3IDPA

B-raf v600e kinase domain in complex with an aminoisoquinoline inhibitor
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
272
structure length
255
Chain Sequence
b'DWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATGSILWMAPEVIRMQNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords B-Raf proto-oncogene serine/threonine-protein kinase
publication title Selective inhibitors of the mutant B-raf pathway: discovery of a potent and orally bioavailable aminoisoquinoline.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 72
structure length 255
sequence length 272
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3idpA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3idpA01
2VWVA 3WI6A 4BWKA 4DCEA 2YZLA 1KUTA 4R5SA 4AOTA 5ETAA 2F9GA 3ANRA 5L3AA 4G6NA 3QTZA 4L42A 3A60A 3BYOA 3R28A 2GQRA 4A06A 5EQEA 3U4WA 4XBUA 4MNEA 4Z7HA 1UWHA 2CKEA 2JFMA 2NRUA 3WF5A 4AOJA 2C3JA 4FV3A 1RW8A 4GK2A 3ULZA 3LJ2A 3WYYA 3DK3A 1SNUA 3O51A 4O7TA 3DA6A 4DCAA 3NW6A 2CKQA 3AQVA 5CTPA 3JPVA 3VS1A 3QFVA 4J95A 2OXDA 5HCYA 5HU3A 2J0LA 4TL0A 4AACA 2GS2A 2JAMA 4RSSA 4MD9E 4TWCA 4X2JA 2PZRA 4ZSEA 3DS6A 3KRJA 3E3BX 3TDVA 4JDHA 3O7LD 4L8MA 2JIVA 5KCVA 1ND4A 1F0QA 5KKRB 3UO6A 4GT5A 4FSRA 4D4SA 5GJDA 4DINA 4AZWA 4RX8A 5ETIA 4FKPA 3DDPA 3VS7A 2C3IB 2R3LA 3EQHA 5LMKC 1SYKA 5AWMA 5K4JA 2XK8A 4LGDA 4UYNA 5CAOA 2FO0A 3G0FA 4R3CA 4GT3A 2XNMA 4ZJVA 3DXPA 5DN3A 4AS0A 4BWPA 3OBJA 3FLZA 4EYMA 4F70A 2QKRA 2RF9A 4DFXE 3D2KA 2WD1A 1UNGA 3DCVA 3UBDA 5AUXA 4TYGA 3D7ZA 3OG7A 4ANNA 5AAFA 2J51A 4FG9A 2BVAA 3LZBA 2VX1A 4I20A 3EJ1A 3KF7A 4BL1A 2W1DA 2W4JA 4IH8A 3WF9A 4MBJA 3COMA 3VS6A 3EN9A 2ITTA 2ZMCA 3OVVA 3OT8A 4FV2A 4JQEA 1SVEA 3N9XA 5GNKA 3IPHA 1DAWA 1W82A 1RQQA 2YJSA 5G6VA 4W8EA 4UMPA 4EONA 1Q8TA 4KABA 4AE6A 4P5QA 4R1YA 1F3MC 2I40A 2OG8A 2ZVAA 5TO8A 3ZO1A 2FH9A 5FXSA 4JT3A 4ZY6A 4FSWA 3SRVB 3W2SA 5CSHA 5HNGA 2NP8A 2VUWA 4EHVA 3JXWA 5BVFA 3KULA 2XIZA 3MTFA 1W7HA 4IE9A 1BX6A 5FTGA 4JDIA 5DRDA 4JBQA 4HVSA 2HAKA 2AC5A 3KC3A 3KU2A 1ZYDA 4EQUA 3UNJA 4JRVA 4FSYA 3Q53A 4BVUA 3DBCA 4K11A 2VN9A 4CTBA 4QTEA 3FQEA 4LMUA 4Z55A 2WFYA 4M3QA 3QX4A 3Q2MA 4IB1A 3VJNA 3N51A 4GJ3A 4NK9A 4FV5A 4G3GA 4U42A 5EI8A 3LAUA 5H8EA 2XB7A 3DQWA 5HICA 4E4LA 3GQIA 3SGCA 3NPCA 4V05A 4IVBA 4WUNA 1OL6A 1CTPE 3IONA 5IQCA 5HI2A 2X4FA 2C3LA 3CY2A 5A14A 2ZM3A 3I4BA 3ALNA 2BTRA 3MTLA 4GU6A 2OZAA 1OUKA 4RVLA 4YC6A 2WMAA 4RIWB 2QC6A 3LE6A 4OTPA 4JR3A 1FINA 2B9JA 3QTIA 4G6OA 1WMKA 3F5GA 3QYZA 4G5JA 2EB2A 3KXMA 4CKIA 4WA9A 3C51A 1PKDA 5AUYA 4M66A 2XVDA 5HBJA 3DKOA 2I1MA 2WXVA 3G33A 2ESMA 3OCGA 3RWPA 4O7WA 3QTUA 4G16A 5T6KA 2A27A 4KIPA 4BIEA 4ZLOA 3R73A 2VZ6A 3GGFA 5J7BA 3C1XA 4M68A 3OCTA 4QP9A 1U46A 5HD7A 2GTNA 2YLEA 4MF0A 3R9HA 3QRTA 3ORNA 4QPSA 2CNUA 1BUHA 4UZDA 3GEQA 3FMNA 4FR4A 4TT7A 4A4XA 3MYGA 3QGWA 3W55A 4ONAA 3FLNC 2I0VA 2R3MA 3E8EA 2FB8A 1SVHA 1BL7A 2HZNA 5C26A 3MFUA 4QRCA 4X7QA 2B1PA 3VBQA 2VGOA 4O0YA 4WHZA 4DFBA 4X3FC 3F3ZA 1TVOA 4PMSA 5LWMA 3WARA 2W5AA 2E9OA 1R3CA 2WELA 4W4YA 1KSWA 4WNOA 3RZBA 3IQ7A 4O27B 4EJNA 3FKOA 3MH3A 4FYNA 1FQ1B 4FIGA 4EUUA 3OP5A 3PVWA 4QMMA 3PZHA 4V04A 3CLYA 4FC0A 5F20A 4BTFA 4EOMA 5CF5A 3LMHA 4U80A 5DWRA 5KMIA 3RM6A 2WNTA 3AC3A 3FLQA 3NEWA 3R02A 2YM8A 4FK3A 3CD3A 4FKQA 4R78A 3LFAA 4I1ZA 4CZTA 4NKAA 3IOKA 3O96A 4O22A 4HVGA 3HV6A 4AZFA 3TIYA 2X0GA 3TV4A 1WBNA 4ENXA 2XCHA 3EIDA 3NYVA 2C69A 3QUDA 3ZBFA 5FBNC 4V01A 3FMJA 4C3RA 4EK8A 4TYHA 2QURA 4NFNA 3R0TA 4Q5HA 3W10A 3LXLA 4FKIA 3QCYA 2XS0A 2IZSA 2PVLA 3R8LA 2VTHA 1URCA 1ERKA 4BCNA 3CPCA 1ATPE 2WKMA 3KVWA 4GYGA 4F6UA 1YXTA 5DBXA 5HU9A 5C9CA 4ANOA 2ZB1A 4GJ2A 3ZMMA 3KRRA 5CEMA 4MYGA 2PVNA 3FY2A 4P4CA 5J8IA 4ZK5A 3UJGA 3LFEA 3UQGA 3V5JA 4OBQA 2IN6A 3MY5A 4TXCA 3B8QA 4HGTA 3MIYA 2OO8X 1YW2A 3A7HA 4IFCA 4PDSA 4L52A 4PV0A 2E9UA 3GBZA 4IM0A 3DPKA 3S3IA 2JC6A 2XF0A 3ZFMA 4RJ5A 5AFVA 4KIKB 3AD4A 4G2FA 4JBOA 1U59A 2QODA 2J0JA 3KGAA 4BCHA 1W83A 1XH5A 3HP5A 4GW8A 5C4KA 2O8YA 4D0WA 1WBSA 4XP0A 2H9VA 3CBLA 3II5A 4OT5A 4W4XA 1OGUA 4WT6A 4DFNA 3HAMA 4YNOA 3DXNA 5CLPA 4L3PA 4O7SA 1YWRA 5HE0A 2ZB0A 2ERKA 4K1BA 2QOQA 3RKBA 3THBA 3ZZWA 4HVHA 5AEPA 4QMWA 1IAJA 4KINA 4PMMA 3FDNA 2GMXA 5IF1A 3PP0A 5DH3A 3EFWA 4U40A 3EYHA 5EOBA 3FC2A 4BCMA 3Q9XA 1XKKA 4RJ3A 4E4XA 3C4EA 3F6XA 2J5FA 2PK9A 3KKVA 4FKSA 1JOWB 3NCZA 4QMTA 3D7TB 3MB6A 5CF6A 5HLNA 4QMYA 4ZMFA 5KUPA 2EXCX 5BVEA 4FZ6A 3QALE 4ITIA 4B7TA 5KMNA 3HLLA 3VW6A 4RX5A 4DH5A 5JMSA 1IAHA 3BEAA 5GIPE 5JGDA 4FL3A 4KSPA 3AMYA 3VS3A 1NY3A 3B8RA 3QCSA 1Q8UA 5KBRA 5AAGA 3Q5IA 2F7XE 3LCSA 5AP0A 1BYGA 3ZRLA 4C57A 4ZLZA 3HDNA 5JFSA 3GB2A 3CXWA 1JSVA 5EYCA 4D1SA 4CRLA 2VD5A 4K33A 2VAGA 2Z7LA 4M8TA 4UYAA 3R8UA 4F9BA 5CU0A 2JAVA 5HBEA 3DB6A 4FVPA 1SNXA 4IX6A 4O38A 3MSSA 3GOPA 3PPKA 5CNNA 4BKYA 3KXXA 3A61A 4D58A 4JDJA 1WBOA 5DNRA 3RHXA 1XH6A 4YMJA 1OIQA 4EH6A 2J7TA 4PPAA 4DT8A 4J53A 4EHGA 3UOJA 1NA7A 2XIKA 5A46A 2YIRA 3DBQA 4OLIA 2GNJA 5CSXA 3EOCA 5E8YA 1M52A 3M11A 3VQHA 2W17A 3PWYA 2VV9A 4I5PA 5DGZA 5BYZA 5IA3A 4O0TA 4DG3E 5HX8A 2VO7A 4FIHA 5IU2A 3V04A 5DIAA 2F7ZE 5DLSA 3E63A 4ZZNA 4QTAA 1S9JA 4CFVA 4ASXA 4H1MA 3S95A 4H05A 3MN3A 