3IDPA

B-raf v600e kinase domain in complex with an aminoisoquinoline inhibitor
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
272
structure length
255
Chain Sequence
DWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATGSILWMAPEVIRMQNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords B-Raf proto-oncogene serine/threonine-protein kinase
publication title Selective inhibitors of the mutant B-raf pathway: discovery of a potent and orally bioavailable aminoisoquinoline.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 72
structure length 255
sequence length 272
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3idpA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3idpA01
4EJ7A 4FK6A 3RINA 4Q9ZA 3R00A 3VUDA 5A4CA 5K9IA 1LR4A 3L8PA 2C0OA 3NUYA 2C4GA 5E92A 3ZRMA 3ZSIA 3ZEPA 3O8PA 3JPVA 4IX4A 3UIUA 5DNRA 4FEXA 3W18A 1PXNA 2RF9A 3TNQB 2WD1A 4IZAA 2W1ZA 1H28A 4JQ7A 2YZAA 1YDRE 4RX5A 2AC5A 3LFAA 4U97A 4A06A 5AEPA 4UN0C 4FG8A 4EUTA 4M67A 3BGZA 3WIGA 4QMMA 1V0BA 4RJ4A 2BCJA 1FQ1B 2GTNA 2RFEA 2BAJA 3FQSA 3KL8A 3BHYA 2WMVA 3A7GA 2A1AB 1RQQA 5AR8A 4XOZA 4D1ZA 4FSTA 4BTFA 5KMIA 3ANQA 5DE2A 5AM6A 5ANDA 3BLRA 1ZOEA 4HCVA 4NZWB 1R0EA 3OCTA 4GUBA 3KRRA 4QMTA 4DEHA 3DAKA 3Q3BA 3Q6WA 3C0GA 4FNZA 2HWPA 3RAKA 5L6WL 5CEQA 1Q97A 3UPXA 2PU8A 4EOKA 4KIOA 3TIZA 4G5PA 3NUPA 3KEXA 2RFSA 5EM7A 2ACXA 4HJOA 4FSYA 4BDHA 4CLIA 5H8GA 4F65A 1MQ4A 2X7FA 2ZB1A 3EOCA 2X8EA 5L2TA 4BCGA 2ITPA 4YGAA 4J96A 3E8DA 4LV5A 2LGCA 2R0UA 4FT9A 3W32A 4U6RA 5JQ8A 3F82A 3QXPA 5AIKA 4GUEA 1B39A 5GJGA 2QKWB 3TNIA 4D9UA 4YTCA 5C4LA 4AWIA 1IASA 5JGBA 3UIMA 5K4IA 3O71A 4L44A 3DOGA 4OW8A 4AW5A 1I44A 4S34A 5EYKA 2OH0E 3ZFMA 2W4KA 3FMKA 4DH1A 5CASA 4CKRA 2F9GA 3NWWA 4IWOA 4MX9A 3LFBA 4ZK5A 3W8QA 3EMGA 3QTQA 4EOJA 4BCQA 4CQEA 3NNWA 5A4TA 2FSTX 4GK3A 1ZYLA 4R7IA 1T46A 3EFWA 4A9TA 4BICA 2RKUA 1UNHA 3CP9A 2ESMA 4CZUA 4IAKA 3HMIA 2JKMA 4OTGA 3RZFA 3BZ3A 1LPUA 4ASEA 4O7LA 2BRNA 2UW8A 1GOLA 5BNJA 1VYWA 3I7CA 4C8BA 3H9RA 1IA9A 3V04A 4I0RA 3OEFX 5DVRA 2W96B 2J0JA 3P23A 4BBMA 2CCHA 3KA0A 3H0ZA 3FC1X 4D1XA 4TWPA 3MN3A 4F0FA 3VBVA 3ZO4A 2A4LA 4FUXA 4X2NA 4M69B 5HBHA 3AMAA 2XMYA 4JR7A 4YTIA 1OPLA 2FA2A 3SW4A 4HVHA 2ITVA 4RJ8A 1ND4A 3KXNA 1O6KA 4LRKA 2OGVA 5AUUA 5DMZA 3TKHA 4YO4A 4IXPA 4IZ7A 4JJRA 2JFMA 3OOGA 3MVJA 2R3JA 4ZLYA 5J7BA 3JUHA 4WG3A 4AZTA 4QMQA 3BEAA 4CT1A 3OCGA 5DEYA 2YCRA 1E1XA 5TO8A 2CKOA 2W1HA 5JZJA 1B38A 3NVMB 4CD0A 4DF3A 2R3PA 3U87A 1J7IA 1RW8A 4RIXB 5ANEA 3GU8A 3UO6A 2B9FA 3ACKA 1SM2A 2ZV8A 4RX9A 3UNJA 4CV8A 5IZFA 1IA8A 2W5BA 1PXIA 4EOOA 1BI7A 3AT2A 5AV1A 4YJSA 4EH3A 2BZIB 2R64A 4PMPA 1G8SA 3S0OA 3V5QA 3OHTA 1NA7A 3BEGA 1OKYA 2IO6A 2Z7SA 5AUXA 4AGWA 2P0CA 5CAPA 2FYSA 2GSFA 2HZNA 2Y8OA 3DB8A 3HMMA 4FGBA 3ZMMA 4AQCA 4MKCA 3CE3A 3UIXA 2Z60A 3R7GA 4K6ZA 3NIZA 2GHMA 4ZEGA 4DITA 2JBOA 4HGSA 1E9HA 4JDHA 2XJ2A 3QQJA 5LOHA 4ERWA 2XM9A 1RJBA 3RNYA 3BYSA 4MWHA 3R6XA 4F70A 2IW9A 5IA3A 1L8TA 3BU6A 4JDKA 4O21A 4UWYA 4AGUA 1OIYA 4BDGA 4HZRA 3BLHA 3ZRKA 5M53A 3LCSA 4XG8A 3ZDUA 3KMUA 3GU5A 5EHLA 1GNGA 3Q5IA 3QGWA 4O7YA 3PUPA 4C4GA 4EUUA 3NW7A 4TNBA 2WFYA 2Y9QA 3E87A 4BHZA 5M4IA 4I5PA 1KE7A 4DYMA 4AW2A 4F6SA 5CENA 3WOWA 2V7OA 3RWQA 3PRIA 3VS3A 2OO8X 4XMOA 3F66A 3DNDA 3T9IA 4TZRA 4DG0E 1M2PA 4AP7A 1XH9A 2NRYA 2OJJA 1E1VA 5CVGA 5EK7A 1BUHA 5JFWA 4XV2A 3RAHA 2WXVA 5CT7A 3HV5A 4I23A 3NYXA 5FRIA 5DH3A 5BUEA 5DG5A 2QODA 5CZHA 3KY2A 3MFTA 4GT5A 1W8CA 3QYWA 4KD1A 4MBJA 4O96A 3LOKA 5I9UA 4MWIA 3DCVA 