E8XA 2BRNA 4A4LA 4BVUA 4F1MA 1JOWB 3LJ2A 4I93A 3FMJA 2XK6A 3UP7A 2YJRA 4DEAA 4ITHA 1YFJA 2E9PA 4L44A 4TT7A 3HDMA 4FV4A 2W4JA 2YCQA 1FBNA 4DFBA 3CC6A 4TYEA 1H07A 5A9UA 4C37A 3HNRA 4GJ2A 3NNWA 4DCMA 1R3CA 3MA3A 3NUYA 3DOGA 1ATPE 5K05A 3U9NA 1KXZA 3PP1A 4GFMA 3PRIA 3OZRA 2JIUA 3LFCA 1YWNA 5LOHA 2VNWA 2I1MA 4QYEA 3ERKA 2XS0A 4MKCA 1YDRE 3NIZA 5AAGA 4HC4A 1BI7A 3ZUUA 2WTVA 3FHRA 5FEQA 1UWHA 4RWLA 3EQFA 2P0CA 5AMNA 3DXYA 4A07A 4PGHA 1TQIA 5CVGA 1QPJA 8MHTA 3W8LA 3OOGA 3M4XA 3PB3A 4BYIA 2JDOA 3IDCA 3UVQA 5DX1A 3T7SA 4AW2A 4QYHA 3POOA 1OUKA 2BROA 4Y8DA 4FSMA 3KKZA 3N51A 4FT2A 3WZUA 3FBVA 3MBLA 3R04A 4M7RA 2QRVB 1VR2A 2HZIA 3LFBA 4HJOA 4QMTA 3MTFA 4XNEA 3FZOA 1NVQA 1V0OA 1XDUA 3T8OA 4BTFA 1IAJA 2GS6A 4BDHA 3JS2A 4Y46A 4EH6A 2BILB 1YFLA 4PP9A 3AXWA 3I81A 1PJKA 2XBMA 4EHVA 3V6RA 5EMKA 3NWBA 4ZSGA 5K4JA 4ER7A 3FTCA 3MW1A 2EB2A 4U43A 1OL5A 2OIQA 1U54A 2XUUA 2PT6A 4EWHA 4Y72A 4Z2YA 4BYJA 4CFUA 4MQ4A 3R71A 4IVBA 5C01A 5LXMA 4C08A 3UO4A 2UVYA 2YIQA 1KV2A 3I0OA 4Y2HA 4ANBA 1ZMWA 4QMVA 2FHPA 2AOTB 4R6WA 4RC3A 4U7ZA 5E1BA 2P2IA 2UZLA 5CVUA 1JG1A 2F49A 3BYOA 4XP0A 2J0KA 2WIPA 4ZZMA 3RHXA 4CTJA 3CJGA 2O8YA 5I4NA 4MEDA 1FP2A 3P8ZA 5LSAA 4YZDA 3LECA 3FZTA 5E8WA 2QCSA 3LVPA 4MXCA 3P0MA 5K0LA 1OPJA 1CKPA 2GSFA 3FMKA 5J9ZA 3HCEA 4EVIA 3PIYA 5EMMA 4E2WA 2XYUA 2JIIA 3SG9A 4D4VA 3QHRA 2DQ7X 5LMKA 4YZ9A 2QOCA 4MQ1A 2OJJA 3SAYA 2YR0A 3LKMA 4RIWB 3OT3A 5FTGA 5KX8A 4EJ7A 4U42A 5L3AA 4MXXA 2Y1WA 4BCMA 3IO7A 4QP3A 2HIWA 4IDTA 3QTIA 4EH3A 4TNBA 1PMVA 5IA1A 1DUSA 5I9XA 3FLYA 2XH5A 3FI2A 3FMNA 4AX8A 4O0RA 1YHVA 2W5HA 2BZKB 4JQEA 4FZ6A 3QA0A 5TR6A 2PXAA 4EONA 5DYJA 2VGOA 2W1EA 3C0HA 5TKDA 4QOXA 5C9CA 2WTJA 4UBAA 5HVYA 5JGBA 5K5XA 3ZRMA 5IDNA 5DT3A 2GS9A 3WF5A 5DI1A 4EQZA 2WFYA 3AT2A 3I79A 3FUTA 3F66A 4JRNA 5E1OA 4KAOA 3W32A 4CTCA 4L3LA 4GU6A 1ZMVA 4YJVA 5KO1A 3EQDA 3GFEA 4K18A 3E3PA 4KKEA 4KABA 1UNHA 1SVEA 1GAGA 3OF0A 1P1BA 2I7QA 4I6HA 4AQCA 4QTEA 3V5LA 3VC1A 3UWPA 3ZXZA 3OY1A 1NW8A 1ZHFA 4JT3A 1G38A 5IH4A 1XDZA 4XHKB 4DH5A 2UW0A 3MB5A 1WFCA 4FZ7A 4DEIA 4O0SA 1H00A 2UZEA 3ZO4A 2FK7A 5ANOA 2H11A 3OFKA 2WTDA 1R8YA 1KPHA 1QMZA 4YC3A 4ZJJA 4RTJA 4ZTHA 3IW8A 4G6LA 5EDQA 3TZ7A 5L2TA 1OPKA 4E7WA 2AC5A 3BGQA 3HEGA 2B1PA 4DG0E 3EN6A 4CFVA 4E6AA 3Q32A 2AVDA 3OCTA 3TI1A 3VS0A 2QOLA 5HI2A 5K9IA 5TT7A 4L9IA 1JG2A 1UWVA 5CCBA 3R9OA 3TV6A 1H0WA 2H00A 4ORKA 3DMFA 3TIYA 3BKWA 3GC9A 3NGAA 3JWHA 4D0XA 3IW7A 4J53A 4CRSA 3M2WA 4FYOA 2ZMDA 2OYRA 4DCGA 1VYZA 3ZZWA 4ZSJA 4BKJA 4FTMA 1BYGA 5DRDA 1G5SA 4U5JA 2CPKE 4YU2A 2X39A 4M68A 4JG7A 3TM0A 3ZZEA 1JQEA 3JYAA 3ZM4A 3RIEA 5E91A 3I5NA 3DMHA 2XK8A 2IZRA 4E2XA 2B4SB 1BL7A 4G9RA 3I6UA 2BR4A 3DXXA 3SW7A 1IM8A 2X4FA 2JAVA 4G6NA 2PVMA 2VWZA 3PY0A 1A9UA 2QO9A 4FT4A 5DPMA 3BU3A 4DT9A 3KQVA 3X0DA 3CY3A 2GQSA 3HX4A 3EKNA 4L67A 4IAKA 2HK5A 5EI6A 3F82A 3P71T 4G16A 3BXOA 3UJ7A 4P2KA 3UP2A 2UZDA 4EZ5A 3ZUVA 4X6RA 4F4PA 4RZWA 3ZSGA 3F2RA 2PT9A 2XNOA 4TWNA 5GIPE 5HCYA 3CD8A 4RG0A 1R0EA 3DDQA 3R7IA 4DBNA 4RFZA 5CSPA 5CVDA 3UA3A 3SR4A 1J1CA 1WVWA 3OD6X 4CVAA 3DUWA 5K0FA 3I9FA 3R7YA 4BDCA 5IH3A 4O81A 3R02A 4RJ4A 1Y91A 1M6EX 3N9XA 3C6KA 