3IDMB

Crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 fab' fragment in complex with gp41 peptide analog eld(nrg)was
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
235
structure length
227
Chain Sequence
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSTQTYTCNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2F5 Fab light chain
publication title Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine design implications.
pubmed doi rcsb
molecule tags Immune system
total genus 35
structure length 227
sequence length 235
ec nomenclature
pdb deposition date 2009-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3idmB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3idmB01
1SYVA 4Y4HC 2B5IB 3SKUD 2VLLA 3U7WH 3A6CH 1ACYH 4LLUA 2WBKA 4QHKJ 2ENSA 1K6QL 4MGXA 4XHJC 4D3CL 2PXYB 2BC4B 3VWJB 3F12B 4BUHA 3CDGB 5SWZD 1B0WA 2W59A 3MUY1 5J0BA 1JF1A 1MWAA 4PJDF 4I48A 4EIGB 2H32B 1TZHB 3QUXA 1I1AB 1CLCA 3V5HA 4Z9KB 2X44D 2ZG1A 5I6XC 2XZAH 4M9OA 1X5AA 3UTSE 4R26H 1MFAL 4JCLA 4H8WH 2P8PA 3RWEB 3QG7H 4JY4B 1KJ2H 1JP5A 4HCRL 1AHWB 1X4YA 1N5YH 2GCYA 3U30B 4UIMA 4ZXBB 3T0EA 4WY7L 1Q94B 1MEXL 4KI5C 3GMMB 5CGMA 5SWSB 1R3KA 2NY4D 4HV8B 1CLOH 4DKEH 1R3LA 3KLDA 4KFZC 2VDLL 3G6DL 1DQMH 1KCRH 3QFDB 1AGFB 4MWFB 3OKDB 3H9SD 4B0MM 5B8CA 2NX5E 5CCKL 2X4NB 1LVEA 4L8BB 3TNMA 1XGPB 5C08D 3ZTJH 2IPUK 2CKBA 2G60H 1N6QH 1MCJA 2RCSH 3CPLB 4WHCA 1NBZA 4LLAA 3CFEA 4CVUA 5HVGB 5IFAH 1X5XA 5FXCH 5D7JA 3I84A 2IFFH 3BP6A 4UOW0 1QP1A 2WWMD 2XZQL 3BJ91 1IVLA 2AJZB 1QLEH 3DUHA 5EU6A 5F44A 2AABL 3RUGF 1IGML 3MUJA 1LE5A 3GSVB 2J6EA 4FABH 1NDGA 4URTB 1CFVH 1S9WA 5HTSA 2W91A 3SGEH 5GPRA 5FYLD 1MHEA 2E9BA 2FHFA 5I16A 1AD9A 1RK0B 4DOHE 4DAGH 4MD4B 3UEZA 4G9FB 1IGJB 1W72A 1J87A 1CFSB 3QISA 2CH8A 5DFWH 5D9SA 5ITFA 4LHUA 4XZUA 5GGRY 1A2YA 4F9PA 3H0TA 4TSBH 3QHTC 4JM4H 3MZTA 3TA3D 4G42B 3MOBH 4WFGD 3BIAX 2VABA 3QDMA 2V9TA 3VXNB 1JK8B 1I8IB 3C5SB 4HWBA 1Q9OB 1LO0H 4NWUL 1TJIL 2AJXH 4G9DA 2VZOA 4Z7VF 2HWZH 1QSFD 2I5YH 4PRIA 5AZ2L 1YUHA 3N0PB 1QSED 4PV8B 3MRLB 4OJFL 1I7UA 1V3MA 4U2ZA 5ANMA 1ZEAH 1WIOA 4JM2F 4JFOA 4DCQA 3LQAC 3G6JA 1WISA 4LRNH 3DBXB 5I8EA 5C2BH 1VFUA 4NKIL 1R3HB 2YC1B 5I1AB 1J1OL 5A2KH 5D5ME 5GS1B 3H6JA 1DUYA 1DQJA 1OTUC 1WWWX 4NBZB 2X4SA 2H3NA 1WC7B 3P4NA 3LCYA 4FQ2H 2OQJA 3RWCB 3ARBC 1QSZA 4ZUWA 5JHDA 4XCNB 5EO1B 4NNXB 3O6LL 5GS3A 1QD0A 4JDTL 4LL9A 3LDBB 4AM0B 1TENA 5IR1B 3IDGA 4HHAB 3T2NH 4Z7OE 2IWGA 2JJTC 2FR4B 2VDMH 2W60A 4EJ1C 4MNHA 4GBXC 3VXUE 2F5AH 1QPPA 5GJSH 3QG6A 2JELH 3BXNA 4QNPF 1FFPA 5F93C 3BSZL 3D9AL 4U6YA 1A5FL 1R0AL 4P46D 3BKJH 4PUBL 3QDGA 1RIVH 3MRHB 4K3JH 2DYPB 3ZKXC 1I3RA 3LH2H 5C0GB 4MA7L 1Q9KA 4POZC 2GI7A 1OCWL 2V17L 3AY4A 4HXBL 5A1AA 1MFDH 3FFDA 2BSSB 4POUB 2CKBH 4BUGA 5E2WL 3PGDB 3FQRA 4YAQA 1MAMH 1KC5H 3JTSB 3N1PC 1UXSA 1MCRA 3FN0H 5IJVB 1ITCA 4LNRB 4WWKC 3ZMRA 1FNEA 1HH9A 3KYMA 1DBML 1F42A 1S7UA 5M94B 5I9QC 5BRZB 2IH3B 2YMXH 2VXUL 1XZ0B 1D5IH 3BE1L 3SHSA 4WHTB 5F3BA 2NY7H 1BFVH 5DVMA 4GS7B 1HNGA 3AREB 5HHME 5TDNA 4QY8A 5I19H 5HHXH 4K23L 3V5KB 5A2IH 2DQEH 2RGSA 1S5HB 3DX6A 1NCWH 1P7QD 1HIMH 1WICA 1NMBH 1RUPH 3KR3L 1KXQE 3U9UB 1ND0A 3ZKND 1KPUA 2WK2A 3TN0C 2IQAB 4L4TB 4PREA 3HRPA 2MNUA 4F57H 4M7LH 5T1MB 4OUUA 2VXVL 2APVA 4HWBH 2ZNXA 4ZFFB 2JCCB 3QA3A 4V2BA 4OCYL 3S3PA 5BVPL 2AJ3A 4R4FH 1QA9A 2CDEB 3MACL 3MGAA 3QEQD 4ODXB 5FDWB 4HX1A 3VA6A 1OAKL 4GSDL 3HI1A 1VGKB 4NNPL 2I24N 4PIRF 1R3JB 3MSPA 3W11D 4NHUB 1AXTH 5D7IE 5GISL 1DJSA 2AJSH 2ID5A 1F4XL 5GHWL 3RY5A 4MMZC 3IFPB 1TPXC 1YNLL 5DF0A 3CXDL 5CJOH 5D7LD 5KZCB 4HIJB 2WQ8A 1NKOA 4YFEA 5IB2B 4YHKL 1IEAB 5BMFL 2VRAA 2EYTB 4G7VL 4PY8I 2IH1B 5ETUB 2GJ6A 4NJAH 5LXGL 4LVHC 2DN7A 4LLWA 3RWJA 1QHOA 1A6AA 2ILLA 4OV5B 3CUPB 5EZOL 3GM0A 4CADB 2Y23A 2FRGP 4PRHA 3HPLA 5CBEA 5KVEH 2CO7B 5TH2A 4O2FB 1J18A 3KPSD 4KKBC 2ZOLB 3MUGB 4EEEA 2XTJE 4LEXH 1EHXA 2NQCA 1MNUH 5TQ0L 4NRZB 3TYGH 1FO0H 3OGCB 3ULVF 3HNVL 3O3BB 3REVA 1DBAH 1A1MA 1CDUA 2HKHL 2NZ9D 4NZTL 3TEUA 2FEEL 5JNYB 3QUXC 1BPVA 3HZMB 3IJYB 3UJIH 2F58H 1QBLL 5FUOL 3QXDB 1RZJH 1T4KA 3A6BL 1MFCL 4CVXB 3ESVF 4XAWL 5K9KB 1BVKB 5INCB 4OGYH 4QRRE 3DYPA 4MAUL 3B2UC 4TTGA 3MV11 1P5UA 4UDTA 2Z91A 3T0EC 1RURL 4KRPD 4M00A 1X7QA 4N0YH 1S3KL 5JW4M 4QRSA 1LEGA 4KJPC 3TFKC 2Q8AH 3HR5A 5GSRB 4G8GD 5E5RB 3VGGA 1KGCE 1CVSC 2DBLL 1WZ1H 5B8CC 4HCRA 3QDJD 1HSBA 3CFKB 1BIIB 3RIAK 3HNTH 1G9NL 4WNQA 4Y1AE 5FO8A 1JGEA 3RBSA 3K3QA 2BVQA 3VFRA 4KHTL 4FQIH 2SEBA 3L9RB 4X6DA 2HRLA 4WJ5B 4PLKD 1MLCA 4X6CF 5D7JC 4L3EA 2IALB 3ILPB 5DHYA 2C5DC 1TITA 4P5KA 3HAEG 1ULVA 1EO8H 1OARH 2VKXA 3Q6GH 5EDXA 5IEKA 3PV7A 3BRGC 4HUWB 4XRCA 3VD9A 3CVHL 5DJXB 3SDAC 2P5EA 1FVCB 1T2XA 3QNZA 2FO4B 4PJ7B 4DFHA 5KVFL 4ORZC 3LPWA 4U4BA 4H1LH 2D31B 1LDSA 4PJDA 5MEOB 3S37L 2VZ1A 2DQJH 5GGUB 5LWYL 5KS9F 4NKOB 5F9DC 1WFOA 4NRYA 5CUSL 5J1TC 1Z2KA 2F8OA 3SDCA 2NR6C 4TQEL 3UP1A 3BZ4B 2EDBA 4PYHA 2VERN 4DKFH 1C8PA 4ZTPL 4EOWH 3F8UB 1JTPA 5FGCE 3RJQB 4F9PC 4D9LH 1LO4L 4P23D 4P2CG 4UOJA 3CCHA 3OKLB 3DXAE 2VLRD 2AJVH 4U2YA 4CAGA 3DVGA 4DQOL 3ZT5A 2Q20A 2COQA 5JOEA 2XN9A 1IAKB 3MRBA 4ENEC 3ZDYE 4PJ8D 5F9WB 1S7QB 4YK4B 