5GINE 5EW9A 3TKHA 3IGGA 3CEKA 2XKDA 3IKAA 3ZRMA 2UUEA 1PXOA 4ZIMA 4CV9A 3DTWA 5IUIA 4C58A 4XRJA 5M44A 4W8DA 1FVTA 5EDRA 3R9NA 2XCKA 2C5XA 4MAOA 4TYEA 4BDCA 4FSMA 5HVKA 3P08A 5CEIA 4AA0A 4PDPA 4FUYA 4LFIA 2IW9A 4BDGA 4WSQA 2R3NA 3ZXZA 1R39A 4FTLA 4IAZA 2VO0A 3PP1A 3PSDA 1K9AA 3ZC5A 4JIAA 3SG9A 4EQMA 2OW3A 4FOCA 4PL5A 4CMUA 5A6NA 3P0MA 4IVDA 4UWCA 4X2FA 4FVQA 4LRKA 3HKOA 4DGOA 3EYGA 4XV2A 3OWLA 2A1AB 1CKIA 2P2HA 4FZAB 2G1TA 4H39A 4U7ZA 3U6JA 3NVKI 4EHZA 2XUUA 5CVHA 2FYSA 3FV8A 3RBWA 4YU2A 4GG5A 3SA0A 2QG5A 4JBVA 4LRJA 1VYWA 2VTJA 2YEXA 2PVRA 3FYKX 3MVLA 4S2ZA 5BVWA 1ZY4A 4AG8A 3S00A 2ITPA 2VTNA 3BWFA 4NL0A 2B0QA 5KHWA 4NTTA 4XLIA 3R00A 3F3WA 1U5RA 5CYIA 3SV0A 3IO7A 3NYOA 2W1EA 1ZOHA 3TWJA 4K18A 5HGIA 2Y7JA 3PXQA 4AF3A 5K5XA 3VC4A 1Q8ZA 4IX3A 2C5YA 4YJNA 2WPAA 3Q60A 4KKHA 4C8BA 4F65A 5BPYA 4IDTA 4FG7A 4QMPA 5FP5A 4QYYA 4IQ6A 2JEDA 2R4BA 5D11A 3UVPA 4TWOA 4I6FA 3BYUA 4RIYB 3W32A 2W1HA 2QOOA 4USFA 2PVFA 3Q4TA 5A9UA 4X6QC 4GKIA 3IDBA 1JQHA 2BZJA 5JGAA 2C5OA 1V0BA 1E1VA 4WOVA 1X8BA 3VJOA 3FHIA 5FGKA 4NUSA 3LM5A 4HZSA 3FSKA 2ONLC 3Q96A 1IRKA 4RMZA 4O6EA 3BLHA 2GQGA 2UZLA 1V1KA 2G2IA 3VW8A 1IA8A 4FSQA 3WYXA 3VBVA 2B52A 2YM3A 4CD0A 5IH5A 4M69A 3P78A 3GP0A 3QHWA 4RPVA 4M7IA 4RVMA 5IQAA 4K77A 1Q61A 4YNEA 1Y57A 5HLWA 4FKVA 4XCUA 2YCRA 3F61A 3QZHA 5D9HA 4YLKA 4I4EA 4YTIA 4NSTA 3RI1A 2VU3A 1SM2A 1ZY5A 2R7BA 5F95A 3I6WA 5E1SA 2RKUA 2VGPA 4DE4A 4FVRA 4CFXA 3ZLSA 3MVJA 1Q8YA 4O91A 4EWHA 2YLFA 5LVMA 3A2CA 4PL3A 4BBFA 2XK4A 3UYTA 4TWPA 5CVFA 4IC8A 3LFBA 4CLJA 4FNXA 2QKWB 3PJ1A 5E92A 4RWKA 3QQJA 1Q99A 4DH7A 3R7YA 1V0OA 2JBPA 5IZFA 2WMSA 4RWJA 1YXVA 3LXKA 4FV7A 2E9VA 3MBLA 4MQ1A 2BAKA 4E6QA 4BZNA 4O1PA 5AP5A 4RIXA 4FKLA 2W9ZB 3KCKA 2IZRA 3NWWA 3BQRA 1T46A 1R78A 4PNIA 4FKOA 1BLXA 4YJVA 2HWPA 1AGWA 2J6MA 3ORPA 3R83A 2WMWA 5KMJA 4RG0A 4BKJA 2KULA 4PDYA 3PXFA 4IMYA 4J1RA 5CF8A 4IEBA 1CMKE 3I0QA 4ZSAA 4WG5A 2EUFB 2QOLA 3FQSA 4HYIA 3O8UA 3LPBA 3W33A 4XG6A 5E8XA 3UIUA 4ERKA 4I6HA 4HYUA 2R3FA 4D4RA 3WBLA 1RJBA 3FJQE 4X2KA 3PVBA 3HV3A 3MGYA 5IQEA 1JNKA 1UVRA 3F5UA 4X3FB 1IR3A 4CLIA 4KRCA 4FF8A 2OIQA 4FKUA 1SVGA 3TZ9A 2UVYA 5AUVA 3VAPA 4A9UA 5CXZA 1PMEA 2HZ0A 4S33A 3FL5A 2GDOA 3DFCB 4YSMA 3G9LX 2REIA 4FT7A 2LAVA 2OSCA 3KXZA 5BVNA 5JGBA 3ZHPC 2W7XA 4ZSLA 4J8MA 2CKPA 2XP2A 2YDJA 4U97A 3QL8A 1JKTA 1GZ8A 3BHVA 1PYEA 3NUUA 4JG7A 3O71A 4HGLA 3IDCA 5M4FA 1APME 4D2PA 5IQBA 5EM5A 2OXYA 3VRZA 3ZFYA 2QQ7A 2Z7SA 4KWPA 4YBJA 4FTNA 2QOCA 2A19B 2W4OA 1Q8WA 4FI1A 3DKGA 3QQHA 4UWYA 4I93A 4GS6A 5GHVA 4U79A 2XJ0A 3KRWA 5BYYA 4LI5A 1FMOE 4PX6A 3RGFA 4FX3A 5HESA 1M7QA 3IG7A 3TV6A 3C5IA 2PUUA 4M14A 2WU6A 4YZ9A 4FTAA 4JQ8A 2W4KA 4YHFA 4BTJA 5H8BA 4CSVA 4F0GA 5AV3A 2W1GA 5A4QA 5AUUA 5CENA 3QQUA 4YJPA 2C5NA 2CJMA 2J0IA 3GU4A 4TNDA 3ZUVA 3KREA 5EQYA 2J9MA 3NGAA 3P23A 1H0VA 3C9WA 4YTHA 4CT2A 4OAVB 4HZRA 3ZXTA 3QXPA 3GCQA 4FSNA 4EBVA 2WMUA 3TTJA 5F1ZA 3E87A 3MPAA 2IWIA 4Z7GA 2X9EA 4EOJA 2E2BA 5HQ0A 3A4PA 2X81A 5HD4A 1U54B 5DT0A 5AV1A 3ZRKA 2VRXA 3GCPA 4OTFA 4LUDA 3QQLA 2UZNA 5AMNA 5E91A 4AT5A 4C4HA 4ORKA 3F3TA 3JUHA 4DITA 4H1JA 4AOIA 4RJ6A 1FGIA 1UU9A 3ROYA 4H3BA 5KMKA 5M53A 5HZNA 3ZSHA 4P5ZA 2PMOX 1STCE 3NYXA 4U5JA 3I7BA 2YIXA 3IW6A 4I3ZA 1H4LA 3KA0A 2BDWA 2W5BA 2R3GA 4FTKA 3S4QA 2OGVA 5L6WL 2QD9A 4BRXA 4E7WA 2BKKA 3O8PA 3QQKA 3RVGA 2VTOA 2R0UA 3QRIA 4I4FA 4M13A 3V01A 3KRLA 4NM0A 1WBPA 4V0GB 2PE0A 5BMMA 4LOPA 4YJUA 3NX8A 1QPDA 3R1NA 4X0MA 1YDSE 2PZYA 2F7EE 3D5WA 2WO6A 2ZV9A 4U43A 4FV8A 5LVNA 3WZEA 2IG7A 3ODYX 3I6UA 3G5DA 4JL9A 4X6RA 1NVQA 3U9NA 4BC6A 2ETRA 3G9NA 2X7OA 5AR7A 4YUQA 5TOZA 4XH6A 3D5XA 1Q41A 5IUHA 5I9ZA 4JAJA 3VQUA 1LR4A 1ZYLA 4WBOA 1PXMA 2ZV8A 3PRFA 1WBTA 4ZTNA 4DT9A 2H96A 5J95A 3UC4A 2XKCA 3BHYA 3DOGA 3JYAA 3EMGA 4DYMA 4FMQA 4XV3A 3GCVA 1QMZA 1PHKA 5FP6A 5H9BA 3UC3A 5B2MA 3FY0A 4UMTA 2YITA 4J99A 4TW9A 2X4ZA 2UZBA 4OTDA 2WOTA 4MTAA 4YLJA 5T3QA 5A4LA 1Q3WA 3E7OA 3HNGA 3VS5A 1KV2A 3UO4A 3RPSA 2R0IA 4YZDA 5E1EA 2QOFA 4WNMA 3WF6A 2BMCA 3FSFA 1FGKA 4LUEA 4GFGA 1W84A 4OR5A 5FTOA 4XV9A 5JH6A 3PRIA 3K5UA 2J4ZA 5EHOA 4BCKA 3KVXA 5LWNA 4MNFA 3ENMA 4XHKB 3Q2JA 3PA5A 3RAKA 4GIHA 5F9EA 3F88A 3EFLA 3HA8A 4FOBA 3ANQA 1TQIA 3CE3A 3QZFA 4K9YA 4BDAA 5GZ8A 1OBDA 4R1VA 3DK7A 3GFWA 3ORTA 3D83A 3R9RA 4TTHB 4C3FA 5K9IA 3OXTA 5JZNA 3F7WA 2ITUA 4IJPA 2AUHA 3O0GA 5AJQA 4DEHA 1LEZA 2FSOX 5CZHA 4LG4A 4F9WA 2DS1A 3BLRA 4D9UA 2BZKB 4XUFA 2YHVA 2PMNX 4RFZA 4KKEA 3PXKA 2ITXA 5L8KA 4H36A 3ZM4A 4QO9A 3HRCA 5AR4A 3RPOA 3C0GA 1ZOGA 3CGOA 2IW6A 3WZJA 4IW0A 3ZOSA 4BB4A 4RC2A 4YJOA 3H9OA 4ANQA 2PE2A 3OS3A 4QYFA 4UN0C 4AT3A 3UIXA 5C8MA 4YPDA 3W2OA 3DQXA 3QKLA 4ITJA 3SC1A 4A7CA 4AT4A 4CFFA 4F08A 2VX0A 3BRBA 3CIKA 5B0XA 3VUTA 5AP6A 5JFXA 4NU1A 4ACMA 5FQDC 1VEBA 4DHFA 2BALA 1UKIA 3KN5A 4M97A 4OTWA 3S0OA 3T9TA 4JRNA 2H6DA 4FKRA 4AZSA 3H10A 3W8QA 2NPQA 4BGHA 5CS6A 4JXFA 5CASA 4XG3A 2W1FA 5IEXA 3FI3A 1Z5MA 5EOLA 3V8TA 4TN6A 3RK9A 4L43A 3ZONA 1FPUA 1H08A 5CT7A 2GFCA 4FUXA 3Q9WA 3L1SA 4D0XA 3GC8A 2CN5A 2XM8A 1R0PA 4ZOGA 3OC1A 3UP7A 1YXSA 1JBPE 2PL0A 2DUVA 4NJDA 3S2PA 3EFKA 4IWDA 2PVMA 3CP9A 1PXKA 1M14A 3EZVA 4QYEA 5FG8A 3E5AA 3VHKA 4F6SA 4MXAA 1WAKA 