4BF2A 2J6MA 4F1TA 3P9IA 5CEQA 2C5VA 2GMXA 4GT5A 3KU1A 3W55A 5JMSA 4MBJA 2XK4A 2JKKA 3FMMA 4FT9A 5I9VA 3Q9XA 4FTKA 1XBBA 3KQOA 2RKUA 4G17A 3GC7A 1WBVA 3NW7A 4WIHA 4C06A 1YI3A 5F94A 5IZFA 4JR7A 5EG5A 4ZP5A 3FMHA 4EH4A 3MESA 5HNIX 1O6KA 4UYAA 4F99A 4XUCA 4PYQA 4D1ZA 2VTJA 2B52A 5C8MA 2ZBPA 1P91A 3MGGA 1I44A 4HZRA 3ZS5A 2XMYA 3NUUA 1REJA 4FKVA 4I6BA 2PE1A 4B9DA 4FTNA 4GOMD 3UZUA 3DB8A 4FEVA 4C33A 3KCKA 4ZTNA 4CCUA 4WRGA 4C03A 1XJDA 3LFSA 4QP6A 3MN3A 2VGPA 2VDWA 4XG4A 5AAFA 3I4BA 3UMXA 2PMOX 4L3JA 3WILA 2Y4IC 5M5BA 3MIYA 4H1JA 2C5YA 3GQLA 2OO3A 4XLIA 5DRYA 4IQ6A 4F7SA 9MHTA 4X1OA 5DXJA 4C61A 4OTQA 4II5A 4EBVA 4FKPA 3BGZA 2ZM1A 4JJRA 3OFMA 3PLSA 3GNLA 3LBYA 4JRVA 3TQSA 4XOZA 5D12A 3R9RA 4K77A 2QOIA 4EKGA 2VU3A 5AX9A 2Q0BA 2ITNA 5H02A 3P79A 4N70A 3VW6A 5DIAA 3P2EA 1L1EA 1UU3A 4QMOA 2OK1A 3NMUF 3BWFA 4EMSA 4HGEA 3RPYA 4E31A 5BVOA 5IA5A 3VC4A 3TKUA 3SHEA 4D1XA 3R7UA 4XUFA 4RIYA 4L42A 5JGDA 1HCKA 4J98A 5AA9A 5C0OE 3WF9A 3V3VA 3NAXA 1FVTA 1IG1A 2C3JA 3NWEA 2IVVA 3RODA 4FX3A 3LCDA 1BHJA 1PF8A 1Y8YA 4NCTC 3U87A 2ESRA 1NW1A 4FT3A 3QALE 5E8TA 4EKLA 3RWPA 2OI4X 3I7BA 4GK3A 3COIA 4IJ9A 2G8NA 4F9YA 3I5UA 3DJ7A 3UJ8A 4GYGA 3KRJA 1NKVA 3D5UA 3HRFA 1RW8A 2YM4A 2JD5A 1OUYA 3MFRA 4L68A 3UNJA 4L6QA 1RI2A 3GI3A 4DH3A 2NRYA 4DH1A 4DGGA 5J5SA 3LQ5A 3FLNC 1H1SA 4L7VA 3TIZA 3EL8A 4RVDA 3AC8A 2GNGA 3PTAA 1J91A 4BCFA 5FWAA 3FTFA 5J1VA 1MQ4A 3IOPA 3EGEA 3L8DA 3G2QA 4O0WA 1PYEA 4QDJA 4IV0A 1UA2A 1IXKA 5K3YA 3CP9A 3NUPA 1O6LA 3LXLA 5DR6A 3P97A 4L01A 3JWJA 3FQEA 4D4SA 3HM2A 3NCGA 3C5IA 2UYOA 1DI9A 5GINE 3G33A 5E8JA 4CMUA 3QD3A 3DK7A 2NPQA 4OTIA 3SM3A 1WS6A 3WYYA 2ONYA 3NPCA 3D15A 3G0EA 5KMLA 3R22A 1N7IA 4A9SA 1ND4A 3EFJA 3BI6A 1YHSA 5EEGA 1F0QA 1R8XA 3BYSA 4ER5A 2WXVA 1E1VA 3PA4A 3WIKA 5ICEA 1XH9A 5EW3A 3UNKA 5K01A 1XQZA 4FK3A 4GVJA 3EZVA 2UUEA 4BBMA 3A7HA 3B3JA 3F7ZA 1G3NA 3QKKA 3ZMMA 5DX8A 3L8VA 5CAVA 4K2RA 2UVZA 2C7RA 2IJMA 2QURA 4DA4A 2BM9A 1PXIA 3QLFA 2I0EA 4ZEGA 4V0RA 2YCFA 5B2KA 5FULA 4CWAA 2OGVA 4BY9E 2YXLA 3GU4A 4FG9A 3UJCA 3TT0A 3UC3A 1XVAA 3U8WA 2ZBQA 4FSDA 4UX9A 2GQGA 5TF9A 1XTPA 3TUCA 3R30A 1H1PA 1YZHA 3L8SA 4BI0A 1PMUA 3AC1A 4O7RA 2R3OA 1OKYA 3QKMA 3TWJA 4XCXA 2G1TA 3DAJA 4POOA 2O0LA 4O7SA 4UWYA 5LCKA 3IW4A 2EUFB 3HP7A 5HIEA 1TW3A 2WZJA 5ETCA 2DS1A 4AUKA 1WZYA 2VO6A 5CEKA 1QPCA 4KD1A 1XXLA 3GJYA 4HW7A 2PUUA 4DITA 3FI4A 4Q9SA 5M06A 4FSQA 1OPLA 4IAZA 4LRKA 4Y5HA 1ZZ2A 4WNKA 4KSQA 3OG7A 4FIHA 4WUAA 4ERKA 4F6UA 1XH4A 3UFBA 4HYHA 5FTOA 4HVGA 4DF3A 1IRKA 5ICPA 4BDIA 4HGZA 3WSTA 3R3HA 5CSHA 4EL9A 3KR1A 3V8WA 1AGWA 3DY7A 4YO6A 2NXCA 4WG4A 3VNTA 3LCVB 3PFGA 4FV8A 3R24A 4YZNA 4NT4A 5L6WL 4BTKA 4BCNA 4O22A 3A7FA 3T0IA 5D7VA 3W2SA 5CSXA 1R1WA 2WEVA 3BIZA 1QCFA 3ANRA 2BR3A 2IFTA 3O31A 4FTQA 4RZVA 3EOCA 3TZMA 4NH1A 2RFDA 3QZHA 4CKJA 4ZLZA 5F2NA 5DXAA 1RJDA 3FTEA 1PXJA 3F3VA 5KKRC 3W18A 4BDDA 4O83A 4V0GA 1WXWA 2VV9A 3QQUA 1PKDA 5ACKA 3RNIA 1H1RA 4OX9Y 3WYXA 2ZIGA 4JDHA 3RM7A 3MERA 1PW2A 5E1DA 3RK7A 3ZFMA 3QU0A 4JLCA 3SRVA 1TW2A 5GHVA 3ITZA 3FAAA 2JDVA 4QP9A 1ZKDA 2IH4A 4TYIA 3TTIA 5EMJA 1M0EA 3HP2A 4H1MA 3BKXA 3WI6A 2F7ZE 4HH4A 1JKTA 1TPYA 