1A6UH 4QXTB 1HHHA 2V7NB 1A3LL 2H8PA 2G2RA 5DD6B 4D0DB 3L5XH 2DLTA 3VGDA 2DWDA 4GJTB 1KJ3L 1DCLA 1FVEB 2Z31D 3F6LA 1PY9A 2NTFB 4DKDC 4HC1L 5GS2D 4GQ9H 1LE9B 2NY0C 5GS2H 5DSCA 5I15H 5LGJA 5BV7B 4C58B 3E2HB 1CFNA 4L8SA 3R1GH 5IHUH 3MXVH 1FE8L 5I73B 3HNSL 4XCYB 5GS0C 1GJIA 3RUGA 5AUMA 1C5BH 2OZ4H 3LPFA 1H3UA 4JDVA 3BISA 1RIUH 4Q7DA 4OQTA 5C0CE 4WVRA 5CSZA 1QLRB 4Y4FA 4N0UA 4GAGH 3EO0A 5IQ7H 5FA4A 3C6LB 4JFPB 1U8KA 4I3SH 1B4JH 5JIHA 1OP3K 5DC4B 4OCRL 1Q1JL 3T09A 1OAQH 5KJRH 3QEHA 5IMMA 3X12B 2ZOKB 3F62A 3MLRL 5F7DA 4XPAL 3MLPA 5LBSL 4F37F 1KT2B 2VDPH 4U1KA 2BOBA 5EUKB 3JV0A 3O3AB 1D5BA 1JTTA 4NKMB 2C1OB 5ID0A 1CL7H 2IPTH 1MRCH 2PR4H 5BS0E 3LEYH 4JY5L 2R2CA 3AY4C 4TNWK 4W6YB 4BQBA 5IESH 4TSAH 4YHNA 4Z7VA 3L95B 5IMLA 2EDOA 1FQ9C 5FYKU 1Q38A 4P0DA 1BEYH 3VWKB 1EFXB 4D9RE 5I18L 1PD6A 1U8IB 3MV8A 2NY1C 1OQOA 4HD9A 1CDBA 4JM2A 1I1RA 3QXVA 1ZLWK 3UTSB 2Y7QA 1FZMB 3OAUL 3VFSB 2VTFA 4NN5C 5EOCJ 2AGJH 3HA0A 1HHKB 5FK9A 2D7MA 4MAYD 1NGYB 1UCBL 2A9NH 4J4PD 2DKMA 4BA8A 3TCXA 3G5YA 3ZL4H 2WZPD 4X80H 2CRZA 1L7IL 5L7XL 4OZFA 3RZCA 5ILTL 1N6UA 2OR9H 5FGSA 5HD8D 1H8NA 3K74B 3CDYA 3TF7C 3U1SH 3O45A 4Z77A 2BK8A 1HQRA 2EDEA 4PGBB 4RGOL 3OPZL 2H45A 43CAA 4AIZA 1T6VN 5FM5M 3MJ7B 2ZKHL 1I9JL 5F1OB 3RWFA 1ROWA 1WBZB 4AMKL 5B3JF 4HH8A 3VRJB 1AQDB 5JDSA 4PJ5D 1PZUB 2GTZA 3OJ2C 4JRYE 3VH8G 4MA3B 3DX8B 4NJ9H 4JFZH 4PG9B 3KPQA 3V8CA 4AZ8A 3KXFD 2CDGB 4F37K 5E2JA 2A6KA 3B9VA 3UC0H 1NBYA 3EYVA 3VFUA 4JLRA 1C5DA 4DOHB 1GPOH 1WAAF 3A6CL 1AGCA 3DSNA 4RBPK 4DJMA 1IC7H 4N1CA 4XXDB 1CDCA 1RZ8B 1GGCH 4YDIL 4F7EB 1Z9MA 2BVTA 1BQSA 3FFCE 4OQTH 5JPMB 5E2VL 4PJFA 5EN2A 3ELAT 1KEMH 4QHNA 3PWUB 4GW5A 1KEGL 2XZAL 4LMQI 1FZKB 2E3VA 5D7KD 3GRWH 4R26L 1XCQA 2UV3A 1OT2A 4H8WL 1CI5A 1KBGH 2KZ1B 1ZT7A 3H3PH 5DMIH 1SEBB 1FV1B 3PDOA 3MLTB 3WUWB 1NCCL 4N5ED 1LK2B 1MJUH 3EYQD 1G7LA 3KLAA 3U36B 2W07A 1X5IA 4HJ0C 1RK1A 2HJKB 1ZHLB 3RVUC 5D5MB 3KS0J 1F11B 3QDHA 4JZJA 4DKEL 4EDXA 2VDKH 1DQML 2YD8A 1CXHA 1QQDB 4GKSA 2H2PC 3A6OA 1LHZA 4HMDA 4JFEE 3D69A 4WUKH 3TNNA 4PGDA 4ISVB 1ORQB 5JMOC 4L9LA 3G5XA 1U0QA 3PWNB 4EVNB 2E7LA 1I1CA 2AQ2A 2RCSL 4WHYG 1E27A 1MCLA 1TQBB 3MO1A 4XBPA 5IFAL 1HYSD 3N50A 4HG4K 4C4KO 4LKCB 3VXUB 1LO2H 5ICXA 3X11B 4UTBH 3BHBA 2MHAB 3NFSH 5D96C 3D0VB 3O8XD 3MBXH 1NFIB 2DRUA 4ETQA 4OZGA 2C3WA 3EKCA 3X17A 4G6KH 4G43A 4NQUA 1YY9D 4OCSL 4ELMF 3W5NA 1CFVL 3DRTA 1JWUA 1U8QB 2YEZA 1FJ1B 2VLMD 4FMKA 4ZUTB 5F6IB 5FYLL 3ARZA 2OTPA 2MPAH 4QHKI 3ARPA 3BT2H 4Y2OA 1OP9A 4GXUN 4NRXB 1G7QB 3MRGB 4BZ1H 5IB3B 1FP5A 1EAPB 3JV4A 1X44A 4UV7H 1J12A 3CVIH 5IBLD 5CEXB 2MMXA 3EO9L 4R90H 1J10A 4TSBL 4NQCA 4P2RD 1FNSH 3FQNB 4YIQB 5T1LA 3OG6B 4EI6B 2AXGA 3KPRD 3BESR 3V5DA 2VC2L 1LO0L 5C8JA 3SDYL 1JZ4A 1U8JA 2HWZL 4ZQKA 5T1DH 4PP2B 1RHHA 4HQQL 3SDCC 4TTDC 5DRWB 1PX3A 3L5WA 4I5BA 4WCYH 5CWSA 3V2AR 2ERJB 3U6RA 1T22B 3MOAH 4KI5E 5HHMB 3ARDB 3ECBA 4LRNL 5T5NG 1RUQL 4U6XB 4AEIH 4D9QD 5F7FA 3FAXA 1N64L 3CJJA 1KULA 4X4XA 3DYMA 3FHQA 5H94A 1TZGH 5IKCA 4RZCB 5I1CL 5J11B 1EK3A 2XQBL 4O51B 4MNGA 5A16B 1CD9B 1BFTA 2KH2B 1EX0A 3TO2A 3PL6A 4X7TB 1MH5B 1ZHBA 1J0JA 3VU2A 2I07B 4PJBE 4ODVH 2PW2B 1E6JL 1ZOXA 4X6CA 1BF8A 5D7IB 5KSBB 3UPAA 1D6VH 2F5AL 4GG6A 1QRNE 4KGLA 5FM8A 5IHLB 4L8SC 1INDH 1YNKL 1KIRB 1UH2A 3V6BR 3ARGB 3FQTA 2HAZA 1I7TA 1LNUA 4XVUD 1RIVL 4K3JL 3P0YH 4LCCB 3HCVB 4QRUA 1IZJA 4Y4FC 1BAFL 5KS9A 4JKLA 4HC1A 4Y0GA 5F96L 4OZHE 4JFQA 4XCEA 1H3TA 4FQHA 5MENE 1F6AB 5CZKA 1RPQA 3BMWA 2V2WB 4XC1H 1MPAL 3FN0L 3U46A 3LRGA 3T0BA 2XKSA 4IS6A 3O9WB 2AJYH 2XTJB 1J0YA 4X99B 2WBJD 1FRGL 5HYJA 5DI8A 4BH7B 2OSLA 4JHZA 3CFIC 3QJHB 3MRFA 5DHXB 1HHJB 3MNZB 1VFBB 3P4OA 4NFBA 3VGHA 2ED7A 1IBGL 2NY7L 2L4OA 1BFVL 5C0NC 4G7YL 5IVNA 5EOTA 1G6RB 3MR9B 4JM2C 5HHXL 3O41A 1BREA 3QO1A 1HIML 4HZLA 3GEWB 3VFGH 4QRRB 1HHGA 3MRRA 5IF0B 5SWQA 4F57L 3MV9D 4JY6B 4M7LL 3S36L 4GW4B 1J8HA 4OD3L 4UNVA 4O9HH 3ZSTA 4TPRL 3SDXF 3BX7C 4RGNC 2YD1A 3RTQA 3KG5A 3QQ4A 3QXAB 1WWCA 3HMXA 4U6HB 4NIKB 3E0GA 1AP2A 1EA9C 2R23A 4MJ2A 5TGBA 3EOTL 1MQKH 4Y1AB 1AXTL 2DM3A 1F2XK 2AJSL 4CN6A 5GGVY 1GGIH 3HKFA 5D6DA 5FGBA 5TF0A 1QFOA 1OTSC 3TP4A 4PLJC 3UAJC 3KYOA 4UBDC 5ACMA 5EZJB 1U8MA 1GOGA 2L7JA 3MRPB 4GAJH 4KZEL 3STZB 1HEZA 4P2OD 2Z92A 4RRPA 3RJDA 4F3FA 3QUYD 1XF4A 3W82A 3RHWF 3IVKB 1REIA 1MI5A 3SJVA 4OCNC 3NCJH 2EC9U 1OP3H 3T8XA 5E03A 5KVEL 2GK2A 2HT2D 1YEFL 3C9NA 4MJ6B 4MXQC 3VMNA 1YMMD 3O3DB 4YPGA 4LEXL 3ILQC 1MNUL 1A4JA 4EUPA 5FGCB 2X1XR 7FABH 2YSSA 3KPNB 1FO0L 1EEYB 3IFLL 3AAZB 4DTGH 3DXAB 2CUIA 4NUGH 3V7AE 2XTLA 4E41B 4ZUSB 4UV4H 2VKWA 3MRDB 1P69B 3B9DA 4YHIA 3LMJH 5EWIL 3FMGH 1EJOL 2WUBL 4PJCE 4AEHH 5BOZG 5I8OH 2A6DA 4XPGL 1R5IA 2NXYC 5FM4A 5ALBH 1OGAA 1Y18B 4XPBL 3ROOA 4J6RH 4LOUD 4D0CB 1H15A 3RDTB 1OVZA 1AKJD 1BQHB 1TDQA 2QSCL 5SWZA 3OKMB 1DVFB 4YBHA 2H9GA 4HKZB 1CXKA 2Y6SD 3T4YA 1HQ4B 4N0YL 3X13A 4NDMA 3RVVD 3R06B 4JZJC 4F9LA 4M1CD 5JR1L 3TBVB 1A9BA 5FYJH 1U3HC 2F5BL 2NY6C 1M7DB 2KKQA 2DDQL 5C70A 5JUEL 1FLRL 4HJGB 4OFYD 4KQ4H 4R3SA 4MJIE 1ZHKB 2Y5TA 5DXWA 5C0CB 2EDTA 4L9LC 2E7LC 1IC5H 5DD3L 1A9EB 3V6FA 4PG2A 1VERA 3MQIA 3JWOL 4JRXE 4AIXA 3O6FB 2YXFA 3LRSB 1WAAA 1VADB 3H9SA 