3MI9A 4EH5A 2ONLA 2OZAB 3E8NA 3ZUUA 1U5QA 2W17A 2PMIA 3QZIA 3WE4A 4FIHA 2R3RA 4M97A 2ZV9A 3JVSA 2G2HA 4HYSA 5E8XA 4IAZA 3RTPA 4O6EA 2CHLA 4RIWB 3RM6A 3N4TA 3DGKA 4YR8A 4J52A 4YTHA 3R7YA 2HOGA 2YACA 4FTAA 4EH7A 1WBSA 4NUSA 2A19B 4D2TA 5E91A 4L45A 4ITHA 3CBLA 4KBCA 4EH2A 3B2TA 5EM6A 3FYJX 5EQEA 3E7OA 5C27A 1QL6A 2FO0A 2YDKA 3GCSA 3FJQE 3KXMA 2ZMDA 5D9HA 3UGCA 3PVUA 4U41A 3S4QA 2C3JA 2BFYA 4QYYA 4E73A 4E5AX 2QC6A 3TZMA 2XK3A 3F5XA 2C6MA 3ANRA 4EOMA 2XA4A 2XCKA 4GW8A 4BGGA 4OTHA 1OIUA 3HV7A 2WTKB 2OK1A 2O8YA 1ZYJA 1Q3DA 3T3VA 3A7IA 4CMTA 3LMGA 2XNOA 3I81A 4OLIA 5IEVA 1QCFA 2F49A 2W99B 1GIIA 4U3YA 5CY3A 2IZUA 3MPTA 3V5JA 4O0TA 3V6RA 3LFSA 5IMXA 4D58A 5B2MA 3EWHA 3NYOA 5DOSA 3RCJA 2YIRA 5BVNA 4ZMEA 4FTOA 4EOPA 5CQUA 3FZSA 2PUIA 5TF9A 4DTAA 3SXRA 5M51A 4USDA 4O22A 3ETAA 2UW7A 4RWLA 3RAWA 2EB3A 2WHBA 1ZZ2A 3H0YA 1BI8A 3UIBA 3VO3A 4AT4A 4TYIA 3FKLA 3PY1A 3WBLA 4UMPA 3ZDIA 4B9DA 2WNTA 3QFVA 3OWPA 3RM7A 4BR3A 3VUIA 2Y4IC 1M17A 2QCSA 3NNVA 1OPJA 1AD5A 2O5KA 4MBIA 4RIOA 4BTKA 4YC3A 1YXSA 4X3FC 1KOAA 4WIHA 1CTPE 4L3PA 4EK5A 2WMAA 4BVUA 1LEWA 3SV0A 3U51A 2UZWE 3PFQA 3TV6A 3UVPA 4AA0A 4AUAA 4MBLA 4BN1A 3HP5A 4FT7A 3R1NA 5EDQA 4MXCA 5EI2A 5M07A 2BHEA 3CCNA 3R04A 3ZLSA 4QMPA 3R63A 5I3RA 2X9EA 1UKHA 1WCCA 2P55A 4GU9A 4HNIA 3LFDA 4EL9A 4BZNA 4MNEB 3WZUA 3QAME 1PKDA 1FGKA 4C4IA 5AFVA 3HMOA 3W55A 3FLSA 5J9ZA 4EKLA 3TM0A 2XNMA 3CR0A 3FSKA 3P0MA 4L01A 4ANSA 2HZ0A 5HIEA 4WHZA 3SD0A 5KE0A 5E9EA 3VIDA 3OXZA 2CNUA 2YN8A 1KV2A 4K1BA 3RAIA 4EWHA 3QQFA 3NPCA 5C8KA 1DS5A 4XHKB 1H1QA 4ITIA 4WSQA 4YJTA 4D2PA 2PSQA 5C9CA 4BDIA 3EZVA 4D28A 4BTMA 2VNWA 4IWDA 2YA9A 4R1YA 3TT0A 4EZ3A 2GFSA 3CY2A 3NCZA 4BZDA 1GZKA 3I1AA 4QMWA 1P2AA 5LVNA 4NM5A 5J1WA 2PL0A 5AP3A 5E4HA 4AT3A 1R3CA 3C5UA 1SVGA 3QQHA 3HA8A 3GBZA 4D2RA 1OL1A 3O2MA 2HELA 5LCJA 2JDRA 3D7TA 4P2KA 2WTWA 2P4IA 4ZTSA 4AZWA 2W1DA 4Y5QA 4CRLA 5A14A 2RL5A 3QXOA 4FKLA 5HE3A 2Y6OA 4A7CA 2CGXA 2GMXA 1WBPA 3A8WA 2QO9A 3UO4A 3W2RA 2CCIA 5E8ZA 2Y6MA 2ITNA 3MVLA 2UZTA 3QTIA 4H3PA 4J7BA 4WG5A 3M11A 4XEYA 3KKVA 4YBKA 4FMQA 3I5NA 3R8ZA 5M57A 3UVQA 2C68A 2CSNA 2GNLA 1OECA 3BV3A 4TN6A 3WYYA 4ASDA 4DFYA 4FE2A 4I20A 4PY1A 3DBDA 1JVPP 3PJ3A 5ACBC 2C47A 2PZRA 2XIXA 2Z8CA 3NX8A 5CS6A 3ROCA 3T8OA 1BLXA 1QMZA 2I1MA 3S1HA 3TACA 4H1JA 3F3TA 4LUEA 2XYUA 1M7NA 5L6PA 4ANNA 4DH3A 4J8NA 4E5BA 3QTWA 5KUPA 3OBJA 3FQEA 4RRVA 4O7WA 2PVYA 3DA6A 1ZMVA 3QD3A 3V3VA 3BWJA 3DKGA 2IVVA 3WZDA 1G8AA 2ITTA 3FLYA 4DEAA 3E92A 5I9VA 3EQDA 2CMWA 3QBNA 3NYNA 2O63A 3C13A 3LXPA 3ORMA 3NUNA 5B2KA 1UU3A 4C3RA 1KE5A 4FEUA 2Y4PA 5J9YA 4K8AA 4P4CA 2VTAA 4BGHA 3MA6A 3UQFA 5ETIA 3HL7A 3HLLA 4NK9A 3Q04A 3RPRA 1KOBA 2RGPA 3COMA 3CTQA 3IK3A 4NW6A 3ZBXA 4QMYA 1PXJA 5CF4A 1UNLA 4ACDA 3FV8A 1U46A 3GUBA 4YMJA 1H0VA 3PPKA 3L8VA 2CLQA 3VQHA 3W2QA 1BKXA 3CLYA 2OIDA 3COKA 4PDSA 1ZMUA 3GU4A 5BMMA 1ZRZA 1YWVA 4AW1A 2HENA 4C4HA 4BI0A 4BBFA 2HCKA 5A46A 4XJ0A 5DR6A 2XK6A 3Q4UA 3R7IA 1H0WA 3PXFA 4EBVA 4ACMA 2ZM3A 2C3LA 2JKOA 3FY2A 5T3QA 4JS8A 2BVAA 4P7EA 4LOQA 4U0IA 5CNOA 1YOMA 4NTTA 2QLUA 3LE6A 3OTUA 2WMSA 4RMZA 3ZU7A 3BU3A 4BWPA 3JS2A 3F88A 4QTEA 3KB7A 3W2OA 2E9NA 2YM6A 4O91A 2WGJA 5M4FA 5M09A 1YHSA 4XG9A 2PPQA 5C4KA 3EH9A 3ORIA 3RNIA 4OT6A 4MXZA 3THBA 3MB6A 3KC3A 4RJ7A 1NVRA 4UZHA 3Q5ZA 4O0VA 4CV9A 3MH2A 4HZSA 3SLSA 2CPKE 5AP4A 3WARA 4YURA 5CF6A 3FZPA 4GL9A 4RZVA 4FC0A 4YZ9A 3GU6A 4G2FA 2V5QA 2V7AA 5KHXA 2GQSA 1DI8A 3IDCA 1NY3A 3V8TA 2F2CB 3EQHA 3KMMA 4GKHA 4TL0A 4FTCA 4WNOA 4U3ZA 3QX4A 1A48A 2BAQA 