1ZYDA 4O0YA 3HCAA 1H27A 1R74A 2BUJA 3C3PA 4Q5EA 3W2QA 2V0DA 2AS0A 3WZDA 1YDSE 4CT1A 3A7IA 1XO2B 1BOOA 4J1RA 2ZB0A 5CF6A 1VLMA 5HIJA 1JTFA 5IQAA 4IH8A 4IC8A 2AOUA 2BALA 5BPYA 5T64A 5IA2A 1BX6A 1JKKA 1NT2A 2QR8A 3LW0A 5FEDA 1OKWA 3L9LA 4C38A 1V1KA 4WA9A 1UWJA 2F8LA 5EPEA 4HVHA 3P7CA 4F9AA 4EH8A 4ZLOA 4H0NA 3N4UA 3VSEA 1MRUA 4A4OA 2XIZA 5HIBA 2GPYA 3C13A 1N2XA 2PZYA 4XP2A 2XK9A 2WMQA 2SRCA 4FV6A 10MHA 3KPUA 4DH8A 3R1QA 2YACA 2VTPA 3OY3A 4LWPA 2IW6A 4NFNA 2RGPA 4G34A 2C0OA 2V5QA 3PFQA 4APCA 3ZSHA 4U0IA 2GNHA 2XNEA 2HCKA 3O7LD 4O2ZA 3R9XB 3UOJA 4FGZA 1FVRA 4RLLA 4O84A 2O57A 1VQ1A 3EB0A 3CLYA 3KEXA 4PMPA 4E26A 3K0BA 4CTKA 3G0FA 3Q6UA 4K33A 2F9GA 3AY0A 3KPJA 3NDJA 2VWIA 3R8UA 3G8BA 2PYWA 2YERA 5CEPA 3CBGA 4HNIA 2CLXA 4XG8A 4OW8A 2LD4A 2P1DA 4OA8A 4AT3A 3LZBA 4E4LA 5CVEA 2XYNA 3TNPC 3CBLA 2YFXA 4E2YA 3TKYA 2UZNA 5E2AA 4NTSA 5K0GA 4KIPA 4WOVA 4BIBA 2P33A 2AN5A 3S95A 3M6WA 1F3LA 3C6MA 1ZYCA 2B9EA 3G9LX 2EXMA 2IVSA 4GOLD 4C59A 3LFQA 2C7OA 1XJ5A 3MIAA 5C03A 4WSYA 4DGNA 3OU2A 4EK9A 4XG9A 5FEEA 1GZ8A 2ZV9A 4LMNA 3ELYA 1OIUA 2JEDA 4Q2AA 3QOXA 3KULA 2R9SA 3IGOA 3CJTA 4GV1A 3GU3A 1CKIA 4F0IA 1K9AA 4CLJA 4F0GA 1Q24A 3R1YA 1OM1A 2J5EA 4PQNA 5JN2A 5FM3A 2JDSA 4LG4A 4U3YA 3M42A 2ZCJA 4WNMA 5KBQA 3LFNA 4C58A 3I1AA 4ENXA 2YJSA 4ERWA 4YBJA 2YWPA 3AC4A 3CY2A 4WG3A 3QX2A 1HOWA 2NP6A 3TJDA 3GRRA 3P9JA 3BE9A 2ETKA 1CMKE 5FXSA 2G2HA 4FNWA 2ZWVA 3F4KA 4LM5A 3GU7A 3FWQA 3JY0A 5CEOA 1YOMA 4Z7GA 3U4UA 3C5UA 3GCPA 3P4KA 5EI8A 2OXXA 3A26A 3SGCA 3D2IA 4ZZNA 4KDCA 2ESMA 3SXRA 2BHHA 1ZLTA 4I24A 2GLUA 4RVKA 3KCFA 4DMGA 3OC1A 4ZAUA 3VUHA 2FPOA 3G89A 3MVHA 5FXQA 3S0OA 3OCJA 2WIHA 3ER9A 4CKCA 2FGIA 3NYNA 5CF5A 1H4LA 4Z16A 4IX4A 4O86A 4C4HA 5HO8A 4KIQA 2PX8A 1H01A 3H9RA 3MPAA 4CMOA 3V51A 1IAHA 3ME5A 3VF8A 4EQCA 5A4TA 3FQSA 5A54A 3AJDA 5DE2A 1CM8A 4IM2A 4FZAB 4GF5A 3VW8A 4OBPA 1D2HA 3TMAA 3QTXA 3DZQA 3MPTA 3C4FA 4FYNA 3W16A 1W82A 5IH5A 2ITZA 3H2BA 4RT7A 2XCKA 2O5KA 4TTHB 5G6VA 2CL5A 4M69B 5LQFA 2AN4A 1V0PA 4RTQA 3PVBA 2ZZMA 3LHJA 5T3QA 2F2UA 4P7JA 2YM8A 3DXNA 5FADA 3LAUA 4JXFA 2Z7SA 2ZDTA 3GOPA 5FHRA 1P1CA 4GMYA 2X1NA 1SM2A 4CV9A 3GRVA 4OTWA 3H4JA 2IO6A 2O64A 3KPVA 4HCTA 3ORLA 2Z8CA 4ZTMA 4BGQA 2RFEA 3G2OA 4ALWA 4ZOGA 4FIFA 1EIZA 5B1SA 3NYXA 4FEXA 3B3FA 1BKXA 3D2LA 4XBRA 4CFNA 4RA5A 5HE0A 2PPQA 3PYYA 4BCJA 4A9TA 3WF7A 3AMBA 3FI3A 4AGWA 2R5TA 3O0GA 1U46A 3KMMA 2HNKA 3HVKA 2QOQA 3KB7A 5F9EA 2E2BA 2IG7A 3VUDA 2P2HA 4FUYA 5HG5A 4GUAA 2PUIA 2I7CA 2X6DA 2QLUA 3MQ2A 5F2KA 3R9NA 5JRQA 2Y7JA 2I0VA 3F6XA 2YIXA 4C3FA 2ZV7A 5BYZA 3OEZA 3HVCA 2OB2A 3E05A 1CTPE 3V5JA 4EH2A 2V74B 5EW8A 5HCZA 2ZFUA 2UV2A 2CGVA 4FEUA 3O50A 4O7ZA 4LYNA 4WNOA 4IFCA 2YX1A 4PMTA 5GM2A 2CKOA 3LGAA 2OXDA 4RPVA 4PIMA 2BZJA 4FKLA 4IIRA 5KYGA 2WK1A 4E6DA 3H30A 4I0TA 3PIZA 3OMVA 2AOVA 4LGHA 1SQFA 4E4NA 4EK3A 4FKRA 2VTSA 2C69A 3ZU7A 4IX5A 3PSDA 3IK3A 4IFGA 4QMYA 3HVIA 3MDYA 4BLVA 4X41A 4OBWA 3LLAA 3U54A 2P3OA 1OBDA 3PIXA 3IKAA 3E23A 1M2QA 1H8FA 2BDFA 2CKPA 4JG8A 1H08A 4FZFB 1R00A 4AU8A 4MTLA 4UB7A 4JAIA 3SOAA 3A7EA 4CZTA 2IN6A 2XIKA 4ZMEA 5DWRA 4E5AX 1M2RA 4H05A 2O65A 3KXNA 3MAGA 3QQFA 5A4QA 3E7OA 