3RL2B 4U31A 1RI8A 2N1KA 3TT1H 4HK0A 4OLZH 3U0TA 1K3IA 4AK1A 3TIEA 1NGWB 3OHXB 1HXYA 3BEVA 3MJ6A 1F6FB 3FRUB 5BS0B 1IM3A 1LP9F 1G7PB 2X70A 5ICYB 3QZWB 5JW5A 3CFBA 2EYRB 2ZUVA 4CNIA 4NQSA 3KJ6H 1EHNA 43C9A 1XT5A 1IAII 4JFFD 4R7DA 5DFVC 3GIZL 5LQBL 4EOWL 1QFHA 3HE6A 3RX7A 3RWGB 4YHYB 3ZE2F 4D9LL 4MLIA 3EOBB 3GSWA 3Q48A 5DJ2A 1VCAA 1ORSB 2IAND 3ULVC 1NDMA 2AJVL 4U05A 4RBPH 4X9IA 3LY6A 3BQUD 1OB1A 3P0GB 2VSCA 4P4KB 4YXLH 5J3HC 3OV6A 25C8L 5DMYA 4F15B 1RZFH 3BGMA 1IAIH 3T0EE 3PWPD 3L7EB 4X8JA 2G5RA 1ES0A 4U6VH 3L3DA 3TA3A 3UTPD 2XA8L 2O26U 3I6GB 4EUPH 4FQ1L 1CICB 4GQ9L 5DVOA 3JWDL 3WNOA 4HIXL 1A3RL 1L7TL 2R69H 3QNYA 4R4BA 3MXVL 1UT9A 5HGDA 2EE3A 4U1MB 2I9LB 3O4OB 5C07A 1RIUL 2DQDH 3PL6C 2BCKB 4ELMA 5CP7B 3WE6A 5IQ7L 3KLHC 2ATKA 1KCVL 4UT7L 1QBMH 2NXZC 3FT4B 1T20A 4L1HA 1GGYA 2XWTB 3UBXB 2HN7B 2Z35B 4JQXC 4LPXA 5HYSB 5EU6E 5GRJL 4GW1A 4YR6A 2AW2A 4QYOB 3SOBL 2QADB 2QSTA 1IM9A 3T2OA 2R1WA 4CMMB 2CRIA 2D4DA 1PG7X 5B38A 4DZ8B 3K0WA 1MHCA 2FIKA 2R2BB 2IPTL 2VITB 1MRCL 3QJFA 1P7KA 1BD2D 2HJFA 4XVSH 3LEYL 3TIDA 4EBQL 1U8LB 2R29L 4XT1C 3BZFA 4FXKB 3VXOA 3FFCB 2PO6A 4TSAL 4AH2A 3BN9C 5IMKB 1BEYL 5C0AA 2XV6B 2VXQH 2Z8WC 4FFWD 3RA7H 4MXVF 5MEQB 3AXLA 3JTTB 2AV1A 4P46A 1Z0NA 4Y7MA 3W0WE 3QDME 1TQCC 3IU3B 3OB0H 4X7SL 4GAYA 3EDEA 3L3JB 2FX8H 1FZOB 4LAJH 4NFCA 3QUMB 5DS8A 4PRIE 2A9NL 4CN4A 3N9GH 5ANME 1M71A 3VD3A 2D7TH 1YECH 2GK0B 4UDUA 1FN4A 5HY9B 1EPFA 5AZEH 5F71A 3AM8C 3QULB 4F8TA 1JYNA 3RNKB 1AR1C 5CS7A 5ESAB 1V7ML 3NN8A 3U1SL 4RFOH 1V05A 4JFEB 4LF3B 5HYQA 2XZCH 3BKYH 4OZ4A 4RWHA 1A7QL 3EGSB 2R56L 2A77L 3GHEL 3OKNA 2QBWA 4QOKD 5BO1H 1B2WL 1MRFL 1VGEL 3JWNC 2EDQA 3GSNH 4LIQE 3CSYA 3ULSA 3RTQC 4J8RA 2H26B 4TULL 1P7QA 4YE4H 5IVZA 1DTUA 4F33B 4XVJH 4DW2L 4C83A 2MCPH 2JK5A 1CTNA 5DR5H 4HWUA 4WTZA 1XCTB 4NO2A 3PV6A 3KHQA 5D6DC 3FO2A 1B0RB 5FGBC 4Y4HB 5F88A 1A64A 3QDGE 1GPOL 2FBJL 4KROD 2IAMA 4RQQB 5C0FB 4D8PA 1D5ZB 1B3JA 1IGIH 4N0FA 1S8DA 4KHXH 4K55A 3BGFC 4XTRD 3DROB 4S11A 2Y36L 4U1IB 1GGCL 4L5FH 4RMUA 1KJMA 3BIKA 2P5WD 3HPJB 4K7FA 1CVRA 5D1XD 2V9QA 5IEHB 4UILH 5I6XB 2GITA 4QRQB 3CZFB 4OLYH 3AMLA 1NGPH 1KJVA 3ZT7A 4KK8C 3SO5A 4Y5YA 2V2XB 2W1NA 1PVHA 4KPHH 3H3PL 5DMIL 5GZOD 6FABH 4OKVB 3O2VH 5KN5B 5T3ZL 3I02B 4JG0H 4IMLA 1JMZA 1WCBA 2QKIB 4KK6D 1AFVH 4P59H 2AEPH 2XWJB 5FV1L 1AE6H 3L3IA 4BFEA 5JZ7D 2RAMA 5F3HB 3SDXA 2G75B 4JN1H 2AEQH 5D1ZD 1BQLH 5E94A 1T5WB 3NPZB 2DMKA 1T1WA 4LKXA 3ZKSD 4O2CA 1J1PH 1N0XH 1ZHNA 4KTEH 4FXGB 4PJBB 3OWEA 1CZ8H 1L9NA 2W0PA 5HHVH 4QF1B 4F9LC 1G7HB 1D5MB 1LO2L 4UTBL 1P9MA 4PJEF 1FC1A 1RJYA 3SBWA 3NFSL 1HWGB 3E6HA 3KNBB 1QRNB 3GSQA 1FAIL 1UB6B 4ODSH 5DJCB 3IDNA 3SCMC 5E9DD 4PRPD 1PEZA 1ZGLP 4MNQA 1B9ZA 2ICEB 1K5NB 4JPIB 2LQRA 4DUXA 3GSRB 4M61A 4PG2C 3MFFB 4OZHB 1H8OA 4M7ZC 2HG5B 3BT2L 2GJ6E 4G8GA 5GRVK 3S5LA 4MQ7A 5MENB 5IM7A 4S1RH 4R90L 3UXFA 3MV7D 3QPXH 2AEIT 2OTUB 2PW1B 1YY8A 3TCLB 4Y4KA 2MWCA 1ZANH 4LSVH 5F1NB 4PRHE 3DJ9A 1VHPA 1H9VA 5BXFA 5T1DL 1OD9A 1YEEH 1LQSR 4G42A 2Y5EA 1TVHB 3AS1A 3MRKA 4MDJB 3P9WB 3HE6C 1QO3B 3MOAL 3A67H 3RL1B 2GT9A 4P9ML 5EBLB 4AEIL 1NGZA 1DQQB 4UU9B 4ZSOA 4BQCA 5T3XD 5BZDB 2CIIA 4BK4A 2ZSVB 5DEFA 4HUVB 3ARBB 4KJQD 4JO1H 4HIIB 3GBNH 1RU9H 2PN5A 1R3HA 3KPMA 1HZHH 2PXYD 5K9OA 3I3DA 5IW3A 5FA3B 3VWJD 1PLGL 1DE4B 2ZCHL 2FJHB 1BBJA 4X5WB 1K2DB 1ZLSL 1ODAA 2XG4A 1O7VA 4RISL 2H32H 2VLRA 4GBXB 5HYIA 1I1AD 3DUUA 3SKOB 4JPKL 2D7NA 1II4E 2MQCA 4AM0A 1D6VL 2B4CC 2DLEA 1WWAX 5AD0A 1F90H 1U8PA 3DNKA 2XZZA 1INDL 3T3MF 1PZ5B 2DTSA 3QCTH 1DLHA 3L3OA 1NC2B 3ZKXB 4PFEA 2ARJB 3EYUH 4X6DE 4UQ3B 1AY1L 5SWSD 3S88H 5ECJE 5CEYA 4PTTA 4PBVC 1SVCP 1LP9A 1G9MH 5I1IL 3OJDB 4L3EE 5GRUH 3OKKA 3QQ9C 2XKNB 1YMHA 3LS5H 1XEDA 3DTXA 2J5LB 4I2XA 3L3GB 1Q8MA 5DA4A 3GO1H 1FFOA 2EDFA 2P5EE 4ZPVB 8FABA 5IG7B 4WWKB 3BZEA 3TWCH 4PJDE 5E5MB 1T7ZA 3MBEA 1NLBH 4TVSa 3O4LD 1JPFB 5I9QB 1FVDA 1I1FB 3OXRA 2A73A 3JXAA 4IRJA 4YXHL 4ERSL 1N6VA 2WUCL 4PRNB 1DP0A 1HOCA 2PO6C 4RIRA 1MCEA 4OT1H 2VL5B 1QFPA 2PNDA 3NIFF 3LEVL 4K3HA 1DBBL 3T0XA 4P46C 1KB5A 4PJCB 4DVBB 4WW2B 4X9FA 4K07A 3WXWH 2KDGA 2ICWA 1NAKH 1S7RB 4M6OH 5BOPA 2XN9E 2WV3A 3TN0B 4DK6A 3VFGL 4O4YL 4LQFH 4KUZL 5BCAA 2XI9A 2AEWA 1S5HA 5ADPL 4V1DA 2EC8A 2KQMA 2PYED 4NBXB 5I8KL 4ZS7L 5GGTL 4JFXA 3UZEA 3Q5OA 5I0DA 2BY2A 1TJGL 3NABL 3IXTA 4K9EC 1MQKL 3S35H 5D2LF 1KELH 5KAQF 4J4PA 4MJIB 1KTDA 1GGIL 1JN6A 3U4BL 1VACB 3RUGE 1P4IH 1CU4H 4DWHA 3G6AA 5E08L 4U0RC 4JRXB 1MIEL 3DV4A 5DJDB 4LVHB 4GAJL 4N0UE 4RWYH 5DO2C 5AYUL 1T7XA 2Q7YA 3PHQB 2CRYA 4Z76B 4G3YH 3PWJA 1YPZF 5TE7H 3MXWH 3T0AA 1M6OB 3V4PH 2NLJA 5EU4A 5CHNB 3ZKNC 2UUDK 2EYSB 4XMKH 1SYVB 3Q0HA 1JHKH 2VLLB 2X6MA 5I1EH 4L29A 4DGIH 4LLUB 5DLMH 2IAMC 4S1DC 3IRZA 5E1AA 1ZTXL 1EMTL 1RUAH 4Z7VE 2NYYD 4KU1A 7FABL 1JF1B 1MWAB 3KXFA 3BOVA 5FO9A 3OZ9H 4KJWD 2GFBA 4DEPC 5EIIA 3QUXB 4PB0H 2YD7A 3MV8E 3V5HB 4UV4L 4O2EA 1CDJA 4HPOL 4TNVK 5IB1A 4DFIA 2P8PB 2DYPD 3FMGL 5I8OL 4RX4D 4Y5YC 5KSAA 5ALBL 4J6RL 4AIOA 5JPNB 2GCYB 1G7IA 4UIMB 3T0EB 5EZLA 4LBEA 4ZMAT 1UYWL 1NLDL 4UTAH 1T04A 5B4MC 1R3KB 1UACH 1IEHA 1R3LB 3TBYA 4RGNE 1AHWC 2HMID 1K3ZA 3S37X 2O5YL 1IQDA 5B8CB 1DL7H 5KVDL 5T33H 4HH9A 