3GT8A 4EEVA 1G8AA 4NT4A 4FT9A 4O0WA 2X6DA 1DI9A 2A4LA 2BRNA 4PDOA 1YOMA 3TN8A 3C4WA 2CN8A 4JBPA 3ORIA 3W2QA 2ZM1A 3QD2B 4BBEA 3IS5A 4DGGA 3C4XA 4RT7A 4K2RA 3R7IA 4L7SA 3GU7A 1L3RE 4HPTE 2UZVA 2QLQA 3CTQA 3K3IA 5EKOA 3SG8A 5IQGA 4MEDA 4CFNA 3TJCA 1MRVA 3CPBA 4QMLA 2FGIA 4IWPA 2B4SB 4GMYA 2IVTA 4O0UA 3ELJA 4UMRA 4DEIA 4GK4A 3PIYA 5BMSA 4FG8A 4W9WA 3U9CA 5EG3A 5KO1A 3VF9A 3GXLA 4JDKA 1LEWA 3IW8A 4Y73A 3DY7A 3E88A 3BKBA 2RL5A 5K0XA 4MHAA 3IOPA 3BIZA 3G0EA 3LKMA 1TQMA 4IBMA 5HIBA 4PTCA 3C0IA 5C27A 4E1ZA 4NM7A 4RWIA 5ANJA 4O2ZA 4FKJA 1TKIA 4O6LA 3WIKA 1XWSA 4EZ5A 1E1XA 4OAUC 1OUYA 4OTIA 4R6VA 5CWZA 5DVRA 3Q4ZA 3EFJA 3B2WA 1NVRA 3FBVA 4D1ZA 2R9SA 2XH5A 4IAYA 4D2TA 3A8XA 2BR1A 4F4PA 5I9XA 3V3VA 4KUJA 3N4TA 3JY0A 3SDJA 4DEEA 1PMNA 4L9IA 4QMOA 3V5TA 2BPMA 1RDQE 2YA9A 5H8GA 4B9DA 5CEKA 5JRSA 5HIEA 3EQGA 2BTSA 4WG3A 5J7HA 4O7LA 3L9MA 1NVSA 3Q6WA 2CCIA 4ERWA 4L67A 4LM5A 1KV1A 4P2KA 2V5QA 2R7IA 5BVKA 2NNWB 2B53A 1QPEA 4L46A 3A7GA 3EQCA 3LFCA 3COHA 4IB3A 1OKWA 3D2IA 2CGXA 3VUIA 2UZWE 3GU5A 5EH0A 3BHHA 5I9YA 3G6HA 4TWNA 3MS9A 1ZZLA 4OUCA 4R7HA 3L8PA 4C34A 3K5VA 3POOA 4C7TA 5AUTA 1P5EA 5BUEA 2C1AA 2HY81 2JKMA 5AADA 4LV8A 4BYJA 3F2RA 3OWPA 4C62A 1OKZA 3TIZA 4BI2A 4CQGA 4QP7A 1GIIA 1OKYA 4ITHA 3ODZX 2JD5A 3OZ6A 4FTTA 5M56A 4WUAA 1KE7A 3KQ7A 2ZM4A 2BDFA 2WMVA 3HUBA 4RQKA 5E90A 4PUZA 4FNZA 5HBHA 4FL1A 1GOLA 4DEGA 4FTCA 4E3CA 5A54A 3KK9A 2X39A 5JRQA 4FEXA 3WILA 4GVJA 4ZS4A 3KXHA 2J0KA 4ALWA 3PVUA 5CY3A 2YAAA 4ZSJA 1T45A 1QPCA 3C4ZA 3NUXA 2ZDTA 4IB5A 4I94A 4QYHA 3BWJA 2C6DA 4DF3A 4QMNA 4DTKA 2C6LA 4RJ4A 3R2YA 3P5KA 4KBCA 3FMDA 2FUMA 1JLUE 4Q2AA 3TM0A 1ZYJA 3BI6A 3R1YA 3PG3A 3Q4UA 3JS2A 4WO5A 3SOAA 3MJ1A 5AV0A 3DZOA 1GZNA 3NS9A 4GH2A 4Z9LA 3BZ3A 3F82A 3LXNA 5EHLA 3HA6A 3OBGA 4ZEGA 4BTMA 5GZ9A 3L8XA 1Y6AA 2G01A 3TL8A 1JWHA 5CVGA 5D12A 3RPRA 5I5ZA 1A48A 1KE9A 4EOLA 5IQIA 4ZXTA 1MQBA 3KMWA 2F49A 4PTGA 2ITOA 3MFRA 4AN3A 3FLYA 3FPMA 2WMQA 3L8VA 4XYFA 4R77A 3HMOA 4BCQA 3VS2A 3P7BA 4FICA 5T68A 2JBOA 3AMBA 4BIDA 3FKNA 5F4NA 3W2RA 2WMXA 2WQBA 5CSPA 4QP8A 3UP2A 3FKLA 1QPJA 4NWMA 3W2CA 1J1CA 1LP4A 2PWLA 4L6QA 4ASZA 3LJ0A 2R3JA 4MBIA 4D2VA 4I0SA 5DE2A 5G1XA 4QMZA 2EVAA 5E8ZA 1OZ1A 4IDVA 4FNYA 3U4UA 2IJMA 5ICPA 2YABA 3FMKA 2IPXA 3PY1A 4ZJIA 3RCJA 4DFYA 2FSTX 4OBOA 1XH7A 4X2GA 4IC7A 2GS7A 5FM2A 3E8DA 1PMUA 3FI4A 2YIWA 4X21A 2BAQA 5EM7A 3SLSA 3V5PA 1OBGA 4BDJA 3AXWA 2X8IA 3MDYA 1OIYA 2XKEA 3H0YA 3KMMA 4NCTC 4QTCA 4AW5A 4EQCA 4BR3A 5CQUA 2CHLA 2XNBA 2YM5A 3QA0A 2VWXA 2WZJA 4Y5QA 5GJGA 4YZCA 3R8VA 2XMYA 2ONLA 4A4OA 3G90X 4I41A 3FXZA 2Y4IB 3IECA 5HOAA 4D1XA 4KB8A 2BIYA 5J1VA 3FUPA 5E8SA 4ZTRA 3R7GA 3TNWA 4UWBA 2IZTA 4PY1A 1XO2B 4DAWA 2JLDA 2VO3A 3OW3A 5IPJA 3SRVA 3BYMA 1FMKA 3QHRA 4J52A 4IWOA 5IDPA 5IUGA 3Q52A 4I22A 5M09A 4BY9E 2XEZA 2C6TA 3D5VA 4CZYB 3ZO2A 3NIZA 3P79A 3TEIA 4YC8A 3HGKA 3UZPA 4U81A 1PXLA 4UXQA 4BCJA 5I4NA 4YGAA 3CJFA 4UB7A 2I6LA 4CKJA 4M0ZA 2C6MA 5J9ZA 2JDVA 2QU6A 5AA8A 5LXMA 4RC4A 4Z16A 3UZTA 4JVGA 1YDRE 2OZOA 3O17A 4D4YA 1OL2A 1PJKA 4ANMA 3LLAA 1FVRA 1ZYCA 5AAEA 3TUDA 2UZDA 1ZRZA 2XK3A 5DFPA 3QAME 3OHTA 2ERZE 3F3UA 4J96A 2WQNA 5L2TA 5KE0A 3DKFA 4QP1A 4NIFB 4LGGA 4NM3A 1PMVA 3EN5A 2HW6A 4RIWA 2ZV7A 2KTYA 3K54A 3S1HA 3NUYA 4OGRA 3U54A 3R6XA 3PG1A 3DXQA 3UNKA 1IASA 3KEXA 2VWYA 4D5KA 1H1RA 4IVAA 3ORZA 5AX3A 4D2WA 2RGPA 3FHRA 4XJ0A 3QYWA 4J8NA 5FTQA 2QNJA 2BIKB 2O63A 4XS2A 1O6KA 3DJ6A 2C3KA 4PPCA 4E6CA 2BHEA 3ATTA 4IWQA 5EI2A 4B6LA 1OMWA 3MY1A 3OWKA 3R7VA 3FZ1A 4ACHA 2C5VA 3GI3A 4HJOA 3AT4A 3QC4A 4YJQA 3G15A 4RFMA 4B4LA 3QRKA 2VWWA 5DPVA 4RA4A 1XQZA 5LQFA 4WKQA 3RK5A 3OEZA 4NZWB 1OVEA 1PY5A 3CJGA 1Y8YA 3NUPA 3PFQA 5AM6A 4W9XA 3R8MA 3RINA 1GZKA 5L6PA 2XNEA 3Q3BA 3I79A 5AR2A 3HAVA 4C38A 4FSUA 2JIUA 4FZ7A 5CSVA 4FKGA 5M55A 4F0IA 4XBRA 3ZM9A 4TYJA 5A6OA 3RALA 1H28A 3JVSA 3C4CA 1G3NA 3SVVA 5AP7A 2ITNA 1UU8A 3VRYA 4FKWA 3CKXA 4ZY4A 3OCSA 4FV9A 4E5WA 3FI2A 4XRLA 5HX6A 2WOUA 2YCSA 5EM6A 5FUTA 5EQPA 3ZYAA 4UX9A 3QXOA 3TV7A 1ZLTA 2Z7QA 4Y8DA 2O3PA 5FM3A 2WU7A 4MX9A 4EC8A 3UG1A 2G2FA 3VUDA 1UNLA 3R1QA 1A9UA 4QP6A 2YZAA 4XOYA 4DEBA 3CKWA 3R9DA 1Y91A 4QD6A 3F2NA 3LCKA 4Z3VA 3NRMA 4C02A 2J90A 1CSNA 3O23A 2QO2A 2C30A 4BZDA 1E9HA 2X7FA 4QNYA 5JK3A 5BUIA 3ZDUA 4CCBA 4D2SA 4WRSA 3P7CA 3G6GA 4IAAA 3BBWA 1O6YA 5E8WA 3SOCA 4IVCA 5KNJA 3F5PA 2YAKA 2AYPA 3F5XA 3WZDA 5CU3A 2CKOA 3RPVA 2GPHA 3LLTA 3QLFA 4E73A 4F1MA 3VBTA 4O82A 3MV5A 3H4JA 3TNIA 2V55A 3LFSA 4IAFA 3PXYA 1MP8A 4GV1A 3TXOA 3ZO3A 2G15A 4YZBA 1Q97A 4GSBA 4KIKA 2UW0A 4QMQA 4LL0A 3E92A 3RM7A 4DLJA 2O64A 2I7QA 5H3QA 2BFYA 2BZHB 5LCJA 2J50A 4L53A 3SX9A 3VUMA 5HIDA 2OJFE 4O0SA 2X7GA 2XIXA 3W18A 4DH1A 4XLVA 2OIDA 3TKIA 5E8TA 4BFMA 5F94A 4HVIA 3CQUA 4Q5EA 1ZAOA 1H1QA 2ITQA 1BL6A 2P33A 2CNVA 2OICA 2OXXA 1JKKA 4GKHA 5JEBA 4IAIA 3UOLA 5BX0A 2RIOA 3E8NA 5FEEA 4C3PA 4U45A 4EH9A 3ZS5A 3HECA 4QT1A 5C8KA 3QWKA 5M4CA 5ACBC 2Z02A 2QO9A 4CFMA 4A9SA 5DOSA 4USDA 3D7TA 2VTRA 3DBEA 5AV4A 1UNHA 3PSCA 5AR5A 4CG9A 2WTJA 4L45A 4FODA 3W1FA 4JIKA 4GG7A 2F57A 2OJGA 5EW3A 1FBNA 4NYEA 3TG1A 5J5SA 2VNWA 4KS8A 4RC3A 2WEIA 2QI8A 2Z8CA 3NNVA 2C47A 3HUCA 3POZA 4DEDA 4N57A 3DDQA 