3ID6C

Crystal structure of sulfolobus solfataricus nop5 (1-262) and fibrillarin complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
227
structure length
220
Chain Sequence
ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre mRNA splicing protein
publication title Structural organization of box C/D RNA-guided RNA methyltransferase.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
total genus 58
structure length 220
sequence length 227
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3id6C01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3id6C02
1U2ZA 3KKZA 5DBXA 5HZNA 2UUEA 2BDJA 4AAAA 1YW2A 5AV0A 3NAXA 3NUYA 2PYWA 3ORIA 3VUHA 1SM2A 4RWJA 3G2QA 2UZDA 3O8PA 3LHDA 3OOGA 1I9GA 3VRZA 4H3BA 3ROCA 3C4ZA 3LCVB 3GO4A 3CBLA 1J91A 1G8AA 1QPDA 3NEWA 4V0GB 4YBKA 2HCKA 3ZYAA 2YIRA 1UNHA 2ZDTA 4NM0A 1BOOA 4RTQA 4KVZA 1CTPE 4Y73A 1YOJA 1XVAA 3BGPA 3KXXA 2I0YA 3REPA 4ASXA 2A0CX 3CJTA 2VWYA 2B9JA 3ZLWA 3RJCA 5F4NA 1IASA 5EYMA 3UE4A 4BZOA 2IDJA 1NVRA 1V0OA 3R7YA 2OPBA 3DU8A 5BXYA 5DPMA 4PUZA 4C03A 2IW9A 5HE0A 4F86A 2AN5A 4POOA 5IZFA 3G2FA 1GIIA 4HW7A 2REIA 3TKUA 2B55A 1FP1D 2EJTA 2QOLA 3NW6A 3JPVA 3NDMA 2WZJA 2YCQA 4ASEA 5AADA 3C13A 4ENYA 5LCJA 2W7XA 3LM0A 2I62A 4AT5A 2O65A 3MVHA 4C2VA 3UOJA 5CLPA 4EL9A 3FLQA 3ZM9A 4CFMA 4DH5A 2X9FA 4B99A 5A14A 2BAJA 3VN9A 2YCRA 4MYGA 3HV5A 4USFA 1BL6A 3Q9ZA 3HMMA 4APPA 1KXZA 4EUUA 5KKRB 2WQNA 1WBWA 4V0QA 1Q62A 2EVAA 1WXXA 4K2RA 4KS7A 4DLIA 4B8LA 5FA8A 3V04A 3LMHA 3DBFA 4JBPA 4GJ2A 2VN9A 5EKNA 4IH8A 1SYKA 3SG9A 3GT8A 2QOBA 5BUJA 5HO8A 2H8HA 5CAPA 3OWPA 1M7QA 4M69B 5HTBA 2CWWA 5D12A 3Q04A 3A2CA 4QMYA 2NP6A 1MQ4A 1NBHA 2PKWA 3AMYA 4LL5A 3PXYA 1YI6A 4XP2A 3ZFMA 3F82A 4IX6A 5IQCA 2BUJA 1YI4A 4W4XA 1CDKA 4YSJA 3OCSA 1JG2A 3GU7A 4IZYA 2CGXA 3TXOA 2BALA 3FE3A 2W1DA 3CPBA 3F61A 2XIRA 5EQYA 2RFNA 4EHVA 2CNQA 4GSBA 1CKJA 3AC5A 4QP3A 2XIZA 2RFEA 2WEIA 5E1EA 1RJGA 4AUKA 5HCYA 3KK8A 1OMWA 2IW8A 4GOLD 3Q87B 3MA6A 4WIHA 5DLYA 1UV5A 3C4EA 2W96B 4BDFA 4IM3A 4QTTB 5CEKA 3KVXA 3E3PA 3RPRA 2R3HA 5LCKA 3JVSA 3MGYA 2ERKA 3L8XA 2OWBA 4YSMA 4D1SA 4DEAA 2C6OA 4ITJA 4NCTA 3TM5A 4PYNA 2W99B 4S30A 4I6QA 4Q2AA 5DLSA 5HVYA 2W1GA 5IA4A 2W9FB 1OIQA 3OZSA 3BYMA 4O0SA 2CNVA 3PG1A 3K54A 1H1DA 4C05A 5FWDA 1MHTA 3LQ3A 1KOBA 4OTGA 5B7VA 5HI2A 4ZTRA 3W2PA 5HLWA 3QQLA 2QONA 4RSSA 2RG5A 3O7LD 3FYKX 1YVJA 3RI1A 3D83A 3V3VA 2AOWA 2YM3A 3VBTA 5LMKA 4FL1A 2X7FA 3VHKA 1NKVA 2WFYA 4Z9LA 1F5QA 2O05A 4YUQA 2P3OA 3PSCA 2ZM4A 2A19B 3GFEA 1FPQA 4EOSA 2VTIA 5AV1A 1JKTA 3VS1A 5M57A 2OBJA 2OJ9A 4IVDA 3N4UA 1JKSA 4YURA 3MB6A 4Y2HA 2PV0A 3AWIA 4ZTQA 2AC5A 2PK9A 3TTJA 3KRJA 3FMJA 3KULB 3AC4A 3WI6A 5H2UA 1G6Q1 4HVDA 3M11A 4R77A 4OBXA 5CVVA 4EJ7A 4OTHA 1GZNA 2GA9A 5HNBA 4PDSA 4U9AA 5E8SA 5M44A 2VTRA 3GCUA 3IW4A 2OIBA 2ITZA 2B0QA 1SNUA 5J1WA 5E7RA 4BTFA 5IQDA 4QPNA 3FWQA 3OMVA 3Q4UA 4CGAA 4E93A 2YDKA 1U59A 3V5WA 3G5TA 4RVHA 2XUUA 4KB8A 2YFXA 4IADA 5DRYA 3QA0A 1OGUA 1OITA 2PGXA 3TZ8A 3OZTA 1Q3WA 5DT2A 2XBAA 4DTAA 3HCFA 2IFTA 2ZJWA 3E63A 3FMMA 2R3OA 5CENA 4EQUA 4FYNA 3EMDA 1Y6BA 2GS9A 3NW7A 5FA5A 4KIPA 4G6LA 1DM2A 4OGRA 2HIWA 2GNFA 4PF4A 5LVPA 3MW1A 5GJFA 1L8TA 2XBJA 1WZNA 4C0TA 3RW9A 4LRMA 3UBDA 1OPJA 4QPSA 4FKQA 5HLNA 2HWKA 4IZAA 3VNTA 1YUBA 1KP9A 1IA9A 4FTCA 3UGCA 2AC3A 3ORPA 3M70A 5KMOA 3EGIA 4E2XA 4YJOA 4ATNA 4X2GA 5A6OA 5FTQA 2UZEA 3C51A 2W1EA 5U4XA 2P55A 4P2KA 4C3PA 2ZDUA 3TUCA 4QMWA 2WOTA 4ER5A 2AZTA 5H3QA 2J0LA 3SXJA 3OOMA 3SHEA 3VHEA 5ANEA 5FTWA 2B3TA 3SAYA 4QOXA 3I5UA 4BCOA 2ZMCA 5IMEA 3I4BA 4XNEA 1F38A 3DXPA 4QDKA 4O22A 1L9KA 5HICA 1I1NA 3VUIA 3NR9A 4NJ3A 5HIEA 4WRSA 5EMLA 4FT4A 4ZSLA 5IG1A 4U5JA 2FGIA 4EOQA 4GOMD 1E9HA 3W32A 5FEDA 5DRTA 4IZ7A 3WZKA 1WG8A 4EKIA 3FMKA 3TKYA 4E6AA 3PVCA 2SRCA 3A7FA 1Q0SA 2GHMA 5AEPA 5JR3A 3CPCA 3GUBA 5AX9A 1M6YA 2EX4A 3DPKA 3QALE 5DE2A 2C5YA 3ORTA 3EN7A 3H4JA 3R71A 2R64A 2PU8A 2BRHA 2W9ZB 5LWMA 5E8JA 3JWJA 3KQTA 2PE2A 3FPMA 4M12A 4YLKA 3G88A 4FZFB 2HELA 4GS6A 3MFSA 2YTZA 1UKIA 4LV5A 4HG2A 4BGQA 3EFLA 5FDPA 3N9XA 2O63A 3KQWA 1Y6AA 3FHRA 3BGIA 4PL4A 4WT6A 3LCDA 4JAJA 1JAMA 5I4NA 1LR4A 4D0XA 4JG6A 3HV7A 4L44A 4Z7HA 3W1FA 2RIOA 1CKPA 4GT3A 3R9RA 1OL5A 4FBXA 2UW8A 1ZGAA 2VZ9A 1V0BA 3PVWA 3L9MA 4UXQA 5GWXA 5TOZA 4E32A 3FKOA 3GOKA 2YITA 3OF0A 3IV6A 5AIRA 4ACDA 5J1VA 5A6NA 3PDTA 4O7ZA 2GNIA 1KYZA 4HYSA 1WFCA 4YJTA 5I5ZA 2VS1A 1L3RE 4JBOA 3DA6A 5EI2A 4RJ6A 4EVIA 5DM0A 3CKXA 1VLMA 4QMUA 4X3FA 5LQRA 2C7QA 4FK3A 1B38A 3OCTA 1E1XA 5AA8A 5DFPA 5CF5A 3KPUA 5LMKC 1B42A 3EVEA 3IECA 2W4KA 3TUBA 2UVXA 3R22A 4CFVA 4XG3A 1JG1A 4F84A 3PP0A 4PGHA 1BUHA 3PY3A 2GS6A 2IBTA 3OW3A 4FKIA 3SSNA 1NBIA 4BHZA 3H0YA 2Q83A 1BKYA 5AM7A 4RLKA 3P9CA 1W83A 4XG2A 3VS0A 5HBHA 5CS6A 3MB5A 4TWNA 4IDVA 4O27B 4PYIA 2F9GA 3KQVA 2ZM3A 4FG8A 1KIAA 2WTVA 4R1VA 3AC1A 1NW8A 2PVMA 4E4LA 3H3CA 3PX2A 3WYYA 3EVCA 4AW5A 5EZQA 1UNGA 4O0VA 1Q99A 2F7EE 4EC8A 1QZZA 4RJ5A 4FZ6A 3OHTA 1HOWA 4BDEA 2J0IA 4E33A 3ZLYA 4EK6A 1YDTE 3OBJA 4BB4A 3BHHA 5E8TA 2B7AA 4LM5A 5K0GA 5KMIA 4P7FA 3A7EA 5IPJA 2ADMA 1B39A 2VAGA 3O8UA 1DUSA 2W06A 5AJQA 5CXHA 1ZMUA 3LCTA 3EQGA 4DH3A 2WTIA 1UWVA 