2MKWA 1JIBA 5GRYA 3AMKA 4MB5A 5BRZD 2CKBB 2DLGA 2AJUH 4ZUUA 4JVPA 3O3UN 4E9LA 4QNPE 1I7RA 3CFEB 1MCOH 1OW0A 5D7JB 2MFNA 2NZ9C 5GZNC 3ARED 3ETBF 3BP6B 2Q7NA 4WFHD 4XWOD 1X5JA 3WKML 1FGNH 1KXTB 1P9MC 5EU6B 5TDOA 1NFKA 3SBWC 4ORGA 4X7FC 1LE5B 4CDGC 4OLZL 3NCYP 4EDWH 5CBAA 4KV5F 1NDGB 1JGUL 1AQKL 2FATL 1S9WB 3SQOH 2NTSP 4I4WA 1KFAH 1MHEB 3BO8B 5F1IA 5I16B 1AD9B 2DQTH 5DWUL 3C8DA 2CIKA 1FVCA 1W72B 4JANA 4Z0BH 1UM5H 5D9SB 2D31A 5E4IA 3ULUD 5ITFB 3SE4A 4LHUB 3ULUH 4XZUB 2HLAA 1TZIA 1A2YB 5EC2A 5EO9A 5EUOF 4JGUA 3H0TB 5DRNA 1MREL 1ONQA 3K81A 1LMKA 2VABB 3QDMB 2APXA 5DRXB 4Y4KC 5TPWH 3UYOD 3LIZH 4G9DB 4NZUL 3MJ9H 4PRIB 1YUHB 5E2TH 1U93A 1O5DT 1FAKT 1I7UB 4LSSH 5ANMB 2ZWLT 5C0JA 4XB7A 5DT1H 4JFOB 1IAIL 2CGRH 4DCQB 3G6JB 4XNXH 4UIKH 5FYKH 5I8EB 2GYSA 5DDHA 1J5OL 4N1EA 2APTA 4M4RA 4HEME 1DUYB 1DQJB 4OGZA 1JNLH 2FHCA 1EVTC 2VDNL 2X4SB 2H3NB 3P4NB 1TCMA 2OQJB 1LO3L 4PJEA 4ZUWB 2R69L 5DZLA 1CK0H 4P9HL 4K3EH 4BSWA 3ET9F 1KIQA 5DVKA 2QQNH 4YDLB 3IDGB 3RKDD 4FQPA 4LLDA 4NO5A 4XNYL 1WTLA 4IJ3C 4FQXA 5HGHA 2W60B 4PGCA 4MNHB 4NO0A 1QBML 4OM1L 2C4XA 3H42H 5DQDH 1A6WH 2D7QA 2E9JA 6CGTA 3OG4B 3QG6B 3FRPG 3GBMH 3BXNB 1FFPB 5HHNB 4YFLI 7CGTA 3GGWA 3QDGB 1NL0H 1QEWA 2NY2C 1I3RB 4NQDA 4X4YA 4LSRL 5KSVA 1Q9KB 1SYSB 4KJYB 3VGFA 3DI3B 3KYNA 4DVRH 4XVSL 3FFDB 5E99H 4DGVH 1BX2A 5EUKA 2X4UA 2ZUUA 3HI5H 4FTVA 3FQRB 4PR5A 4YAQB 1A22B 3FO1A 4U1JA 5EA0L 4HK3N 1UXSB 3QDAA 4OIIL 1SBSH 3RA7L 3GMLA 2P45B 4NQCE 3ULVE 4NN5B 1FNEB 3QPQD 3GSXA 5L88H 3KYMB 1G1YA 5MERA 4HFUH 3MBEC 4MQSB 1KCUH 3VWKA 4WU7A 4KK9C 4OLXH 4IRSA 4GXUM 2Q8BH 4IRJC 1SMAA 3IT8D 3N9GL 3ARUA 4YHPA 3GK8H 1N3NA 2D7TL 5F3BB 1MAKA 4S1SL 4KVNH 1EDQA 1RULH 4QY8B 5HHOE 5IGXH 1IGFH 3B6SA 3DX6B 2LTQC 3MLXH 1CXFA 1ND0B 4RFOL 2WBJA 3V0AC 1KPUB 1JPTL 4PREB 5CJBA 5C6TL 2UVEA 3G5VA 4KUCF 4MNGE 4OUUB 4KKCC 2NX5A 5F9JB 3QA3B 1JVKA 2AJ3B 5D4QA 1QA9B 2R1XA 2A0LD 4HX1B 3GSUA 5F7LB 4JFYA 2XQYG 5IB4B 4OM0L 2CK2A 3HI1B 3TO4A 4HS8L 4P5TD 4LGPB 4GO6B 1BIHA 4XVJL 4X6CE 1MCNA 4NHCL 4R0LB 1HILA 1OSPL 2CLRA 4J4PC 5F7UA 5CMAA 1EEZA 4RMWA 2B8OT 1I3GH 3RX5A 4NM8H 5JOPD 5GGTA 1HNFA 4NQXA 2AK4D 2GJ6B 2IGFL 4LLWB 5KS9E 2EKJA 4C4KT 3TT3L 4KRLB 3RWJB 3D3VD 1UCTA 3ORJA 1A6AB 3V6OA 4IDLA 5BV7H 3NGBB 1BQHG 3LKRA 4G5ZL 1CDHA 3U4EA 3VW3L 3CU7A 3THMH 4FRWA 4OLYL 2MOVA 2A6JA 2APWA 4XWGH 4PRHB 3HPLB 5CBEB 4M5ZH 5TH2B 3ES6A 4OCWH 3EBAA 3P0VH 5D7SL 2V5YA 2HH0H 3C6LD 5JXAH 2YD4A 5HYJE 4QRPD 4LHJB 3KYAA 1JYVA 1KTLA 4WGVB 3O2DH 5CJ8A 3REVB 1AFVL 1A1MB 2AEPL 1AE6L 4RGMC 1F58H 5A2LH 1X4XA 3C8KA 1UQSA 1Y6NR 4OF5A 2E8YA 2DIBA 5EIVA 1HI6A 4QXUH 1OAYH 4L9DA 4ZODA 1XGQA 2AAVA 3LD8C 2AEQL 2BNUA 4Z7WF 1BQLL 5EOCL 3T1FA 1T4KB 5KSAC 1EEUA 1I7ZA 3DRQA 1TNMA 4XP9H 4UDTB 2Z91B 4JHWH 5D2LA 4IOFC 1AI1H 3HLAA 4MXWH 1W0VA 1N0XL 5CEZE 1X7QB 1J8HE 2YUVA 3GNML 2FZ3A 5I17A 1A47A 4PJ9A 5K9JH 4QRSB 1LEGB 4P2YA 4Q6YA 1FL3A 2ZCLH 3HR5B 2DQCL 5D96B 1DQTA 3QZWG 4O02H 4MA1C 1AD0A 2L7UA 3PWNA 4EVNA 4XI5D 1HSBB 1NSNL 1YPZA 4WNQB 4NYLA 5FO8B 4HAFA 1JGEB 1AKJA 1JPGA 2VISA 1GHFH 2BVQB 3VFRB 1KIPA 4WEBH 2X1QA 1MCFA 1FNFA 3HB3D 2SEBB 4X6DB 4M6NL 3RZWA 4JJ5A 5DD1H 1MLCB 3QIBA 4XBGA 3EFFB 5FHBL 1OW0C 4L3EB 5FO7A 5DHYB 4Q9RH 4X9HA 4JO3H 4P5KB 1QKZH 5IEKB 4XRCB 4J3TA 1CIDA 2P5EB 1FNGA 3QNZB 2R9HC 4PJDB 1YDPA 2X4OA 5IHZB 1MI5E 4KZDL 3MRJB 1MF2H 1JCKA 4NRYB 4OIBA 2J4WH 4B50A 2F74A 4PTUB 4U7KA 4TN9A 1KUMA 1WEJH 3A67L 3CCHB 2R8SL 3VXRD 3DVGB 1SY6A 4N9OB 2QQLL 2NZIA 5L9DH 5T3XL 4AL8H 1U91A 2N56A 1DANT 2XN9B 2HFGL 1MLBA 5CJXA 3MRBB 3GBNL 3UBXG 1CLYH 1OGAE 3IAPA 4UB0H 1HHHB 4WO4A 3VXPA 3H7BA 4P57B 5HYSG 2H8PB 2G2RB 3TH2T 5SWZE 5IBLC 5MHSD 4WI6A 3HC3L 4N90E 1GL4B 2DWDB 2YD5A 1GAFH 4LCWA 5F9WC 4M03A 1EVUA 5J6HA 5B3JE 5DSCB 5LGJB 4LSDA 1S5IH 3WBDA 1XGRA 1IL1A 1CFNB 4L8SB 2IBGA 1MSPA 3RUGB 5AUMB 5HXMA 1PSKH 3ZKMC 4JDVB 5E8DH 4LDEB 3RGVA 2UY6A 5CSZB 3RVXC 3DETD 4Y4FB 4N0UB 3EO0B 5FA4B 3S88L 1U8KB 3ZDXF 4FQXC 5SX4I 3NAAH 1G9ML 4FFVD 4OFKA 3U7YH 1XF5A 1WAAE 3MNVA 3QEHB 5IMMB 5E0QA 3LB6D 3H9SE 4OTXL 4XNMA 1RZ7L 5F7DB 3MRQA 1XF2A 5ENWA 3GO1L 4U1KB 2GKIA 5EUOA 5C08E 3ZHDA 3PXJA 1D5BB 1YN7A 1E4JA 3S36X 5ID0B 1F6LL 3ARVA 3C5JA 3EZ8A 1JHTA 4EI5D 2LV4A 3P11H 5HYFA 4YHNB 4Z7VB 5IMLB 4JO4H 2Z93A 1CD1A 2NY3D 5FDYA 4OT1L 1DZBA 3O0RH 3O9WA 3MV8B 2F19H 3MC0A 3S7GA 4PB9H 5GGQH 4JM2B 3MRIA 4YHOH 2Y7QB 4TRPH 3M45A 1CWVA 5FYLE 2ADIA 5FK9B 1B0GA 5TQ2H 3H8NA 3VWKC 4IRSC 3VD5A 4KTDH 1G6RA 4LQFL 3G5YB 2BHYA 1GZPA 3HG1A 1S7VA 3RZCB 4OZFB 3BGAA 1N2RA 1JBJA 4RGNB 3HC0A 3UJJH 3SKNA 5HVWA 4HULB 5DMGC 1CT8A 3UYPA 4WFGE 4PV9A 4CU8A 3UTQA 3O45B 3N06B 4WI4A 4Z77B 5C71A 1HQRB 4M62H 4AIZB 43CAB 4A2LA 4N0CC 1DEEA 3EYSH 4S1QH 5BW7A 1XR8A 4Z78B 1Q0XH 5KVMC 3RWFB 1P4IL 3D6GA 1CU4L 4KK5D 1F4WL 5C07E 1W0YT 4YDKH 3ZYOA 1XF1A 1PBYA 3DHJA 4Y1AA 5DJZB 4ELME 5JDSB 4JO2L 2GTZB 2W0KA 2WWKO 4F7TA 3TO4C 3VI4F 1QYGL 4YWGL 1CDGA 1OAZH 3KPQB 1CF8L 2I25N 2A6KB 5B39G 3STZA 1NBYB 3EYVB 3VFUB 4JLRB 1C5DB 4XMKL 1RZKL 3PP4L 2EXWD 1JHKL 2R4RL 4YXKL 4ZD3L 2WIIA 4CDHA 1AGCB 1BM3H 1QPXA 4N68A 1XIWA 4G6MH 4I3RH 3GI9H 4JFDA 1MVFA 3CSBA 2F53D 1RUAL 3ZYJA 1JUFA 1ZWIA 3V6OC 3LV3A 4K8RC 