3D0EA 3O8UA 3O23A 4CFMA 4TYJA 4L52A 4L42A 3MY1A 4IFGA 4IM0A 2BDWA 5CALA 4Z16A 5FUTA 2VUWA 4DCEA 4QO9A 3VVHA 4DTKA 4PX6A 4CKIA 1M52A 3DZQA 2XEZA 3O7LB 3DKCA 3MIYA 4GYIA 3IDBA 3AOXA 4YJVA 4I24A 1V0OA 3QKMA 1CKJA 5HCZA 1KWPA 4BHNA 2YAKA 1UWHA 1EH4A 5M44A 5DHJA 1WVYA 1GIJA 2UW3A 4WRGA 4B8MA 5IQFA 2I0HA 5F94A 3V51A 4OGRA 4WT6A 4YJOA 4DGMA 4TW9A 3LXNA 3ATSA 2WO6A 3PG3A 4MVFA 5T68A 3F7ZA 3WI6A 5AM7A 4RC2A 4BIDA 3GC0A 3R7EA 2O3PA 5GINE 1O6LA 3CSVA 3AMYA 4PPAA 2NPQA 1GZNA 3G9LX 3GQIA 3VNTA 2I7QA 2BALA 4IFCA 3TXOA 3L9PA 4UXLA 3MH0A 3DKFA 3PXKA 4XH6A 5DT4A 2JKKA 3SHEA 2GQRA 3QTXA 2YITA 4UB7A 3TN8A 4BZOA 4BFMA 1OL6A 2IW6A 4NFMA 2QURA 5B0XA 4JQ8A 3ZOSA 4A9YA 3BYOA 5KMLA 2EXEA 2KULA 5HNIX 3F2NA 3RJCA 1YI3A 3SOCA 3I4BA 1M14A 4Z7GA 2E9UA 3NAXA 4G31A 4G3CA 2UUEA 2ZM1A 4QTDA 3NW5A 4XP0A 3FZ1A 5I9YA 1OB3A 4YU2A 4F9YA 4G6LA 1R0PA 4I21A 3FMNA 4X6QC 3VUKA 3I6WA 3QTZA 4JDJA 5HBEA 4FTIA 4HGTA 4FT3A 1ZOGA 5CZIA 3SC1A 4B7TA 5KNJA 3VBYA 2PE0A 5FDPA 3QLGA 5IPJA 1VZOA 5DRDA 4RA4A 4X2FA 5EHYA 2VWWA 2VX1A 2PVNA 4BWXA 4D4SA 3U9CA 5A6OA 2QOKA 1JSVA 3ZC5A 4XBUA 5DWRA 5HVKA 3U55A 4XP2A 2XNBA 3HMNA 4ASXA 1YQJA 2ZYBA 3E5AA 3BHTA 2YIYA 3ORLA 3QL8A 2QVSE 3VS6A 3H3CA 4EK4A 4FA2A 4QMZA 4M66A 3VHKA 4BCHA 3RVGA 1PMEA 2BIKB 4XG6A 3UOHA 2OZOA 4H3QA 4Z55A 4BF2A 4IH8A 2PZ5A 4O84A 3PVGA 4LUDA 2HZ4A 2KTYA 4O0UA 4F6WA 2AC3A 4DLIA 5JN2A 2OIQA 2BRGA 2JDVA 3KK8A 3PSBA 1OL2A 4M68A 3C7QA 3ORNA 4O7ZA 2VTMA 3KU2A 4PTCA 4EH6A 4WOVA 1HCKA 4QNYA 5F95A 3RALA 3KF7A 3C0IA 5IQEA 1OUYA 4EHZA 4FODA 3UTOA 3O17A 4I5MA 4QQ5A 3OC1A 3E3BX 3OXIA 4D5HA 3ZZWA 4BI1A 4O2PA 3BQRA 5ANJA 3QGYA 2ZVAA 3PJ8A 4BKYA 4CRSA 5CLPA 1GIHA 3LQ3A 4FYNA 4PDPA 4ZJVA 2G2FA 4Z9LA 5JKGA 3K5VA 3CTHA 4UX9A 1SYKA 2XNNA 5I9WA 4RBLA 2XNEA 3MTFA 3KXZA 4UV0A 5HNBA 4O7NA 2PVLA 3IPHA 4YJRA 5FTQA 3UPZA 2BRMA 2GQGA 3K5UA 5A9UA 5E8WA 4IACA 3GFWA 4BDAA 5E7RA 2J2IB 5BUIA 5IA4A 3CJGA 4RZWA 3QHRA 4NH1A 1S9IA 2VRXA 1YI6A 5AMNA 3P86A 5HE1A 4AZVA 1OKWA 2R3HA 4KS8A 1JSTA 4BDFA 3EKKA 5AV0A 3TZ9A 4N6ZA 5LMKA 5EKOA 4CMUA 2PMOX 5FLFA 2I40A 4I4EA 2HW7A 2ITQA 4K77A 4M12A 5BQ0A 5DN3A 4YZNA 3WILA 3CGOA 4F1TA 2YM3A 3FLQA 5HKMA 1URCA 4C61A 3FKNA 3GC8A 3LQ8A 3IW8A 3BYMA 4F1OA 4PPBA 3ORXA 5FP5A 3JR1A 3CJFA 3LJ2A 3EIDA 4OTWA 1H01A 5IISA 3OFMA 5L2QA 2QOLA 2YCSA 3WF6A 4IJ9A 2XZSA 2B4SB 5GZAA 2XF0A 5ACKA 3RPSA 4DFNA 2WMTA 2ZOQA 3A7HA 5GJDA 4MAOA 2IWIA 4FOBA 3S3IA 4EEVA 1Q61A 4AOTA 3D2IA 3D5UA 1PYXA 3H4JA 4I0SA 3ODYX 4X7QA 3MTLA 3PVBA 1H1RA 3ZCLA 3C9WA 3F7WA 4IQ6A 4RVKA 5FEDA 4CCUA 4D2SA 4DG2E 3N4VA 2E9OA 1SVEA 4NEUA 2BIYA 2XJ1A 1XBCA 3R71A 4OTDA 4H05A 4U40A 2B52A 4N6YA 2CNQA 5FQDC 5HE0A 4C0TA 3UC3A 3LKMA 4DFBA 1ZYSA 5AP2A 4PL3A 4ZSGA 3A4OX 2GS6A 3BIZA 4P90A 4FF8A 4FT0A 4UY9A 5TR6A 4AAAA 4C02A 4J1RA 3TV7A 1Q99A 2XIRA 4HVDA 5CF5A 3GOPA 5G6VA 3QKLA 2OI4X 3M42A 5AP6A 2R5TA 3PWYA 1JKLA 4CXAA 1Q4LA 5KCVA 2PVMA 2HYYA 3U8WA 2R9SA 4QMUA 3TDWA 2H34A 2YJSA 3RHKA 4F9BA 4DFXE 4XG7A 2IZSA 5BYLA 3GC7A 4FICA 3MGYA 4LGDA 2PE1A 2PMNX 5BYZA 4M8TA 2VU3A 2F4JA 4MH7A 3NYVA 4QMOA 3D4QA 4KRDA 3KXXA 4HPUE 5J5TA 3OP5A 2EUFB 1PY5A 2XNPA 3G90X 2WQNA 1XR1A 2Z7QA 5C03A 3NR9A 1Q5KA 2YERA 3QRUA 3II5A 5E8VA 2REIA 4FOCA 4BWKA 3UZRA 4DCAA 1FMOE 4H39A 4IAFA 5AP1A 4BGQA 4DGGA 3QA0A 3VWAA 4FTTA 1OIRA 2HXLA 2CKEA 4A9UA 4BKZA 2QOFA 5IMEA 4MD7E 2HW6A 2PY3A 4F7SA 4GG5A 4FNXA 3NIEA 4LOOA 3IQ7A 5AWMA 3A99A 3Q6UA 3DB6A 5K0KA 1OBGA 4YHTA 3ZFXA 1STCE 2HY0A 3OVVA 3PE1A 4CG8A 4I92A 3L9NA 3PXRA 3WF5A 3FUPA 4PMTA 3ENMA 4MCVA 