2JH8A 4JDJA 3ZTXA 3OUKA 4I5PA 4MNEB 4CLIA 3KXXA 4ZTQA 1VIDA 1T46A 2QOOA 4RJ6A 5HE3A 3E63A 2PWLA 2OY0A 5KMOA 4PYOA 4D5HA 4NW5A 3FI8A 1UFKA 1B42A 2R2PA 4BC6A 2R7BA 4GT4A 1OIRA 3SMQA 2PVHA 4YLLA 1EJ0A 4GG5A 3COKA 4FNXA 3PPJA 2P55A 2NYUA 2PTKA 1WZNA 3OCGA 3HV3A 4E33A 2PX5A 4HGLA 2AZTA 2RFSA 5KNJA 2C0TA 3EJ1A 4DT8A 2W1DA 2PVJA 4WBOA 4AA5A 2JJQA 3VJOA 5E92A 5JGAA 4PYMA 3IECA 4CQEA 3M11A 5J8IA 4AOIA 4CFXA 3EFWA 1DS5A 5IA0A 5KZIA 1KPIA 2QOFA 4JG6A 5HLNA 2JBPA 3REPA 4RGJA 2BR5A 5KBRA 4OR5A 4X2KA 3UGCA 3ZYAA 5ANGA 2J0JA 2GHGA 3LSTA 4QMLA 4QMSA 4JVGA 5L2WA 5LVOA 4AOTA 3JVRA 5AV1A 4JBPA 3ZCLA 5CAQA 4QQKA 2ZIEA 5LVLA 5T6KA 3EQHA 2V7AA 3OZTA 5HFJA 4ACHA 1N7JA 4OT5A 3TV7A 3MH2A 2J2IB 3TUBA 2QLQA 2EFJA 2WGJA 5E4HA 3EEYA 2OXYA 2R64A 5CIYA 1GZKA 4C34A 4KS7A 4ZY5A 5GWXA 2FSTX 4WNPA 1VL5A 3RAKA 4YURA 4FKIA 2GNJA 4FKSA 4ALVA 3KPYA 4H58A 3A7JA 1VBFA 4M13A 3OCBA 2OJFE 3ORTA 1BUHA 4O7NA 2R7IA 4LL0A 4Z9LA 4ER6A 2Y6OA 3BWBA 4E5WA 3NWWA 4NK9A 5L8LA 4XV9A 5IMEA 5F95A 4O0VA 1IASA 4FR4A 4F6SA 3FY2A 1MUOA 3D5XA 2HW6A 3OZSA 4PINA 2C6DA 3ORMA 4Y95A 3A8XA 3MHTA 4RX8A 5EYKA 4AZSA 4ATNA 1FQ1B 4R6XA 4I92A 4MXOA 3TNIA 4EOLA 3FHIA 4HGTA 4CXAA 1OL2A 1YKRA 5JFWA 4YMJA 3R8MA 4EH9A 4EK6A 3VS3A 3RAHA 2HWOA 4I4EA 4ZK5A 1Y6AA 3HMNA 4QP4A 4DHFA 3TRKA 3JXWA 2IWIA 4GUBA 4RX1A 3V8SA 3Q4ZA 4RIWA 3OU7A 2GA9A 5CT7A 4E1ZA 1QAMA 3BZ3A 2LGCA 4C4IA 3UJBA 3C4XA 4W4YA 4NM5A 3D5WA 3Q9WA 5ANEA 1PKGA 2GU8A 4BIEA 1U54B 4GIIA 5BX0A 3P2KA 5BQ0A 3HCFA 5E2BA 4L8MA 2C6OA 1Y8CA 1JAMA 2ZM3A 5BUJA 3QGWA 2AUHA 5EZSA 2W1GA 3BKBA 2W7XA 2VTLA 3POZA 3W1FA 3CD3A 2OF4A 4NSTA 4H3QA 5A4LA 4I1ZA 4Q5HA 2UZTA 3ALOA 4AT4A 4RX9A 2VWUA 2OZVA 4TXCA 4YV1A 4GT3A 2DPMA 1WBWA 3FXZA 4GKHA 4CGAA 4RIOA 1HNNA 3HVJA 5IH6A 3RM6A 4GVAA 3R0QA 4IZAA 2C5XA 1ZOEA 3PJ1A 5I0BA 3V5WA 5HBEA 5GJGA 1JKLA 3ZRLA 4PNEA 4NJ3A 2Y9QA 4WBBB 5M44A 3L1SA 4EH7A 3PRFA 4UV0A 2VWBA 2VWXA 5AUUA 3EQRA 2XIXA 4D9TA 3PT9A 2NXEA 3EYHA 4FC0A 3RPSA 3LBFA 4BCKA 2J4ZA 5ANIA 4F65A 4EZ3A 4L53A 4CG8A 4BTMA 1XCJA 3EPPA 5FUTA 2HZ4A 3LXPA 3DFCB 2G01A 3VQUA 2OZOA 3QRTA 2VDVE 3E88A 3LXKA 1ZQ9A 5EHYA 4YZCA 4O0XA 2PE2A 1NBIA 4YHTA 2ZDUA 4FIGA 4RC4A 4C4AA 2YEXA 2WOUA 5IQHA 2OH4A 4FV3A 1P5EA 3DFAA 4RJ8A 4TWOA 3DBFA 3FTDA 2A27A 5JRSA 1JBPE 4PP7A 4RVMA 5M08A 4LQMA 4HSGA 3VVHA 4F6WA 5C26A 3E7PA 2OLCA 4HYIA 4XCUA 3EVBA 4QQ5A 3ORKA 3D7TA 4AT5A 2O07A 3KRLA 3G9NA 5CSVA 5C8KA 2J7TA 2XJ2A 4CEGA 5DT2A 3QRIA 5E8RA 1YQJA 2QD9A 1B39A 4NUSA 2C47A 4HYSA 1UKHA 5DNRA 2Z6QA 1EH4A 3QF9A 3EMBA 1UNLA 3FKLA 3E64A 1IR3A 2RFNA 3LMHA 4X3FC 4O82A 2QKRA 5ICCA 4EYJA 4GCJA 2QG7A 3ZLWA 4I41A 3NAYA 4A6DA 2OZAB 3JWGA 4I5MA 3V8VA 5D10A 3DXQA 4EQUA 4TY1A 5E9JA 4ER0A 4ZSEA 2FK8A 2JHAA 3VIDA 3QQKA 4NW6A 3PXQA 5E7RA 3O7WA 3U6IA 3PXKA 3GCQA 2PUNA 3FE3A 4FKJA 5C1QB 3P23A 4P7EA 2ZWAA 4TKSA 3F2AA 2W5AA 3HNGA 3CGGA 4UXLA 4QO9A 3OOMA 1NW7A 5DM0A 2QKWB 2R3IA 3Q9ZA 1L3IA 4YLKA 3S3IA 2OBJA 3LMIA 3MSSA 3QFVA 1QANA 4HPTE 3FC2A 5E1EA 4XUEA 3CR0A 5AP1A 4QMQA 3UZTA 2F57A 4D2SA 2JFLA 3UZPA 4JBOA 3PY3A 3PVUA 4BDGA 5EHOA 4FNZA 1INLA 3LFEA 4PONA 3LDFA 2XRWA 2CMGA 4ANSA 4AA4A 4K6MA 2PVNA 3GWZA 2G70A 