2IPKA 1WBYB 4PJFB 5EN2B 3CGTA 4JB9H 5C0AE 3RVWC 3BDYL 4QHNB 4HPYL 2EDNA 4S2SA 5GGSA 5TE6L 4GW5B 2B0SL 5J13C 1XCQB 2W0LA 3MLYH 2NXYB 3MJ8B 5EU7C 4Z7NF 3KPLA 1RIHH 1CR9H 1J0HA 2V2TA 3PDOB 4NGHH 3U79A 3WIIH 1G7LB 3KLAB 2DICA 2YA1A 1CDIA 4UTAL 1RK1B 1A0QL 3GDBA 4GKOA 4JZJB 5FV2A 4EDXB 4D0CA 3EAKA 4IHOA 1BJ1H 1VPOL 1DVFA 2NY6B 3B5GA 5KVGL 1A8JH 4GKSB 2IBZX 3KYKL 2XTJD 3QI9A 3WFZA 1F8TH 4AQOA 3D69B 1A14L 4KQ3L 3TNNB 2KZWA 4PGDB 1UKSA 3TBVA 4L9LB 2FL5A 3G5XB 3U9PH 3B9KA 4RCAA 2D3VA 3BPOB 1E27B 4ZO6A 1P4BL 3MO1B 4AT6A 4XBPB 1U2CA 1TETL 4PJ9C 4AJ0A 2IC2A 1L0XA 1U3ZA 5ICXB 4KMTL 4HJGA 3WHXA 1T7WA 1G6RH 3BHBB 3LEXB 4OZGB 5CILL 4G43B 1TQBC 4F58H 1NCDL 1MUJA 4QRRD 4EDWL 5LGHH 4ZFOL 3DRTB 5DURD 1JWUB 2YEZB 2P48B 4CJ1A 2Y6SC 3MLUH 2VO5A 1RMFH 3AS3A 3WFDH 1V3LA 2LFGA 5ISZA 1VEOA 2DQTL 3QIBC 1JWMA 1VSCA 4KXZH 4Q2ZA 3QEQE 2LU3A 4RAUA 5LCVH 1K8DB 4Z0BL 1UM5L 1JGDB 1KGCD 5CGTA 3QP3A 3ULUL 3FRUA 2HJLA 2VUYA 4Y89A 5I1HH 3HI6L 5KG9A 5ICYA 5E8OA 3OL2A 4NQCB 2EYRA 1WT5A 1K85A 2N7BA 3Q2CA 2AXGB 1GC1H 2EE9A 5GSVA 3PIQA 3V5DB 5C8JB 4MD0A 1GGTA 3P40A 3M1BA 1WWBX 1IKFL 3MJ9L 1RHHB 2DBJA 1NBQA 1A1NA 1ORSA 1OF2A 3L5WB 4I5BB 4XNUH 4Z7WA 4LSSL 4U1GC 1P84K 3U6RB 5FKPA 3ECBB 4XNXL 5F70A 5IVXF 2QQKL 3UX9B 3VFOA 3HC4H 2X1OA 4MA8H 5F8QC 2HFTA 4IOSD 3KLSA 1T03H 1TJHH 3I6KA 1QVOA 1MCHA 1JNLL 2A1WL 2EEBA 3CDCA 3SDXE 1ZVHA 2ERJC 1CFTA 3O3EA 4X4XB 5CJXC 3TZVD 4HUNB 5H94B 2BXZA 3KPSE 5IKCB 5TDPA 4WO4C 5HVHC 4MNGB 1C08A 3U0PA 2M8XA 4HIHA 4YFLF 1X5HA 3SDDA 3H9YA 3TO2B 3PL6B 3MYZA 4NPYA 1CICA 2QQNL 4PGJA 4Y2DA 4YO0A 1ZHBB 1MCPH 1UM6H 2X4TA 3OJVC 2NXZB 1T2QL 4E41D 4DN4H 1QFUH 1BJ8A 2V5TA 4X6CB 4H26A 1UGNA 4XPHH 2VNCA 3FL7A 4ZS6C 3GBML 4XMPH 5CP7A 2RHEA 4JRYA 4LCIL 3RDTD 1SJXA 3FQTB 4PJ7F 1YA5A 4U3XA 1LNUB 4NWTH 3RGVC 3Q6FB 3ZTJG 4QRUB 4ODBD 2VAJA 5KS9B 5D6CA 4CRPA 3V4VH 2FEDC 1Z9OA 4JFQB 4XCEB 3IB4A 4G8GE 3AFLA 1BOGA 1BGXH 4TOYL 4YEFA 1E4XI 3S96A 4FQHB 3NFPA 1OWWA 3WFHA 2EZ0D 3VFVA 4P9HC 4PY8J 1RZGA 3TH4T 1BFSA 3PDGA 1SBSL 1E4KA 1MCKA 3U46B 1UWEH 1TQCB 1CGSH 5L2KD 3LKPA 4IS6B 4YDVA 5GQBA 4WFED 5J4MA 4HT1H 4MS8C 3MUZ1 1MVUA 3LKNA 3O6FD 4F7PA 5HYJB 5DI8B 3BWUC 5DVNA 3ZE0F 2OSLB 2RFXA 1MCCA 5FHAL 3MREB 3E6FA 4TYUA 3P4OB 1VFAA 1SJHA 3KAAA 4QXGL 4YZFF 3O9WC 1RULL 5EOTB 3WFEH 2AERT 3I75A 5IGXL 1IGFL 3O41B 4ZSOE 2JB5H 2Q1EA 5BS0D 3QO1B 1M05A 4KDVA 1GIGL 4HZLB 3B5HA 1H0DA 3O4LA 1HHGB 5FOBB 2HT4D 3MRRB 3VXMA 5SWQB 4XNQA 4FNLH 2VXSL 1EEQA 1J8HB 4YGVB 4D9RD 1FORH 3D5OF 3QEUA 4LLVA 3BH8A 4MDIA 3B2VH 4FFWC 3SGJA 3RFZC 4LHQB 3RTQB 3QQ4B 5F1SA 2VLRE 2R0WL 1DDHA 1AP2B 2R23B 1UC6A 5TGBB 3RIFF 4M7JH 2UYLA 4P4KD 4M6MH 1CQYA 3PP3K 5E6ID 5F1KC 4WRLA 2BZDA 4Z7UF 1QNZL 2XT1B 1V7NH 5BW7C 3OXSA 3IF1A 2J8OA 4Y16A 5MP6H 3KYOB 4X7EC 1Q72H 3VRLF 4ZAKD 1U8MB 1ZLVK 3EDFA 1HEZB 3BGFB 4HJJH 35C8H 4ZO9A 4Q6IA 1LP9E 3I2CH 1IE5A 2GJJA 2YD6A 3ZKQD 2Z92B 3IAGC 3UBXI 1AO7D 2DQUH 4A6YL 5HI3D 4F3FB 5BV7L 2F8VA 2BVYA 4NN6C 1XF4B 5CINL 5C0FA 1A02N 1MI5B 3IKCA 3SJVB 2CUHA 1PKQA 3ZE2E 2FX9L 4X8XA 3SPVA 4APQD 3C9NB 2OL3A 1VFMA 2HH0L 4ONFH 2FIRT 4YPGB 3H7LA 5JXAL 1XIWC 2GEEA 4KKLC 2X05A 1A4JB 4QRQA 4EUPB 4LEOB 2YSSB 2J88H 4JFHE 4W6WB 5DD5H 3OKEA 2QADD 3CLEH 4YHIB 1MELA 5ADOL 3MA9H 4QTIH 1OAYL 3B8YA 2A6DB 3WJLA 1R5IB 1VEMA 1OGAB 4HLZH 3ROOB 1KCSH 2I26N 4JCMA 1SVZA 3GJFK 4XPTL 3CMOH 4LAQL 1H15B 3C87A 5SWZB 1FG2A 4JKKA 3DOSA 4XP9L 3MCG1 4JHWL 3T4YB 2BHZA 4ODTH 4NZRH 3NH7H 3QWRD 3X13B 4V1DE 4NDMB 1YYMH 3AS0A 3WLWD 1A9BB 2ZCLL 1NCNA 1JMXA 2W9LA 1YEJH 5C7XH 1DVFC 2OJEA 4RX4A 3RIFK 1IT9H 3RVTD 3QI9C 4LHUG 5HHPA 2DQHH 4R3SB 3QUMH 1GHFL 1U6AH 1R5VA 4M1GL 4WEBL 2Y5TB 4OSUL 4LU5H 3B9KC 4GMSH 3V6FB 3NTCL 1J1XH 3TJEL 4OLEA 2F54A 4Q9RL 3IAQA 4JO3L 4QO1A 5JW4Q 3H9SB 1QKZL 4ZFZA 4FQLL 3KGRA 3QBTB 2WAHA 4I0PA 5D8JH 2VDRL 3U0TB 4JFED 4HF5H 5C08B 4JN2A 4LQ1A 1AJ7L 4XP1L 4TUOB 3TIEB 2JIXA 1YC7A 1HXYB 3BEVB 1F4YH 1MJJA 1IM3B 5AG9A 4JKWA 4MXVE 2C3GA 3CFBB 5HDLA 4CNIB 2J4WL 4NQSB 1MJ8H 43C9B 3VFTA 4R7DB 4NQVA 4J3UA 2CR6A 3HE6B 4YHZH 2LE9A 2DQGH 3VDCA 4ZFOA 5FCSH 3GSWB 3KXFE 5JORA 3NA4A 1YJDH 5DJ2B 1WT5C 3BW9A 1NDMB 3GSOA 2F9BT 4Y4HD 2HFEA 2VQ1A 3CFJA 1JZ7A 4RMQA 4NM4H 2NPLX 4AL8L 1MY7A 5JDJA 3QCUL 2CO6B 2Y06H 1DUZA 3QO0A 1CLYL 3DWTA 4CVZA 4EN3D 1NANI 3BGMB 2UZIL 3UTTD 1UXWA 5DK2A 4XCCH 3QIWA 3NMEA 5DRZA 1ES0B 3L3DB 3TA3B 3T0VA 4F15C 1ZK9A 1S5IL 4HXAH 3MLZL 4JHBA 1MFBL 3D39A 3QNYB 4FMFA 4R4BB 5ESQA 2YPVL 2DM2A 5HGDB 4XCFH 3ZZ1A 1JZ3A 2YD2A 3GMRA 4JZNA 1FZJA 3E8UL 5T3ZE 4HKBA 1NANH 3SDDC 3KVQA 3EOAB 4KI5D 4WW1A 4FQCH 1HINL 5C07B 2MCG1 1RQ5A 4ELMB 1CICC 1DQDH 1MJ7H 1UH3A 3WE6B 4Y2DC 2R4SL 2WANA 5DUPH 4EZMA 2ATKB 2A9MH 2Y07L 3I9GH 3O6KH 3K4AA 2O5ZL 1T20B 5C3TA 1A6ZA 3U7YL 5C09D 4P3CL 4WV1A 1YYLH 3BD4A 2ARJA 4GW1B 4YR6B 2CK0L 2XXMB 4N9GA 1IM9B 3FKUS 2R1WB 5AWNH 2DL2A 5B38B 3D85A 1MHCB 2FIKB 2CD0A 3QJFB 1P7KB 2HJFB 4EQ3A 4LSPL 3MLWL 3TIDB 2FYYA 4RAVA 3BZFB 3VXOB 1CIUA 2PO6B 4AH2B 3BMVA 2HT3D 1QRND 1KNOA 5C0AB 4OAWA 3O0RL 3AXLB 4OD2A 2AV1B 4PB9L 2XNAA 4P46B 1E4KC 5E8PA 1T80A 4X4ZA 3B8SA 3WIHA 5IVXA 4TRPL 1OTTC 5DUBA 2K7PA 1EHAA 1NUFA 4H1LG 4H88L 4GAYB 5DHVB 1A4KA 1OM3L 