5CVHA 2QOBA 2HAKA 3PA4A 4RG0A 4TNDA 2X39A 4ZLZA 4WD5A 4D0WA 3QRIA 4ZY5A 1IG1A 5CANA 2WTJA 2NP8A 3D7TB 2PHKA 2UW6A 3DAJA 4F9AA 4C34A 4ZY4A 1OZ1A 4FTJA 3AD4A 3FLZA 4I4FA 3VW6A 3LVPA 5KKRC 4O7VA 3PG1A 1YWNA 4Y85A 3V5TA 3FHRA 2PVJA 4FT5A 4W8EA 4EOSA 3FDNA 2QO2A 5CU6A 5LARA 2QO7A 5C8NA 3ENHA 4EOLA 3KRLA 3P7BA 1Y91A 2G01A 2YDIA 4C37A 3FZOA 1Y6BA 3DDPA 3SXSA 4IB0A 3OF0A 2OG8A 5IDPA 4TWNA 5HO7A 3P08A 2XK4A 4IE9A 3VC4A 5IA2A 5HICA 3RI1A 1KE6A 1BMKA 2DQ7X 3KRJA 4FZAB 3DQXA 3FZTA 3QYZA 3QWKA 4U80A 4CCBA 4F0IA 4E4NA 5I4NA 5EI8A 4R3CA 4B6LA 4ZMFA 5D12A 2QU6A 3Q9ZA 1H27A 2IJMA 4QNAA 3FLNC 2I0EA 4JLCA 3FPQA 3CKXA 3IGGA 4CFNA 4R3RA 3EJ1A 3OWLA 3IW5A 2FH9A 4V0GA 5FXSA 4FG9A 4GEOA 4D2VA 4D0XA 2BTSA 4BDEA 4U42A 3B8RA 5J79A 3FI2A 2YHVA 2XBAA 2R3FA 4FTMA 2I0YA 4HNFA 4IC7A 5FXRA 3HEGA 3WF9A 4FV6A 2WQMA 4FKVA 2WMXA 3W10A 3L8SA 4U45A 3E88A 3FXWA 5HO6A 4N57A 1OL5A 5DLSA 5HEZA 5EDPA 3SG9A 3A2CA 2QOCA 3LCKA 5C1QB 3JY0A 4AN2A 4L43A 4O83A 5CAQA 4Q5HA 3DY7A 4HGEA 4GK4A 5FXQA 4LV8A 5A4LA 3DK6A 3UC4A 5FP6A 1SVHA 3NMUF 4TY1A 5I9ZA 1YHVA 5DPVA 3ZZEA 2OU7A 3MWUA 3QZFA 5ANKA 3UJGA 4ASZA 4RWKA 3Q9WA 3LJ0A 5AX9A 3FXZA 2H8HA 3KVWA 3RMFA 3KVXA 4FKPA 4F6UA 3KCFA 4YUQA 4GVJA 1VYZA 4O0SA 2G9XA 1YXUA 2OXXA 2CGUA 4QT1A 3EKNA 3F6XA 3PTGA 3RPVA 2UZOA 4BDDA 4KAOA 5CU2A 2V22A 4NJDA 3OWKA 4FVPA 2VTNA 3MSSA 4XRJA 4IZ5A 5G1XA 5A3XA 3UVRA 1IAHA 1GJOA 3DS6A 4FV9A 1PW2A 1XWSA 2BAKA 2DYLA 4L46A 4M14A 1Z57A 4L7SA 3G33A 2C5XA 2QR8A 5HBJA 1DAWA 4HCTA 4FKJA 4F7LA 3UQCA 4G5JA 2ITOA 2OJ9A 4FKWA 1GZOA 3RWPA 2WELA 3DTWA 2JLDA 4TRLA 3VBWA 3WE8A 2XVDA 3PPJA 3UE4A 5KBRA 3EL8A 2ZAZA 1I09A 3G6HA 2PVFA 2XKCA 4EYMA 1ZZLA 3ERKA 3DV3A 5KMNA 3TUDA 3P1AA 4Y46A 2B9JA 3CQWA 2HXQA 4FEQA 2XKFA 4J71A 4NT4A 5LVMA 2GHGA 1UNGA 4QTCA 1A06A 3QC9A 1QPDA 5KZ0A 4FSWA 4FUYA 5C01A 3V5LA 1PJKA 4PTEA 4K2RA 2VN9A 5BPYA 1XQZA 5K0XA 4H3BA 4UMUA 3EN5A 4ZSLA 3P7CA 2W9ZB 4O0RA 2BTRA 3LHJA 4YO6A 1KV1A 4AX8A 5CEMA 4C62A 3D94A 3MYGA 5FBNC 4OTIA 3KCKA 4RGJA 3CEKA 3QCXA 4FZ7A 4YBJA 5DI1A 4YPSA 4AF3A 3OUNB 4RC4A 4O1PA 1YOJA 4X6RA 2VTIA 5EG3A 3LMHA 3ALNA 4FKUA 2X7GA 4IB3A 4KINA 2H96A 2R3LA 4I41A 5HG9A 3VUGA 1H00A 3U6HA 1R1WA 2YEXA 5FEQA 2C5YA 2BKZA 3OUKA 1IRKA 2LAVA 3I0OA 4LGGA 5D11A 5ETAA 3TG1A 3V6SA 4PDOA 4CFFA 4IWPA 2R3IA 3POOA 4J98A 4OUCA 2HZIA 3RKBA 3U9NA 4APPA 1BL6A 3QTRA 1PRYA 2VO7A 3W2PA 4DHFA 2JDSA 4MXYA 4IAYA 4EQMA 2ZJWA 3NAYA 5BMSA 3HP2A 3I5ZA 5JRQA 3G2FA 3PPZA 2OF2A 4L6QA 3TJCA 5IDNA 1OITA 5AP7A 2JEDA 4Y83A 5HVYA 2YIXA 2Z7RA 3CTJA 4NCTC 2QOIA 4FR4A 1JQHA 4O27B 4BL1A 5AV4A 4QTAA 4O82A 5HIDA 4PL5A 4ZTRA 4G6OA 4OR5A 5HTBA 1BX6A 2HY81 2VTQA 5CEIA 5IA0A 4MXAA 3CIKA 3LPBA 4S32A 2PMLX 5D1JA 3VS1A 3FMEA 2WB8A 3NEWA 3AT4A 1XH8A 4FKRA 2X2MA 1YDSE 2RFNA 4FV0A 4ERKA 2QI8A 4M7IA 3FLWA 4IVBA 4F7NA 3HDMA 3DK3A 4JT3A 4YTFA 4FV3A 2VO0A 2GHLA 3A7FA 3SGCA 4X3JA 4FTLA 4I6HA 5KMKA 3QHWA 4WKQA 4F64A 3KXGA 3R8MA 4F1MA 5A6NA 2X8IA 3BYUA 4A9RA 1TVOA 3ZLXA 4MF0A 4MHAA 2EWAA 3PLSA 1OIQA 2BZJA 3PVWA 4J53A 3VUHA 4S2ZA 5CTPA 4YHFA 1H1SA 3OZ6A 4S33A 4LFIA 5CI7A 4F09A 3RHXA 5CU0A 1U5RA 1W84A 4QD6A 2UVXA 2ZV2A 4LMUA 3EL7A 3VULA 4G9RA 3EQPA 2R7IA 4DGOA 1LUFA 4RVLA 3C4XA 2JAVA 5FG8A 5CSWA 4CZYB 4D4YA 4DEEA 2G2IA 2UW9A 4MXXA 4FZDB 4O7TA 4QYGA 5DYJA 3SG8A 4E6AA 5FD2A 3HKOA 3IW6A 3NZ0A 2JDOA 3G0EA 3PZEA 4LL0A 2WMUA 4LRMA 1YW2A 2W05A 4KABA 4BCNA 4DT9A 3O8TA 2PVHA 4ZSEA 4NFNA 4AGDA 1JWHA 3A8XA 5CU3A 3SQQA 2RFDA 2P33A 4RWJA 3W33A 2X2LA 4FKSA 3SRVB 4AA5A 1A9UA 3GENA 3Q4ZA 4MD8E 