3OD6X 2H8HA 2OU7A 4N70A 3CCNA 2HYYA 4U6RA 4YJRA 5BUJA 4O7YA 3REPA 3QX2A 4E93A 2J0MB 5DR2A 5CEQA 2J5EA 3COIA 1Y8GA 3QD4A 4E4NA 4AFJA 1VR2A 2X8EA 3KF4A 4JLCA 2E9NA 4B0GA 3UVRA 3LQ5A 2Y8OA 1UA2A 2IW8A 3UIMA 2ITYA 4I5HA 4E5BA 2CSNA 2HIWA 2ZJWA 4HPUE 4RRVA 2HZ4A 5FXQA 5JZJA 4FSZA 3ORLA 3FLSA 4EHEA 4O96A 4EL9A 2Z7RA 2GU8A 4E8AA 3NYNA 3OUKA 1AD5A 4B8MA 3UZRA 3GU8A 4YO4A 4FEQA 5CNOA 4BDDA 3EQIA 2FSMX 5EHYA 3KRXA 4WG4A 4HVDA 4YZMA 1P4OA 2X1NA 3AC8A 4PP7A 3PXZA 2PY3A 3NNXA 4XMOA 2PZPA 4QP2A 3D0EA 1UV5A 3I0OA 3DLSA 3PJ8A 3P7AA 4AX8A 4C0TA 3H9RA 4RX9A 5IG1A 5DEYA 3FYJX 2XNGA 3KY2A 4AA4A 2W0JA 2XK9A 4GK3A 3A4OX 5CU4A 3V6SA 4CTCA 1XJDA 3BV2A 1BI8A 4Y83A 4GUBA 1OI9A 1R1WA 2V62A 2VTAA 4U3YA 3R7OA 4EH8A 1DI8A 3TZMA 5CX9A 4X2NA 3T3VA 3WOWA 2PVKA 3A7JA 5CAQA 3OY3A 3PE2A 5HCXA 3PIZA 3LM0A 3FL4A 4HOKA 4J71A 3QU0A 3H0ZA 5LMAA 3UPXA 1UU3A 4FL2A 4K6ZA 2GTMA 3ACJA 4F99A 5IH4A 5D41A 2ZAZA 3PY3A 4IADA 4U9AA 5FEQA 3GCSA 1R0EA 4AXAA 3E93A 5CEPA 4MNEB 4F6WA 2R3QA 4BDBA 3CSVA 2CLQA 4Y46A 3SXFA 1YWNA 5TE0A 3SAYA 4O7NA 4J97A 1KOBA 4EH5A 2X6EA 5A4EA 4KNBA 4C35A 2WTVA 4L01A 1YXUA 3E7VA 5LMKA 3BU3A 2X2KA 2WEVA 3BQCA 2I0EA 3F9NA 4XP2A 4AWIA 3CTJA 3JR1A 2UVXA 4AZTA 1XH4A 2RFSA 3GVUA 2W06A 3C13A 5CI7A 4WNPA 4CFUA 2OKRA 5C1QB 2Y4PA 3ORXA 4GFMA 1XR1A 4DG0E 3DJ5A 3RPYA 2UV2A 5L6OA 4AGCA 1Q3DA 3OOMA 2SRCA 5HE1A 5L2QA 5I9VA 3QRUA 4BCIA 4O7VA 2A0CX 4JJRA 4KBKA 5AUZA 3DU8A 3FEGA 4I0TA 1P4FA 4LMNA 3LFFA 5I3RA 2JDRA 4QMSA 4EUTA 4RA5A 1BMKA 1KWPA 4CEGA 2IZUA 4CG8A 3ZLXA 3QTSA 3F7ZA 2YDKA 3DZQA 2PMIA 4I6BA 2QVSE 4WIHA 4RIYA 3ALOA 2YFXA 1BKXA 1IEPA 2BILB 2HXLA 4K8AA 4MD7E 3WIGA 4FA2A 3OTVA 3MWUA 3SQQA 3R01A 4TRLA 3MESA 2FSLX 2GNGA 2RFEA 2PPQA 2ITVA 2DYLA 3OCBA 5ANGA 2WQMA 4O0VA 4EK4A 3FXWA 4ZY5A 3I1AA 2HOGA 4HCTA 3PA4A 3VBWA 2Y4IC 4ID7A 2Q0NA 4ANBA 5IQHA 3BELA 3UTOA 3R7EA 3UGCA 5M51A 3QZGA 1YOLA 3SXRA 4EZ7A 5GIOE 4AN9A 2X2MA 2R3IA 3V5LA 2XZSA 2WTWA 4AFEA 5FXRA 4QQCA 5KMOA 5M08A 3LCTA 4O2PA 4C33A 5CALA 3QTQA 4G31A 4IZ5A 5J87A 5K0KA 4M67A 5JT2A 4ENYA 1TQPA 2YACA 4ZTHA 3R21A 4IZAA 3VBXA 2W9FB 3H30A 4AW1A 2WTDA 3R7UA 4EH7A 4I23A 3QWJA 2WMBA 1A06A 4DC2A 3FZTA 5IKWA 1OITA 2XNPA 3C4FA 2HK5A 3EH9A 4R3PA 3N4UA 4ZS0A 5C4LA 4KIQA 3SW4A 3KULB 4BCGA 2PZ5A 4PQNA 4EJ7A 3PY0A 4FV4A 5HNBA 3UOHA 4F7LA 5CU2A 2RFDA 5TT7A 4O83A 4I5MA 1XH9A 3MH1A 1H0WA 2RSVA 4YHJA 1WVXA 4NW6A 3V8WA 4HCUA 3DAEA 3GFEA 4RJ7A 2B9HA 2OJJA 4FZFB 5ANKA 3UMXA 5HVYA 2JFLA 2PSQA 3VWAA 3WE8A 5L8JA 1M17A 3R2BA 3AT3A 4GVAA 3R8PA 3BGPA 1Z9XA 4RBLA 3TNQB 3PSBA 3NW7A 2OH4A 2VTTA 3CC6A 2JKKA 5AV2A 4ACDA 1ZYSA 2NRYA 2OZAB 5ACKA 4CVAA 3LQ8A 1WBVA 2ZDUA 5BVOA 4B99A 2WIPA 4NKSA 4YP8A 2QO7A 4EOPA 3DNDA 1YRPA 4X3FA 5KZIA 4PMPA 2BRBA 2C68A 3U8WA 2VWUA 2HWOA 1OB3A 5IA1A 1UWJA 3AC4A 4XG7A 3ET7A 5CT0A 2IVVA 5GJFA 3EQPA 4IXPA 5LVOA 4FE2A 4FT0A 3P9JA 4NW5A 4E4MA 2WQOA 4LOQA 3I7CA 4NTSA 4M84A 3D5UA 3DB8A 4DFZE 2EU9A 4ZZOA 3MFTA 1XBCA 4KKGA 4G9CA 1WBWA 3EWHA 4HW7A 2R64A 1UKHA 4ZMEA 1J3HA 4NH1A 4RQVA 4EBWA 4F09A 2P4IA 2XJ2A 4Q9ZA 3BLQA 4HYSA 4XX9A 3PYYA 2XNNA 3UQCA 3ZH8A 2ACXA 4FTIA 4JG6A 1MUOA 2PULA 4RZVA 4BKZA 3CTHA 5HG8A 4EWQA 1F5QA 1EH4A 4FTJA 2WTKC 3CQEA 4FYOA 5AR8A 5ITAA 2YIYA 5EKNA 1KE8A 2GNFA 5BNJA 2PYWA 2C0IA 3A7FA 3EZRA 3WF8A 4FGBA 2ZV2A 3UVQA 4LRMA 3PVGA 1KOAA 3LOKA 3OT3A 4GL9A 4S32A 4AQCA 3TDWA 3LFDA 3RHKA 5HO8A 5IA5A 1MQ4A 3Q32A 5DR9A 1CKJA 2XM9A 2BUJA 4BDFA 4N0SA 2IO6A 4O0RA 3UMWA 4CMOA 2PHKA 2ITWA 4DEAA 5AP4A 2V0DA 3PJ2A 1YQJA 5I0BA 5JFWA 3QKKA 4DGMA 3ZUTA 3VIDA 4H58A 2JDOA 4YPSA 1OKVA 3VUGA 3ZLYA 4YSJA 4NCTA 2DWBA 4YC3A 3FPQA 1U54A 3LFQA 3QQFA 4L3LA 4TYHB 3QTRA 3P86A 2Y6OA 1FOTA 1K2PA 5KMMA 3MB7A 4Q9SA 4QMUA 3U6IA 5IA0A 1JSTA 2QOBA 4G34A 3BU6A 3CGFA 1WVWA 1ZMWA 3E64A 4MXCA 4KD1A 5D7VA 5EFQA 4MH7A 3DTCA 1VJYA 3AGMA 4JX3A 1I44A 3RNYA 4EZ3A 3NUAA 2WMRA 4EOKA 3B2TA 2WMTA 4MK0A 1PXIA 5HG5A 5EW8A 5A4CA 2B9IA 4F1OA 3PXRA 2V7AA 4V0GA 3ZC6A 4AGUA 4IACA 3UQFA 3F69A 3V5WA 3KMUA 2YM7A 3GC9A 5AP2A 4L3JA 4RVKA 4D5HA 4TZRA 3AGLA 5JSMA 2HXQA 4JS8A 5L2IA 2QCSA 4CZUA 1NW1A 3BEGA 4R5YA 3MY0A 4FT5A 2JKOA 2RG6A 2YISA 4S30A 4CT1A 4FGRA 2HZIA 3ID6C 4A07A 1M7NA 1OIUA 4FV0A 5FEDA 1XH8A 4B8LA 5AUWA 4NFMA 3NR9A 2C6OA 2X9FA 1DAYA 4FIIA 3JY9A 5AIKA 4DN5A 4EH2A 3DT1A 4AGDA 2WAJA 2WTIA 3UIBA 1O9UA 1DS5A 2BRGA 3FC1X 4ASEA 3QD0A 4O86A 3VHEA 3F66A 4QP4A 4F1TA 3QCXA 2VX3A 3M2WA 5EK7A 5D7AA 4QPMA 2EXMA 4RX7A 4U41A 3FI8A 3DLZA 1H24A 5LARA 4BCOA 5H2UA 3TT0A 5IQFA 3ULIA 2OI4X 2UW5A 2PU8A 3PA3A 4TPTA 3TJDA 3NMUF 3A99A 2CGUA 2R3OA 1YI6A 2B54A 1OPLA 4HNFA 5FWKK 1YVJA 5IA2A 4ZTLA 3HRBA 4MBLA 2J2IB 4GU9A 4EH4A 5JKGA 4RLLA 1CDKA 5J9LA 3Q5ZA 1B39A 1W98A 3QF9A 1GJOA 4RLKA 2UVZA 1YKRA 3DV3A 3OFMA 4EOIA 1GIJA 4BDKA 3NUSA 3BPRA 3M1SA 1MRYA 4FEVA 2OF2A 3NDMA 3ORMA 4QYGA 2C0OA 3PIXA 3QKMA 5EDQA 2GNHA 3UDBA 3ZU7A 4A9YA 1MRUA 3RTPA 2XYUA 3TZ8A 2OJ9A 3GC7A 4C37A 4A9TA 3DAJA 4IX4A 2UW4A 3HV5A 3C7QA 4LQMA 3EN6A 4NEUA 5DRBA 1Q62A 4D9TA 2YWVA 2XK7A 3E3PA 3EB0A 4EK5A 4HCVA 3UPZA 2QG7A 1Q5KA 2BCJA 4JNWA 4U0IA 4UBAA 3T9IA 3DFAA 5LVLA 3VBYA 4BWXA 1J7UA 4N6ZA 2QR8A 3V8SA 4KS7A 1PYXA 1G8SA 4G3DA 4APPA 4PF4A 3T8OA 3BE2A 