5T64A 3AC2A 4F08A 2ERZE 5CSXA 4JDHA 4JX7A 5A3XA 3FTCA 3UG1A 2Y4IB 3P7AA 4QPAA 1LEZA 4AFJA 1XKKA 3DXNA 1OL7A 1O6LA 4AA0A 2OO8X 4XOYA 4YJSA 3I9FA 1H24A 4KIOA 1KUTA 4ZTHA 2PVJA 4U80A 4YUWA 5AUWA 4FKSA 4ENXA 5EM8A 5CSHA 2JIIA 4TN6A 4FTIA 2ERCA 4IB0A 5DT4A 2B53A 4R78A 2XMYA 2QRVA 4FIGA 1WBSA 5EIFA 1FMOE 4RTSA 3AXTA 3U55A 3FUPA 3UJ6A 4OTQA 4FV6A 3LVPA 1ORHA 2ITXA 3BHVA 4D2SA 4D28A 2CMGA 4NIFB 5JN2A 2PVKA 4PDYA 5H02A 3PT9A 4ASZA 3R02A 1KE7A 1J7LA 4LOPA 4PIMA 5JFWA 1Q61A 1GJOA 3IG7A 4CMUA 2PUUA 4V0RA 3R00A 3SGLA 1O9GA 3PFQA 2WD1A 2VD5A 4AN2A 3UO6A 3S00A 3VS7A 4FSNA 4X41A 3R2YA 4S33A 3Q6WA 3MI9A 4RRVA 4G17A 3LW0A 4PY1A 5AUXA 3KREA 3ZDUA 4RYLA 2YAAA 1BI7A 3DNDA 1PXLA 1XH6A 2OH0E 4QVGA 4D4YA 2O0LA 2EU9A 3K6RA 1IY9A 2O07A 4KUJA 1Q3DA 2VO3A 2VWZA 4XS2A 4HYHA 2R3GA 4NU1A 3A25A 3E7PA 4HVGA 3EVGA 2AR0A 3QZGA 4QMXA 5ETIA 2BRMA 3ATSA 3VWAA 3MS9A 4CFNA 4MK0A 4HRAA 4WUNA 3EMGA 2CN8A 4FZAB 4EOOA 2JDOA 2VWBA 3HEGA 3VC2A 5AUYA 2XCHA 4I5HA 4FV4A 4RIWB 4GL9A 1IG1A 3R8MA 4USEA 4IX5A 4EOLA 5EFQA 3EZVA 2VRXA 4RTOA 4A9YA 3R63A 5K5XA 1JSXA 4I20A 5F95A 5DG5A 4HGEA 4BCNA 2UW0A 4EH9A 4ER0A 3GU8A 1NV8A 2OZOA 4AE6A 4PGGA 4FGZA 4IFCA 4AW0A 5HD4A 3G7UA 2Z60A 3SW7A 2IVUA 5KE0A 4IM0A 2HZIA 4UWBA 2VZ6A 1EQAA 5JSMA 3KN6A 2J5FA 2JH8A 3TFWA 4B4LA 5CU4A 3DOUA 3LXLA 4PTEA 4FTTA 1SVHA 4GEOA 3DKCA 5C9CA 4EJNA 2JDVA 3F3UA 3T9IA 4FT7A 4EI4A 4PMPA 4IAKA 4G6NA 4I92A 4WKQA 3W2CA 5EM5A 4GW8A 4I1ZA 3LCKA 3RWQA 4JQEA 4ZS4A 2PVFA 5FEQA 3UJDA 1S9IA 1S9JA 1BKXA 4YO6A 4QMPA 4QP8A 4E8AA 2X8IA 2OI4X 3JWGA 3G8AA 2JKKA 4C33A 4RFMA 5HO7A 3EFKA 5ERGB 4EOMA 1XQZA 3D94A 5AP5A 4L7SA 1AV6A 4RX7A 3HNGA 4KSQA 4DCAA 2WMSA 5KX8A 2QO7A 4I21A 5G6VA 5IEYA 4TNBA 3KQOA 3P8ZA 2YIYA 4EHEA 3QRIA 1N2XA 4X3FC 4BCJA 3E87A 4TY1A 2V0DA 5EI6A 4FV7A 3PY0A 3NAYA 1AQJA 1PXNA 4C61A 2G2HA 4P90A 4QP6A 5D10A 3EEYA 2W1ZA 2BMCA 3MV5A 2WKMA 2E9VA 2EB2A 3DFCB 3MTIA 2C6MA 2PVNA 5IQHA 4CFFA 3I64A 5FBOA 2OJFE 3SKCA 4CKRA 4ZZMA 4ZTLA 4WOVA 3BWBA 2WAJA 3QD0A 4AACA 3L9LA 3GU5A 2VU3A 2VX1A 4OUCA 4IKPA 4CRSA 4JIKA 4F6SA 3C4CA 2BRBA 2J50A 4P5QA 4CEGA 5FULA 4F64A 4QTEA 2Y9QA 4HCUA 4KD1A 4G3CA 3FKNA 5AFVA 3QGYA 4YZMA 3UQCA 4RBLA 2EFJA 3MTLA 2GS7A 3W55A 4FI1A 3PVBA 4MD8E 3BV2A 3THSA 2PWPA 4W4VA 2BR4A 1WBPA 4YMHA 5FP5A 5EW8A 3BLQA 2UZBA 1H4LA 4BI2A 4V01A 5L2TA 2WMBA 1NW6A 2EXCX 4FZVA 4CKBA 2VWXA 3G6GA 5HNIX 4F09A 4ACHA 2R0IA 2CHLA 5M56A 4MNEB 3ULIA 4L52A 4FKLA 4BDGA 3NUUA 1N7JA 4O83A 5E9EA 3HM2A 5C8MA 4ACMA 2C6DA 3VUMA 3I1AA 2P41A 3IW5A 4IWNA 2XRUA 4FEXA 4NW6A 3O4FA 5ACKA 3B89A 2Z6UA 3TOSA 4P7KA 3MY0A 4LRJA 4RTPA 2C5OA 3C4WA 4OTDA 4IC7A 1O6YA 3SGCA 3QTUA 5HEKA 4FGRA 1OKZA 2PJDA 3BX5A 1H08A 4S32A 1MRVA 1AF7A 1ZRZA 3DAEA 3OU2A 4B0GA 5B2KA 3QCXA 5ICPA 4YZCA 2PVCA 3T7SA 1R74A 3ZLSA 4F65A 2ZWAA 3BGZA 1KV1A 5JFSA 3MYGA 4AQCA 5HIIA 2GFCA 1WY7A 3VC1A 4XCUA 4NT4A 4A06A 5FGKA 4EZ7A 4KS8A 2ZVJA 5KHWA 3ORXA 3PTAA 4WO5A 2BIKB 5E2AA 4KW7A 3ZXTA 1R39A 4R8SA 3ZO3A 2GU8A 2VTAA 3PY1A 2QHNA 2OGVA 4MNFA 2BDWA 3G9NA 3ORZA 2GTMA 4RC3A 4JRVA 5HCZA 2QR8A 4BCPA 1YFJA 4TZRA 5EG3A 4E4NA 4BCMA 2YZAA 2QOCA 4CV8A 4GYIA 3UWPA 2XK8A 4AW1A 3UJGA 2X6DA 4RTJA 4RZVA 5D41A 4XHKB 2UW4A 1SQGA 3GDHA 4F0IA 2J9MA 3TTIA 4A9RA 2P2HA 5BVOA 2IN6A 3U4WA 4I4FA 3VS3A 4EORA 3KCFA 5K05A 4DYMA 3OWJA 3NW5A 4FSDA 2AS0A 4KKHA 2G1PA 2KW5A 4O84A 2FRXA 4YHJA 5IA2A 3S0OA 4I22A 3FXXA 5CI6A 3LJ2A 1YXVA 3OEFX 3S95A 1UWJA 4BLUA 2R3QA 3Q9WA 1HMYA 4N6YA 3F6XA 1XDUA 5CVJA 2FSOX 4FZ7A 1H27A 3EQPA 5C4LA 3UODA 4EH2A 3U4UA 1R3CA 5J8IA 3KRLA 4F1MA 2AYPA 4OBWA 2ZV2A 3W10A 5LQAA 3SG8A 3E8CA 1ZY4A 2LAVA 4JX3A 4XLVA 4YHTA 3FHIA 3MCZA 2ZBPA 4FYOA 1XBBA 1W98A 3GQIA 1HNNA 3QGWA 5LQFA 2G2IA 4Q9SA 2OH4A 2UZLA 3G0FA 2VX0A 4F7LA 3E93A 3FLWA 4EOIA 3LCSA 3N4TA 3ZUUA 4RVMA 5JZJA 2QOIA 5BW4A 2J7TA 5EEGA 2C69A 3A4OX 5ITAA 3SX0A 5GOZA 1PF8A 1OVEA 1OBGA 3QC9A 2C7PA 4FX3A 3OU6A 5EYCA 3NNXA 3QUEA 3Q96A 3ERCA 3OT3A 2JIVA 4Q5EA 3EYGA 1P4OA 3UJ9A 5HIMA 2YM8A 4MQ1A 1R8XA 2PLWA 5CVHA 5DSTA 5M06A 4LOOA 1OI9A 4FTKA 4I4EA 2BHEA 5ANGA 4WBOA 1Q8TA 2X7OA 3ZHPC 1ZAOA 3E23A 3FLZA 1FBNA 3FLNC 1JOWB 5ICCA 3BHUA 4YJQA 2OJIA 5CD1A 3ZC6A 3HECA 4ZS0A 3CP9A 2YCSA 4EK3A 3ZUTA 3LQ5A 4ZMEA 4BF2A 4GFOA 3OP5A 3IDCA 3QCSA 1YQJA 5HHWA 3FPGA 4ORKA 1SKMA 1PXJA 5TT7A 2IDKA 2BM8A 4XUDA 1U5QA 4WNMA 4CV9A 2PZ5A 2AOVA 1Q8UA 3D5WA 3MY5A 3EPPA 4DA5A 4KIQA 4EONA 1P91A 2VTPA 5I9UA 3KR0A 2XYQA 5HX8A 4IB1A 5TR6A 3ORKA 2PE0A 1YXTA 1RQQA 1PW2A 3UYTA 4LL0A 3KL8A 1N7IA 2BZIB 2I40A 2OSCA 5CSWA 1XO2B 4O2PA 2VDWA 4B6LA 3R8VA 3KY2A 4PTCA 3UZRA 2C3JA 2YA9A 3PWYA 5CSVA 4RJ3A 2QD9A 3KQMA 2O64A 4Y5HA 4XG4A 3PA5A 3EN5A 3ZU7A 1T46A 1XHAA 3TDVA 4BDBA 4D5HA 3QTQA 2PVYA 3LJ1A 3H0ZA 4PNIA 5HILA 4EOJA 2Q41A 4H3PA 4EYJA 2AOTB 2R2PA 4PYKA 3B8RA 2OZAB 5KZ0A 3IDPA 2X9EA 3QQHA 2ACXA 2G15A 3T7RA 2Z6AA 3UPXA 4RWLA 1LEWA 3GCPA 2QLQA 1VPTA 1RJFA 4X63A 4CMTA 4ER7A 3CS9A 3H9FA 2VNYA 1M52A 4QMOA 3GRZA 4FIEA 2FYSA 4GK2A 4QP4A 1W82A 3UA3A 1OIRA 3QD4A 3QYWA 2X2MA 3P9KA 3DJ6A 1P14A 4I3ZA 5CWZA 2OXDA 4BP1A 4YJRA 3C4FA 3KPYA 4LV8A 5KYGA 4QQTA 4RMZA 4MWZA 2WOUA 4C06A 4I41A 4JQ8A 5KQSA 4IWDA 3K5UA 3I7BA 