5GIPE 3BE2A 5HCYA 4AXAA 1PXPA 1JAMA 2Y7JA 5DR9A 5L4QA 3C1XA 4KSPA 3DBFA 1J1BA 4RFYA 4BDBA 5IU2A 4IBMA 5IEXA 4GT4A 4M0YA 3DT1A 2VWZA 1CDKA 4ANOA 3ZBFA 1ZYCA 5FM2A 4WUAA 2GCDA 1XBAA 3VHEA 1YI4A 3LQ5A 3TEIA 1PXMA 3DQWA 3BGQA 4U8ZA 4JAIA 4Y5HA 4RVTA 4E1ZA 3RPOA 2GNGA 3R02A 2UZVA 2ERZE 2JC6A 2X1NA 3VAPA 1H8FA 5F20A 5CI6A 5IQGA 3D9VA 5D7VA 2W1CA 3BRBA 4FVQA 4FIFA 4JBQA 3A62A 4CNHA 2DWBA 4FTRA 5IG1A 5IUGA 1OM1A 3PDTA 3MFUA 4BCJA 2WTDA 3OG7A 1WBVA 3I6UA 4C35A 1YDTE 2J5EA 1OBDA 2WTCA 4QP7A 4Q5EA 4DC2A 3GU7A 4JRVA 3HUBA 4QPMA 3G15A 4O81A 2W06A 3E8EA 1WBNA 3PXZA 2B54A 2ZB0A 3QF9A 4GVAA 2X8DA 4QMVA 1SNXA 2GNHA 4F7JA 3R7VA 3FXXA 2B53A 4YC8A 4CFXA 5EOLA 3IONA 5IUHA 4JX3A 4HW7A 4LI5A 4LMNA 4MXOA 4V01A 5AAEA 1W83A 5KX8A 4FSZA 4B4LA 2WQEA 2XYNA 3TNHA 4E6CA 1NT2A 4RVMA 3HUCA 4BI2A 4XS2A 4X3FA 4EK8A 3SA0A 1YVJA 4YP8A 5C26A 3MY0A 5BVKA 1F5QA 1WVXA 3R9OA 4QP3A 4I93A 5AX3A 4J95A 3TIYA 4WSYA 3H10A 4I94A 4S30A 2XK7A 4QYHA 4ALVA 2W1IA 3QTSA 4FV5A 4GS6A 4MK0A 2OFVA 3U4WA 4E20A 3VRZA 1JKSA 2O2UA 3OOMA 3CKWA 3OCSA 1V0PA 5CSXA 4IX3A 4FSMA 3R0TA 3OT3A 2BROA 4XOYA 3QQGA 5HLWA 2JDTA 2PWLA 3BPRA 4FIIA 5F9EA 5L2IA 5HGIA 1PXKA 2UW4A 2WOUA 4YLKA 4FIEA 5BVFA 1KE9A 2BDFA 4EKKA 2XIZA 3Q2JA 1ZAOA 1YXTA 4ZXTA 2GNFA 4L3LA 4L8MA 3GXLA 4LM5A 4QRCA 4TYHA 4DBNA 5IA1A 3HAMA 5EFQA 2OJGA 4UYAA 1PMNA 2WTKC 4M3QA 1B6CB 4FL1A 2QHMA 2UV2A 5ANOA 3WZEA 2BZHB 1WAKA 3QQUA 4XG2A 5CSHA 3ZFYA 4B99A 4FVRA 3UOKA 3AD6A 3EZRA 4FNYA 3F69A 3R73A 5FTGA 4MQ1A 3NNXA 1F0QA 3E8CA 4DG3E 3LCOA 3W1FA 2DS1A 5HX6A 5TOZA 3EFKA 3EYHA 3NUUA 1H1PA 4F99A 1Q8TA 3SXFA 4KA3A 2P3GX 4HYIA 4BKJA 3QTUA 3UNZA 4MNFA 2CNVA 2UZNA 3V01A 1ZYDA 3PIYA 3O51A 5FEEA 3F3VA 2C1AA 3FI3A 1OI9A 1YXXA 2YCQA 2P2HA 5DEWA 1URWA 2EXCX 2F57A 3ZXTA 4WG4A 4ZZNA 5A4QA 4JQEA 3EN4A 3BBTB 4USFA 4FYOA 4B0GA 3PJCA 2VTHA 5L3AA 3E63A 2JIIA 3ZSGA 1PHKA 4O6LA 4DINA 3H9FA 3VRYA 5HTIA 5M08A 2VGOA 1MRYA 2A2AA 3G6GA 1NVQA 4V04A 2JIVA 3C5IA 2ITYA 3BV2A 3WF7A 4U43A 4JIAA 4ARKA 3BWFA 3W16A 2OKRA 3A61A 1FOTA 4K18A 4BDCA 4I22A 3ORPA 2X2KA 3VW8A 4YJUA 3LJ1A 3I0QA 3G0FA 4W4WA 1YHWA 3HV3A 3PYYA 5BX0A 3OEZA 2WQOA 4XLVA 3ET7A 4M0ZA 5B2LA 4QP4A 4I6QA 4DGNA 2FGIA 4TKSA 4ZZOA 2CKPA 3PWDA 3TWJA 3LFEA 4ANMA 4X2JA 4CYIA 1SMHA 4I0TA 1ZY5A 5AA9A 3MS9A 2OW3A 2YIWA 3PIXA 4GRBA 3ZONA 3TUBA 4RWIA 5HTCA 3GC9A 5HU9A 4Q9SA 2ETMA 2WKMA 4FGRA 2XS0A 3C4ZA 4WRSA 1XH4A 3F3WA 1Y57A 4CSVA 1GZ8A 3FMJA 3ID6C 2JITA 2YIQA 3RP9A 4V0GB 4ZJIA 4MF1A 1K3AA 2R3NA 4XNEA 3ZS5A 5JSMA 3NVKI 5IH6A 3QUDA 2ITZA 2XKEA 3F5UA 4E4XA 3EQFA 5LVPA 3PXQA 4DEGA 2GTMA 4IB1A 3OMVA 3LXKA 5EM8A 4C3PA 2XIKA 5ETFA 2XBJA 2X4FA 5EKNA 3R28A 3QWJA 3EQIA 2WMWA 2B9HA 5H8BA 5JRSA 3L1SA 3PY3A 4IB5A 2VTPA 4FV2A 3QRKA 1W0XC 1OPKA 3UZTA 5IUIA 4RX8A 4OT5A 2CLXA 4CTCA 1TQIA 4A4LA 2GDOA 2UZLA 3D5VA 3TV4A 5C8MA 3AT3A 2X0GA 1H1WA 1Q24A 2QOHA 1XH7A 5L2WA 5LCKA 4EI4A 3LIJA 4DH7A 3VQUA 4J99A 4ALUA 4D5KA 3KRXA 1YXVA 3DJ5A 4H1MA 3QCSA 3DXPA 3I7BA 3LFNA 4YJNA 4F0GA 1H25A 2VWVA 2WOTA 1RE8A 3Q52A 2VO6A 3HAVA 3NW6A 3BQCA 2YABA 3CQUA 4GFOA 4JG7A 4DH5A 4G3GA 3NCGA 3UYSA 2OICA 2XB7A 4NW5A 4ZTLA 4YZCA 5IQHA 3ZO1A 1REKA 3P5KA 2QR7A 4ZSAA 3OBGA 3NUXA 3VS0A 2OF4A 4G6NA 4KB8A 4C58A 2J50A 2VWXA 3EYGA 2ZM4A 1UVRA 2VGPA 2F7ZE 2W1GA 2R2PA 1WZYA 5J5SA 5AAFA 5LQFA 2XRUA 2YLFA 3GB2A 4NIFA 5D7AA 2PTKA 3CPCA 3PXYA 1OVEA 2GFCA 5E90A 2RG6A 3BHUA 3ZSHA 5CEOA 3S95A 4O86A 2QHNA 5FDXA 4AN9A 1FPUA 2VX3A 2W7XA 3RPYA 3OT8A 3SVVA 1CKIA 3FL4A 2WTVA 4EONA 2GS2A 1U54A 5ITAA 3ZEWA 4AZFA 