4GRBA 5FA5A 4MBLA 1K2PA 2ZW9A 5BVWA 4M67A 4NM0A 5I9ZA 1YUBA 2PVLA 4GC9A 4IAFA 3TN8A 3F88A 2ZB1A 2XYVA 4XG3A 4WD5A 4LGGA 1O6YA 4RFMA 3ZO3A 5EIWA 1KOAA 3HAMA 4IANA 1UVRA 2PZIA 4AW1A 3FQHA 4PYIA 2QG5A 1T45A 3KXZA 4DG3E 5CY3A 3DTWA 4QVKA 5EOBA 5M07A 3K5VA 2VRXA 1M14A 3P86A 3II5A 4ITIA 3D7ZA 5IA3A 2XNBA 3FKOA 2V62A 2BRHA 2XZSA 4KW7A 3FUUA 5HHWA 4ZTRA 3UBDA 3IONA 1REKA 4D28A 2O63A 2JG3A 4C4JA 2BRMA 5IQEA 3UVPA 4APPA 4TWPA 2YDJA 1JSVA 5CNNA 3VQHA 4X3FA 3HUBA 5CAPA 4X7QA 2C30A 1QL6A 2A1AB 4KWCA 4HZSA 2BIYA 1PMEA 2F7EE 2UVXA 3RK9A 2W06A 2IDJA 2OKCA 3TCPA 4AACA 2XEYA 2HY0A 2YXDA 3LM0A 5K0EA 4ZZOA 3AQVA 1RQQA 3SX9A 1Q8UA 4RSSA 3ATTA 1ERKA 1G60A 3E5AA 4BRXA 5CEIA 5B2MA 2BHEA 2WTKC 5BMMA 3JVSA 2UYCA 4G1WA 5CWZA 4LECA 2VUWA 4CSVA 2HELA 4C3PA 5DH3A 4ASDA 3PPKA 5HEKA 2YM6A 3LCSA 2FO0A 3ZBFA 4PNIA 5K4IA 2BAQA 4L52A 3GCSA 3FKNA 4GYIA 4NWMA 4UN0C 5GP1A 4GH2A 3UG2A 4PWYA 5HBJA 5BVNA 3QXOA 4DGLC 2ZJWA 2UZWE 4EHZA 4AOJA 5HLPA 1S9IA 2ITOA 4L7SA 5HIKA 3QCSA 2B9HA 4WG5A 4EOKA 3KQPA 4GJ3A 1SVUA 3CKKA 4IMYA 3Q60A 4BI2A 4Y30A 2ORED 3SC1A 3R8LA 3K54A 3Q9YA 1Q5KA 5FLFA 3VBYA 3F3ZA 4MXAA 2YM3A 5B7VA 1SUSA 2HTEA 2BTRA 5DA3A 2UW9A 2UYHA 2P40A 4DTAA 4RIYB 5EM8A 5EKNA 3P08A 4PL5A 5IQGA 4P5QA 5AUVA 1SZMA 2VWWA 2YABA 2QHMA 4KB8A 3BEAA 5K0NA 2GNLA 4QPAA 4HTFB 3NEWA 1UU8A 4RTKA 2XVDA 3G2MA 5ANDA 4X60A 1J7IA 4JXJA 2Q41A 4KIGA 3SD0A 4PTCA 4R5SA 2HOGA 2EU9A 3HECA 3BYUA 3UPZA 3R9HA 3KF7A 3R28A 2CWWA 2GAFA 3EFLA 1Q0TA 3KVXA 5EQPA 2C6MA 2CKQA 4GU9A 4BP1A 2XBAA 2HAKA 2C6LA 4A06A 2WO6A 3EN7A 3AT4A 4B0GA 3EMDA 2R3HA 3RVGA 5EK7A 5CEMA 4KBCA 1AF7A 3UA4A 2JKQA 4DLIA 3DS6A 4HGYA 4X2NA 2JAMA 1J7UA 3OW3A 3QTWA 2PWYA 4IX3A 4YV2A 1Q8WA 2WMSA 1I1NA 2PVRA 4NU1A 1O54A 4BZNA 5TO8A 2P8JA 4YJQA 3CKWA 2EJUA 4QDKA 4YUZA 5FBNC 3HMPA 3GCUA 3ZUTA 4C4FA 3GB2A 2FYSA 3A61A 5HLWA 2VTNA 2W4OA 3H0YA 2PY6A 3K6RA 4YJOA 1WCCA 5HEZA 3DLIA 1MHTA 3OE4A 1G8AA 2Y4PA 3KN6A 3QQLA 4YJUA 5AAEA 2XIRA 2OJIA 4AF3A 4GG7A 3MA6A 4B6LA 1OBGA 3THRA 2ZOQA 2W1IA 2WMRA 5FXRA 5DM4A 4FEWA 2P41A 3CKXA 3P78A 3UTOA 1V0BA 3EH9A 4FL2A 3HA8A 2RG6A 3LDGA 5EM5A 4XRJA 4X21A 4QTDA 3MB7A 3Q4UA 4YC6A 3RKBA 1RJFA 3HRBA 2A2AA 2C6KA 1ZOHA 3O96A 1RJGA 1H1DA 5LCJA 2E5WA 4O7VA 5ICFA 4P58A 3VHEA 5BUEA 4ZJVA 3OFJA 5CVJA 1UU7A 5J87A 1KP9A 3VBVA 4ITJA 3BV2A 5IEVA 4O38A 3ZO1A 2BFXA 3AMAA 3PXYA 3FUWA 4I94A 3ORNA 4NZWB 4FS8A 4PMSA 3BHYA 4IAAA 3Q4TA 3TKHA 3IHTA 5U4XA 4U7PB 3FLQA 3GCZA 1RI3A 3F3WA 4KBAA 5CD1A 3Q04A 4WRSA 4GOOD 3MFTA 4BCGA 3N4TA 4C4EA 3TL8A 2PGXA 4ZTBA 3ODZX 4J8MA 2DUVA 3C0IA 3FUVA 5DOSA 5EW9A 3L9NA 4DA5A 1Z5MA 1TQPA 1JG4A 5IUGA 2PZPA 3HMIA 3ZFYA 4DZRA 2OG8A 3SLSA 3G6HA 5AIRA 4WVLA 3T3VA 3UIUA 5CNOA 2VN9A 2OSCA 3SGLA 5CU4A 4ALUA 4F09A 3FPGA 5DHJA 2ERCA 3SSOA 4PRJA 5DEWA 5FCDA 2XBJA 2GNIA 5D1HA 4AN2A 3ZONA 2WMAA 1ZWSA 3DAKA 5AUZA 3H9OA 4V0GB 4IB0A 5DVRA 4Y83A 4AZVA 1KE7A 4H3PA 4J8NA 4KA3A 2R3QA 4FUXA 2PVYA 5K0BA 3F61A 3D0EA 3G8AA 3CTJA 3MWUA 2VO7A 2XVAA 4R5YA 3CCNA 1Q4LA 3SRVB 2C0IA 4KKGA 3NVMB 4BHZA 3EKKA 5HKMA 3G5TA 3PWYA 2Z6UA 3FPHA 1WVYA 4ACGA 4YR8A 4EORA 4KKHA 3F69A 2XVMA 2A0CX 5AV3A 3QZGA 3DLSA 3WF8A 3GRUA 