4OCXH 5TQ2L 5DS8B 5KW9H 4JPVL 3UCRA 2FNBA 1S9VA 4K2UL 3CMGA 1M71B 3T0WA 5MEND 4CL7A 4UDUB 1FN4B 3FZUC 3H9HA 3UJJL 4P2RE 2UWEF 4IEFB 3NN8B 1MAJA 1FHGA 1CXIA 4M62L 4MQTB 5HYQB 2IMNA 4OZ4B 3OAYH 5KSBF 5J1SC 4PJEE 2VZVA 3OKNB 1PQZA 2WLZA 3VG0L 4KVCH 2YZ8A 4YQXH 1O0VA 4U6TA 1Q0XL 4U0RB 5IMOA 1DFBL 4NQEA 4OD1H 1I9RL 3FOLA 4PJXF 4CJ0A 4YDKL 2E9IA 4KC3B 4ETYA 3SGJC 2X7LA 3CSYB 5E1HB 3ULSB 4J8RB 3GMPA 5JQ6H 4G6FB 1OTUD 1P7QB 5IVZB 1ZA3A 4XGZA 3BDBA 2BRRL 1D9KA 4C83B 4K94H 1HE7A 1G0XA 2JK5B 3ARBD 1IGCH 4K3DL 5IFHH 3CXHJ 4NO2B 3PV6B 1FH5H 1AC0A 3FO2B 2ED8A 5F88B 3TC9A 4YBQC 4Y16C 3RKPA 3BP7A 3V0WL 5LGKA 2IAMB 3QEQB 4NQDE 4RDQG 2FO1A 4D8PB 2DOCA 4N0FB 1JE6A 1S8DB 4GBXD 4XNZB 4G6ML 3K80A 4Q6IC 1KJMB 3BIKB 1YEHL 3GI9L 4I9WD 1QR1A 3FONA 4K7FB 4FTVE 5DQ9A 5C0DA 5F6HJ 4DEPB 3PGFH 5F97E 4U1HB 2B2XL 1Q0YH 4OQ1A 2GITB 2IPUG 3JV5A 1HCFX 2C4FU 4ZDHA 1NC2D 1KJVB 3MLYL 4Y5YB 2DLFH 3PQYA 1DN2A 4POZD 1UJ3A 2X4RA 3JUYA 1RIHL 4HKJA 1Y6KR 2YPLA 2HKFH 3D3VA 5AYQA 1EGJA 4MVBC 2FWOA 3GJFA 2Z8SA 3WIIL 4IMLB 1XGUA 1WCBB 1R24A 1H3GA 4M43H 3ZTNL 4POYA 3L3IB 3QRGH 1DLFH 2C1PA 4IDJH 5D70H 2AV7A 4WWKD 4X5XA 5JPNA 3NCFB 2FH8A 1FNAA 3SDXB 2X1PA 3WJLC 5E94B 2YN3A 2OP4H 3GMOA 4YBLC 5DEZA 1F8TL 3OF6D 3FB5A 1T1WB 1FG9C 4LKXB 4GRWF 4O2CB 4QRPA 2CR3A 2R15A 3QHZL 3WIHH 3DVNA 2AXFA 1FGVH 1ZHNB 4Z7UA 2GSIA 1NPUA 5CIPA 5FUCC 3T3ME 3WD5L 3WHE0 1KN2H 3WO4B 2V6HA 1EZVY 1Z9SA 3W81A 1RJYB 3SGEI 3PWLA 4MYWB 3E6HB 4ZOEA 5FKAA 3GSQB 2R0LH 5F7YC 4ACPA 2JJSA 4HIEA 4R2GC 3IDNB 5IROA 4XP6H 1DQLH 3F7VA 3LKSA 5J9PA 2FD6L 4QHLA 2XA3A 5J6GA 4FG6C 4MNQB 2ESVA 2X89D 3REWA 2HA1A 1I8LA 2W9EH 3LHPL 3WFDL 4I77L 1OQXA 4M61B 2D0HA 4L8CA 4NCDA 4UZGA 3E3QC 3FO9A 1WFTA 4H20H 4LVOB 4G8GB 3S5LB 4MQ7B 2A6IA 1CE1H 5IM7B 1NGQH 5EG6C 3VFMA 1MIML 3BO8A 5EH1A 4I0PC 4YHLH 4GRLD 5I1HL 4XB8A 3V6OE 5TFSH 3DO7A 4MJID 1YY8B 2QR0A 4PLNC 4Y4KB 1GC1L 3BH9A 3WNLA 4P5MA 1Z3GL 1JGLL 4DN3H 3NIFE 2BNRA 3G08A 4JRXD 4JPWH 5EU7E 1A7RH 5BXFB 1INEH 2ICCA 3W0WA 2DM4A 4M3JA 5DRXA 3MRKB 3D2UA 4EIZC 4U1NA 5EORL 4JQIH 2GT9B 4KKNA 4LVEA 5FCUH 3HC4L 3PG2A 1NGZB 4MA8L 4Q74A 4ZSOB 2R39A 1NAML 4Q9QH 5T1KD 5HI4C 2CIIB 4EKXA 1S9KC 5DEFB 1TJHL 4BFGA 2ORBH 2VDOL 5DJ6A 2EH8H 1C16A 4KKBD 2R2HA 1H5BA 2HRPL 4FZ8H 4JHAL 3UJTH 3KPMB 5K9OB 3S8WA 5TF1L 1RJLA 3ZDZF 1BBJB 2OR8A 4N1HB 5D2LE 3DGCR 3QIWC 4K94C 1MWAH 1KN4H 4IJ3B 4XC3H 4LCYA 1MCPL 2VLRB 3QUXD 5I75C 3VXRA 1FC2D 3DUUB 3QXWA 1JGVH 1P6AB 3GJFH 5GGRA 1IQWH 1DSFH 5KANG 1OPGL 3QWOA 3IGAA 4XPHL 3PWVA 4Z95L 5AD0B 2AK1H 1U8PB 1YPZE 1C1EH 1YN6A 3B2UD 2R0ZH 5L8JB 1DLHB 3T0ED 3KJ4C 3L3OB 2NY2B 2QL1A 3DPBA 4MCZA 2VZSA 1IFHL 5CEYB 4PTTB 2XQYK 1KENL 2UY7A 4KJPD 5HHNA 1LP9B 5T5FH 1UG9A 3OKKB 5K33A 1YMHB 1ED3A 2MJWA 3DTXB 4QHMA 4I2XB 2KBGA 3TM6A 1YQVL 4WV1C 2HTKD 1BGXL 2H41A 1BZQK 4OZIF 2LU7A 1FFOB 1SYSA 4KJYA 1UJTA 8FABB 4ONGH 1RUMH 1F3DH 3BZEB 1N0LA 2XYCA 3EJZD 4CU6A 3MBEB 2Y1VA 4UQ2A 3F58H 2J5LC 1UH4A 4HT1L 4ODHL 5E24E 5IBUG 2RIKA 1FVDB 3OXRB 2A73B 4IRJB 3AROA 3WSQH 4L8DB 1HOCB 4RIRB 1F02I 5EU6D 1AXIB 3SDAD 1E4XL 4KKAC 4M1DH 2XIDA 1M7XA 5ITBH 1WGOA 3ARFA 4ZTOH 2J6EH 1KB5B 4JREC 5K93A 3NA9H 5EU5A 3CDFA 2LTQB 2JB5L 1S78C 5D93C 2ICWB 3FQXA 1BZ7A 1WV7T 2MQ0A 2C9AA 4EI5A 1W72H 5EZIH 3G5ZA 5HDQH 1TNNA 4LHUD 4R4NC 15C8L 1C5CL 3Q5TA 2KPNA 4V1DB 4WW2C 1FYTD 3VFPA 4P4RB 1INQA 3CFDA 4JFXB 5JW3H 3I3EA 3IJHA 3QDMD 4PGEA 4LCWE 1FL6B 2J8UA 4A2MA 4HUUA 3VGAC 5FECA 5F9JA 1EIBA 4ENED 3IXTB 4OKDA 4M6ML 2RR3A 4PRID 5E7FA 2APBA 5I1KL 1KTDB 1JN6B 3MODH 5JHLH 3BAEH 5IB4A 1V7NL 4FFZH 3SGDI 4WFFD 3G6AB 3MLSH 2R2EA 3NZHH 4KV5E 4BZYA 3DV4B 2V5MA 1FIEA 4OF0A 4UI2A 3VFNA 4NKDA 4R0LA 4DGYL 2Q7YB 1IC4H 3UTPE 4HJJL 1FCCA 3PWJB 3Q1SH 4GKZB 3I2CL 3T4AA 2NY0D 2ZUWA 3OR7B 2DQUL 3FJTA 1D9KC 2NLJB 4TUKH 5EU4B 5GS0D 1OLZA 5JHDD 4PJHF 3WFBL 5GS0H 3T08A 5EUOE 5F7NC 3SGDH 2LABA 4L29B 4M3KB 2WP3T 2FGWL 3P30L 1A6VH 5E1AB 2A0LC 4LIQH 2EXYC 2QEJA 3CNKA 4ONFL 3OX8A 5ALCH 5IW6A 3K4ZA 4Y5XA 3S4SA 1ETZA 3KXFB 3K2MC 1XAUA 3ARTA 3BP4A 1AGDA 5FO9B 4RGMB 2GFBB 5IVOA 5EIIB 1JNHB 4FOMA 2ZCKH 3SKJL 4O2EB 3FN9A 3QDGD 5CZVH 3LD8B 3MCKA 5IB1B 2C26A 3L5IA 1F13A 2UWEA 5KSAB 2GHWB 5JIKA 1GOFA 1UJ3C 1JJUA 3VXTB 1G7IB 3RY4A 5EZLB 2ZUQC 4K7PH 4LBEB 5EO0A 1T04B 4QHUA 3HG1E 1S7SA 3V4UH 5JXEA 4NZRL 3NH7L 2NY1D 4JQVA 3TBYB 5C0IA 4U7SA 3DYOA 3DSFH 3EYFA 1GVIA 1OP5H 4PJXA 1IQDB 4MA1B 5K59F 2FB4L 4HH9B 5A3IC 1I9IH 1I9EA 2YOCA 4BELD 4X0KB 3X3GH 4FA8A 2P42B 3W2DH 2DQHL 2VXTH 2XFXA 3HE7D 3BN3B 4ZUUB 4ALAL 5DFTA 2E7CA 1I7RB 3LSOA 4LSTH 4AENA 3MFGB 3TBTA 1G6VK 4FFYH 1NC4A 3K8LA 2IG2H 4Z7QF 4UINH 5KBNC 5TDOB 4BK5A 4ORGB 4Q0XH 2CMRL 5C6PB 2JJSC 5F8RC 3OAZH 3M8OH 5CBAB 3MRNA 3EFFA 5INDA 4LASH 5F9OH 1AH1A 4Q97A 5C9JA 1BLNA 3GMQA 4I4WB 4QOKE 5F1IB 1N8ZA 4PJGF 2NY5L 1I8LC 1HKLH 5EC1A 2BVPA 3TVMA 5EOQL 5IWLA 2CIKB 2EH7L 1FBIH 5E8EA 3D87B 4JANB 4N5UA 2OK0H 4JZOB 5HSFA 1CYGA 1OGTA 3UROR 3B43A 2HLAB 1TZIB 5EC2B 5EO9B 3ZT6A 5IHZA 4JFDE 4XP4L 3MRJA 4WI3A 5DRNB 1ONQB 3EJJX 1PFCA 2DMCA 3TPKA 1YJDL 3IDMB 1PG7H 3HB3C 3DIFA 4PTUA 3VG9C 4X7DC 3UYRL 4HW6A 1NJ9A 1U93B 2XY2A 2Y06L 4IOIA 1MHPH 5D1QA 5C0JB 4JG1H 4PY7A 4LLMA 