2EXEA 2Y6MA 4IJ9A 4S31A 4ANSA 5J79A 3FMLA 4BBMA 4PTEA 3P4KA 2Z60A 4WRGA 3A62A 3ETAA 4DBNA 1H1WA 2XNOA 4HYHA 3HX4A 5HLPA 5B2LA 1PXNA 4YTCA 1REJA 2QR7A 4IZYA 4J7BA 4P90A 4R3RA 2JDSA 2YM4A 4GFOA 1H00A 4QQ5A 4W4WA 5KHXA 4L44A 1OL7A 3ITZA 4CYJA 4E26A 2EWAA 2UW9A 2XIRA 4I21A 4FIEA 3ZDIA 2UZTA 3H3CA 3TCPA 4JAIA 4F9YA 3Q04A 3CS9A 4FIFA 4BI1A 3BX5A 3SHEA 5I9WA 4G9RA 4QP3A 2IVSA 3D9VA 4DTAA 3NSZA 2QOIA 3VNTA 4AZEA 1H1SA 4E20A 2W99B 2H34A 5E8VA 4BI0A 3OUNB 1OPKA 2BROA 2RG5A 4FTMA 1JPAA 5ANIA 3GUBA 2OK1A 4DG2E 4DTBA 1W0XC 2UZEA 2AC3A 5D10A 4BICA 5JQ5A 5IMXA 3I60A 5JN2A 1NT2A 1RE8A 4C2WA 3ATSA 4O21A 2P3GX 2PMLX 3BYSA 5D1JA 3FLWA 1HCKA 2CLXA 3ZZEA 4BTKA 2UW6A 4E6AA 4YTFA 4JQ7A 5J1WA 2R2PA 2VNYA 3FE3A 4I0RA 3QZIA 4JX7A 4BGQA 2W1IA 2OLCA 5KZ0A 4AU8A 2F4JA 1L8TA 1WFCA 2QONA 4RFYA 4PMTA 4C4GA 3UOKA 3ZTXA 1ZXEA 3LIJA 4DFUA 1H27A 3AG9A 3TNPC 3QRJA 4WD5A 3QBNA 2VTPA 4RIOA 4CKRA 3PWDA 4J98A 1GZOA 3D14A 3OY1A 3PJ3A 2GSFA 3Q4CA 3ZUUA 4AGWA 2G2HA 2WIHA 4F7SA 1H25A 5BQ0A 4M12A 1OPJA 3KL8A 3IK3A 4U3ZA 4FV1A 2ZYBA 3DNEA 3EN7A 2VTSA 4QPAA 2HW7A 2R3RA 3EHAA 3BGZA 4XG8A 5E9EA 2JKQA 4BCPA 3CY3A 3IW4A 4C4EA 5GZAA 4O7RA 2C1BA 2C6IA 4I5CA 3SXSA 1OECA 4HGSA 2GHGA 3OMVA 2PUPA 5C01A 2UW3A 5HTIA 1XHAA 2HELA 3U55A 4QNAA 3PLAE 4CNHA 3HZTA 5ETCA 4M69B 5DMZA 5HKMA 5I3OA 3OF0A 2FA2A 5CAVA 3OXIA 4Y72A 3BYVA 2PE1A 3RP9A 3PPZA 3BGQA 4FKTA 3HL7A 3MPMA 1FVVA 3I5ZA 4F64A 4N6YA 3MI9A 2OJIA 4TYIA 1P2AA 3NNUA 4EOOA 4IHPA 4PNKA 5AM7A 4RVTA 4M15A 1P14A 2CNQA 4G6LA 1UU7A 3TUBA 5M4IA 3LCDA 3TUCA 1U5QA 3JVRA 4L00A 5AX9A 2W5HA 2QU5A 2PUIA 2XBAA 2CPKE 4Y85A 4F7NA 3W16A 5TF9A 2CMWA 4MXXA 2OWBA 1G5SA 2VWIA 3DBFA 1LPUA 1YI4A 2HCKA 3AC5A 1OM1A 4F0FA 3HDMA 4G1WA 3NAYA 2R3PA 2X8DA 3UE4A 3CD8A 3M42A 4BN1A 2BAJA 4YJSA 4OTRA 2XYNA 3FMMA 5K3YA 4G3EA 3BHUA 4EK6A 4I24A 4RIXB 2EB3A 3R8ZA 3BE9A 4K0YA 3IDPA 4F63A 4TKSA 3RNIA 5FD2A 4NM5A 3RJCA 4W4VA 2BFXA 2I0YA 5A4TA 3U51A 5DEWA 4ZZMA 4IZ7A 4JOAA 4BDEA 1K3AA 4AAAA 5K5NA 5LVPA 5ETFA 3ZCLA 3MW1A 5HTBA 1H1PA 3COKA 5EDPA 1NXKA 3I81A 1BI7A 4C36A 2JIIA 4YJTA 2B55A 2PVYA 3DAKA 3SW7A 5B2KA 4QTBA 4IB0A 4U8ZA 3PUPA 4EOQA 3DKCA 3MH0A 2R5TA 3R22A 5HG9A 3O7LB 4CXAA 3R1SA 1AQ1A 3IW7A 4I6QA 2O2UA 2YCFA 4X3JA 5E7RA 4FEUA 4MVFA 3VULA 2YDIA 3QLGA 4RWLA 2JDTA 3QUPA 4MWIA 4D4VA 4KIOA 4MD8E 2V7OA 4QMVA 5AP1A 3UG2A 3ROCA 2B7AA 4ACCA 3BCEA 2UZUE 2BZIB 4A9RA 2BKZA 4FEWA 2P2IA 2DQ7X 4DFLA 4DBXA 1PXJA 1QL6A 2WTKB 5AA9A 3QGYA 4MXYA 4II5A 4EI4A 2QOKA 3EKKA 3PPJA 5CU6A 3L9PA 4BIBA 3MJ2A 4G3CA 1J7LA 4UEUA 4RJ8A 2YCQA 1GAGA 1YHWA 1CM8A 4G3FA 2XK6A 1YDTE 2VTIA 2GNIA 4C4IA 4BHZA 1PKGA 4ZTMA 5IISA 4GEOA 5EYKA 1JVPP 4GYIA 4O1OA 4YZNA 3R63A 4ZP5A 4IX5A 5IQDA 4KBAA 4O84A 3WZUA 4OBPA 1GIHA 1I09A 4S34A 4XNEA 5HG7A 3LW0A 4F7JA 2O5KA 4FTQA 3VS0A 2OBJA 5FBOA 3TNHA 3W2PA 4C61A 4R7IA 4XOZA 1WZYA 3HV7A 5CEOA 3FZOA 4DA5A 2WTCA 3R71A 2Z2WA 3TI1A 4BYIA 3P1AA 2QOHA 2R3HA 3VO3A 3FQHA 1XBAA 3RCDA 3RMFA 1URWA 5BYLA 5KKRC 2CGWA 2JGZA 4H3PA 2O0UA 4RGJA 3OROA 3QCQA 3AMAA 4C59A 3ZSIA 2VTLA 3MA6A 4WSYA 1H07A 5LOHA 4QTDA 3UYSA 3BV3A 1S9IA 3KK8A 3PTGA 5AP3A 4NJ3A 4MQ2A 4TY1A 2WB8A 1PXPA 4BDIA 4A4LA 5CSWA 2UZOA 3D15A 3KB7A 3L9LA 5EYMA 3UODA 2C0TA 4DH8A 4C4FA 4TNBA 3E62A 4JI9A 4EH3A 3LMGA 1KE5A 4FT3A 3AC1A 4IM3A 4ZTSA 5HCZA 1VYZA 3EKNA 3ZLWA 1HCLA 3PDTA 1ZMUA 5J9YA 2BRMA 3D94A 2CDZA 2YN8A 3TACA 3ACKA 3Q6UA 4YO6A 1JKSA 3ZEWA 3TTIA 5K4IA 5E8UA 1H26A 4ZTQA 3EQDA 3OWJA 3LQ3A 3HMIA 2GHLA 4KSQA 4BCFA 3PJCA 2VO6A 3MH2A 1OL5A 2OFUA 3TZ7A 2P55A 1YOJA 3HMMA 3RZFA 1ZOEA 3T3UA 3K2LA 4YHTA 4OTHA 2VTQA 3OXZA 4CFWA 2Y9QA 5TKDA 2A2AA 3AC2A 4JG8A 5KBQA 1JKLA 3C0HA 3KFAA 3L9NA 3O8TA 1YWVA 3VN9A 4EORA 4UY9A 4FTRA 3AD5A 2HY0A 2JITA 4GRBA 2OH0E 3LHJA 4P7EA 4IANA 5HVJA 3SD0A 3V5QA 2PUNA 5AIRA 4HGEA 2XJ1A 4O7ZA 5JFVA 4L68A 1U4DA 4ALVA 5IEYA 3EN4A 4FNWA 4CMTA 4LV5A 2XKFA 4BDHA 4NIFA 3NZ0A 4L7FA 1J91A 3QD3A 4XG2A 4OTGA 3VS4A 1Q24A 3EL7A 2OF4A 4XV1A 3W8LA 4D28A 2GQSA 4FK6A 4D55A 3PZEA 5L8LA 3F2AA 2UW8A 3OEFX 2ETKA 5CANA 3FWQA 3PE1A 2RFNA 3NVMB 1ZZ2A 3DJ7A 4EKKA 3ORKA 4FTOA 1J7IA 3BU5A 3FZRA 3GQLA 1REKA 2GNLA 2YM6A 4XEYA 4CV8A 3ZSGA 4EK3A 3QTWA 4C2VA 4ACGA 3LJ1A 5CI6A 4DGLC 5CXHA 4QQJA 4EKLA 5DT4A 3VUKA 4BZOA 2GCDA 3A7IA 2UW7A 3NLBA 2GFSA 4CQEA 1JAMA 4LGHA 3ZFXA 5I9UA 3FMEA 3NW5A 4C4JA 2V22A 2VWZA 2OIBA 3FMHA 3OW4A 4LYNA 4AZVA 5C8NA 1OL1A 2HENA 4QMXA 3A8WA 5IEVA 1M2QA 4GCJA 2B9FA 3VVHA 3Q9ZA 3RAWA 5KX8A 5DYJA 3NNWA 5L4QA 2PVJA 1J1BA 1JSUA 2O65A 1WCCA 3MIAA 2PZIA 1WVYA 2YIQA 4WNKA 3R9OA 4CYIA 3V51A 3LCOA 4MCVA 3N4VA 3G2FA 3HRFA 3O50A 2Q0BA 1CKPA 4O81A 1QCFA 5EM8A 3TKUA 5B7VA 5HE3A 3F3VA 2BHHA 1O6LA 3GNIB 4YURA 3QUEA 4R7BA 3ENHA 1Q4LA 3EL8A 3ERKA 5DA3A 3C5UA 4APCA 1YHSA 3GCUA 3GOKA 4AUAA 5FDXA 1M2RA 1ZWSA 2ETMA 4QQTA 5IA4A 2PVHA 4YBKA 3KN6A 1PRYA 2BRHA 5HORA 5LMBA 5M4UA 4CRSA 1SZMA 3FAAA 1YXXA 4EYJA 3QC9A 3AT2A 4Y5HA 5M07A 3GENA 4MXOA 2Q83A 5L2WA 5DT3A 1DM2A 1YHVA 4FTUA 3FXXA 3NCGA 4FV6A 1PW2A 3K3JA 3SKCA 5DHJA 3UO5A 1IA9A 1LUFA 4HNIA 4UV0A 4YR8A 4QOXA 4U44A 1H8FA 2XBJA 5IH6A 4OT6A 5EI6A 1M2PA 4IIRA 2CCHA 4LL5A 2Y0AA 3Q9YA 4MKCA 4OW8A 2YJRA 3HVCA 4USEA 3HMNA 4LOOA 