3A7HA 2E9PA 2HK5A 3KXNA 4CSVA 4N70A 1RI1A 5CX9A 1RJDA 2E9NA 4ANLA 4NM7A 3N51A 3VJNA 2IZTA 3TJCA 4B17A 4LOQA 3AGLA 4A9UA 3KRWA 4I6FA 3CY2A 2UW3A 3SLSA 4RTLA 1ZZ2A 4GU9A 5CZIA 4YTFA 3HZTA 5BVDA 3VBVA 4A7CA 1DS5A 4C38A 3F2RA 4TYEA 2NP7A 4II5A 4CMOA 2PWYA 4YJPA 5J9LA 2ZB0A 2IO6A 4LG1A 3F3WA 4Z16A 2C7OA 5K4JA 3RVGA 4AG8A 4D55A 4FKGA 5JKGA 4O2ZA 2QVSE 2UZWE 2ZV8A 3BBTB 4O0UA 5C03A 3EKKA 3OWKA 4L53A 2G8NA 5T67A 2HY81 3P9JA 2ESMA 3W2RA 4BDIA 4JG7A 3TUDA 3ELUA 2C3KA 4HC4A 4K18A 3NWBA 5KHXA 4K9YA 5EMJA 4J53A 4U42A 4MKCA 3HEMA 3LFAA 3B3GA 3IGOA 4L9IA 2XNPA 3OCJA 2ESRA 2XYNA 1KYWA 2WGJA 5CTPA 3O7WA 2CKEA 4ONAA 2W0JA 3ALNA 3EIDA 3SA0A 3T9TA 4L3PA 2Z8CA 4CTCA 4HYIA 1JTFA 4FUYA 1Z9XA 4U0IA 4J97A 4FEWA 2RF9A 1U46A 5AP2A 5FXQA 2XCKA 4ACCA 3NVMB 4F9AA 2V7AA 4MVFA 1URWA 3KEXA 1FINA 2XP2A 5FQOA 5M51A 5GINE 4BCKA 3POZA 1XTPA 5K9IA 3RAKA 4EKLA 2BZJA 3BE9A 3UVQA 2ORED 2XJ0A 1Q4LA 1U4DA 1PJZA 1NW3A 1A48A 4EK9A 1YOMA 4RA4A 4L42A 4P58A 4ZJVA 4C3RA 4CNHA 3R7EA 1KPIA 2J0KA 4EH3A 3QTZA 4I5PA 2PMLX 1H26A 1P2AA 5IQFA 5HX6A 2GCDA 4JR7A 3BRBA 3FLYA 5DEYA 3A27A 5HD7A 4ZIMA 4AA4A 4MXCA 4QYYA 3GNLA 3FUTA 3DAJA 2B78A 4YUXA 2XBMA 5JRQA 4BC6A 3HMNA 2Y4PA 3R9OA 1T45A 2YJRA 3R2BA 5LMAA 2HTEA 1J7UA 2NXNA 3G51A 3I81A 3U54A 4RWKA 3VBXA 2PE1A 3GRYA 1CKIA 1PHKA 4G1WA 4BCQA 3IYLW 3AQVA 4KDCA 4DH8A 5ICGA 3PG3A 4YMJA 4EH5A 4I23A 4C4JA 2OF4A 5DRDA 2B9FA 4RQVA 1UKHA 5CVEA 1XH9A 3ALOA 3GC8A 2H9VA 5EQJB 3FV8A 2XRWA 5CEMA 3C9WA 3FY2A 4CG9A 4Q9ZA 3V8VA 5LARA 3QKLA 5CVUA 1Z5MA 4DH7A 4PRJA 5T3QA 4AU8A 3AMAA 3ZCLA 3GQLA 3OCGA 4I93A 1JTEA 2H11A 3MH1A 4J1RA 4HZSA 4APCA 1F3LA 4IX3A 3TKHA 3PXQA 4ALVA 4QYFA 2QURA 4R5YA 4RJ7A 4TL0A 2BCJA 5LOHA 2Y4IC 3QWKA 3HAVA 4FVQA 3GU4A 4QP2A 5AWMA 4FL2A 2VGOA 3BWJA 4XV2A 3HMIA 2R3JA 4WSYA 5KS2A 5FM3A 4FKRA 1K2PA 2J51A 5A46A 2I0HA 2VWWA 4K77A 3B3FA 5L8LA 4O91A 3QXOA 5DI1A 4O7VA 3GRVA 2PZYA 5EHIA 3ZRKA 2Y1XA 4NFMA 3M1SA 1YHSA 3IHTA 5JMSA 3DQXA 3KU2A 2B9IA 4H1MA 1FJXA 5KMLA 1PMUA 2WK1A 2Q0BA 2YDJA 4QT1A 4LGGA 3HRFA 3FUUA 4DGOA 1ZYCA 1VQ1A 4Y30A 2EXMA 4YUYA 3BKBA 3EGEA 5HKMA 4GT4A 3HMPA 1RI2A 2GLUA 4NJDA 4DF3A 1O6KA 4GV1A 3JS2A 3U87A 4OW8A 4G3EA 3AXSA 3FMLA 4TWOA 4V04A 5FXSA 2XH5A 3QD3A 4FICA 2ZIEA 4PX6A 2CMHA 4DINA 2CL5A 2BZGA 4M7RA 2C4GA 1NVQA 2QU5A 2V55A 2HMYB 3NDJA 1Y91A 3II5A 3PXZA 3LHJA 2YUIA 5DYJA 3RPVA 2ZBRA 1DL5A 1LPUA 1PXMA 4FKOA 3HRCA 3FRHA 3QUDA 4HOKA 3F3ZA 4FR4A 2YERA 4WD5A 2YR0A 4GFMA 4U7ZA 2UW5A 4ASDA 3IK3A 4X2JA 4GCJA 2WQMA 3OFMA 2WELA 4E73A 4O96A 3R8ZA 3KR2A 3V01A 1UNLA 2DQ7X 4DFYA 4FKUA 3R0QA 4N6ZA 2YXEA 4WUAA 3UO4A 4AGWA 4BZNA 3IEIA 4PCAA 3O7LB 4DEHA 3SVVA 3EJ1A 2GB4A 4FV3A 4DG0E 4Y95A 4CKEA 4HTFA 3DP7A 5DXJA 5FD2A 2W5AA 4BIBA 3SXRA 2X2LA 2PVLA 3PXRA 5CVDA 3LFFA 2PZPA 4C4GA 4R05A 1WVXA 1VJYA 3WBLA 2P3GX 1JQDA 4JXFA 3ZBFA 3CCNA 4U79A 3UMWA 4JR3A 5M4FA 4A9TA 3BLRA 4PDPA 4QP9A 3LKZA 2X2KA 1NXKA 2ITOA 5ETCA 5LR6A 2X0GA 4OLIA 5AMNA 3SRVA 3SMQA 3GGDA 1RI4A 5CAVA 5I0BA 4UY9A 3DDQA 2R3SA 4H0NA 5LJJA 1G3NA 2YXLA 4RLLA 4YV2A 2ZZNA 2C5VA 3ACJA 2JKMA 2PMIA 4ZXTA 4XG9A 4ISCA 1OIYA 4M84A 3TKIA 4GYGA 3WE4A 3NUPA 1SMHA 3U6IA 1EAMA 1ZWSA 2JFLA 3NX8A 2G9XA 1JNKA 2JGZA 2K4MA 1FGKA 3LX6A 1Q8WA 2VTNA 4Y85A 1ZMWA 4TYHA 3NPCA 4BGGA 4FV9A 5HCXA 2W5HA 5M4CA 4NYEA 4YZ9A 3P9NA 1F3MC 4QYEA 2NYUA 5K8VA 4D4VA 4ER3A 4P5ZA 4ZY5A 5E92A 2HOGA 5CAOA 1VEBA 4U81A 4FT0A 3PSBA 3NCGA 5FM2A 1KOAA 3DB6A 4J71A 4YC3A 1NW7A 3DQWA 2HYYA 2XK3A 4MD9E 1IR3A 4MHTA 4FKPA 3BHTA 5IEXA 2VTSA 3SX9A 5AUUA 5AUZA 4Y5QA 3MH3A 3WARA 4OR5A 1AQ1A 2XKDA 4KRGA 2R0UA 3F69A 4O38A 4FS8A 5DX8A 3GU6A 3OW4A 4TT7A 2GHGA 3FKLA 2Q0NA 4CXAA 2VTQA 1MQBA 2PTKA 2YJSA 3A61A 3QOWA 2WMTA 5HOQA 4X3FB 4F70A 2AVNA 3LQ8A 2IH4A 2BAQA 1V1KA 5DNRA 3UJ8A 4FSRA 1SUIA 3GWZA 5EC8A 4CZUA 4X3JA 1UWHA 4FT2A 4RJ4A 2CCIA 5EQEA 4OTWA 4U6RA 4J98A 5FBNC 4BCIA 3M6XA 4FTOA 1YFLA 2G01A 1EJ0A 3KXMA 1PMNA 2C1BA 3QZFA 2UZTA 4DT8A 2YX1A 3R7IA 3QX4A 1VIDA 3RAWA 5CCXA 4PL3A 2RKUA 2O0UA 4I0TA 3KMWA 1P1CA 3EN6A 3DBQA 3BEAA 2HXLA 5EZSA 2PMNX 2W1HA 5DRBA 1GIJA 3FAAA 3F88A 4XV1A 1YDSE 2EWAA 3EL7A 2JFMA 3KRRA 4RVGA 2Y0AA 3GRRA 4IWPA 3DLZA 3JUHA 3FC2A 2Z02A 2UZVA 3EVAA 3I0QA 3ZUVA 4JXJA 4YUVA 3FYDA 1ZOHA 2PXCA 4RIYA 4X21A 4ZSGA 5BVEA 3Q3BA 4UZHA 1Q8ZA 2EG5A 3R9DA 3ZRMA 2H6DA 4XMOA 3KB7A 3JY0A 4JT3A 2OB2A 4N57A 5CYIA 5AP6A 4X60A 3KMUA 5EYDA 1EH4A 4G5JA 2P35A 4QMVA 5HGIA 3ZZWA 1VE3A 4TW9A 3TL8A 1BMKA 3O23A 3KU1A 3UJBA 3R01A 3OBGA 2Z7QA 3DDPA 2WMWA 2QC6A 2QRVB 3QZHA 4EQCA 3HYHA 5L6PA 4FSYA 2GNJA 5KMNA 4ZJIA 1ZYDA 3KQ7A 3FZ1A 5CNNA 3ZH8A 3WZEA 4M13A 3CTHA 4IQ6A 4NK9A 3R6XA 4NZWB 2HAKA 1YZHA 3C0GA 3V6RA 4QMLA 2XVMA 2YIXA 4JQ7A 2ZFUA 1URCA 4O7YA 3RM6A 4GIIA 3T8OA 4JVGA 4XG8A 4A4OA 4MQ4A 4FE2A 1VYZA 4M8TA 4QP1A 3FXWA 3ODYX 2W4OA 3NUXA 2XK9A 4I0RA 5AIKA 4ZAUA 4F1TA 1OPKA 1VR2A 4X2FA 4ZZNA 4KRCA 2BRNA 4IV0A 2BZKB 4FIFA 5DT0A 4XH6A 1ZKDA 1NT2A 2P4IA 5EM6A 2OYRA 4ACGA 3BZ3A 1GY3A 3DTNA 3DNEA 2RGPA 4TNDA 5JH6A 1HCKA 3SSMA 3W2SA 5G02A 3AGMA 3W33A 4RGJA 2JHCA 3UTOA 4BHNA 5FG8A 3GOPA 3QQGA 3PUPA 3REOA 4TYIA 5CSPA 1TQMA 5JGDA 4CCUA 4H3QA 3G2MA 4OA5A 4GQBA 4Z55A 5HIKA 