3HECA 3SRVA 2WAJA 5HZNA 3VJNA 2BDJA 4JG8A 1X8BA 4ANLA 3D5XA 2Q83A 3FY0A 3IOPA 4F08A 4F63A 4QYEA 4IVCA 4R5YA 2F7XE 4K0YA 4HVGA 3BU5A 4TPTA 3DTCA 5KMJA 5DA3A 4NSTA 1ZOHA 2X81A 1J7UA 3HV6A 2HWOA 3Q32A 1ZLTA 3DBCA 3S2PA 5JFSA 4IM2A 4EK3A 5AUWA 2IG7A 4H58A 4RQKA 4XUFA 3ACJA 4IIRA 2FB8A 2B55A 4WA9A 5H9BA 3ULZA 4UEUA 2PULA 4UYNA 1CSNA 4WBBB 4GJ2A 4A9SA 1VR2A 3DFAA 3JYAA 4TT7A 3D83A 4RQVA 5F1ZA 2J6MA 2VX0A 5CNNA 5E8YA 3ULIA 4EHGA 2VAGA 5JFVA 4M15A 3UP7A 5AJQA 4FNWA 4X2GA 2UW5A 4ZS0A 4FV7A 5I9XA 3B2WA 2C6DA 4JXFA 5HHWA 2UW0A 4XCUA 4KBKA 3F5PA 4W9WA 3DJ7A 3SOAA 3SX9A 5HX8A 3VN9A 4DEIA 2R7BA 5J9LA 4FV1A 1H07A 4E5WA 4IWQA 1CMKE 4OTFA 2C3IB 1DI9A 3ZM4A 2BPMA 4X2KA 1NW1A 4GFGA 2CJMA 4RC3A 3CQEA 5LXMA 3BHVA 3R9DA 4HVSA 4NM3A 4Z3VA 4CVAA 4WO5A 4JI9A 4A07A 3IECA 3LCDA 2WMQA 4WBOA 3R8LA 3EN7A 4DBXA 3ZRLA 1FVRA 3MDYA 1TKIA 3KULA 5DR2A 1QPEA 2W0JA 4CG9A 4FK3A 4KIPA 3Q4TA 5CYIA 4IVDA 3PRFA 4YZMA 2XKDA 3TKUA 3UOJA 4LL5A 1PKGA 5IQCA 3DZOA 5H8EA 5BVWA 4BTJA 3A4PA 2JBPA 3FPMA 3BCEA 5EYMA 4ENYA 1JLUE 1M2RA 3KFAA 3KMWA 4JX7A 1KSWA 3UDBA 4P5QA 3U6JA 3WZKA 3QCYA 4USEA 3N9XA 2JD5A 4I5HA 5AP5A 2OIBA 4CZTA 4YSMA 2B0QA 1JKTA 4AE6A 4QMNA 3DXQA 2C6EA 4GIHA 3QC4A 4FL2A 4IDVA 5AIRA 4RT7A 2GU8A 4FV8A 2PUNA 3BLQA 3MFSA 3MVMA 5I3OA 3HYHA 4Y72A 3R8UA 3P78A 3DKOA 3V8SA 4XX9A 4PNIA 2QOOA 3U6IA 3FMLA 2QG5A 4AS0A 3UG1A 4KWPA 1S9JA 5BVEA 3GCVA 5HLNA 3KGAA 4EQUA 1OKVA 2C6LA 3N51A 3NS9A 2YM5A 4FKOA 3CC6A 4GJ3A 3TI1A 3MA3A 2NRUA 4BDJA 4CFWA 4EHEA 3K54A 3R22A 5DFPA 4R7BA 3GCPA 5AAGA 4EORA 4I5CA 2OWBA 2Y0AA 1J1CA 2VTJA 3AXWA 2IPXA 2GNIA 5HO8A 3MH1A 4IC8A 4ZOGA 4AG8A 3TJDA 3HVCA 3I60A 3PSDA 1FVVA 3UOLA 1V1KA 4ZY6A 1BYGA 3PP1A 1ATPE 3IW4A 2ITXA 3ZUVA 5DIAA 5GJFA 1APME 1JBPE 1RDQE 4FSUA 2JGZA 4DN5A 2WIPA 2QG7A 3VJOA 3R9RA 4II5A 4JRNA 2B9IA 4RIYA 1IEPA 1K9AA 3P7AA 4FTUA 5EW9A 3RK7A 5KMMA 1MRUA 5E8TA 5M56A 4OBQA 1WBWA 2WTIA 1M7QA 1H24A 2ZMCA 4J97A 5CQWA 3H9OA 2QQ7A 2O65A 4E3CA 2BUJA 2EVAA 4YZDA 3COHA 4APCA 1XH6A 5CF8A 2ETKA 3HRFA 2EXMA 5E8UA 1L3RE 3BYVA 2R4BA 3H30A 4W4YA 5ICPA 5DGZA 4ZIMA 5HI2A 2FSLX 2HIWA 3GI3A 5BVOA 2F7EE 5B7VA 5CSPA 3GFEA 2H9VA 1YRPA 1Y8YA 3JVRA 2V55A 3SAYA 4XP3A 2OLCA 2F2UA 3R1SA 2ZV7A 3IW7A 3GVUA 3RGFA 1UWJA 2ITUA 5IH4A 5HOAA 1U4DA 5EHOA 4BYIA 5IQAA 4EC8A 2VZ6A 3QKKA 3P4KA 1J91A 4PWNA 5A4EA 3AGMA 3QQLA 4KBAA 4CKJA 2V0DA 3N4UA 3UNKA 3ZH8A 2SRCA 4I1ZA 1XO2B 3E62A 4C38A 3ALOA 4OAUC 2Y4IB 4RJ5A 3PJ2A 4YJQA 2ONLC 2AYPA 3Q9YA 4HOKA 4L68A 4AA4A 4BIBA 3MY5A 5GHVA 3MPAA 4UMTA 4ZSJA 4NM7A 2UZEA 1R39A 1WBTA 4X3FB 5ETCA 4E8AA 3HRBA 2UZBA 3KRWA 4K33A 4QPAA 3LCTA 4ORKA 5CX9A 4KRCA 2VTOA 2XJ0A 4TWCA 3LLAA 4XV3A 2J9MA 3COIA 4G16A 4U5JA 5H3QA 4KS7A 3VF9A 4OTRA 4MQ2A 4PV0A 3CD3A 4KKEA 1MRVA 3FEGA 2PVRA 3ORKA 1WFCA 1PF8A 5I5ZA 2R0IA 3AC5A 3NLBA 3QZHA 5AADA 3KXHA 3LFCA 3VS7A 3GT8A 4N4SA 4YLJA 4I6FA 4HPTE 4FSNA 4NU1A 2WMRA 3KF4A 3CD8A 2G1TA 3FC2A 4DLJA 4MD9E 5HIBA 4GKIA 3ZLWA 1JOWB 4YSJA 4PNKA 4EQCA 4IX6A 4TYHB 1MQBA 1TQMA 4FSQA 4JVGA 5GZ8A 1UU9A 3MESA 3HZTA 1JPAA 4PRJA 2QU5A 5E1SA 5EQPA 3R7OA 2XK9A 3GGFA 4IHPA 3F3UA 2WQBA 3ZM9A 1MP8A 2PZPA 4E7WA 3HV4A 3Q9XA 4G1WA 3V5WA 3R2BA 3VS2A 2FSOX 4AOIA 4RJ3A 3UZPA 2Z7LA 3GCUA 3ROYA 4L67A 3TTJA 4W8DA 1DM2A 3GNIB 4KIQA 5JK3A 3AC2A 5LVLA 3D15A 1NXKA 2PZYA 4R77A 4FKGA 4MYGA 3FZRA 3MVHA 4ACCA 4CMOA 2CKQA 4CGAA 4HCUA 4EH4A 2YWPA 5AV2A 3UQGA 4O0YA 1P14A 3MH3A 3Q2MA 2B1PA 3AC3A 2R3OA 1TQPA 1PMVA 5J8IA 4HYHA 3KREA 2WEIA 4G34A 3VBXA 5J7HA 2VNYA 4E26A 4EH9A 2FUMA 4R7HA 