5FEBA 2VSDA 4XCCL 2JKXA 5DDHB 3NACL 1RV6X 1MRDL 2AI0L 5EBMA 5FM5O 5IT2L 2UZYB 1A7OH 4C56D 1T21A 3C5ZA 4P57A 5CLTA 3SKMA 3QUZA 4Z6AT 3S6CA 4HXAL 4PJEB 5TJWK 5HHQA 1H5BC 4BSWB 1CXEA 1KIQB 4HJ0D 4FQCL 4WEUD 1DQDL 4LLDB 4NO5B 5SX5K 1ZLUK 3RVUD 2LVCA 4FQXB 5HGHB 2BX5A 4PGCB 4NO0B 2A9ML 3DMMA 3I9GL 4NO3A 1OSZA 3PDDA 2H2PD 1CL7I 1K6QH 4YDLC 3WEXB 4D3CH 5MEPA 2VH5L 1JF6A 3EUUA 4KMQA 1VDGA 4PRBA 1UM4L 3GGWB 5GRXG 1QEWB 4J1UA 4GUPB 4NQDB 4X4YB 5KSVB 3HUJF 3KYNB 5ISZE 3FOMA 1BX2B 2WWKT 1MFAH 3EFDH 2X4UB 4FTVB 5CJQH 4PR5B 3FO1B 4U1JB 4HCRH 3WNMA 2I9TA 3G04A 3GMLB 5LAXA 4WY7H 1MEXH 2MTPA 3GSXB 2GTWA 5IOPB 5MERB 2M2DA 3DETC 4WU7B 4RMVA 1I4FA 4OCXL 2VDLH 3UDWA 4IRSB 4L3ED 3G6DH 1N4XL 4CW1B 1MFNA 4XX1E 1Y0LA 2BJML 4Z7WE 2VIRB 4YHPB 5CCKH 1N3NB 3IKKA 4ODUA 3WDHA 5BVJA 5IFJA 2CLZA 1WIUA 5DC9B 5E8NA 4LGSB 3ARFC 2WBWB 3F5WA 1Z5LA 3B6SB 2WINA 1ADQL 1J86A 4H0GA 2WBJB 3P9MA 2IADA 3SDCD 4RRPG 4TTDD 4EI5C 2FJGA 2XZQH 3G5VB 4WTWA 1D3CA 3HMWL 2FBOJ 4KVCL 4MB4A 2NX5B 1IGMH 4YQXL 3K2UL 1E0OB 1S7XA 2R1XB 1S9YA 2FX7L 3LQAL 4P3DA 5ACLA 4F80A 3GSUB 5I1JL 4HSQA 4JFYB 3ZSSA 2FLRT 3TO4B 3MCLL 4BQ6A 4OB5L 3HZYA 4OFDA 3WLBA 1FNLA 5T3XE 3STLA 1QOKA 4Z78A 1URLA 1NEZA 1HXMA 3RU8H 4XBEL 3NCEB 2VZTA 1HILB 3K8KA 4EUPG 3B4NA 2CLRB 5DJZA 2D7OA 5CMAB 1EEZB 1FH5L 2DQIL 4J3OC 4OZIA 2VL4A 2B1AL 4QCIA 2VOTA 1XR9A 4LGRB 3GMNA 4I1NB 4NQXB 3LN4A 3INUL 4R0LC 1JNNH 5GGVL 5I66A 1JFQH 5E6IA 3U7WL 1K4DA 4M6AA 5AZ2H 1ZXQA 1UZ8A 2YKLH 1ACYL 3LKRB 5BQ7B 3ARYA 4OJFH 3U4EB 5DJAA 1BOYA 5J13B 2OCFD 2A6JB 2BHUA 3N1FC 3ZYIA 4CVWA 5B3NA 3ES6B 1CGVA 4D0BB 4OGAC 4BFBD 5SWSE 1EBPA 1J1OH 3NGBC 1WBYA 4QRTA 5KANI 1OAUH 4R96A 1F3JA 4WUUD 1AO7A 1QHPA 1KTLB 3TPUA 4Y5XC 1UWGH 3MJ8A 3QG7L 2XWBA 3O6LH 1KJ2L 3QRGL 3C8KB 1UQSB 5D70L 1N5YL 1MHHA 1HI6B 2X40A 3PGCA 1XGQB 2BNUB 3T1FB 2EDRA 3LZFH 3O4LE 1MY5A 4ELKA 1I7ZB 3DRQB 1CLOL 5D2LB 3VXME 1KCRL 3HLAB 3W9DA 1W0VB 2ZG3A 4WU5A 2FZ3B 2PETA 3BSZH 5I17B 4PJ9B 5DJYA 5JXEC 1A5FH 5C0ND 3MV8D 4Y19D 1PY4A 4Z0XA 1FL3B 2YR3A 4JM2D 4PUBH 4G6JH 1KYOJ 1KN2L 2VLJA 1K8IB 3RPIA 2G60L 4MA7H 1AD0B 1N6QL 4LNVA 2V17H 3ZDXE 1U9KA 1YPZB 4PJAF 1O7SA 4NYLB 4XP6L 1AKJB 1JPGB 2VISB 4X7CC 1KIPB 2IFFL 5E2WH 4ODWA 1ACZA 1AGEA 4PJHA 4JJ5B 4OBSA 3SY0A 3LEXA 1QLEL 2W9EL 4OZFH 3QIBB 4XBGB 4RGND 5FO7B 3TBWA 3K8MA 2PYEE 5LG1A 5FB8A 3N1QC 4FABL 2EDLA 3CX5K 4BKLA 4FS0A 1T5XA 5L2JA 1E28A 2QHRH 3O81A 3BD5A 1FNGB 2FSEA 3MGOA 4DAGL 5F6HI 2ADJA 2X1WL 1K8DA 1YDPB 1OTSD 2NNAA 2X4OB 3KHOA 3BE1H 2OR7A 1JGDA 4I18A 3UAJD 4UBDD 3WKNA 1PKQE 1X5FA 3NZ8A 3DX7A 3TVMC 2BDNH 3C60A 5IWLC 1P7HL 4BQ8A 4JPWL 1A7RL 4JM4L 2CLVA 2C7UA 1INEL 2F74B 4U1GB 1UKQA 3MOBL 3T3PF 5ERWA 4U0QB 1BVLA 2BNQD 2AJXL 4IBLT 5FCUL 3EDDA 2I5YL 4NT6A 3SO3C 4B41A 1R6VA 4M7KH 1P5VA 4Q9QL 1T1YA 3CVHA 4OCYH 1U91B 1KG0A 1MLBB 1ZEAL 4MXQD 4WO4B 5C2BL 5HVHB 1OAKH 3ABZA 4GSDH 5HHOA 4NNPH 3VXPB 3H7BB 3ILQD 3UJTL 4OIAA 5D1QC 5GISH 4QGYA 1F4XH 5GHWH 4FQ2L 1YNLH 4RMRA 1U3JA 5FUCE 5B38G 4LCWB 5CZXC 3OJMB 5J6HB 3WXVH 3C5ZC 4L4VA 3QUZC 4YHKH 3IDYC 2GSGB 4KDTA 3TV3H 2NXYD 1XGRB 1DSFL 1OWRM 1IL1B 1UB5A 4N8VA 1OOAA 1NMCC 2WW8A 1WJ3A 5LXGH 3T2NL 2DIJA 2V5SA 1IAOA 2AK1L 3VI4E 3GB7A 2VDML 4EN3A 2B39A 2R0ZL 3UTTA 4I3GA 3RGVB 3J7HA 4GRMA 4HMCA 2P8LB 5EZOH 5GJSL 1A7PH 2JELL 2Q3ZA 1UZ6E 3E3QE 4PJGA 5T5FL 4JVWA 2OX5A 3DMMC 3JVGA 1GZQA 1XF5B 2F54E 4H0HB 3MNVB 3QH3A 4C59B 1U3HD 3BKJL 2NY6D 4XNMB 1MQ8A 5HI5C 3MRQB 5CD5D 3Q6FA 1XF2B 2V7HA 3A0OA 3LH2L 5ENWB 2EC9T 1ZV5A 5EUOB 3B9EA 2ZJSH 1MFDL 1VA9A 1YN7B 5B39A 2CKBL 2YUZA 2HKHH 3C5JB 3F58L 4NZTH 4BYHA 3BKMH 1MAML 1KC5L 4YGAB 1JHTB 1JV5A 1JPSH 5HJ3A 3H9ZA 5C09A 3WSQL 1QBLH 5FUOH 3V6ZA 2D4FA 3MA7A 2Z93B 4Z7NE 2VR4A 3QNXA 2VZ3A 1CD1B 1MFCH 3FB7B 5ACZA 1FSKC 4AQ1B 5ITBL 4MAUH 3EJYC 3MRIB 3G6JF 1P2CA 3P3YA 1RURH 3MPCA 2J6EL 4RNRA 1WIPA 1NGXA 5E7BA 3NA9L 2YMXL 3MREA 2ADIB 3QIUA 1B0GB 1D5IL 2H2SC 2DLIA 2DIAA 4KAQH 3UDWC 5GIRA 3QSKB 4L3CA 1WFUA 4P2QA 5I19L 1GZPB 5HDQL 3HG1B 1S7VB 3OBAA 5DFVD 2DQEL 1J0IA 2EECA 4WTZG 1N2RB 1NCWL 3HC0B 1QSVA 3SKNB 3CC5A 1NMBL 1RUPL 4NQCD 1CT8B 4M8QB 3ULVD 4PV9B 5T1LD 3ULVH 5FOBA 3UTQB 4ONHA 5I1LA 4N0RA 3QXTA 2ICWJ 4HWBL 4YGVA 5J3HD 3RZCC 1F45A 4HLJA 5DYOB 3T04D 3D39E 1DEEB 4R4FL 5FF6A 1XR8B 5JHLL 4O58H 4WGWB 3MLSL 5KVFH 3RX8A 3EO1A 4W70A 3S37H 5LWYH 4F7TB 1ADQA 3HUJA 1EXUA 2W92A 1XMWA 4XXCA 4HDIA 5CJOL 5IHBA 3O6MH 1VENA 2EIZA 4NN6B 2AXHA 2ZP0T 3MRMA 5CGYC 2IFGA 3R8QA 4NFDA 1XGTA 5GS0L 4NJAL 3L1OH 4ZTPH 1ZLUH 2YHGA 3CD4A 2WIIB 4CUCA 2VLKD 4OBRA 1ZS8A 5FYJU 4LIQL 1XIWB 1U92B 5DC0A 3W5MA 4PRAA 4DQOH 2A2QT 2IBBA 2CJUH 4OLUH 4JFDB 4QWWC 5ALCL 2H6PB 3TBSA 1JUFB 1ZWIB 3T2QA 3LV3B 5E6IC 2IPKB 3R0MA 4S2SB 5GGSB 1A3LH 4AEEA 4OCMC 3BP5A 2ZCKL 4O00A 2XICA 4M9PA 1YEDA 4M48H 3EZJB 4LEOA 5IVXE 3TYGL 4OI8A 5L8KB 3KPLB 1KJ3H 1DBAL 5I1GH 2V2TB 1D6EA 4HC1H 1WZLA 2BFVH 3BN9D 3KPTA 4K7PL 4JKPH 3UJIL 2P8MA 2F58L 2ZUYA 4E0RA 1RZJL 3HNSH 3W39A 4AYFA 4IHOB 4HWZA 1FLTX 1BECA 1ZA6A 4OGYL 3DSFL 3ZE1F 5J7CC 2QJDA 1WF5A 4YPJA 1ZLWH 3QI9B 3OMZA 1RJZA 5L6YH 3X3GL 5I2IA 5IK3A 4OCRH 1Q1JH 5HPOA 5HYJD 3W2DL 3N1GC 5FYJD 4BSJA 2Q8AL 2FL5B 5JQHC 1T1ZA 3B9KB 3MLRH 