5ETAA 4IZ5A 2ZAZA 3QLGA 4W8DA 3FY0A 4E5BA 2VUWA 5JRSA 1JSUA 3R7OA 3KF7A 3UP2A 1XWSA 4O0XA 2G70A 4KINA 4WG3A 4E31A 2QOHA 5D7VA 2WA2A 3KXHA 3EQBA 3OPNA 3LMIA 3MH0A 2XK4A 4GEKA 3SC1A 3AD6A 1PYEA 4DG2E 4ZTMA 5HQ0A 1R0PA 2BR5A 4LQMA 3R1QA 4ZK5A 2IZUA 4FG7A 4M97A 1PXOA 3PJ2A 2QE6A 4CFWA 5AUVA 3ZC5A 3ZO2A 2ZM1A 2X81A 3HA6A 3GCZA 2PBFA 2I6GA 3VSEA 1QPJA 3BYVA 4FTQA 3SOAA 4DH1A 4OX9Y 5F9EA 3E64A 3LOKA 4EYMA 3TQSA 4HNIA 3KQQA 1ZXEA 2FSTX 2R7BA 2WXVA 3LFDA 4RC4A 5CT7A 3FZTA 1ND4A 4WXHA 4FSMA 3A8XA 3IW6A 1QANA 4W4WA 4LFIA 5D1NA 3LKDA 3L8VA 1Z57A 3PZEA 5E8VA 3WILA 4C36A 2XNNA 2C7RA 3P9IA 2PT6A 4K11A 4ZOGA 2JC6A 3Q9XA 2YN8A 5C1QB 4G16A 4IE9A 2JDTA 1L1EA 4F6UA 5E2BA 3ORHA 2JAVA 3KRXA 4RWIA 5DTMA 2QU6A 4O7WA 5BW5A 1YKRA 2R3NA 5P8WA 2H96A 4ZSJA 4PMMA 4YBJA 3M4XA 2ZV9A 3AMBA 3A60A 1JPAA 3GXOA 4QPPA 3TT0A 4AZEA 1UA2A 2ONLA 1WMKA 5DXAA 5A4EA 3FBVA 3BXOA 5K0EA 5BUEA 5K5NA 4MBLA 3R1YA 3I60A 4DBNA 2JHAA 3TV4A 1IM8A 3NWWA 4L00A 2BAKA 5B0XA 3QC4A 3UYSA 3KF4A 2P0CA 5K0NA 2UYCA 3OU7A 1XDZA 3G5LA 1HCLA 1ZG3A 4OT5A 3MJ2A 4NM5A 4CKJA 5LWNA 3AT2A 4L68A 3O51A 2QI8A 2WO6A 3UQFA 1WBNA 3V8SA 4IB3A 4NECA 4IVCA 2YCFA 2V7EA 1OL6A 3VULA 1W0XC 2XK6A 4E2YA 4YGAA 5CEQA 4L3JA 2HW7A 4D0WA 3BT7A 4DFZE 3EGVA 4M37A 3DXXA 5EOLA 4EOKA 2NP8A 3KFAA 1GOLA 3NS9A 3QQUA 2FO0A 1FPUA 2BFXA 3S4QA 5IDNA 3E8DA 2UZUE 3EYHA 4F0GA 5CALA 3I5NA 2ZLBA 4XJ0A 4DCGA 3R28A 2YISA 2ITQA 2QG5A 5LQCA 3L8PA 4FTJA 3A99A 3JXWA 4FSTA 3DCVA 4A9SA 4A4XA 4O0YA 2OU7A 3SXFA 1PYXA 4TXCA 2PX5A 3GFWA 1ZGJA 2OXYA 3RAHA 3G89A 3TIYA 3QOXA 1ZHFA 4OA8A 5HZMA 4I0SA 3NLBA 3MCTA 3QHWA 3E92A 4F63A 3FUXA 4P7JA 4AZTA 1Z3CA 4NTSA 4UWCA 4E6QA 3P4KA 3M6VA 1BI8A 4YZNA 2HZNA 4J8MA 3ELYA 1Q97A 4RTNA 2FK7A 2XK7A 4RTRA 2J2IB 3WE8A 3HA3A 1SNXA 3ZEPA 1I44A 4K6ZA 2Y6MA 2WMUA 1ZMVA 5DM2A 4WBBB 3L9PA 3ZSIA 4FKVA 4QTBA 3P86A 5HVJA 1TKIA 3LL7A 4OBQA 4EHZA 2N47A 2C30A 3ZO4A 4FT5A 4CKCA 4F9WA 2OJJA 2BKKA 2JEDA 2PY3A 3RPYA 2I0EA 1O54A 1XJDA 5EKUA 3FZGA 4PV0A 4ALUA 3TKAA 4H05A 4IMYA 5H8BA 1ZLTA 3BU6A 4M38A 3ZRLA 5CU2A 4CVAA 3P7CA 5EIWA 3F5UA 3LM5A 1X19A 2VDVE 2OXXA 4EKGA 2OIQA 1KHHA 4HYUA 1WBVA 4EQZA 3HCBA 5K03A 3BCEA 5BVWA 1YOLA 3PPKA 2NRUA 3G6HA 2ITVA 3P2IA 2P33A 2ZWVA 4XUCA 4DGMA 5HU3A 5DPVA 2GMXA 2OFUA 5CT0A 3UVPA 4D9UA 4DBXA 5IH3A 5FUBA 4ZTNA 3TNWA 4JIAA 3GENA 3FXZA 2OXTA 4F4PA 3MPAA 1JQEA 5HESA 3NRMA 4UXLA 4BCFA 4WVLA 3HP2A 2VWUA 3TNIA 5C9ZA 2HV9A 3IS5A 4R6XA 2QCSA 3MHTA 2XNGA 2R7IA 3OS3A 4JBQA 1PRYA 1X1AA 4PQNA 1AD5A 5KMJA 3OE4A 3NYOA 3BHYA 2QOQA 4R5SA 3BYUA 4O7TA 5CXZA 1PXPA 1YXUA 4GC9A 3ANRA 3DXQA 3QA8A 2C6TA 3BLHA 1E1VA 4NCTC 5EDQA 1XDSA 1XH8A 4CLIA 5JGBA 4DA4A 1V39A 3TPZA 4QQ5A 4GOOD 8MHTA 5KO1A 4GKHA 4Q5HA 3P08A 3M2WA 3UIBA 4DZRA 1J7IA 5JUWA 4G9CA 3EQIA 1VZOA 3HLLA 2G72A 3ZBXA 2QODA 4BI1A 3W18A 5IU2A 3PLSA 4K6MA 2F57A 4FEQA 5AP3A 3U9CA 5GHVA 5BQ0A 2ONZA 2WU6A 3EN4A 3F2NA 2QO2A 3MESA 3R0TA 2RL5A 3ORLA 1UU3A 3G15A 2GTNA 3COIA 3UG2A 4LG4A 1OIUA 3FSKA 5D1HA 3EKNA 5ACBC 2P7HA 5M4UA 4A4LA 4JRNA 3ELWA 3DKOA 4I24A 3BWFA 4EH7A 3VS6A 2Z2WA 3GBZA 2BR1A 3E3BX 4XBUA 3MH2A 3VBQA 4W4YA 4DLJA 4AUAA 4PP7A 4TRLA 5C0OE 5CASA 4YPSA 4C4FA 3R21A 3CTQA 2PX4A 4D9TA 3MTFA 2R3FA 3DGKA 2YWPA 3WF7A 3K0BA 1ZZLA 3D15A 5AV4A 5BYYA 4YLJA 5L3AA 4IEBA 3R8LA 1A06A 5KMKA 4BDDA 2HXQA 3FYJX 5IISA 2VV9A 2NXEA 3E8SA 1SZMA 4C02A 5DR2A 4D2RA 5CM2Z 3KC3A 5BVFA 4C3FA 5FHRA 2JBPA 3HDMA 4YC6A 3E8NA 1AQIA 5EHLA 4Y83A 4CFUA 3MFRA 4NM3A 3FEGA 3LDUA 2AOUA 4H39A 3D0EA 1M2PA 4C08A 3ODZX 1GAGA 4YJUA 5L8KA 2ZBQA 4FNZA 5BVKA 4DE4A 2EJUA 2PMOX 2LD4A 4UX9A 2WA1A 5EKOA 4YJVA 5KBQA 2B9HA 2R3KA 3BU5A 3F4KA 2XZSA 2ITYA 4WNOA 2BZHB 4UZDA 3OZRA 5E8RA 4GH2A 2P2IA 4JS8A 5E8XA 4AS0A 9MHTA 4ZLYA 3QL8A 3MPMA 3TDWA 2FHPA 3I5ZA 4OT6A 4S2ZA 1KPGA 3N4VA 3ANXA 3RP9A 3MJ1A 4EUTA 2NPQA 5LQUA 4UEUA 5CU0A 4IANA 3AOXA 2YABA 2J6MA 2WTJA 4AT3A 5IA3A 3GCSA 4GJ3A 4UN0C 1MRUA 3TLJA 1JR4A 2OKRA 5J95A 3DK3A 4NUSA 2XA4A 3AD5A 4E4XA 4RC2A 4LECA 5AUTA 3RIEA 4GVAA 5EI8A 4J8NA 5ICEA 4ZP5A 3AT4A 4QYHA 3D4QA 4FTNA 3SD0A 3HDNA 3ZS5A 2OBFA 3LBYA 5F2KA 3FZOA 1VYWA 1REKA 3FZPA 5D9HA 3B5IA 4E5WA 5HORA 3RTPA 4QYGA 4ZTSA 2CDZA 3OTVA 5IQIA 2PWLA 1GIHA 3DBDA 3RNIA 2DULA 4HPUE 2A4LA 4YPDA 4R6VA 4UBAA 4XLIA 3W8QA 1SVEA 2E9UA 5I9XA 3AXWA 1J1BA 3TJDA 5D1JA 4UYAA 4FZDB 3SR4A 3UFBA 1ORIA 2BPMA 4KKEA 3DR5A 4JDKA 1Y8YA 3Q52A 3FI4A 2UV2A 3PZHA 5EG5A 4YZBA 3F3VA 4DAWA 2BTSA 4GUEA 3FPQA 4QMMA 3TNHA 4MTLA 4LYNA 4L3LA 4XBRA 4KABA 4GRBA 2PX8A 5DIAA 4NTTA 3CJGA 4C34A 3SM3A 2C6LA 4AN3A 2G1TA 2OKCA 4U41A 2W5BA 3DB8A 4MXYA 2CKQA 3G2PA 3RAIA 4BDKA 2F4JA 2XNEA 5DH3A 3MIAA 2R3IA 4FIHA 2R3MA 2XYRA 5GNKA 5CAUA 3CKWA 4AOIA 4HCVA 3VQUA 4G6OA 4JDIA 4ANQA 1UFKA 2O3PA 3F7ZA 4E1ZA 2YEXA 2IH5A 2XM9A 2R4BA 4GT5A 4CG8A 5IA0A 3FYCA 4EHGA 4D5KA 3F5PA 3RHKA 2XF0A 2W1FA 1FMKA 3LXPA 1UIRA 3E7OA 2IBSA 1STCE 3MIYA 2GNLA 4HPTE 2CSNA 3EVDA 3C3PA 3WYXA 3UZPA 3W2QA 4X61A 5FQNA 4XG6A 1KPHA 5FEEA 4DN5A 3OUNB 3B2WA 3BKWA 5ANOA 3HA5A 5L2IA 3THRA 1M2QA 4G34A 5K01A 3TEIA 4IDTA 4ZY4A 3VRYA 3FJQE 5EKXA 2JD5A 4GG7A 2VDUE 2O2UA 3NUSA 3G2OA 5DR9A 4DEDA 1OL1A 3QAME 4F7SA 3BGDA 4ID7A 1OKVA 