4ZZMA 3VF8A 4NKSA 4ENXA 2C69A 1P4FA 3C4FA 4IEBA 4UWCA 3LM5A 3NUAA 4MTAA 5J95A 5D10A 3KN5A 4PP7A 5TKDA 1Q41A 4S31A 3IKAA 3UYTA 2UVYA 3DFCB 3OWJA 3ELJA 1Y6AA 3L9LA 4KIKB 4O0WA 4C7TA 5IH5A 1OL7A 4ZP5A 2PYWA 5GIOE 2PK9A 1OUKA 2PUUA 4G3DA 4ZTQA 5FBOA 4C2WA 5JH6A 3M1SA 1FBNA 3VUTA 4FEWA 3UMXA 5CXZA 3B8QA 3OS3A 1ZWSA 3TL8A 2W4OA 3MPMA 5IQBA 4XYFA 5FGKA 2ETRA 3D14A 3QQKA 2VWBA 3MB7A 2AUHA 3V8WA 5L8JA 1T45A 3FQHA 4UBAA 5BYYA 4C4JA 2P2IA 3Q4CA 4ID7A 4X0MA 4E4MA 4TYGA 5CAVA 4PPCA 5F4NA 4ZAUA 2EU9A 5AUVA 2IZTA 3QX2A 2I0VA 4UWBA 4FL3A 5E8SA 4AGCA 3QALE 5CXHA 3F61A 1MUOA 4F4PA 4DE4A 5CU4A 3AG9A 4EK6A 5AR7A 4CLJA 3K3IA 5TT7A 5EW8A 1IAJA 3UG2A 3E64A 4ZTMA 1QPJA 3QU0A 3KQ7A 4PTGA 4ZTNA 1WBOA 1R78A 1WVWA 3ODZX 4ACGA 3DJ6A 4JBOA 4L53A 4G17A 3ZO2A 2CN8A 1JNKA 3GQLA 3EQGA 3QD0A 3E7VA 4IX5A 4K9YA 2ITWA 5DBXA 4BCOA 1U59A 4C4FA 2YM8A 5CAUA 4GMYA 2ZDTA 3O7LD 1CM8A 4RA5A 1P4OA 3PE2A 3PIZA 2XRWA 1W7HA 2IVTA 3WIKA 4EWQA 5EYCA 4YHJA 3MV5A 1JKKA 4KKHA 3FKOA 2HK5A 3C51A 4ANQA 2VV9A 3F2AA 1QPCA 4C3FA 2WZJA 4JNWA 5J1VA 2YAAA 4WNMA 1KUTA 3ZXZA 3DAEA 4B8LA 3G51A 4YNEA 3REPA 3W2CA 4DFZE 3F5GA 4YZBA 2C0TA 4F9CA 3F9NA 1REJA 3QA8A 2VTRA 4RJ6A 4TTHB 3LXLA 1PXOA 4PUZA 4AACA 3DDQA 4OBOA 4EBWA 3EN9A 2WU6A 5JGDA 2YDJA 4D9TA 4RLLA 4DFLA 2R3QA 3MFRA 3F2RA 2YCFA 4FX3A 4C2VA 2J5FA 1XJDA 2BFXA 3RK9A 3BE9A 5M4CA 4JR3A 5E1EA 1M2QA 1W98A 4N0SA 4XV1A 5HG7A 2Q0NA 2WIHA 5TE0A 1J3HA 2RIOA 3HRCA 3TUCA 3DLZA 3UMWA 3SKCA 5FTOA 4EHVA 2XEYA 4QMXA 3LFQA 1PMUA 3HX4A 1AGWA 4XG3A 2IN6A 2VO3A 4BRXA 4NTSA 5CWZA 2UVZA 3RK5A 5L2SA 4DAWA 3VS4A 1HOWA 4CEGA 4C36A 3KK9A 2IVUA 5HESA 5D41A 1G5SA 1XBBA 4NIFB 3C4CA 4QYFA 1H08A 3M2WA 4IAIA 4IMYA 4JDIA 3IS5A 2J7TA 2OH4A 3HMPA 4U44A 5HG8A 1PXLA 1VJYA 3QRTA 3BELA 1UA2A 3LW0A 3R7UA 3DLSA 3A7JA 2W1EA 3IOKA 1DAYA 5EH0A 4DT8A 3L9MA 1Q8YA 1CKPA 2WEVA 2VWIA 4GT3A 3JY9A 4IJPA 4O2ZA 2BMCA 4TXCA 3UBDA 4JBVA 2XIYA 3ZLYA 3ZTXA 1U54B 5DRBA 3GOKA 4WUNA 5K5NA 2J90A 2A27A 5KO1A 4DFUA 4UXQA 4R78A 5M55A 3G9NA 4OTQA 4E93A 3ATTA 3TCPA 2A0CX 3QCQA 5JZNA 2W5HA 2E9VA 2XH5A 2QOQA 4AFEA 3RCDA 3ZUTA 5EW3A 5CAOA 4AFJA 2GPHA 3TDVA 5T6KA 4BYJA 3C4WA 2QLQA 1Q8UA 3C0HA 3LZBA 4PP9A 2WU7A 5EI6A 4AZEA 4IADA 4PQNA 4CTBA 5CEKA 5CT0A 4YJPA 2VD5A 1JSUA 1UV5A 3A60A 3K2LA 1Q3WA 1Q8WA 5HVJA 4D1SA 2I6LA 3NDMA 4BIEA 1K2PA 5H2UA 4L7FA 4JIKA 2PVKA 4NYEA 3LMIA 4BBEA 3U54A 1ERKA 3EN6A 4NWMA 4QQJA 5EM5A 3BX5A 4KSQA 4D2WA 3R01A 4IAAA 4NCTA 4AT5A 4BCMA 2YWVA 4ITJA 3OY3A 4HVIA 1GAGA 3Q60A 1O6YA 1ZY4A 5AP0A 4KUJA 3AGLA 4L3JA 5EOBA 4EZ7A 2YFXA 3LFFA 4BCIA 3ITZA 3EB0A 2VWYA 4GFMA 2YM4A 2YJRA 5GZ9A 2OXDA 3E93A 4IVAA 3DNEA 3R83A 5L6OA 5KHWA 2PUPA 5M4UA 3DU8A 3R1QA 4FSRA 4M69A 5CSVA 4I3ZA 2C0IA 5AUTA 1XHAA 4EOIA 4AW0A 2X6EA 5DT0A 1GY3A 1UKIA 2VWUA 3QUPA 4IDTA 5ANIA 5HNGA 3VS5A 5LMBA 3R9HA 3EQCA 3KULB 1BL7A 2ZDUA 3ORZA 4K11A 3AQVA 2VTSA 3AMBA 3TZ7A 4O1OA 4C4EA 3FMMA 2RSVA 4R1VA 3CGFA 2NO3A 3UO5A 3K3JA 3FE3A 4BC6A 4QPSA 4GYGA 5BUJA 3EQRA 3WF8A 1FGIA 3U4UA 4FKTA 1YKRA 5L8LA 5KBQA 1OGUA 4W9XA 2OBJA 2IW8A 4AE9A 3GCQA 2C1BA 2E9PA 4Y8DA 5AR4A 4ONAA 5AUZA 2BHHA 4EC9A 1ZXEA 3AD5A 3FAAA 3MW1A 4FI1A 4RIXA 4CYJA 5EQYA 2O0UA 3IDPA 4JL9A 5HQ0A 1ZARA 1YWRA 3QD4A 3PSCA 2C5OA 5KMOA 3AC8A 1UU7A 5JT2A 3ORTA 4G3EA 2C6KA 3IGOA 1HCLA 2R3KA 4NM0A 3R9NA 3FI8A 2CN5A 2IVSA 2BZKB 3I79A 4QMLA 3Q96A 3W2SA 4FTKA 3HDNA 1FVTA 3D5WA 4FTNA 3QUEA 4JAJA 3FL5A 2EB2A 3CPBA 3NGAA 3F3ZA 2XNGA 3S00A 4PDYA 2Z2WA 2H6DA 1Z9XA 3NUSA 3VUMA 4V05A 2C5NA 4CFVA 1O9UA 4NL0A 4DEBA 