3BQRA 4FKGA 4RWJA 5JFSA 3E8DA 2F2CB 5IG1A 3CIKA 5AEPA 1RJEA 4F0FA 3VF9A 2CMWA 3R21A 3VS1A 5EEHA 3VHKA 3ZFXA 1R0PA 3Q2MA 1UU9A 3SVVA 3V5TA 2OICA 2PXCA 4IB1A 5CLPA 4XG2A 4OGRA 4BI1A 5IPJA 4N4SA 2AOUB 4E73A 5BVKA 4HOKA 2XK7A 3IS5A 1NW3A 4AAAA 5EQEA 2VDUE 3KXMA 4BCHA 1FPQA 4DGOA 2PVFA 2ZV8A 4TNDA 1OZ1A 2X81A 3NUAA 5CXZA 3R6XA 4A9YA 4I3ZA 4MNFA 1G6Q1 2XF0A 3DA6A 4Y73A 3IG7A 4Y5QA 3Q4CA 2Z2WA 3LJ0A 3MTLA 2QYOA 4JIKA 5AWMA 3VC2A 2A19B 3HAVA 3MV5A 2V7OA 3A99A 2V55A 4CFMA 3IPHA 2IBSA 3UIBA 4EHEA 1ZG3A 4JOAA 3FSKA 4KBKA 2BIKB 4U44A 3BT7A 4FG7A 1SG9A 3TPZA 3FXXA 4X63A 3VRYA 4AZEA 4FV9A 5HE1A 3NUXA 5A14A 4AE9A 3ZHPC 1U5RA 1IA9A 3QTSA 1DL5A 4M7IA 2ERZE 4QT1A 5AV0A 4BP3A 1SNXA 4ZIMA 3QYWA 3TNWA 2ZIFA 1H26A 4XYFA 4L46A 1P39A 3KXGA 3RW9A 1FMOE 2GB4A 2KULA 5EHGA 3EEOA 4D58A 4AE6A 1NVRA 3ULIA 4TN6A 1H28A 1OGUA 3HMMA 4JQ7A 3DZOA 4BDAA 1STCE 4QPNA 3PVWA 3G15A 3UYTA 3R1NA 3CJQA 1L3RE 3GIWA 3ZO2A 3ORPA 5BXYA 2ETMA 5AUXA 2PSQA 4B17A 3MPMA 4IAIA 2A14A 4ER3A 5EC8A 1KE9A 3TNHA 3QXPA 4EEVA 3LFFA 5HU9A 5EYDA 2EVAA 3QRUA 4QTCA 4RWZA 4W8EA 5C4LA 4OBXA 3FEGA 4K8AA 3WARA 2IZTA 1X1CA 1UIRA 4P5ZA 3SXSA 3HCDA 3FLSA 5AADA 3DP7A 2X9FA 3EWHA 1WAKA 5FQDC 2B9FA 3HMOA 3A7DA 5M4FA 1DM2A 4IJPA 3HCCA 4P7GA 4GFGA 4QP7A 4QQNA 4A6EA 5LQAA 4FTUA 5CX9A 2VWVA 3ZEPA 1CSNA 3KULB 3BLHA 3KHKA 4GW8A 1YDTE 3DV3A 3L8XA 5I9WA 3IGGA 4RYLA 3C0GA 1JSZA 3A25A 2CSNA 3I60A 3LXNA 3V8TA 2BDJA 2AR0A 4M36A 2P4IA 1UKIA 3AXTA 3EVCA 2C7QA 2I62A 3DBQA 5GM1A 1JPAA 1OL1A 5AX3A 4BGHA 4HVIA 2G2IA 3ENHA 2CNVA 3UPXA 3P9KA 1ZARA 1KE5A 1K3AA 3ORZA 3BEGA 4ACDA 3E87A 4YPDA 3QTUA 3FZRA 3DB6A 5KVAA 2VTHA 3P5KA 5KMNA 3KQTA 2KTYA 3B8QA 5EHIA 5JKGA 2H1RA 2B7AA 1Q8YA 4Z7HA 3CTQA 4MVFA 4JAJA 5A46A 5E8ZA 3EVZA 2I9KA 3CEKA 4I4FA 4BR3A 4E70A 2XB7A 3ETAA 5LMBA 2IW9A 3BRBA 3BU5A 3G2PA 4PTGA 3QD2B 1WBOA 1Z9XA 3ELJA 1JSXA 3KK8A 3ANXA 1TVOA 3ZLXA 3UOKA 3FPQA 3KR2A 5DM2A 5T6BA 3OWPA 1YXXA 1ZGAA 3SVZA 3PWDA 3GC8A 3VULA 4JNWA 4Z3VA 5LVNA 4G3FA 1LPUA 2B0QA 5HCXA 5IDPA 1GZNA 4F85A 3VBXA 2YIYA 3ANQA 5EQJB 4DQ0A 4M37A
chains in the Genus database with same CATH superfamily
5FOUA 2AFIA 4S05A 3BMQA 1P5ZB 1U8XX 5E7JA 3NW5A 4B6OA 3IJEB 5D3KA 1DTSA 3WL8A 5IQFA 5GJWC 1SRQA 1EA7A 2VNHA 2M6LA 4QEBA 1NULA 3S2GA 1A88A 5C7LO 5CU7A 1DOAA 2CN8A 4PSAA 4YY3B 4RKRA 4Q7MB 2XB2A 2O8VA 2RKWA 4FL3A 1FNMA 3W8NA 1F14A 5CALA 3JQ9A 4IO0A 3HE3A 1OVEA 4V2IA 1QG6A 3NFFB 1I0LA 3QOWA 3HHPA 4X20B 3PVZA 1YOLA 5E9QA 2XBUA 1Y57A 4GYJA 4UARA 1U9IC 3KQHA 3NBUA 4CG3A 1MA0A 5EYMA 2JLAA 1U2QA 2WFMA 3VVBA 3DZDA 5EFQA 4NPCA 2QDKA 3Q0IA 4E93A 2CXHA 2D2EA 4F4JA 1DIHA 1KQGA 2JGMA 5AUTA 1GIIA 3AVXA 2JIZA 3KB6A 4I1VA 4MEAA 2A3NA 2K4MA 4AURA 2V3CC 3F6CA 4RACA 4JX7A 2FSOX 3ULZA 3N76A 2XRUA 2E9NA 4WA8A 2FH9A 3LP8A 4NRDA 1FVHA 5JEBA 2V7XA 2G28A 4ACMA 4BQOA 4LI0A 2WU0A 1G55A 5CRIA 3FDXA 3EAFA 5JANA 4K9QA 4YALA 5ARDA 5E9EA 1ZRZA 1RVDA 1G3UA 2B1GA 4MNEA 2VF5X 5CLHA 2IXTA 2B9JA 2IIQA 3VDRA 2QN7A 1A8IA 2I4MA 3OTQA 4P0TA 3GJ4A 2FG6C 4UWCA 4XRGA 2CK3A 2D5LA 3R5JA 3MELA 2YHBA 2DKFA 1YQXA 3KM0A 3TQQA 3P5SA 1SUPA 1ZOPA 3D8NA 1L5NA 3JSXA 4YMIA 2ZM4A 1YHNA 2ZR9A 3FMPB 