4FA2A 3ENMA 2BROA 3TNQB 4C04A 2FK8A 4P7GA 4FUXA 4FVPA 3H30A 2CGUA 3BE2A 3OVVA 5K09A 2V22A 5HBEA 5BX0A 3VVHA 2PXAA 4MBJA 3V5QA 3GP0A 3Q5IA 3R9NA 2VTLA 2Y7JA 3MPTA 3NCZA 4GIHA 3Q32A 5T6KA 4QMZA 4PWNA 1QAMA 1GZKA 3HVHA 4PMTA 4X2NA 3ER9A 3O2MA 2NXCA 2YIQA 2JBOA 3UP7A 2V62A 3A7GA 3KPVA 2H00A 5L2SA 3F3TA 3JYAA 5DOSA 3A4PA 1G60A 3BGQA 3SW4A 2CJMA 3E88A 4Y8DA 4FL3A 5CVGA 2HNKA 4XOZA 3LZBA 2ETRA 3VJOA 3RK9A 4F1OA 4MIKA 1REJA 2JITA 5CQWA 3LFCA 3GCVA 3P23A 3LDGA 4U8ZA 3A7IA 2BIYA 4RVKA 4BN1A 5HLPA 4EQMA 2P40A 4YU2A 4MQ2A 1DI8A 3IW8A 1YB2A 1V0PA 5H8EA 4JDJA 4RWZA 4JBVA 3V6SA 1ZYJA 4LRKA 3THBA 3IONA 4UB7A 2UW9A 5CEPA 3KQSA 4QTUB 3DV3A 1D2GA 4Y46A 2GDOA 3COHA 2IH2A 1U54A 4YLLA 1YWNA 3BWMA 1NVSA 5MHTA 2JDSA 3FMDA 3EQCA 1YWRA 3WF8A 5DT3A 4FEUA 5K0BA 3I7CA 3LSTA 4AXAA 4BTMA 3UNJA 1YXSA 3TN8A 4ALWA 4DFXE 2PVRA 1KV2A 1UU8A 5AX3A 2XKFA 4AN9A 1R18A 3PP1A 1H8FA 2OIDA 3FLSA 5IUIA 4LMUA 1Y57A 5IKMA 5DTQA 3IDBA 3OY3A 2JIUA 2FSMX 4DEEA 3QCYA 4YC8A 1QPCA 3NYXA 5EW3A 4AZSA 2J5EA 5E90A 2FB8A 3ZFYA 4QTAA 4NL0A 2HZ0A 4DKJA 3QRUA 4FOCA 1BYGA 1Q5KA 4M7IA 3W2OA 3QQKA 4FODA 4R3CA 3D9VA 4V05A 3WF6A 4QQJA 3UNZA 3MN3A 2HY0A 3VAPA 3IO7A 5A4CA 4USDA 4CTKA 4E4MA 4F6WA 2OICA 1WCCA 3D2KA 4AZVA 4AZFA 2I7CA 4IAYA 4E30A 1H1SA 5JQ8A 2HWPA 3D7TA 2IIPA 3DXZA 3RINA 1I09A 3KPJA 4MXZA 3M42A 5A9UA 4E6DA 5K0CA 10MHA 5F2NA 2OG8A 2AOXA 3O17A 2I7QA 4CKIA 3VC4A 3OEZA 3RK5A 5LVNA 1GZOA 1GZ8A 4FKWA 4Z2YA 1MRYA 3KPWA 3P5KA 3QTIA 2JH9A 2C47A 2PHKA 3C7QA 3R9XB 3CJFA 4NWMA 2J90A 1Y8CA 4ZY6A 3R9HA 2A14A 5KNJA 5J9ZA 3R7VA 4QQCA 2VWIA 4OTFA 4CCBA 3NGAA 5EVJA 1PY5A 4AF3A 3GJYA 5KCVA 3OY1A 4FT9A 4EH6A 4YTCA 4FSXA 4HGLA 2YIWA 2OY0A 4QQNA 2XB7A 3W8LA 3CQWA 3PXFA 3PRFA 5HU9A 2X8DA 3FDNA 3FTFA 5LVOA 2QKWB 4NKAA 5E8WA 3VS5A 2PUIA 3LIJA 3QYZA 3VO3A 2YHVA 4CWAA 2WQEA 1RI5A 5GM1A 2IVTA 2IVVA 4F85A 4IFGA 4WNKA 2XYVA 1H28A 2UYHA 3KXZA 4BYJA 4EZ5A 5GIPE 3T0IA 3TNPC 3ZMMA 3F2AA 3BZBA 3DKFA 2XNMA 3H10A 4PONA 2BILB 2XJ2A 2RFDA 5M53A 1YDRE 4IAZA 3KMMA 3ORMA 3UZTA 4GUAA 4HTFB 3LCOA 1R1WA 5HNGA 5AV2A 4RSRA 3GRUA 1WXWA 2GPHA 5IEVA 2XKCA 3QTXA 5CNOA 3FI2A 4QVKA 3QHRA 3ROYA 1G38A 3HCAA 4X2KA 4C59A 4XRLA 2F2CB 3D2IA 2DPMA 3NNVA 3BIZA 5GJDA 4BLWA 4FV2A 4GK3A 3SRVB 4C58A 3DBEA 3COKA 4ER6A 4DFUA 3QKKA 4M15A 1XH4A 2VO0A 3VUKA 4OBOA 4BTJA 4AP7A 5C01A 3QD2B 1L3IA 2NRYA 3PIYA 1P5EA 3G33A 4AWIA 4IACA 4EK5A 3UDBA 3NIZA 3UJAA 1EIZA 5GIOE 5CCBA 1ZY5A 1DAYA 3HNRA 5LMBA 4ANBA 5HIJA 2G71A 3Q2MA 4LMNA 5EHYA 3BQCA 4E5AX 1K9AA 4NH1A 3HV4A 3LFBA 2O5KA 5AAFA 3DLSA 3T3VA 3QQJA 3KXGA 3RALA 3WSTA 4LUDA 4TYHB 3ETAA 3ERKA 2C0TA 5ANJA 1IRKA 2ZMDA 3MFTA 1NV9A 4KA3A 4G3GA 2ONYA 4KRDA 2QO9A 4FIJA 2UW6A 3AT3A 3TCPA 4HCTA 5TF9A 3UPZA 3HVIA 3FI8A 3FPFA 2J4ZA 5A4QA 3UNKA 1XBAA 2J0MB 3PYYA 1OR8A 4IVBA 3I6WA 1OECA 2OF2A 5DWRA 3TACA 1H1RA 2ZB1A 3B3JA 3UJ7A 4C4HA 4MWHA 3A26A 2WMQA 4OTIA 3BQRA 4KDRA 3RM7A 3R30A 2CLXA 3U6JA 3F9NA 2UYOA 4BCHA 5I9VA 4EMSA 3FI3A 4U3ZA 3R1SA 5L6WL 4AFEA 4MBIA 3QTRA 4L6QA 1CMKE 3FZRA 1A9UA 5E8ZA 3CTJA 4G2FA 3CIKA 3KR1A 3QBNA 4YO4A 3S3IA 3ZLXA 5BNJA 2WNTA 1XR1A 5IQBA 4MD7E 1IA8A 4EEVA 2C6KA 3CGFA 4G5PA 2FSLX 4IIRA 4U7TB 1X1CA 4XP0A 4TWPA 1SQFA 4RQKA 4E7WA 5TKDA 3KA0A 4FV8A 5LQJA 4C2WA 4NKSA 2OLCA 1MP8A 1NW5A 4IC8A 5DHJA 3O31A 4MHAA 2CPKE 3NNUA 4FSUA 5ANDA 3KN5A 1XXLA 3E05A 3GU3A 3ELJA 4J96A 5F2OA 3LDFA 4O6LA 4QMSA 3Q2JA 1EG2A 3U8WA 1BC5A 2P8JA 5AAGA 2R6ZA 3A62A 4CT2A 3VF8A 3OFJA 4HSGA 3Q6UA 4RIXA 3CGOA 1J1CA 3FPJA 1Q8YA 3CQUA 5LXMA 2W05A 2OO3A 3RPSA 5JFVA 4CRLA 2GSFA 2ETKA 4PNKA 2JG3A 3RODA 5HE2A 2EB3A 4RIYB 3RCDA 3ZO1A 2CN5A 2W1IA 4BI0A 5E9QA 4RX5A 5FUTA 3V8WA 4R3RA 3PXKA 3EH9A 5HIBA 5EMMA 4ERWA 4YP8A 5B1SA 2UZ4A 1INLA 4FV0A 1D2CA 4QMQA 4YTHA 1R8YA 5E9WA 5C27A 1YHVA 2PSSA 5M09A 1XH5A 2OK1A 1KWPA 5HBJA 4HVIA 4A6EA 5CAQA 4C37A 1TPYA 3PJCA 1RJEA 5ICFA 2VO7A 1OKYA 3HA7A 4YZDA 1SVGA 3RHXA 4AA5A 3CCFA 4EZ3A 3HVJA 4XRJA 2ZVAA 4ERKA 4E2WA 3DJ7A 5LQNA 4O7SA 1K3AA 1SUSA 1KE5A 2ZZKA 2ITUA 3BWYA 1SVUA 4PYJA 3HA8A 4PYMA 3GC0A 4V0GA 4AT4A 5I9YA 1TVOA 1XH7A 4BP3A 2WIHA 1TW2A 2PULA 4RT7A 3FSFA 3LGAA 1PMEA 3BV3A 5FDXA 3OG7A 2NNWB 2PL0A 2WTCA 5BVNA 2JHPA 4R7HA 4IAFA 4RZWA 1KE6A 3OXZA 2ZZMA 4HVHA 1ZYSA 3FZSA 3ZEWA 3ULZA 2WTKB 1CM8A 3U51A 2UZNA 4I94A 4DQ0A 1PMVA 1VL5A 4XUEA 2I6LA 3T3UA 2ZV7A 3ITZA 2QG7A 4L8MA 4O0WA 3PB3A 4K33A 3WF5A 4BZDA 2BM9A 4FSQA 4DGGA 3F66A 2X4FA 2XKEA 4ZTBA 4PWYA 1OB3A 3TV7A 1PKDA 3MB7A 5CU6A 5FTGA 4IAIA 3V97A 2R5TA 5HIDA 3RKBA 4U40A 4A6DA 4MXAA 1OBDA 5AP0A 5EQPA 5CUQA 3MVJA 4KWCA 3O71A 4QMNA 3LXKA 5EEHA 5K4IA 2V74B 5CF8A 2X7GA 5EH0A 3R1NA 3LCUA 2C1AA 1J3HA 5EK7A 3KKVA 5F1ZA 3ZXZA 1X1DA 1PXKA 4WNPA 4KBKA 3EVBA 4HJOA 4I5CA 1H0WA 2E2BA 2YAKA 2YM7A 2ETMA 2R3PA 1BL7A 5BYZA 1W7HA 3PJ3A 5ETFA 5IH5A 1JSTA 3R24A 2B1PA 3HMOA 5CVFA 3P2EA 3TG1A 1GNGA 3C0KA 4AX8A 3Q53A 4X7QA 2JJQA 2PUNA 4FMQA 1Q41A 3CVOA 3HRBA 5EPEA 2NXJA 5M4IA 4IVAA 3OE5A 5LVMA 4HVSA 4EKKA 4OQEA 2C6EA 4GG5A 2YACA 2BHHA 3DMGA 3EMBA 4YNEA 5L6OA 4BLVA 3C50A 1UU7A 2OFVA 4I6BA 4P7EA 5DEWA 5FHQA 3NVKI 1L3CA 4IAAA 4HZRA 2ZIGA 3PVGA 2P1DA 4S31A 4WRGA 5HG9A 2CCHA 4M0ZA 1U5RA 