3L8SA 2C4GA 2VWBA 3DBDA 3HP2A 2IVUA 2C6KA 2ZOQA 5IMEA 2F2CB 5DR6A 1YI3A 4D2RA 4DLIA 3AD6A 2NO3A 3LVPA 1B6CB 4AW0A 3H9FA 4UMQA 3BHTA 2C6EA 4ZAUA 3IGOA 3LXPA 5HTCA 3HMPA 3QA8A 4I92A 4H3QA 2YWPA 5IDNA 4PL4A 4M0YA 2W96B 5ANOA 4UALA 3MVHA 3OTUA 5FRIA 3QTXA 3I5NA 3VF8A 4AE9A 5J5TA 3WE4A 5AR3A 1GNGA 3O2MA 4PP9A 3GU6A 5HHWA 5DI1A 3DGKA 3BBTB 2QLUA 4GT4A 4OTQA 1W8CA 4AP7A 4EC9A 3RAHA 2XRWA 4WBBB 3KXNA 4IFGA 4ASDA 5HEZA 1OIRA 5LCKA 2W05A 1V0PA 4MXZA 3ZO4A 2ITZA 3WF7A 1GY3A 2GS6A 3HEGA 5M57A 5C03A 4AW2A 5FDPA 4AN2A 5HO7A 2QHMA 1B38A 3AOXA 4F9CA 3C50A 3RWQA 3UNZA 3NIEA 4BF2A 3R30A 5ANEA 2GHMA 2ZMDA 3NUNA 3FZPA 3OOGA 4UZHA 5TR6A 3MA3A 4ALUA 4UMUA 5JQ8A 4ANLA 2VTMA 4IAKA 4G17A 4PWNA 4CCUA 2LGCA 5CF4A 2XEYA 5DG5A 4ZSGA 2W1ZA 3V6RA 5L2SA 4FBXA 2WHBA 2WGJA 4BGGA 5E4HA 5HE2A 5KMLA 4KA3A 4FIJA 4DGNA 2OFVA 3HV4A 3R04A 5CZIA 3ZEPA 4KRDA 3KCFA 3MVMA 2I0HA 4FSTA 3D4QA 4GUEA 1Y6BA 4CGAA 2YERA 4E5AX 4IM2A 4N4SA 4F9AA 4MWHA 2X2LA 4PRJA 5CQWA 4JR7A 3EQFA 2BDJA 4XP3A 1VZOA 3IW5A 3RK7A 4ARKA 3EQRA 3MFSA 4RZWA 4XG4A 3U87A 1ZARA 3QQGA 2FVDA 4ZJJA 3E8CA 2XIYA 4FZDB 5A3XA 4E6DA 3ZBXA 4PPBA 4YLLA 4G5PA 5HO6A 4MF1A 5LJJA 4AA5A 3PLSA 3U6HA 2XRUA 2W1CA 3VUHA 2E9PA 4GIIA 4ZLYA 2XA4A 1H01A 2QHNA 3DK6A 3G51A 4UXLA 2G9XA 5EYDA 1PF8A 5HNIX 1Z57A 3HYHA 1SMHA 2P0CA 2CGVA 4DH3A 5CAUA 3NAXA 1HOWA 3EQBA 1XBBA 1ZMVA 3FZSA 3RAIA 1KE6A 5FLFA 4KAOA 4Y95A 5ANDA 3CQWA 3KXGA 5CAPA 3GC0A 4XG9A 5M06A 4O0XA 3CR0A 3MPTA 2PTKA 4BHNA 3WZKA 3LMIA 2R3KA 2WQEA 4EOSA 5BVDA 2F2UA 3LFNA 4R8QA 1IG1A
chains in the Genus database with same CATH superfamily
2VWVA 3WI6A 4BWKA 4DCEA 2YZLA 1KUTA 4R5SA 4AOTA 5ETAA 2F9GA 3ANRA 5L3AA 4G6NA 3QTZA 4L42A 3A60A 3BYOA 3R28A 2GQRA 4A06A 5EQEA 3U4WA 4XBUA 4MNEA 4Z7HA 1UWHA 2CKEA 2JFMA 2NRUA 3WF5A 4AOJA 2C3JA 4FV3A 1RW8A 4GK2A 3ULZA 3LJ2A 3WYYA 3DK3A 1SNUA 3O51A 4O7TA 3DA6A 4DCAA 3NW6A 2CKQA 3AQVA 5CTPA 3JPVA 3VS1A 3QFVA 4J95A 2OXDA 5HCYA 5HU3A 2J0LA 4TL0A 4AACA 2GS2A 2JAMA 4RSSA 4MD9E 4TWCA 4X2JA 2PZRA 4ZSEA 3DS6A 3KRJA 3E3BX 3TDVA 4JDHA 3O7LD 4L8MA 2JIVA 5KCVA 1ND4A 1F0QA 5KKRB 3UO6A 4GT5A 4FSRA 4D4SA 5GJDA 4DINA 4AZWA 4RX8A 5ETIA 4FKPA 3DDPA 3VS7A 2C3IB 2R3LA 3EQHA 5LMKC 1SYKA 5AWMA 5K4JA 2XK8A 4LGDA 4UYNA 5CAOA 2FO0A 3G0FA 4R3CA 4GT3A 2XNMA 4ZJVA 3DXPA 5DN3A 4AS0A 4BWPA 3OBJA 3FLZA 4EYMA 4F70A 2QKRA 2RF9A 4DFXE 3D2KA 2WD1A 1UNGA 3DCVA 3UBDA 5AUXA 4TYGA 3D7ZA 3OG7A 4ANNA 5AAFA 2J51A 4FG9A 2BVAA 3LZBA 2VX1A 4I20A 3EJ1A 3KF7A 4BL1A 2W1DA 2W4JA 4IH8A 3WF9A 4MBJA 3COMA 3VS6A 3EN9A 2ITTA 2ZMCA 3OVVA 3OT8A 4FV2A 4JQEA 1SVEA 3N9XA 5GNKA 3IPHA 1DAWA 1W82A 1RQQA 2YJSA 5G6VA 4W8EA 4UMPA 4EONA 1Q8TA 4KABA 4AE6A 4P5QA 4R1YA 1F3MC 2I40A 2OG8A 2ZVAA 5TO8A 3ZO1A 2FH9A 5FXSA 4JT3A 4ZY6A 4FSWA 3SRVB 3W2SA 5CSHA 5HNGA 2NP8A 2VUWA 4EHVA 3JXWA 5BVFA 3KULA 2XIZA 3MTFA 1W7HA 4IE9A 1BX6A 5FTGA 4JDIA 5DRDA 4JBQA 4HVSA 2HAKA 2AC5A 3KC3A 3KU2A 1G8JA 1ZYDA 4EQUA 3UNJA 4JRVA 4FSYA 3Q53A 4BVUA 3DBCA 4K11A 2VN9A 4CTBA 4QTEA 3FQEA 4LMUA 4Z55A 2WFYA 4M3QA 3QX4A 3Q2MA 4IB1A 3VJNA 3N51A 4GJ3A 4NK9A 4FV5A 4G3GA 4U42A 5EI8A 3LAUA 5H8EA 2XB7A 3DQWA 5HICA 4E4LA 3GQIA 3SGCA 3NPCA 4V05A 4IVBA 4WUNA 1OL6A 1CTPE 3IONA 5IQCA 5HI2A 2X4FA 2C3LA 3CY2A 5A14A 2ZM3A 3I4BA 3ALNA 2BTRA 3MTLA 4GU6A 2OZAA 1OUKA 4RVLA 4YC6A 2WMAA 4RIWB 2QC6A 3LE6A 4OTPA 4JR3A 1FINA 2B9JA 3QTIA 4G6OA 1WMKA 3F5GA 3QYZA 4G5JA 2EB2A 3KXMA 4CKIA 4WA9A 3C51A 1TFFA 1PKDA 5AUYA 4M66A 2XVDA 5HBJA 3DKOA 2I1MA 2WXVA 3G33A 2ESMA 3OCGA 3RWPA 4O7WA 3QTUA 4G16A 5T6KA 2A27A 4KIPA 4BIEA 4ZLOA 3R73A 2VZ6A 3GGFA 5J7BA 3C1XA 4M68A 3OCTA 4QP9A 1U46A 5HD7A 2GTNA 4DHIB 2YLEA 4MF0A 3R9HA 3QRTA 3ORNA 4QPSA 2CNUA 1BUHA 4UZDA 3GEQA 3FMNA 4FR4A 4TT7A 4A4XA 3MYGA 3QGWA 3W55A 4ONAA 3FLNC 2I0VA 2R3MA 3E8EA 2FB8A 1SVHA 1BL7A 2HZNA 5C26A 3MFUA 4QRCA 4X7QA 2B1PA 3VBQA 2VGOA 4O0YA 4WHZA 4DFBA 4X3FC 3F3ZA 1TVOA 4PMSA 5LWMA 3WARA 2W5AA 2E9OA 1R3CA 4LV7A 2WELA 4W4YA 1KSWA 4WNOA 3RZBA 3IQ7A 4O27B 4EJNA 3FKOA 3MH3A 4FYNA 1FQ1B 4FIGA 4EUUA 3OP5A 3PVWA 4QMMA 3NFFB 3PZHA 4V04A 3CLYA 4FC0A 5F20A 4BTFA 4EOMA 5CF5A 3LMHA 4U80A 5DWRA 5KMIA 3RM6A 2WNTA 3AC3A 3FLQA 3NEWA 3R02A 2YM8A 4FK3A 3CD3A 4FKQA 4R78A 3LFAA 4I1ZA 4CZTA 4NKAA 3IOKA 3O96A 4O22A 4HVGA 3HV6A 4AZFA 3TIYA 2X0GA 3TV4A 1WBNA 4ENXA 2XCHA 3EIDA 3NYVA 2C69A 3QUDA 3ZBFA 5FBNC 4V01A 3FMJA 4C3RA 4EK8A 4TYHA 2QURA 4NFNA 3R0TA 4Q5HA 3W10A 3LXLA 4FKIA 3QCYA 2XS0A 2IZSA 2PVLA 3R8LA 2VTHA 1URCA 1ERKA 4BCNA 3CPCA 1ATPE 2WKMA 3KVWA 4GYGA 4F6UA 1YXTA 5DBXA 5HU9A 5C9CA 4ANOA 2ZB1A 4GJ2A 3ZMMA 3KRRA 5CEMA 4MYGA 2PVNA 3FY2A 4P4CA 5J8IA 4ZK5A 3UJGA 3LFEA 3UQGA 3V5JA 4OBQA 2IN6A 2X0PA 3MY5A 3B8QA 4HGTA 4TXCA 3MIYA 2OO8X 1YW2A 3A7HA 4IFCA 4PDSA 4L52A 4PV0A 2E9UA 3GBZA 4IM0A 3DPKA 3S3IA 2JC6A 2XF0A 3ZFMA 4RJ5A 5AFVA 4KIKB 3AD4A 4G2FA 4JBOA 1U59A 2QODA 2J0JA 3KGAA 4BCHA 1W83A 1XH5A 3HP5A 4GW8A 5C4KA 2O8YA 4D0WA 1WBSA 4XP0A 2H9VA 3CBLA 3II5A 4OT5A 4W4XA 1OGUA 4WT6A 4DFNA 3HAMA 4YNOA 3DXNA 5CLPA 4L3PA 4O7SA 1YWRA 5HE0A 2ZB0A 2ERKA 4K1BA 2QOQA 3RKBA 3THBA 3ZZWA 4HVHA 5AEPA 4QMWA 1IAJA 4KINA 4PMMA 3FDNA 2GMXA 5IF1A 3PP0A 5DH3A 3EFWA 4U40A 3EYHA 5EOBA 3FC2A 4BCMA 