3DAHA 3RK5A 1E0AA 5ELMA 3UIMA 4FTRA 4GYKA 2ALJA 3VZDA 3DOUA 4YWHA 5IUJC 4IOMA 2R44A 4IWDA 4UBJA 1TJNA 4D74A 1GPBA 4ZMFA 2IYOA 2C3IB 3RU7A 3LZ6A 1IZ8A 5HJEA 2EZ9A 7AT1A 4B3BA 2PH1A 3LUKA 2REQB 4PIVA 1JEYA 2E9UA 4CCAA 3ZWYA 3L8YA 2EW1A 1SZDA 3SZ3A 4GE3A 2ZE7A 2BH9A 2CGEA 4RFSA 2J5KA 4UASA 4E21A 4DFNA 2KQUA 4G2TA 5AP3A 4QBKA 3KSDO 2W58A 1FNCA 1K9SA 4CV0A 4DMHA 4IDAA 4XX9A 1N6PA 4MA5A 4TTIA 2XD9A 2IPXA 3UFXB 1Z3CA 2Z8YA 1SVGA 1JQDA 2Z6AA 4J29A 3ROKA 3TJMA 3GU6A 1DO8A 3UJDA 4KG7A 5CP8A 1K8YB 2JJYA 1P0MA 1Z0SA 2AIRA 4CV8A 4KI7A 3U7RA 3U6JA 4XJTA 3U1TA 2ZYAA 2C68A 2G9NA 4CCWA 3C0KA 3WRWA 5HOEA 4BEJA 3UKJA 1DTWA 2MSNA 4PX6A 2P2SA 1F38A 1I94B 3VKFA 2HT6A 3PC3A 2ZYRA 3FGZA 5C37A 2Y77A 1DXHA 2HSZA 2G71A 4AQDA 4IX6A 3KHTA 4QTAA 3SHVA 2ZT7A 2QI9F 1ODCA 3HJNA 2PGNA 1G8PA 5DLYA 2BR1A 2IPNA 1Z8DA 1CX9B 1KSWA 5K0JA 3KY2A 1RI1A 1AY0A 2VS1A 2BKAA 3UT5A 3L8CA 4I36A 3NNDA 1DJPA 2HU5A 4YSJA 1RZUA 2VF7A 5J5CA 2I6TA 4HNVA 4Q19A 4JJFA 2RJOA 1XHAA 4F1JA 3K2BA 1U5BB 4IMJB 4FTOA 3SQWA 1QZXA 1LDYA 1P31A 5ALMA 3R9DA 1HTWA 5C8ZA 1G20A 1VLZA 3JRXA 1BRTA 5EG3A 4RX7A 4S30A 3H04A 2UW5A 1Y1KE 1L7AA 1VDMA 3R7OA 1FSSA 1FU7A 1KHHA 4W8GA 4C07A 2HH9A 1NJSA 3UMWA 2C7VA 3PLAE 4XEHA 3IAUA 3PFCA 5JNVA 2JGFA 4A1OA 3DDCA 2ZI3A 3ZHCA 1VYWA 2X7FA 4RPLA 4EDHA 4P2GA 2H6DA 5DEIA 1SKYB 4KODA 4B83A 3OWKA 3GBVA 2B9VA 3C4CA 4EHGA 3BWDD 2WMWA 1NYTA 2XBLA 1NM5C 1OPXA 4JLBA 4QBFA 3UB3A 5HTBA 2VSFA 4KITB 4EI9A 2IK8A 4FXOA 1J1BA 5LQSA 4P4CA 4XWWA 3UF0A 1PKXA 4LDQA 2XKCA 2FR1A 3AWDA 4FGUA 3NW9A 2WPNA 4F8JA 4EY8A 2ITWA 2RD2A 4PNHA 1I4WA 4HV4A 2JLWA 1PY5A 3LQ3A 4H3VA 4HGNA 2OD2A 1MC1A 3Q1KA 2FVYA 4PCLA 1LPMA 1NDUA 3KZCA 1QHHA 3U4AA 1C1DA 4IGFA 5IDWA 2C3UA 2JANA 4AXFA 3MS9A 1WUTA 3HDYA 1L5KA 3FZPA 3ENNA 3DBDA 4P4LA 2X5OA 3ZHUA 1U3GA 1FDTA 4I9UA 3RREA 1ZH8A 1SRRA 2BZIB 3ZGOA 3B6JA 4IIJA 3WLRA 2CY0A 2HBRA 3ER8A 8LDHA 3KSBC 2VT6A 3R6DA 3LX8A 3TR6A 3TZHA 1H3FA 3QVTA 5JYBA 1H1WA 4R8RA 1M1YA 2P9EA 2CLLB 4O91A 2CVZA 5JEDA 3DXPA 4LNUA 4X91A 2XIQA 4C04A 2QRZA 4DR5B 4UTPA 2IHYA 2ADMA 1YRPA 3DTYA 3Q5GA 2XNNA 1ODKA 2Q0HA 3ZE8A 1GN8A 1ZXEA 2JF0A 2E9VA 5DTQA 4QMNA 1EWKA 3M2PA 2VTRA 2CV0A 5HS4A 4U2KA 1TQ6A 4WDRA 1JQ5A 4J95A 3UQZA 1T5DX 3V48A 1ABEA 3L7AA 1WW8A 1PBTA 3BGIA 4N5LA 4MTAA 4Y2YA 4FT0A 2GYVA 1NOIA 4YUYA 3UNZA 3QQPA 3VVMA 2I0YA 1PYXA 5CURA 1J2RA 3WMEA 2AH5A 2J9FB 2CLKB 4BN1A 3E8EA 3M89A 3DK6A 2QU6A 2FWAA 3AFNA 2OGTA 2JBAB 3UYSA 1MG0A 2EEPA 5BT9A 1ZOLA 1G66A 1XTVA 2YWFA 5JDCC 2B53A 2V96A 4ZQFA 1H5NA 2R6DA 5KVVA 3H0EA 4OU4A 4N41A 1P4FA 1N7HA 2B8NA 2IWRA 3MT8A 4QPDA 4F4IA 4BUZA 5IU6A 1NX9A 1P60A 3N86A 4XW2A 4OYRA 4P1ZA 2HRZA 4WN3A 5EL0A 1RC8A 1P0QA 3JWEA 3EN5A 5EJFA 1M6HA 2O2JA 1XTQA 3PFHA 1QIHA 3UV3A 2ZE6A 3F98A 4XSVA 2OD7A 3QVSA 3ZHVA 3K1TA 4BNKA 1GYQA 2C97A 4PX5A 1EB8A 1TGVA 3RTCA 3T9FA 3KRRA 3V97A 3LE6A 4PPNA 3RRNA 3TQTA 3UMBA 1S2DA 4M0ZA 2GF9A 2XHZA 4LVCA 3PUYA 3CC8A 5K3SA 3TQCA 1T0HB 1ZSNA 2DECA 4UCXA 3GGOA 1TJ3A 4BJ1A 5LD2C 1TEZA 5IKMA 1WDKA 1KMQA 3UGQA 1L8OA 2GFCA 1ECLA 2TSYB 2WEIA 3IIMA 1KXJA 3SJBA 3VO9A 4HDQB 4OP3A 1VGVA 3T3GA 2C42A 5J59A 3O4GA 2XKEA 1D1TA 1MB9A 1B8OA 