3C4XA 4MXXA 3VS4A 3P1AA 4YJNA 3SDJA 2IW6A 3EQRA 1PJKA 2A1AB 5EHOA 4Z7GA 4F0FA 4C4EA 5D11A 1P39A 4QQKA 4ZZOA 4R6WA 4EWQA 3K2LA 3SOCA 4L7VA 2J0JA 2WMVA 2VO6A 3TM0A 4U43A 5EGSA 2PZRA 4GC5A 1P4FA 1X8BA 2WMAA 3G9LX 3UC3A 5T6BA 4DHFA 3EB0A 4O6EA 3FPHA 4GMYA 3DTWA 1AGWA 3ENHA 3ZDIA 1YI3A 2I0VA 4D4RA 4PCLA 5E1BA 4XUFA 2WMXA 5DSXA 4YTIA 4FSZA 4XX9A 3ANQA 1FVTA 3MFUA 3ORNA 2UVYA 2GQSA 3LAUA 3V8TA 2B52A 5IMXA 2B54A 3HV3A 4LI5A 5F20A 4FNYA 4O7RA 2Z6QA 2UVZA 3VBWA 3FQHA 5K0FA 5CY3A 2IP2A 5J5SA 4A07A 4FVRA 4BDAA 1IAJA 1VP3A 3PSDA 5ANKA 4OTRA 1JG4A 4ANMA 4FSWA 4XCXA 4DTKA 2PSQA 3A7DA 1R0EA 3DT1A 4ZEGA 3PE1A 3HCEA 1W84A 3S68A 5AAEA 3PTGA 2VTHA 2GPYA 3E62A 5J9YA 3LPBA 4FIIA 5H9BA 3LFSA 2IVSA 2CNUA 3DFAA 1ZARA 4F9BA 4ZMFA 1WZYA 2WTWA 3VF9A 4KIGA 3L9NA 3OROA 4GVJA 3ZSGA 2C3IB 3UQGA 3VIDA 1KE9A 4PINA 3DBCA 4RV9A 4YMGA 4E26A 1ZOEA 3LFQA 3CR0A 2QR7A 1QL6A 2W1CA 4GFGA 2X6EA 5T68A 4NFNA 4BY9E 3CC8A 3KULA 5DWQA 3NUNA 1MJFA 3C0IA 3E5AA 1MUOA 4M68A 2Z7LA 4TWCA 4C7TA 2XNBA 3NIEA 1JLUE 2AUHA 1FVVA 4F9YA 4RVFA 4YR8A 1Q0TA 1VBFA 4QMTA 3L1SA 2Z7RA 3PS9A 3C1XA 4LWPA 4LGHA 2VGPA 4HGTA 4K8AA 3A7JA 4XEYA 5JFXA 1F0QA 4DFLA 5J7HA 4DCMA 3MQ2A 5IH4A 3NUAA 3S2PA 4RVTA 2WB8A 3LBFA 4O82A 2C0OA 3NW9A 3U81A 3CC6A 1QAQA 3M33A 5FP6A 4O81A 1SG9A 3R6TA 5DM1A 1WAKA 3KGAA 3GIWA 3PA4A 4FT3A 5E1SA 4O0TA 2VTMA 3JVRA 4BYIA 4JNWA 3ATTA 3EQDA 2YWVA 3D5UA 5I9WA 4PTGA 3IGGA 1TQPA 1ZOGA 4DFNA 4RFYA 3DZQA 3BGVA 2AVDA 1YF3A 2AN4A 3P7BA 1ZQ9A 1JSVA 2X39A 3TZMA 4B9DA 3MGGA 4IX4A 3DJ5A 3QUPA 5GJGA 4M67A 2QYOA 3LCCA 2YZLA 4IWQA 5M08A 2PUPA 3C0HA 4GBED 3CJRA 2ITPA 2E5WA 5IQGA 4JG8A 2XS0A 3AY0A 4FKJA 1OPLA 4O86A 3TR6A 3V5TA 2O06A 3MTEA 2GFSA 2X8EA 2WEVA 1FVRA 2WU7A 4PNEA 2GAFA 2QM3A 2R9SA 4GKIA 3HVCA 5E1MA 2BTRA 3UVRA 3CLYA 1Y8GA 2W17A 5JQ5A 4CLJA 3QRJA 3HUBA 3KR9A 4YUZA 2PXXA 4EC9A 4JLCA 4TKSA 5HVKA 1L3BA 3BELA 3QWJA 4GU6A 3SV0A 5IH6A 3X0DA 3MVMA 4BICA 5KKRC 1G5SA 3CD8A 5FCDA 2KULA 4JI9A 1JSZA 3UZUA 3PE2A 3Q4CA 2JKOA 3P78A 2XJ1A 1OKWA 2ITNA 3POOA 4BR3A 4U7PB 5E1OA 3D5VA 4EK4A 4UALA 5KBRA 2UW7A 3VUGA 4FTAA 4ZSEA 3QCQA 4LUEA 5EMKA 2WPAA 3FUWA 1H25A 5E91A 4R3PA 2EUFB 4E6CA 2JDRA 3QFVA 1M17A 5HG7A 3TZ9A 2WIPA 3GC7A 4J7BA 3UIMA 4X1OA 3AG9A 2WQOA 5K0JA 3Q4TA 5BMMA 3FMNA 3CGGA 3WIKA 2BRGA 2F8LA 3C5IA 4PDOA 3Q5ZA 1RW8A 4F7JA 4C62A 3UIUA 4MEDA 4XYFA 3FC1X 2CKPA 3R83A 3LFEA 4FTLA 4DTBA 3EVFA 2WQBA 5KMMA 2H34A 2GQRA 5B2MA 2HENA 3KQPA 4RVLA 2R3RA 3GEQA 3DLIA 4QTDA 4IM2A 3R73A 5E4HA 5A4LA 3IPHA 2R3LA 3VBYA 3GVUA 5FXRA 1JBPE 3NMUF 3AJDA 3DUWA 1OUYA 2Z7SA 1KE8A 2ZSUA 3QTSA 1QPEA 4E2ZA 5KVAA 1FP2A 4J52A 3EWHA 2DYLA 4F7NA 1O9HA 2ZW9A 3I58A 2HR1A 2XM8A 3DMHA 1QMZA 4H36A 4U97A 1LP4A 3MDYA 2NO3A 2P3LA 4S34A 3UIXA 1CSNA 4X0MA 4AE9A 1P1BA 2QOFA 3PFGA 5C1IA 5CF4A 2KTYA 4XP3A 4GK4A 3V5LA 3MBLA 4IB5A 2UZOA 1R78A 4RTMA 4RX8A 4DGLC 3COMA 3RK7A 2DUVA 2QLUA 2CMWA 2JAMA 4D4SA 5JT2A 3EL8A 1OM1A 3LMGA 3Q7EA 4XV9A 2A27A 1G55A 3PLAE 4HNFA 3JR1A 1RI3A 5FWAA 3BKXA 3FMEA 4L7FA 3MWUA 4BGHA 2WTDA 4C35A 5IF1A 4FV5A 3WZUA 4CTBA 3LECA 4PP9A 4IWOA 3DTCA 3IKAA 2OJGA 2HW6A 4AOTA 1NE2A 3D5XA 2CLQA 2AOUB 2GQGA 4BKJA 4YNOA 3R7UA 3UOHA 3M6UA 1YZ3A 1JKLA 1OL2A 4JJRA 5CEOA 3BUSA 3DMFA 3ZTXA 3QRKA 1JG3A 3DOGA 5AV3A 2AN3A 5JZNA 3V51A 5EOBA 1BLXA 2B4SB 3QU0A 4BIEA 2GH1A 5HEZA 3CKKA 3CBGA 5IQAA 2YQZA 1H01A 3TWJA 5DR6A 4YHFA 3KHKA 3GXLA 5CU3A 4HGSA 4HGZA 2C68A 3FQEA 1XCJA 3IOKA 3L8DA 3ER8A 5E8UA 3I53A 2RG6A 3UOLA 3CSVA 4KBAA 4ZLOA 2C0IA 4DG3E 3BYOA 1T43A 5AM6A 4M0YA 3LXNA 3RWPA 3AC3A 3NNWA 1DI9A 4RTKA 3ZSHA 3HV6A 5A54A 3GGFA 3QKMA 5DTRA 1O9UA 3HKOA 4ZSAA 3UA4A 3RZBA 3JWHA 7MHTA 2CGVA 4B7TA 4F9CA 3OTUA 3ZOSA 3FMHA 4C4IA 3VUDA 2JLDA 3NYNA 2VWVA 5I9ZA 1JQ3A 4TYGA 5HG8A 1IXKA 2H1RA 3I79A 3Q4ZA 4QNAA 3UBTA 3ET7A 4PIPA 5J87A 4AGDA 5C8NA 3C6KA 3OWLA 1H0VA 4MWIA 4BIDA 3OXIA 5BPYA 5M07A 4QNYA 4X6RA 2FCAA 3O96A 2FYTA 2ZCJA 5EOVA 1EJ6A 3MERA 3RMFA 2CGWA 3BI6A 4KAOA 5HTCA 3NSZA 4FP9A 3BWCA 2FA2A 2IZSA 4TYJA 3ELDA 3TM4A 4ITIA 4RX9A 3OD6X 2V5QA 3VW8A 3MY1A 1DAWA 1W8CA 2ZYBA 5HG5A 1KSWA 3QRTA 4FEVA 3QF9A 3NYVA 4YV1A 5L8JA 3AC8A 3EFWA 2XNOA 2XVDA 3CD3A 3CY3A 2O8YA 2YVLA 4RIWA 4D1XA 3SXSA 3HCDA 3VYWA 2O57A 3F7WA 4FK6A 1OZ1A 3TI1A 2DS1A 4DEGA 3P97A 2PX2A 4O29A 3TV6A 3QZIA 4U45A 2PY6A 4EK8A 3QTWA 3NZ0A 3OCBA 4DT9A 3PVUA 4L67A 4Z3VA 2VTTA 3FL4A 4RA5A 2C5NA 4R1YA 4AW2A 4ANSA 3RPOA 2YDIA 5C4KA 3T7TA 4D1ZA 3R3HA 4N0SA 3QX2A 2F7ZE 2VNWA 3HP5A 5IA5A 3OFKA 2W4JA 4F99A 2B25A 1R6AA 3BU3A 3EQFA 4E20A 1IAHA 3W16A 1WS6A 1D2HA 2GNHA 5JEBA 3PA3A 3QXPA 3NTVA 3DK7A 3PPJA 5GM2A 1Q24A 2CKDA 2IG7A 3FTDA 5DA3A 3F5GA 1JVPP 2F7XE 3TRKA 3BYSA 4KNBA 4U44A 3E7VA 5EYKA 1RJBA 3ZM4A 3DY7A 4ARKA 5FTOA 3PJ1A 4FTUA 4IJPA 5DM4A 2YM4A 2VTJA 3FTEA 3S1HA 3VS2A 1G8SA 4BRXA 3O8TA 4FV1A 3D14A 1WVWA 4UOEA 3B8QA 2P3QA 4GF5A 2LGCA 4ITHA 5FQDC 1BHJA 4PMSA 1JKKA 1H1QA 3PRIA 3OXTA 4L43A 5EDRA 4BVUA 4ZLZA 5IUHA 4QDJA 3BEGA 2ITTA 3UC4A 2VX3A 1JQHA 4CZTA 4IW0A 5LSAA 1OUKA 2C3LA 4MCVA 3LKMA 2XIKA 1XCLA 5AP4A 4K0YA 5A4TA 2QOOA 5AP1A 4FTMA 5ANIA 5KQRA 3IOPA 3DULA 4C4AA 4W8EA 3R04A 2FVDA 4FC0A 5M55A 1H00A 4MF1A 4DGNA 