4XPAH 1CG9A 4AT6B 1YNTA 5LBSH 1KJ2A 1WZ1L 4LSTL 4HS6A 4NQEE 2ARJQ 3S3JA 3HNTL 1AR1D 3WHXB 2IG2L 2YA0A 4S10A 5D1ZB 4UINL 1FFNA 4WIQA 4FQIL 2PCPA 4J3WA 4Q0XL 3BPOC 3OF6A 1MUJB 1LWRA 3M8OL 4PS4H 1T66C 4LASL 5F9OL 4XH2B 2IEPA 5E2UH 1BZ9A 3IRPX 5CEZD 1J8HD 1EO8L 1OARL 3Q6GL 5CEZH 1I75A 4YJZL 5I18H 5ISZB 4OGXH 1HKLL 2BSED 4KI1A 1JWMB 4Q2ZB 4RAUB 5HGAA 3T77A 5C08A 1P1ZA 4TUOA 3OAUH 3RHWK 1CGUA 1PX4A 4OF8A 3VXQA 2YD9A 3HMXH 3NFNA 2DQJL 2HJLB 3HRZA 5M95B 4CMHC 3LQMA 1GGBH 3LN5A 5KG9B 1UCBH 5IB5A 5E8OB 2HTLC 3ZE0E 3FHAA 3CSPA 1IEBA 4TUJB 4XP5H 4G8IA 3GIVA 4LCUA 5GSVB 3PIQB 2R1YA 4I18C 5ILTH 4DKFL 4MD0B 2R0KH 3ZO0A 5JOPE 3AB0B 1UKTA 3M1BB 1G9NC 3PQYE 1Q9LA 3C60C 5C3LD 2AK4E 2DQFA 2ED9A 1A1NB 3V9FA 4Z7WB 1OF2B 3ISWA 2YPLE 1T83A 1T0MB 3HN3A 2DWEA 3D3VE 2B1HH 4GRLA 5FKPB 4RGOH 3OPZH 4K71C 5DK0A 3VFOB 1SJVA 1G0DA 1A6UL 1A7OL 3UPRA 2NY5C 1I9JH 2ZKHH 3I6KB 1QVOB 3L7FA 3SJVD 4AMKH 3GFUA 4KK8D 5EBWA 1CFTB 3O3EB 3MRCA 4W81A 5TDPB 3L5XL 3NCYS 2EO1A 4OFVA 1C08B 3U0PB 4HIHB 3SDDB 3FN3A 4PJAA 4QRPE 4NPYB 1GSMA 4LSUH 1LK3H 4Y2DB 4YO0B 5I15L 4Z7UE 2X4TB 1QSFA 4R97C 4ZO7A 3VGEA 4NNYA 2XY1A 1JI2A 1QSEA 3R1GL 5IHUL 5T1KA 5AAMA 3IDIA 3VRLE 1C5BL 4H26B 2OZ4L 4U33A 3EOAA 4KDTC 3RI5F 3C6SA 1OGAD 4JRYB 4GAGL 4YDIH 5IBTH 5C2UB 1VFOA 4I3SL 1B4JL 2Q86A 4EN3C 3BUYA 2AP2A 2FCBA 4N90D 5E2VH 2ESVE 1OAQL 4EXKA 5KJRL 1KEGH 3NOIA 5D6CB 2KL6A 1LEIA 4RFNC 2VDPL 3JVGC 3NPSC 3EFDL 2IQ9H 1BOGB 2ITDA 4X6FA 3S96B 5CJQL 3NFPB 3WFHB 3VFVB 1CQKA 3WJJA 1CL7L 1RZGB 3SCMD 2PR4L 4G6AC 1NCCH 5GRZA 5F9AC 1CFQA 5IESL 3GM8A 2EDKA 3LKPB 4YDVB 5E95B 3BD3A 5J57B 5F7EH 2BNRE 1MVUB 3LKNB 1GGUA 4F7PB 3RGHA 1CE6A 2RFXB 1R3IH 4BSVA 2DI7A 4UUJA 3E6FB 3VE0A 1T3FA 1J05A 1VFAB 1SJHB 2E6JA 4YEEA 3VCLA 5DHVA 2AGJL 4OI7A 3I75B 2EDHA 1M05B 3ZL4L 4X80L 1TMCB 1H0DB 3QIUC 3O4LB 3JBG7 3RWHA 2CKNA 2OR9L 3VXMB 4XNQB 4DZBA 3BPLB 3LN9A 2Z0BA 3SDAA 2HT3C 3I6LE 3QEUB 4LLVB 5IJKA 3BH8B 3HE6D 4MDIB 1U8OA 4HS3A 4OCSH 2HVKA 3IFNH 3M17B 3VXRE 1DDHB 1N59A 5FYLH 1E6OH 2B20A 2UYLB 3RI5K 2X9XA 3RU8L 2YD3A 2WMPA 1CDYA 2BMKA 3OXSB 3IF1B 4Y16B 3EO9H 4NJ9L 5MHSE 4JFZL 2OI9C 1FYTA 5J89A 2PYEB 3TYFA 3WUZA 4F7MA 3D0LA 3K1DA 4Q6IB 5CSGA 1EV2E 2MKLC 4WDIA 1JNNL 4R9HA 2VC2H 4XXCC 3UC0L 3SDYH 1JFQL 5TE4H 2OMNA 4PP1C 2B4CH 5EU3A 1LD9A 3SE8H 3QEQA 4HQQH 4QKXB 2YKLL 1IC7L 3IKCB 2IJ0C 3QFJD 1PKQB 5DUMH 5C07D 3OSKA 5H37G 3SPVB 3X14A 1RUQH 4OQTL 2OL3B 1G7MA 1K4CA 4U1HA 5GJTH 3QQ9D 1KEML 4K7PY 4HWEH 1N64H 2M1KA 5HPMB 1OAUL 5D7LA 4OI9A 3GRWL 3DVIA 3OKEB 3IETA 5C0BD 4L3AA 5I1CH 1UWGL 1KBGL 1BFOA 2XQBH 3P4MA 1S9XB 4LVNC 4YDJB 3L3HA 2YUXA 2JB6A 1IM9D 4GG8A 4M93C 1DN0A 4MMXC 3VI3F 3VMOA 1MJUL 1L6XA 4YBLB 3LZFL 1E6JH 5DTFA 1AC6A 1FG2B 3GKWH 2PO6D 2VDKL 1Z0MA 3DI2B 4ZFGH 5C0AD 4DK3A 1YNKH 3KPSA 4IIQA 4TVPE 4N8PA 4WUKL 4G6JL 1FO0A 3TJHD 2Z4QA 2OJEB 3MYJA 2J8UE 4R2GB 1BAFH 5DHVH 5F96H 5HHPB 1R5VB 4G80A 4H8WC 1UVQA 4ZYKA 3MBXL 2O61B 3T65A 3QR2A 1I85A 1MPAH 3BI9X 4G6KL 2F54B 4ZFZB 4CU7A 4I0PB 2QHRL 3PHOA 4K9EH 1FRGH 2NY4C 4JN2B 4LPWA 2MPAL 2JIXB 1RJCA 3HE7A 5C9KA 5J06A 4PJFF 4BZ1L 1MJJB 3DURA 1IBGH 4UV7L 5IIEA 3CVIL 2K9UA 3QDJA 2LU4A 4G7YH 4ZUVA 5ESVA 2BDNL 5DO2D 5DMKA 1H3XA 1FNSL 4G6FD 3VFTB 1XF3A 4NQVB 2X5PA 2AKRA 4ZFOB 1SM3H 4HZAA 1HSAA 5JORB 2ZSWA 3BW9B 3GSOB 2W0FB 3S36H 3VXSD 5F7MC 4OD3H 2HFEB 2VQ1B 1N7MH 4M7KL 3CFJB 2WWMC 3DX9A 3RBGA 2P7TA 2P46B 4WCYL 4Y8DC 4TPRH 1NFDF 2IAMD 3PABA 2NW3A 4S1DD 2UWEE 4H1LA 5ICZA 1DUZB 2WLYA 3QO0B 3FTGA 5FGRA 1FDLH 4CVZB 1UXWB 1T83C 5DK2B 3CXHK 3GHBH 3EOTH 1SHMA 3RWIA 4M8VA 2F53E 3QIWB 2YRLA 5CD3B 5KSBE 5DRZB 4GRLC 3RIAF 1ZVSA 5I75B 3U0WH 1TZGL 1T6WA 1KLFA 3WXVL 2X4QA 1L0YA 1QRKA 4PJXE 5D2NE 3TV3L 1G84A 4KZEH 4P23A 3D39B 2BOCA 5ESQB 3VRIB 1G7JB 4OZGF 2EIEA 3TA3C 3GMRB 4JZNB 1FZJB 3KJ4B 3OGOE 4HKBB 4ODVL 5BZWA 4WW1B 2D7PA 1NMAH 5B4MD 3LKOA 5EFIA 3S34H 2E9WA 4PJ8A 1AXSA 4OV6F 1B6UA 1A7PL 4C56A 1A6ZB 1P4LA 3L3KA 4ZXBD 3OKOA 4WV1B 1OAXH 1YEFH 5L0QB 1D5XA 3P0YL 3PE9A 1BMGA 4N9GB 1KXVC 2Z31A 3GJEA 5JOFB 2ZJSL 3T2PA 3D85B 1RZIA 2JLLA 3IFLH 3X3FH 1U36A 5GZND 4U1LA 3BKML 2FYYB 4RAVB 2OZ4A 1JPSL 5EWIH 3DV6A 1NQBA 4XC1L 1EJOH 2WUBH 4XPGH 1R5WA 4XPBH 1KNOB 4HMEA 3AU1A 4OAWB 3WJJC 2AJYL 5H2BA 2QSCH 4OD2B 2Q6WA 3WNPA 4X6BA 2XNAB 4JREB 5E8PB 5JLZA 1H3WM 4MNQD 5IVXB 2ITCA 3DUSA 4L8DA 5DUBB 3BWAA 2YWZA 5D93B 3S98A 1EAJA 2UVFA 1A4KB 1S7WA 2XPGB 5JR1H 2ZUSA 4KAQL 2P1YA 1BJ1J 1S9VB 5KOMC 2F5BH 1F4HA 2DDQH 2HTKC 5JUEH 2ZPKH 1FLRH 3C08H 3H9HB 4G9FD 4GRWE 5I1DA 3EJZC 2Z8RA 4Y4KD 1XH3A 3ULVL 3VGAB 5DD3H 3MX0A 3JWOH 2E7BA 3S97C 4O9HL 5F89A 4GG6F 4P4RA 4PRDB 3MV01 3BRDA 1PQZB 1U58A 4YX2H 4O58L 1FL6A 5IMOB 4NQEB 5IJKC 3FOLB 3U7AA 1KOAA 2D0FA 3MMEA 4MAYA 4MCYA 2X7LB 3FQUA 4JGJA 2HYMA 3L6FA 3GMPB 1ZA3B 4XGZB 5KSUA 1D9KB 1HH6A 4W68A 2XACC 1GXEA 3O6ML 3HZVA 3T1WA 4TNWF 3Q3GA 4B53A 3QCVH 4Z8FH 1YEIH 4FQJH 1PAMA 3MUHL 3GIZH 3L1OL 5LQBH 3DECA 4GKZA 2YBRA 3BP7B 3CLFH 5FOJA 3OR7A 4GLRI 2EDXA 3BPCA 2DF3A 1L0QA 3WUWG 4BFIA 2FGZA 1A6TA 4B7IA 4E41E 1P6FA 4P5TB 5ID1A 2CJUL 2YZ1A 4OLUL 1QR1B 3FONB 25C8H 3NCJL 5DQ9B 1T89A 5C0DB 2CDFA 4CKVX 5DEGA 1BJMA 4PJ5A 1TIUA 4HKXA 1I1YA