3Q9XA 1XKKA 4RJ3A 4E4XA 3C4EA 3F6XA 2J5FA 2PK9A 3KKVA 4FKSA 1JOWB 3NCZA 4QMTA 3D7TB 3MB6A 5CF6A 5HLNA 4QMYA 4ZMFA 5KUPA 2EXCX 5BVEA 4FZ6A 3QALE 4ITIA 4B7TA 5KMNA 3HLLA 3VW6A 4RX5A 4DH5A 5JMSA 1IAHA 3BEAA 5GIPE 5JGDA 4FL3A 4KSPA 3AMYA 3VS3A 1NY3A 3B8RA 3QCSA 1Q8UA 5KBRA 5AAGA 3Q5IA 2F7XE 3LCSA 5AP0A 1BYGA 3ZRLA 4C57A 4ZLZA 3HDNA 5JFSA 3GB2A 3CXWA 1JSVA 5EYCA 4D1SA 4CRLA 2VD5A 4K33A 2VAGA 2Z7LA 4M8TA 4UYAA 3R8UA 4F9BA 5CU0A 2JAVA 5HBEA 3DB6A 4FVPA 1SNXA 4IX6A 4O38A 3MSSA 3GOPA 3PPKA 5CNNA 4BKYA 3KXXA 3A61A 4D58A 4JDJA 1WBOA 5DNRA 3RHXA 1XH6A 4YMJA 1OIQA 4EH6A 2J7TA 4PPAA 4DT8A 4J53A 4EHGA 3UOJA 1NA7A 2XIKA 5A46A 2YIRA 3DBQA 4GKIA 4OLIA 2GNJA 5CSXA 3EOCA 5E8YA 1M52A 3M11A 3VQHA 2W17A 3PWYA 2VV9A 4I5PA 5DGZA 5BYZA 5IA3A 4DDGA 4O0TA 4DG3E 5HX8A 2VO7A 4FIHA 5IU2A 3V04A 5DIAA 2F7ZE 5DLSA 3E63A 4ZZNA 4QTAA 1S9JA 4CFVA 4ASXA 4H1MA 3S95A 4H05A 3MN3A 5GINE 5EW9A 3TKHA 3IGGA 3CEKA 2XKDA 3IKAA 3ZRMA 2UUEA 1PXOA 4ZIMA 4CV9A 3DTWA 5IUIA 4C58A 4XRJA 5M44A 3W0NA 4W8DA 1FVTA 5EDRA 3R9NA 2XCKA 2C5XA 4MAOA 4TYEA 4BDCA 4FSMA 5HVKA 3P08A 5CEIA 4AA0A 1XMMA 4PDPA 4FUYA 4LFIA 2IW9A 4BDGA 4WSQA 2R3NA 3ZXZA 1R39A 4FTLA 4IAZA 2VO0A 3PP1A 3PSDA 1K9AA 3ZC5A 4JIAA 3SG9A 4EQMA 2OW3A 4FOCA 4PL5A 4CMUA 5A6NA 3P0MA 4IVDA 4UWCA 4X2FA 4FVQA 4LRKA 3HKOA 4DGOA 3EYGA 4XV2A 3OWLA 2A1AB 1CKIA 2P2HA 4FZAB 2G1TA 4H39A 4U7ZA 3U6JA 3NVKI 4EHZA 2XUUA 5CVHA 2FYSA 3FV8A 3RBWA 4YU2A 4GG5A 3SA0A 2QG5A 4JBVA 4LRJA 1VYWA 2VTJA 2IEWA 2YEXA 2PVRA 3FYKX 3MVLA 4S2ZA 5BVWA 1ZY4A 4AG8A 3S00A 2ITPA 2VTNA 3BWFA 4NL0A 2B0QA 5KHWA 4NTTA 4XLIA 3R00A 3F3WA 1U5RA 5CYIA 3SV0A 3IO7A 3NYOA 2W1EA 1ZOHA 3TWJA 4K18A 5HGIA 2Y7JA 3PXQA 4AF3A 5K5XA 3VC4A 1Q8ZA 4IX3A 2C5YA 4YJNA 2WPAA 3Q60A 4KKHA 4C8BA 4F65A 5BPYA 4IDTA 4FG7A 4QMPA 5FP5A 4QYYA 4IQ6A 2JEDA 2R4BA 5D11A 3UVPA 4TWOA 4I6FA 3BYUA 4RIYB 3W32A 2W1HA 2QOOA 4USFA 2PVFA 3Q4TA 5A9UA 4X6QC 3NFGB 3IDBA 1JQHA 2BZJA 5JGAA 2C5OA 1V0BA 1E1VA 4WOVA 1X8BA 3VJOA 3FHIA 5FGKA 4AXDA 4NUSA 3LM5A 4HZSA 3P5JC 3FSKA 2ONLC 3Q96A 1IRKA 4RMZA 4O6EA 3BLHA 2GQGA 2UZLA 1V1KA 2G2IA 3VW8A 1IA8A 4FSQA 3WYXA 3VBVA 2B52A 2YM3A 4CD0A 5IH5A 4M69A 3P78A 3GP0A 3QHWA 4RPVA 4M7IA 4RVMA 5IQAA 4K77A 1ST0A 1Q61A 4YNEA 1Y57A 5HLWA 4FKVA 4XCUA 2YCRA 3F61A 3QZHA 5D9HA 4YLKA 4I4EA 4YTIA 4NSTA 3RI1A 2VU3A 1SM2A 1ZY5A 2R7BA 5F95A 3I6WA 5E1SA 2RKUA 2VGPA 4DE4A 4FVRA 4CFXA 3ZLSA 3MVJA 1Q8YA 4O91A 4EWHA 2YLFA 5LVMA 3A2CA 4PL3A 4BBFA 2XK4A 3UYTA 4TWPA 5CVFA 4IC8A 3LFBA 4CLJA 4FNXA 2QKWB 3PJ1A 5E92A 4RWKA 3QQJA 1Q99A 4DH7A 3R7YA 1V0OA 2JBPA 5IZFA 2WMSA 4RWJA 1YXVA 3LXKA 4FV7A 2E9VA 3MBLA 4MQ1A 2BAKA 4E6QA 4BZNA 4O1PA 5AP5A 4RIXA 4FKLA 2W9ZB 3KCKA 2IZRA 3NWWA 3BQRA 1T46A 1R78A 4PNIA 4FKOA 1BLXA 4YJVA 2HWPA 1AGWA 2J6MA 3ORPA 3R83A 2WMWA 5KMJA 4RG0A 4BKJA 2KULA 4PDYA 3PXFA 4IMYA 4J1RA 5CF8A 4IEBA 1CMKE 3I0QA 4ZSAA 4WG5A 2EUFB 2QOLA 3FQSA 4HYIA 3O8UA 3LPBA 3W33A 4XG6A 5E8XA 3UIUA 4ERKA 4I6HA 4HYUA 2R3FA 2AEGA 4D4RA 3WBLA 1RJBA 3FJQE 4X2KA 3PVBA 3HV3A 3MGYA 5IQEA 1JNKA 1UVRA 3F5UA 4X3FB 1IR3A 4CLIA 4KRCA 4FF8A 2OIQA 4FKUA 1SVGA 3TZ9A 2UVYA 5AUVA 3VAPA 4A9UA 5CXZA 1PMEA 2HZ0A 4I6LA 4S33A 3FL5A 2GDOA 3DFCB 4YSMA 3G9LX 2REIA 4FT7A 2LAVA 2OSCA 3KXZA 5BVNA 5JGBA 3ZHPC 2W7XA 4ZSLA 4J8MA 1W2CA 2CKPA 2XP2A 2YDJA 4U97A 3QL8A 1JKTA 1GZ8A 3BHVA 1PYEA 3NUUA 4JG7A 3O71A 4HGLA 3IDCA 5M4FA 1APME 4D2PA 5IQBA 5EM5A 2OXYA 3VRZA 3ZFYA 2QQ7A 2Z7SA 4KWPA 4YBJA 4FTNA 2QOCA 2A19B 2W4OA 1Q8WA 4FI1A 3DKGA 3QQHA 4UWYA 4I93A 4GS6A 5GHVA 4U79A 4QEBA 2XJ0A 3KRWA 5BYYA 4LI5A 1FMOE 4PX6A 3RGFA 3AKKA 4FX3A 3O5AA 5HESA 1M7QA 3IG7A 3TV6A 3C5IA 2PUUA 4M14A 2WU6A 4YZ9A 4FTAA 4JQ8A 2W4KA 4YHFA 4BTJA 5H8BA 4CSVA 4F0GA 5AV3A 2W1GA 5A4QA 5AUUA 5CENA 3QQUA 4YJPA 2C5NA 2CJMA 2J0IA 3GU4A 4TNDA 3ZUVA 3KREA 5EQYA 2J9MA 3NGAA 3P23A 1H0VA 3C9WA 4YTHA 4CT2A 4OAVB 4HZRA 3ZXTA 3QXPA 3GCQA 4FSNA 4EBVA 2WMUA 3TTJA 5F1ZA 3E87A 3MPAA 2IWIA 4Z7GA 2X9EA 4EOJA 2E2BA 5HQ0A 3BL9A 3A4PA 2X81A 5HD4A 1U54B 5DT0A 5AV1A 3ZRKA 2VRXA 3GCPA 4OTFA 4LUDA 3QQLA 2UZNA 5AMNA 5E91A 4AT5A 4C4HA 4ORKA 3ML1A 3F3TA 3JUHA 4DITA 4H1JA 4AOIA 4RJ6A 1FGIA 1UU9A 3ROYA 4H3BA 5KMKA 5M53A 5HZNA 3ZSHA 4P5ZA 2PMOX 1STCE 3NYXA 4U5JA 3I7BA 2YIXA 3IW6A 4I3ZA 1H4LA 3KA0A 2BDWA 2W5BA 2R3GA 4FTKA 3S4QA 2OGVA 5L6WL 2QD9A 4BRXA 4E7WA 2BKKA 3O8PA 3QQKA 3RVGA 2VTOA 2R0UA 3QRIA 4I4FA 4M13A 3V01A 3KRLA 4NM0A 2XALA 1WBPA 4V0GB 2PE0A 5BMMA 4LOPA 4YJUA 3NX8A 1QPDA 3R1NA 4X0MA 1YDSE 2PZYA 2F7EE 3D5WA 2WO6A 2ZV9A 4U43A 4FV8A 5LVNA 3WZEA 2IG7A 3ODYX 3I6UA 3G5DA 4JL9A 4X6RA 1NVQA 3U9NA 4BC6A 2ETRA 3G9NA 2X7OA 5AR7A 4YUQA 5TOZA 4XH6A 3D5XA 1Q41A 5IUHA 5I9ZA 4JAJA 2XAOA 3VQUA 1LR4A 1ZYLA 4WBOA 1PXMA 2ZV8A 3PRFA 1WBTA 4ZTNA 4DT9A 2H96A 5J95A 3UC4A 2XKCA 3BHYA 3DOGA 3JYAA 3EMGA 4DYMA 4FMQA 4XV3A 3GCVA 1QMZA 1PHKA 5FP6A 5H9BA 3UC3A 5B2MA 3FY0A 4UMTA 2YITA 4J99A 4TW9A 2X4ZA 2UZBA 4OTDA 2WOTA 4MTAA 4YLJA 5T3QA 5A4LA 1Q3WA 3E7OA 3HNGA 3VS5A 1KV2A 3UO4A 3RPSA 2R0IA 4YZDA 5E1EA 2QOFA 4WNMA 3WF6A 2BMCA 3FSFA 1FGKA 4LUEA 4GFGA 1W84A 4OR5A 5FTOA 4XV9A 5JH6A 3PRIA 4LDTA 3K5UA 2J4ZA 5EHOA 4BCKA 3KVXA 5LWNA 4MNFA 3ENMA 4XHKB 3Q2JA 3PA5A 3RAKA 4GIHA 