1M2RA 4QTCA 3TIZA 5IDPA 1U54B 2BH2A 5E8YA 4JOAA 4QO9A 5BYLA 3PJ8A 3GI3A 3G0EA 3P0MA 2E9OA 1JWHA 1FQ1B 2FH9A 4H1JA 5CEIA 5BUIA 3QV2A 4JAIA 4BDCA 5IA1A 2PVHA 2X4ZA 1I4WA 3MAGA 3HP7A 2BFYA 2Y8OA 4LWOA 4R7BA 4EH8A 4DCEA 3G8BA 4O7NA 3QQFA 4R7IA 3H9RA 3U6HA 2X1NA 4O0RA 3HGKA 4RJ8A 2ITWA 3M6WA 4FNXA 3GB2A 4BBMA 5B2LA 2QHMA 2IJMA 4MNEA 2B2CA 4UWYA 3DH0A 3IW7A 3HL7A 2WTKC 3WZJA 4R8RA 5F94A 3PFHA 3PX3A 5HE3A 4HGYA 4RX1A 4DEBA 5GP1A 3CEKA 3FQSA 4AOJA 4QP7A 3KVWA 3D2LA 4DFBA 1R00A 4EH4A 3G5DA 3HAMA 1WVYA 3UJCA 3DKGA 4P4CA 3TMAA 5E9JA 4IBMA 4L01A 3Q9YA 3D7TB 5IUGA 1WBTA 3FUVA 3B7PA 5DX1A 2PPQA 4AGUA 3BBWA 3NWEA 4HH4A 3LFNA 3AD4A 3C3YA 4Y72A 2XEYA 3ME5A 5TO8A 2RFSA 3CJQA 3NDIA 1YXXA 4DM3A 2Y6OA 5H8GA 5HFJA 3UO5A 4M14A 1H07A 4PYQA 4PYLA 3L8SA 4U3YA 3DS6A 2QKRA 5DGZA 2CKOA 3GC9A 3R8PA 4L45A 5K0LA 2VTOA 1RDQE 4GOND 3QLFA 4OQDA 3FRIA 3OC1A 1YRPA 3U9NA 2XVAA 5C26A 3O0GA 3OT8A 1QYRA 3D7ZA 4WG4A 3P79A 3EFJA 2C6IA 3KCKA 2I9KA 3LLTA 2XEZA 2XYUA 4MXOA 2ZULA 4AGCA 2HWOA 4CD0A 4DC2A 4FNWA 3JY9A 3V5JA 5BP7A 5LQKA 2YM6A 4MX9A 1WBOA 4KSPA 3UMXA 4CTJA 2XIYA 4G3FA 5EDPA 4FG9A 2BVAA 3VQHA 3RCJA 5G1XA 3DZOA 2YXDA 3SQQA 4BDHA 2IWIA 3MVLA 5E1DA 4IV8A 2IPXA 4G3DA 3I0OA 2JKQA 1ERKA 4B8MA 4DMGA 2FUMA 4N4SA 2QY6A 1PXIA 3HUCA 3PIXA 2A2AA 4D58A 1YHWA 2HZ4A 2QQ7A 3EHAA 4IHPA 4BTKA 3MSSA 4J99A 3HVKA 3CQEA 4J95A 1BX6A 2B9EA 3DXYA 3SSOA 1FOTA 3NJRA 4FOBA 3EZRA 2IZRA 3DK6A 3LJ0A 2ZOQA 4QRCA 2XIXA 4PYOA 3WIGA 3WZDA 2GS2A 3P71T 4DEIA 4H58A 4NSTA 2OZVA 5EM7A 4MTAA 3O50A 5K3YA 1UU9A 2C5XA 5FLFA 1IEPA 5L2WA 1PKGA 3R8UA 2F2UA 4FR0A 3I6UA 4UYNA 1TW3A 3FPEA 3UOKA 4RPVA 1APME 4TTHB 3ZFXA 4NW5A 4EBWA 1NA7A 3HX4A 2QNJA 4FKTA 4AZWA 3K3IA 3K3JA 3KQYA 4OBPA 2YM5A 1XBCA 5KZIA 4G31A 3C5UA 3OUKA 3DAKA 2I1MA 3VW6A 4IJ9A 2ONLC 4KWPA 5D7AA 5LVLA 5DX0A 3WF9A 1NW1A 5EHGA 3PPZA 2BDFA 4RG0A 5C8KA 4FGBA 2UYQA 5IQEA 3RGFA 3PWDA 4JL9A 4O7LA 5JK3A 4CXMA 2OW3A 4K1BA 1LUFA 5JGAA 5FADA 1M0EA 2BR3A 5BMSA 4X6QC 5EW9A 4TPTA 5CI7A 4BBEA 4EWHA 2OB1A 4CQEA 2V7OA 2WHBA 4YV0A 3LLAA 1XJ5A 5CIYA 1NY3A 5CF6A 3CXWA 3V5PA 4EOPA 4RIOA 5DVRA 3EVZA 3GNIB 2Y1WA 3LPMA 2QOKA 5AA9A 1ATPE 1H1WA 4BBFA 3BPRA 2ZTHA 3TZ7A 3HCCA 1M6EX 5CZHA 2WMRA 4ZJJA 2IGTA 4L46A 4CT1A 1X1BA 4KKGA 4WA9A 3EOCA 4RVDA 5KUPA 3EEOA 4CFXA 4PL5A 3K5VA 5DN3A 4BCGA 1KR5A 5AP7A 1DCTA 2GHLA 4EBVA 4DITA 5FRIA 3G90X 3EQHA 4MAOA 3A8WA 1VP9A 3ID6C 4E70A 4M3QA 3B2TA 3WOWA 1UVRA 1B6CB 4G9RA 5M5BA 4XG7A 2G2FA 3H2BA 3JWIA 4WG5A 1QCFA 1FGIA 5HE1A 3A4TA 3E8EA 3P2KA 3DLCA 2GNGA 4KBCA 2P7IA 1M14A 2PT9A 3GCQA 4XV3A 1H1PA 2PZIA 1TQIA 3PIZA 1YWVA 3ACKA 2BKZA 5CQUA 3C6MA 5CANA 4I6HA 3IQ7A 3FL5A 4RIXB 3Q60A 3MA3A 3SVZA 4M36A 3F5XA 2AOTA 3ZZEA 2OZAA 1M7NA 3LE6A 3ZONA 4RFZA 4KIFA 2ZIFA 3HTXA 4UV0A 4BDJA 1RE8A 4GUBA 2DWBA 4WHZA 1QAOA 2F49A 4MH7A 3H9OA 3KK9A 4FTRA 4C07A 2VP3A 4I5MA 3OZ6A 4G56A 2FPOA 3EN9A 3CE3A 4O21A
chains in the Genus database with same CATH superfamily
2CXHA 1QHFA 1U2ZA 5AOBA 4CG3A 2WP0A 3VR5A 3SKVA 1RXWA 5HZNA 3ESXA 2UUEA 3MGBA 3ECAA 1QK3A 3F7OA 1OTHA 4ZVKA 1C4WA 1QHSA 3VR2A 5GV7A 5G4LA 2VOEA 1ORDA 3NUYA 2WR8A 4F60A 3LQ1A 2BZ1A 3PGKA 1I13A 4JL6A 5JY6A 5EKTA 4H3BA 3ROCA 2DWPA 1BXGB 1G8AA 3GP5A 5KVQA 2HCKA 3ZYAA 4G1MB 2ZDTA 1BOOA 2OM2A 2RG7A 4FVTA 4RTQA 3THYB 1DAHA 1JQLB 1YI8A 3K9FC 1FU4A 4MUEA 2XUAA 3ZLWA 4YMTA 2OEPA 1IASA 1D1QA 1QTRA 2QJWA 2IDJA 1V0OA 4DBVO 3RRFA 2OPBA 3TJZA 5BXYA 5DPMA 4PUZA 4C03A 3IEPA 5LZ7A 2ZTMA 2BKAA 2IW9A 3A1FA 5LYYA 2BLLA 4POOA 5IZFA 3LQ4A 3G2FA 4QBKA 5MGBA 3NEJA 1LS1A 5KYUB 5IT4A 4RXTA 3U7IA 1WZEA 3PWSA 1DQNA 3NW6A 2NUTB 3NFRA 3TLMA 3V3TA 3JPVA 1X0XA 1YZVA 4ASEA 5AADA 4RVNA 4ENYA 5LCJA 2W7XA 1AGNA 3VH4A 2BMWA 5KMGB 2MIIA 3UOJA 1UFVA 4EL9A 2REQB 3FLQA 3ZM9A 2HJ9A 4PGAA 3I2YX 1XZJA 3IQDB 4PU0A 1G4HA 1FU7A 4MYGA 3H1PA 3HV5A 1J1ZA 1UPTA 2Q9UA 2QN8A 4J1NA 4UUPA 3T1OA 4JJ4A 3RHFA 4XIIA 3BL8A 4EUUA 2MOKA 2GERA 1OC4A 4CM9D 2EVAA 4K2RA 4KS7A 3ZXSA 3T12A 4LZLA 3LMHA 5EXEA 4D3YA 4E08A 2VN9A 3RHZA 4Z8YA 1CJUC 5JD4A 2R6AA 3GT8A 3CHYA 1R0KA 1G64A 5HO8A 3DNMA 2Y0EA 1M7QA 2HJVA 1F20A 1L1FA 4YCCA 4LQDA 5EL0A 4CCYB 3UH0A 3HO8A 3OZAA 1IBLB 3AL3A 1QKJA 3A2CA 4QMYA 3TK1A 4B44A 1NBHA 4EFLA 5DN9A 4E15A 3PXYA 1YI6A 1R9GA 2JFNA 3OE1A 3U5ZB 1BA2A 1Z68A 2JJMA 3O21A 3M2TA 4IX6A 1O7JA 4BFSA 2BUJA 1M7HA 5B12A 3U16A 4YJ3B 2HWXA 5FO0A 2BGRA 1NLZA 2BALA 3AMVA 1A8PA 2VDMB 3F61A 4E5PA 1GZ3A 2PRZA 1IZ9A 1VL8A 2XIRA 4LQCA 2QX6A 3T1HB 4LOIA 2CNQA 4QUAA 3C97A 4EJSA 3RPEA 3AC5A 3F6SA 3PA8A 1Z0UA 5BV3A 5E1EA 3C3KA 3F78A 1OMWA 4IRUB 4YCAA 3F5DA 3SICE 3BL7A 4NFLA 3UB3A 1X7GA 4MPDA 2DHDA 2ZRMA 5IT0A 3BGOS 2HYDA 4DXDA 3JAWB 4IM3A 1QDUA 4BRZA 3E3PA 1WDWB 5LCKA 3JVSA 5EP2A 1EXDA 3CV3A 3WFZA 1XB2A 3WQQA 4CM8A 4ITJA 2XQVA 1A4IA 4G0NA 4FGKA 3TM5A 3L0BA 3H1TA 3NVDA 3K0EA 2QT1A 4X95A 4Q2AA 5IA4A 1E2PA 4W99A 1NXXA 2GZ1A 4IIBA 1T4DA 2H85A 5DT9A 2B36A 4LOKA 2PUDA 3OZSA 2CNVA 3PG1A 1JDUA 3BSSA 2JFWA 3K1JA 1NNUA 5EJ7A 3MMZA 4M99A 1ESZA 1SCUA 4RPKA 1QIIA 1TM5E 3DBHB 4OTGA 2NVOA 3PL5A 2B0JA 1OXMA 5FWXB 3QQLA 2QONA 4PHHA 1YC5A 2WAXA 4DN6A 4BNHA 1SCBA 3LDHA 1LPAB 1FSZA 1H4TA 1OOEA 4L4ZA 4E3ZA 