3PSBA 5CA1A 4GC5A 3LCOA 4CCSA 3GFFA 3LY7A 1A5SB 1OWNA 4D4RA 2ZBVA 2R3SA 1JNKA 4C1NA 2XUJA 2FR8C 4H3BA 4PWZA 3CZRA 2K2QB 1M1NB 5EI2A 1EIWA 1GO2A 4A0SA 2VQDA 3T15A 3KMUA 3S1AB 2IS1A 5EHXA 3MWYW 3QGYA 2YITA 4XD2A 4DDGA 3S2PA 1W5TA 1HL7A 3UPDA 2DUWA 2DLCX 2CGUA 2JRCA 3FZYA 3VSAA 4AJNA 3W5SA 5JH7A 2P9GA 4I0WB 3TEIA 1KZGB 1RBMA 4E6QA 3NFGB 1FOEB 3ODYX 4X61A 1YZVA 4LQLA 3HLLA 3OO0A 4BRSA 3EFOA 4BX8A 1PWZA 4TYHA 3RGFA 3I6WA 3AHGA 3IX7A 5AUWA 5KQRA 3UJGA 1ZONA 1AUOA 4U8ZA 4J96A 4I5HA 4J0JA 4YWJA 3N75A 4UHFA 2IZ1A 5AW7A 1CRWG 1YC2A 2AC7A 1JG7A 1ZITA 1AF4A 4HQFA 4W6ZA 3CT4A 2G17A 1VCHA 1SVOA 4NXMB 2PULA 4FTLA 2YICA 3MUNA 2QZPA 2OQVA 2O3QA 3QNWA 1YNOA 3FFTA 2PMIA 2PRZA 1BMFD 3KQMA 1YRQA 2QSUA 3ZVMA 4B3IA 1PWHA 1CVRA 4CEIB 5M4IA 1SCUA 5BUCA 4A10A 2G4VA 3CSDA 2I22A 2FPKA 4RVLA 3DFFA 1XSEA 3GHYA 4FW8A 3EW9A 3OBIA 4V01A 4BCQA 2VUHB 1U2SA 3UG1A 1Q2XA 1U2TA 4B8WA 2EGHA 3FOFC 1LNQA 3EQIA 4WL0A 4ND8B 1X19A 5JD3A 4DLWA 4UM9B 3TLCA 1W36C 2JLVA 5HZNA 3E9RA 2V5AA 5EIFA 4DCOA 4I0RA 2ZULA 2ZUVA 3VZCA 1QAQA 3TLEA 1GUBA 4YTCA 4LY0A 1W52X 2WP0A 3LOQA 4F56A 4FSZA 3PP8A 4BCCA 3FDJA 4JBNA 3GP0A 4F7NA 4QMXA 3ZEWA 3EVFA 3CH7A 2ERXA 2ZJ1A 3W0OA 2FG7C 4DEGA 1QH9A 4FINA 3D5TA 4MWZA 3FFAA 2CXRA 2NXWA 1LSJA 3H13A 2ITXA 4BZOA 5FNVA 2DRIA 1JHXA 3E4CA 3MH0A 4ZT3A 2JIQA 4YN3A 1K1EA 1NI3A 2SBTA 1H4QA 1SXHA 1SQGA 4H36A 3GD5A 1Q41A 5JO9A 1PR1A 1XNQB 4RBLA 5G02A 3EPJA 1ZMUA 2JGZA 2RL5A 1XCLA 1JDJA 2PQ0A 2F00A 1I3LA 4X3FB 2F48A 5HX8A 3C39A 1W4ZA 4EBFA 3KK9A 4F8YA 1BG6A 4OXKA 3PSCA 4KRFA 1BKYA 4QA9A 4R8KA 1TUGA 4Y1RB 1CJKC 1VC2A 2CL7X 5CS6A 2AF3C 4MPTA 1VJYA 2RG5A 2B54A 3DE2X 3N9IA 3UAWA 4I6EA 1L8TA 3CEAA 3EN4A 3I5ZA 2PJDA 4WXMA 1DAMA 4FYYA 5EM7A 4D2RA 4LUDA 3UODA 4KBGA 4DHIB 1TU0A 3NORA 3QLJA 4HTFA 1T34A 1H9BA 5AUPB 3PXAA 1ONSA 3S2EA 1DJNA 4BKUA 1NU8A 1J97A 2C96A 5EOLA 2XW6A 5AV4A 3RANA 1X8XA 4A0RA 4IADA 5TPWB 3DS8A 3DDWA 2P6MA 3W0SA 1Q19A 3HR7A 4HKTA 1XCBA 2QD5A 3PFBA 5J2TB 3OOEA 4R2WA 4QTXA 3R83A 4V04A 4LMUA 5ULLA 4HDMB 2W2QA 1UBTS 1KWPA 4DEBA 4OHBA 3IDSA 1M10A 4LYGA 4KSCA 1C1YA 1UFRA 4XDYA 3UK0A 2IDZA 1BGWA 1XWSA 1DUIA 3R23A 1GZ4A 1AKVA 1FMLA 4URZR 1N9ZA 2QRVA 1ZP6A 3WWOA 4M7PA 3VBCA 5CGQB 5IT9A 2IKQA 1M67A 5K99A 3A11A 2BAJA 1L3CA 4V02A 4MVJI 4X84A 3Q9NA 3OMLA 4B8ZA 3X44A 2GKGA 5JPIA 5TV2A 2QRQA 1UPTA 3L9MA 5EDRA 2VT7A 1E99A 4Y9SA 2YFKA 4NCAA 3SEFA 2D0PB 5M04A 5GOZA 4U9IS 1SC4A 3Q41A 3UK7A 2V6BA 4MRMA 1UWLA 5HQTA 4HB4A 4JR1A 3IBCA 1CD5A 3AKLA 5EKUA 5J9FA 1P3Y1 2OBBA 5HK9A 1RKBA 3Q40A 3E7WA 5A06A 2O2IA 4AK9A 3HCBA 2PLFA 1XP8A 4HGQA 1AC5A 3HDNA 1TI7A 4DEHA 2VBFA 3IODA 4CG1A 4YCJA 4OQQA 2ITPA 4RHEA 1G8SA 4UUBA 4P53A 4EC9A 1QG0A 2VA8A 4HDNA 3QVUA 4FJVA 4JMQA 2Y4NA 2CV2A 4A0HA 1NLYA 4YXWD 2G25A 2BGLA 1EVQA 4G85A 1JBQA 1Q0UA 2C61A 2RF9A 5JCZA 1Z39A 4FTTA 2JS7A 2GTIA 2A7XA 1WJGA 2VAGA 5DIFA 1L7BA 2FWMX 3S1HA 4HSEA 4O3FA 3TOVA 4JI3B 3C3BA 1DAWA 3PLNA 3OEHD 4G3XA 5IKEA 1XLWA 4QJ4A 4AP7A 3WL7A 4BDEA 2OHGA 3RNYA 4G5SA 3HFRA 3NRJA 1Q3WA 5JQ8A 3R2BA 1Q1QA 2AKEA 3A6EA 4CLDA 2DMRA 3NZ0A 2QQ7A 4F46A 5CVTA 1USKA 2G88A 1VSUA 2HIHA 4PEVA 4FFVA 4WLOA 1J3HA 1JQLB 1P74A<