5F9EA 3F88A 3EFLA 3HA8A 4FOBA 3ANQA 1TQIA 3CE3A 3QZFA 4K9YA 4BDAA 5GZ8A 1OBDA 4R1VA 3DK7A 3GFWA 3ORTA 3D83A 3R9RA 4TTHB 4C3FA 5K9IA 3OXTA 5JZNA 3F7WA 2ITUA 4IJPA 2AUHA 3O0GA 5AJQA 4DEHA 1LEZA 2FSOX 5CZHA 4LG4A 4F9WA 2DS1A 3BLRA 4D9UA 2BZKB 4XUFA 3PFYA 2YHVA 2PMNX 4RFZA 4KKEA 3PXKA 2ITXA 5L8KA 4H36A 3ZM4A 4QO9A 3HRCA 5AR4A 3RPOA 3C0GA 1ZOGA 3CGOA 2IW6A 3WZJA 4IW0A 3ZOSA 4BB4A 4RC2A 4YJOA 3H9OA 4ANQA 2PE2A 3OS3A 4QYFA 4UN0C 4AT3A 3UIXA 5C8MA 4YPDA 3W2OA 3DQXA 3QKLA 4ITJA 3SC1A 4A7CA 4AT4A 4CFFA 4F08A 2VX0A 3BRBA 3CIKA 5B0XA 3VUTA 5AP6A 5JFXA 4NU1A 4ACMA 5FQDC 1VEBA 4DHFA 2BALA 1UKIA 3KN5A 4M97A 4OTWA 3S0OA 3T9TA 4JRNA 2H6DA 4FKRA 4AZSA 3H10A 3W8QA 2NPQA 4BGHA 5CS6A 4JXFA 5CASA 4XG3A 2W1FA 5IEXA 3FI3A 1Z5MA 5EOLA 3V8TA 4TN6A 3RK9A 4L43A 3ZONA 1FPUA 1H08A 5CT7A 2GFCA 4FUXA 3Q9WA 3L1SA 4D0XA 3GC8A 2CN5A 2XM8A 1R0PA 4ZOGA 1W2FA 3OC1A 1YXSA 1JBPE 2PL0A 3UP7A 2DUVA 4NJDA 3S2PA 3EFKA 4IWDA 2PVMA 3CP9A 1PXKA 1M14A 3EZVA 4QYEA 5FG8A 3E5AA 3VHKA 4F6SA 4MXAA 1WAKA 3GT8A 4EEVA 1G8AA 4NT4A 4FT9A 4O0WA 2X6DA 1DI9A 2A4LA 2BRNA 4PDOA 1YOMA 3TN8A 3C4WA 2CN8A 4JBPA 3ORIA 3W2QA 2ZM1A 3QD2B 4BBEA 3IS5A 4DGGA 3C4XA 4RT7A 4K2RA 3R7IA 4L7SA 3GU7A 1L3RE 4HPTE 2UZVA 2QLQA 3CTQA 3K3IA 5EKOA 3SG8A 5IQGA 4MEDA 4CFNA 3TJCA 1MRVA 3CPBA 4QMLA 2FGIA 4IWPA 2B4SB 4GMYA 2IVTA 4O0UA 3ELJA 4UMRA 4DEIA 4GK4A 3PIYA 5BMSA 4FG8A 4W9WA 3U9CA 5EG3A 5KO1A 3W0RA 3VF9A 3GXLA 4JDKA 1LEWA 3IW8A 4Y73A 3DY7A 3E88A 3BKBA 2RL5A 5K0XA 4MHAA 3IOPA 3BIZA 3G0EA 3LKMA 3AKJA 1TQMA 4IBMA 5HIBA 4PTCA 3C0IA 5C27A 4E1ZA 4NM7A 4RWIA 5ANJA 4O2ZA 4FKJA 1TKIA 4O6LA 3WIKA 1XWSA 4EZ5A 1E1XA 4OAUC 1OUYA 4OTIA 4R6VA 5CWZA 5DVRA 3Q4ZA 3EFJA 3B2WA 1NVRA 3FBVA 4D1ZA 4BJJB 2R9SA 2XH5A 4IAYA 4D2TA 3A8XA 2BR1A 4F4PA 5I9XA 3V3VA 4KUJA 3N4TA 3JY0A 3SDJA 4DEEA 3UDTA 1PMNA 4L9IA 4QMOA 3V5TA 2BPMA 1RDQE 2YA9A 5H8GA 4B9DA 5CEKA 5JRSA 5HIEA 3EQGA 2BTSA 4WG3A 5J7HA 4O7LA 3L9MA 1NVSA 3Q6WA 2CCIA 4ERWA 4L67A 4LM5A 1KV1A 4P2KA 2V5QA 2R7IA 5BVKA 2NNWB 2B53A 1QPEA 4L46A 3A7GA 3EQCA 3LFCA 3COHA 4IB3A 1OKWA 3D2IA 2CGXA 3VUIA 2UZWE 3GU5A 5EH0A 3BLAA 3BHHA 5I9YA 3G6HA 4TWNA 3MS9A 1ZZLA 4OUCA 4R7HA 3L8PA 4C34A 3K5VA 3POOA 4C7TA 5AUTA 1P5EA 5BUEA 2C1AA 2HY81 2JKMA 5AADA 4LV8A 4BYJA 3F2RA 3OWPA 4C62A 1OKZA 3TIZA 4BI2A 4CQGA 4QP7A 1GIIA 1OKYA 4ITHA 3ODZX 2JD5A 3OZ6A 4FTTA 5M56A 4WUAA 1KE7A 3KQ7A 2ZM4A 2BDFA 2WMVA 3HUBA 4RQKA 5E90A 4PUZA 4FNZA 5HBHA 4FL1A 1GOLA 4DEGA 4FTCA 4E3CA 5A54A 3KK9A 2X39A 5JRQA 4FEXA 3WILA 4GVJA 4ZS4A 3KXHA 2J0KA 4ALWA 3PVUA 5CY3A 2YAAA 4ZSJA 1T45A 1QPCA 3C4ZA 3NUXA 2ZDTA 4IB5A 4I94A 4QYHA 3BWJA 2C6DA 4DF3A 4QMNA 4DTKA 2C6LA 4RJ4A 3R2YA 3P5KA 4KBCA 3FMDA 2FUMA 1JLUE 4Q2AA 3TM0A 1ZYJA 3BI6A 3R1YA 2X0QA 4AXEA 3PG3A 3Q4UA 3JS2A 4WO5A 3SOAA 3MJ1A 5AV0A 3DZOA 1GZNA 3NS9A 4GH2A 4Z9LA 3BZ3A 3F82A 3LXNA 5EHLA 3HA6A 3OBGA 4ZEGA 4BTMA 5GZ9A 3L8XA 1Y6AA 2G01A 3TL8A 1JWHA 5CVGA 5D12A 3RPRA 5I5ZA 1A48A 1KE9A 4EOLA 5IQIA 4ZXTA 1MQBA 3KMWA 2F49A 4PTGA 2ITOA 3MFRA 4AN3A 3FLYA 3FPMA 2WMQA 3L8VA 4XYFA 4R77A 3HMOA 4BCQA 1W2DA 3P7BA 4FICA 3VS2A 5T68A 2JBOA 3AMBA 4BIDA 3FKNA 5F4NA 3W2RA 2WMXA 2WQBA 5CSPA 4QP8A 3UP2A 3FKLA 1QPJA 4NWMA 3W2CA 1J1CA 1LP4A 2PWLA 4L6QA 4ASZA 3LJ0A 2R3JA 4MBIA 4D2VA 4I0SA 5DE2A 5G1XA 4QMZA 2EVAA 5E8ZA 1OZ1A 4IDVA 4FNYA 3U4UA 2IJMA 5ICPA 2YABA 3FMKA 4O4BB 2IPXA 4AXCA 3PY1A 4ZJIA 3RCJA 4DFYA 3VONA 2FSTX 4OBOA 1XH7A 4X2GA 4IC7A 2GS7A 5FM2A 3E8DA 1PMUA 3FI4A 2YIWA 4X21A 2BAQA 5EM7A 3SLSA 3V5PA 1OBGA 4BDJA 3AXWA 2X8IA 3MDYA 1OIYA 2XKEA 3H0YA 3KMMA 4NCTC 4QTCA 4AW5A 4EQCA 4BR3A 5CQUA 2CHLA 2XNBA 2YM5A 3QA0A 2VWXA 2WZJA 4Y5QA 5GJGA 4YZCA 3R8VA 2XMYA 2ONLA 4A4OA 3G90X 4I41A 3FXZA 2Y4IB 3IECA 3W0SA 5HOAA 4D1XA 4KB8A 2BIYA 5J1VA 3FUPA 5E8SA 4ZTRA 3R7GA 3TNWA 4UWBA 2IZTA 4PY1A 1XO2B 4DAWA 2JLDA 2VO3A 3OW3A 5IPJA 3SRVA 3BYMA 1FMKA 3QHRA 4J52A 4IWOA 5IDPA 5IUGA 3Q52A 4I22A 5M09A 4BY9E 2XEZA 2C6TA 3D5VA 4CZYB 3ZO2A 3NIZA 3P79A 3TEIA 4YC8A 3HGKA 3UZPA 4U81A 1PXLA 4UXQA 4BCJA 5I4NA 4YGAA 3CJFA 4UB7A 2I6LA 4CKJA 4M0ZA 2C6MA 5J9ZA 2JDVA 2QU6A 5AA8A 5LXMA 4RC4A 4Z16A 3UZTA 4JVGA 1YDRE 2OZOA 3O17A 4D4YA 1OL2A 1PJKA 4ANMA 3LLAA 1FVRA 4DHZA 1ZYCA 5AAEA 3TUDA 2UZDA 1ZRZA 2XK3A 5DFPA 3QAME 3OHTA 2ERZE 3F3UA 4J96A 2WQNA 5L2TA 5KE0A 3DKFA 4QP1A 4NIFB 4LGGA 4NM3A 1PMVA 3EN5A 2HW6A 4RIWA 2ZV7A 2KTYA 3K54A 3S1HA 3NUYA 4OGRA 3U54A 3R6XA 3PG1A 3DXQA 3UNKA 1IASA 3KEXA 2VWYA 4D5KA 1H1RA 4IVAA 3ORZA 5AX3A 4D2WA 2RGPA 3FHRA 4XJ0A 3QYWA 4J8NA 5FTQA 2QNJA 2BIKB 2O63A 4XS2A 4DHJA 1O6KA 3DJ6A 2C3KA 4PPCA 4E6CA 2BHEA 3ATTA 4IWQA 5EI2A 4B6LA 1OMWA 3MY1A 3OWKA 3R7VA 3FZ1A 4ACHA 2C5VA 3GI3A 4HJOA 3AT4A 3QC4A 4YJQA 3G15A 4RFMA 4B4LA 5BV3A 3QRKA 2VWWA 5DPVA 4RA4A 1XQZA 5LQFA 4WKQA 3RK5A 3OEZA 4NZWB 1OVEA 1PY5A 3CJGA 1Y8YA 3NUPA 3PFQA 5AM6A 4W9XA 3R8MA 3RINA 1GZKA 5L6PA 2XNEA 3Q3BA 3I79A 5AR2A 3HAVA 4C38A 4FSUA 2JIUA 4FZ7A 5CSVA 4FKGA 5M55A 4F0IA 4XBRA 3ZM9A 4TYJA 5A6OA 3RALA 1H28A 3JVSA 3C4CA 1G3NA 3SVVA 5AP7A 2ITNA 1UU8A 3VRYA 4FKWA 3CKXA 4ZY4A 3OCSA 4FV9A 4E5WA 3FI2A 4XRLA 5HX6A 2WOUA 2YCSA 5EM6A 5FUTA 5EQPA 3ZYAA 4UX9A 4DDIA 3QXOA 3TV7A 1ZLTA 2Z7QA 4Y8DA 2O3PA