3D83A 1LNSA 2XUOA 2AOWA 3V1NA 5LMKA 3DPUA 1R12A 3W0MA 2Y1LA 4FL1A 2X7FA 3VHKA 1CDEA 2WFYA 3O8BA 5BMVF 3NH6A 3BAFA 4YUQA 1VCNA 4HB4A 1JUDA 2A19B 5DE3A 4EOSA 2WQZA 1L8LA 3UKDA 1HORA 2OBJA 3INNA 1NR1A 4QBHA 2OJ9A 2HSZA 4IVDA 3N4UA 2HSEA 5B30A 3ILXA 3MB6A 3S2IA 2PV0A 2AX3A 1SUPA 4P22A 3A1NA 2NAFA 5JCPA 5KNLA 2SCUA 4OYLA 3KRTA 3TTJA 4PNPA 5E6UA 4R8MA 4LGMA 3RD5A 3MB8A 5DCYA 3AC4A 2VHTA 2FQQA 3GMIA 2J5QA 2EYUA 3WI6A 1KJJA 2FPRA 2H1LA 1AURA 2RKWA 3M11A 3HABA 1CERA 4OL9A 5IJWA 4HUTA 1SUAA 3WO1A 1TQ2A 5CVVA 4OTHA 1DOZA 4KZPA 2BF4A 5HNBA 1C3EA 1CW2B 1J09A 3VI3B 4CIAA 3H9UA 1AK1A 3WL6A 4BMXA 3GCUA 3A6LA 1JPUA 2GZMA 3OURA 1CS4C 4MRMA 1GRQA 2OD2A 1SNUA 7AT1A 4KMRA 4QPNA 2IGBA 3OMVA 1VYHA 3V8NA 4GMDA 1U59A 5FBKA 5ILOA 3Q88A 1RWVA 4QAQA 2P9EA 1NX9A 3G5TA 1G21A 4KB8A 2QMQA 3JVDA 4IADA 3CPEA 2NM0A 3QA0A 2HIHA 5AKYA 4WXRA 1C1XB 5K2MA 1CP3A 1XOIA 3PP8A 1EGHA 2BUCA 5JQGB 2ZJWA 2CCKA 2CY0A 3WZ2A 2VSQA 2XAAA 5IHXA 2CHFA 3E63A 1QUEA 2PFSA 2R3OA 2J33A 2ZYGA 1O6CA 3U3RA 3QEAZ 1IEQA 2GS9A 3PX7A 1L5MA 1TYDE 3IPYA 1LQTA 1VI5A 3IVGA 4OGRA 4XPZA 5GJFA 5DVZA 4XI9A 2J45A 1W1UA 3H0EA 5HLNA 1C41A 3X1XA 1VB3A 2AJCA 4JFAA 1DCKA 1IA9A 2Y1CA 4FTCA 3UGCA 3ORPA 3EGIA 1O57A 1S3IA 4GLFA 4E2XA 4YJOA 3CT4A 3HDVA 5CB4B 3BD9A 3L0SA 5A6OA 1E7SA 3C51A 5U4XA 4UQLA 5F64A 2P55A 4U6SA 4C3PA 5MN6A 1MB0A 2P9GA 4PGFA 2EAUA 3E3AA 2MMCA 4S35A 1Z22A 4ER5A 4F2WA 3O0TA 2A0WA 3ZHQA 3S1LA 4R68A 3SXJA 3OOMA 3SHEA 3VHEA 2FLVA 4JIMA 2W2MA 1AK9A 1GILA 4R1TA 2OCPA 1HE1C 4G0WA 2P5YA 1MKYA 2PANA 3HR7A 3V6MA 4QOXA 1P4JA 4AYTA 3DL7A 4BCOA 3PGMA 5BWCA 4MDHA 5AXBA 4XWAA 5IMEA 1T8SA 3I4BA 3H1FA 3LP6A 3KOMA 1ZW1A 2CWDA 1E79D 3K6KA 5MGNA 3VUIA 4L8VA 3RUEA 5A2GA 4EFKA 5FTMA 4NJ3A 2BFWA 2C5LA 5EMLA 4FT4A 1XWFA 3HMQA 5IG1A 3DHVA 4JP8A 1OAAA 3B7GA 5CYGA 2P6PA 5K6TA 1KFCB 4YBZA 3W32A 1EHIA 2IXTA 2Z5FA 4EKIA 2HCTA 3KU4A 3IQZA 2JH3A 1DQYA 3WNZA 1GVHA 4ARVA 5JR3A 3EYAA 4BKUA 1DXOA 2XAOA 1HE5A 4Z1MA 3LUBA 4YP7A 3EN7A 4F78A 3O4HA 2VH5R 2NO4A 3JWJA 3DL0A 2I2FA 3OCYA 4DHEA 3AM1A 2R6DA 3JATB 1O5OA 4YLKA 3G88A 3VHRA 1T8WA 4LV5A 1GG5A 5ALRA 4BGQA 3EFLA 3EX7C 3EGOA 1J0XO 4M9CA 2BGTA 5K3DA 1RDFA 4BMDA 4IM7A 3UGJA 1NIPA 3LCDA 4HPXB 3RRBA 4Q01A 4TMTA 1ONSA 3CPHA 1XNQB 1JAMA 2OESA 2ZQ5A 1LR4A 1I4EB 1QZUA 2QUHA 3HV7A 4Z7HA 4D57A 4GT3A 1KO5A 2CJFA 4FBXA 1RWXA 1MVNA 4EITA 2VZ9A 1QG4A 4N3NA 3T5MA 5G0UA 3WDLA 3QEOA 4X20B 1WCIA 2B6HA 3FAZA 4L9RA 2WKQA 3DWEX 4PEVA 4YLYA 1Z07A 3ADPA 2A92A 3FKOA 4F9EA 3GOKA 4F8JA 4IDBA 3CN9A 3C24A 4O7ZA 3FWKA 3WWEA 4CIXA 3ELBA 4MKGA 2VS1A 1L3RE 3TLAA 5EI2A 3CKXA 4H0CA 4X3FA 2XHZA 1PR2A 3EQ2A 5K6AA 2EP7A 4MAAA 5KYTA 2OFXA 2A0XA 3AJAA 2VP6A 3DZJA 1E1XA 1Q12A 5DFPA 5JOQA 3KPUA 4MQUA 5LMKC 3EVEA 2W4KA 3TUBA 4GYYA 3RYIA 2UVXA 5F23A 4NJMB 4YWHA 5A4DA 1RPJA 3QBTA 3UANA 4E1VA 2PH3A 4C0XA 4D74A 2IBTA 3OW3A 1FSGA 2JC3A 1YC2A 2O8VA 1NBIA 2HIAA 1NW4A 2Q83A 4G1CA 1NSYA 3L18A 2PMFA 4E5DA 4WESA 2OV1A 5CS6A 3JVUA 1GZ7A 4IDVA 4DY6A 3BULA 1NNSA 4PYIA 4A4DA 3K0KA 2OZPA 1KIAA 3Q2KA 5FBZA 3G8CA 3AC1A 2CBGA 4E4LA 1A9XB 1QGUB 1PTJA 1UNGA 1EFUA 3AFMA 4KJXA 3F2IA 3PENA 4EPYA 3MHPA 3H1AA 3OHTA 1HOWA 3VGPA 4UW9A 5E8TA 4PBRA 4LM5A 1FUIA 4M49A 4IJQA 3VNVA 2NSHA 3O8UA 1DUSA 3SYNA 3N2KA 2W06A 1W94A 1QRUA 4OQXA 4F5DA 4N41A 4PFQA 4DH3A 1EAYA 2WTIA 1UWVA 5L4NA 3CRRA 4EVQA 4F08A 1NKTA 4D8YA 4H3VA 3C3CA 4L28A 3WGVA 3QJ5A 4UUBA 2DWQA 3DMRA 4W5QA 5WRFA 3U3ZA 4CRWB 3GLIB 1ZVMA 4FPXA 4AB1A 3GGOA 4AFJA 3CYFA 1LEZA 2EV9A 3I9NA 4AA0A 3R3UA 1H24A 4KIOA 2RB4A 1J5XA 2PVJA 4YUWA 3BH7A 4RA9B 4UNIA 3C7AA 5ALTA 1W88B 4OATA 3GRAA 3AYZB 5JEEA 5K8JB 3OWOA 1I32A 3RHSA 2OZLB 2DJ5A 1FP4A 4OYHA 3AXTA 5JROA 5A6SA 1Z28A 4A8JB 3W9YA 1JEQB 2WJ3A 2MINB 3OTIA 1Z7GA 3BHVA 4D2SA 4JQZA 5LYJB 5JN2A 3H5AA 4LOPA 3HP1A 2CK3D 1JFVA 1MZVA 4NU5A 1GXSA 4KC0A 4CMUA 2PUUA 4RU1A 1A88A 1O9GA 2PGAA 1QIHA 3PFQA 2WD1A 1EE9A 4ZCTA 4Y2TA 4S33A 1RM3A 4RQBA 1UZNA 1VLRA 4GWKA 1Q7TA 4KE7A 3PQ5A 1BI7A 1U9ZA 1YJAA 2J8ZA 4QVGA 1ZIYA 4DTIA 4EDFA 5BNWA 1WWKA 3TRFA 4GYWA 1Q3DA 1E6UA 3VPBA 4NCBA 1P5ZB 4JYCA 2QPAA 2AW3A 3E5MA 3E7PA 4PFKA 1WZUA 4UNSA 4HYTA 4NAHA 4PLVA 4S0XA 2BRMA 4GUDA 3W1EA 1IOVA 1NF2A 1R1DA 4Z5XA 4WUNA 3EMGA 4FZAB 4GNRA 1P60A 4N7RA 3VC2A 3HZOA 4MR7A 3KZ1E 4EY4A 4DZTA 1PX0A 1LPBB 4IEIA 2I65A 4RVOA 5EFQA 1GPAA 4I20A 3EFBA 5AKIA 4RMNA 5DG5A 5M29A 3SM9A 1NULA 4BCNA 3DGEC 1IXSB 3QUTA 2PYDA 4B76A 2ZQZA 2IV7A 2XXAA 4WJKB 5B36A 4G1VA 4TMKA 1N2CE 3RT9A 4G07A 1P2GA 2GTPA 4IFCA 4AW0A 5EA2A 1ABBA 1C7QA 5KE0A 4IM0A 2ORVA 1EQAA 2J5FA 2JH8A 4ZCLA 1DJQA 1A9TA 1CJVC 1F8GA 2IHVA 3LXLA 2VDJA 4PTEA 3WZMA 4FTTA 5IAAA 1DAPA 1E9RA 3DA8A 3AHHA 2WYOA 1SN7A 2JDVA 3T9IA 4GH5A 3IDZA 1SBYA 1SHKA 1GPMA 1N2HA 3GR6A 4GIBA 2PGNA 2VVTA 3LCKA 4NE9A 1RFLA 4JQEA 3ZVRA 3PYLA 3UJDA 1S9IA 1D2MA 1BKXA 4YO6A 4QP8A 3PKZA 4ZI2A 1GEEA 5HO7A 1M6VB 4Y6SA 3EFKA 3B6JA 4EB3A 1XQZA 3D94A 4CEIA 4DDMA 2WT9A 5AP5A 4BLRA 1JAHA 3MJ4A 3WIVA 4RX7A 4E6PA 2O8FA 2ZUDA 3ZHVA 4QPCA 4ND4A 4DCAA 1FTNA 2ZRAA 3D7KA 1GPYA 2QO7A 2DC1A 4TNBA 3IVCA 3TR5A 2BBTA 1SC6A 4EHEA 1BCRA 1NPYA 3QRIA 1KYYA 4X3FC 5K6AC 4BCJA 5DP1A 2YWFA 3E87A 5FNVF 1EXWA 2VF5X