3GP0A 3MIAA 5AR5A 5GNKA 5BVDA 2ERKA 4R3PA 4RX7A 2J0KA 5IQIA 4LYNA 4XV9A 1YOLA 4C33A 1AQ1A 1G3NA 2XP2A 3VBQA 2CDZA 2XK8A 3PZHA 4GCJA 4Y73A 3LAUA 4QMSA 3FWQA 3ZC6A 2NNWB 2FVDA 2CGWA 5AA8A 2J0LA 4ZLOA 4EJNA 5HD4A 3D7ZA 2PE2A 4LGHA 4QOXA 4BY9E 4RIYB 4FTQA 5KZIA 2C3KA 3DBQA 4DTBA 5IKWA 2QNJA 4IANA 3UODA 3IO7A 3PP0A 2R3MA 2J51A 4GSBA 5L8KA 2OFUA 3OW3A 4GH2A 3EFJA 4NKAA 3FSFA 4YPDA 1Q8ZA 4C57A 3OXTA 1ZMWA 3C50A 2QKRA 4O38A 4KIKA 4YLLA 3R8VA 4J8MA 4KKGA 4HYUA 2BR1A 2C30A 5AV3A 4OTPA 3FBVA 2QONA 4QQTA 3T9TA 2OZAA 4FKIA 5K5XA 3P79A 3PY0A 3BGPA 4U81A 2IZRA 5IQDA 3OW4A 3L8XA 3DBEA 1UU8A 2BILB 3BI6A 4RIWA 4IZYA 5IA5A 1F3MC 4BCPA 3PJ1A 1J7LA 1FMKA 2X4ZA 4W4XA 4U7ZA 1Q62A 4R5SA 3AC4A 2X9FA 3D2KA 2G15A 2FSMX 2J4ZA 3POZA 4QP2A 3MJ1A 3PA5A 3OROA 4QQCA 4UZDA 5HLPA 4AU8A 2YISA 4DEDA 1LEZA 3TNPC 2C6OA 4XBRA 4U9AA 5LWMA 3FYKX 5HD7A 4X21A 2OJFE 2YM7A 4E6QA 2RG5A 3TKIA 2XUUA 3EQBA 4F9WA 1VEBA 2CGVA 4JBPA 5HE2A 3JXWA 3DPKA 4M84A 5FWKK 4RSSA 2J0MB 4QP8A 4QP9A 1Z5MA 3IG7A 4C59A 4CFUA 2Q0BA 3UP2A 3WZJA 5AR3A 4CT2A 2UZUE 4PL4A 3BKBA 5HCXA 3OCBA 4G9CA 1W82A 4JOAA 4O7SA 5HG5A 2XCHA 3ZYAA 4LOPA 4EYJA 3MBLA 4A4OA 5LMKC 5LWNA 4RFMA 2V62A 4D4RA 4GG7A 3G5DA 2JIUA 3R2YA 4BCKA 2C6TA 5ANGA 4OAVB 4ZTHA 3C4EA 1OMWA 5AUYA 2X6DA 2YLEA 3DXNA 4P5ZA 4H36A 4GV1A 2GS7A 3TZ8A 5I0BA 2XM8A 4DH8A 4G3FA 4GU6A 4PMMA 3OY1A 4BB4A 4D4VA 4XLIA 1H4LA 5IEYA 5JMSA 2PZIA 2X7OA 5HU3A 3SDJA 4AZSA 4FIJA 4XG4A 1PYEA 4PMSA 4RLKA 3EFLA 2QD9A 4L9IA 4N70A 4GIIA 4LG4A 3NSZA 2W5AA 5AR2A 3CS9A 4FZFB 4UMQA 3ZO3A 2J0IA 5EDRA 4QTBA 4RPVA 3P9JA 3RZBA 5M06A 4L00A 4MEDA 4O7RA 4M13A 3FI4A 3QD2B 1LP4A 2C5VA 3R8PA 5KKRB 3O96A 3OTVA 3O0GA 2BRHA 1XKKA 1KE8A 3V5PA 4TYEA 4E4LA 2Z02A 3R1YA 3QLFA 1IR3A 4R6VA 3GEQA 4WNPA 4ACHA 1SNUA 4OBPA 1XH5A 4MNEA 5J87A 4AN3A 2VTTA 2GNJA 4A4XA 3HNGA 4JG6A 4WNKA 1FINA 4FZ6A 2E2BA 3NNUA 5K3YA 3VBTA 5JQ5A 4Y95A 4QP1A 5CEPA 2JKQA 2OSCA 4NJ3A 4YNOA 4ZS4A 3RBWA 5EYDA 4ALWA 3LM0A 4BCFA 2C6IA 5LJJA 1P5EA 3Q53A 3CXWA 1H26A 2VTLA 5JGAA 1WMKA 2BKKA 1OKZA 2JAMA 3HGKA 3CY3A 3PA3A 3OD6X 2W9FB 4ZJJA 3BHHA 4R8QA 4HGLA 4I6BA 1Y8GA 4AOJA 3EHAA 4U79A 1SZMA 4RFZA 3W8LA 5JFXA 1NVSA 2JFLA 4O0XA 4BDKA 2O64A 4QP6A 3TTIA 4CQGA 4PF4A 3FMDA 4FKQA 4IM3A 3FMHA 3ZHPC 3KN6A 4GK2A 4XRLA 4FG7A 3T3UA 3R21A 4LRJA 4TWOA 3QZGA 3O50A 2OJIA 2WPAA 5JEBA 5K4JA 3E3PA 4FIGA 2B7AA 4KNBA 2OXYA 4FBXA 3BBWA 3WYXA 4D55A 4Z7HA 4FEVA 5DT3A 3PLAE 3LLTA 4ANBA 3FHIA 4DA5A 3HA6A 4DGLC 4EH8A 4Q2AA 4EOQA 4UMRA 5CVFA 5LVOA 4FV4A 2BRBA 2WMBA 2YZLA 3R30A 4IW0A 4UALA 3QRJA 3SW7A 3NRMA 4E6DA 4W4VA 5FM3A 3MJ2A 2UZDA 4YC6A 4LQMA 2W1FA 3AC1A 5A54A 5IF1A 3TNWA 2R3GA 5HORA 3DK7A 5LMAA 4EZ5A 2DUVA 2W4JA
chains in the Genus database with same CATH superfamily
4EJ7A 4FK6A 3RINA 4Q9ZA 3R00A 3VUDA 5A4CA 5K9IA 1LR4A 3L8PA 2C0OA 3NUYA 2C4GA 5E92A 3ZRMA 3ZSIA 3ZEPA 3O8PA 3JPVA 4IX4A 3UIUA 5DNRA 4FEXA 3W18A 1PXNA 2RF9A 3TNQB 2WD1A 4IZAA 2W1ZA 1H28A 4JQ7A 2YZAA 1YDRE 4RX5A 2AC5A 3LFAA 4U97A 4A06A 5AEPA 4UN0C 4FG8A 4EUTA 4M67A 3BGZA 3WIGA 4QMMA 1V0BA 4RJ4A 2BCJA 1FQ1B 2GTNA 2RFEA 2BAJA 3FQSA 3KL8A 3BHYA 2WMVA 3A7GA 2A1AB 1RQQA 5AR8A 4XOZA 4D1ZA 4FSTA 4BTFA 5KMIA 3ANQA 5DE2A 5AM6A 5ANDA 3BLRA 1ZOEA 4HCVA 4NZWB 1R0EA 3OCTA 4GUBA 3KRRA 4QMTA 4DEHA 3DAKA 3Q3BA 3Q6WA 3C0GA 4FNZA 2HWPA 3RAKA 5L6WL 5CEQA 1Q97A 3UPXA 2PU8A 4EOKA 4KIOA 3TIZA 4G5PA 3NUPA 3KEXA 2RFSA 5EM7A 2ACXA 4HJOA 4FSYA 4BDHA 4CLIA 5H8GA 4F65A 1MQ4A 2X7FA 2ZB1A 3EOCA 2X8EA 5L2TA 4BCGA 2ITPA 4YGAA 4J96A 3KIOC 3E8DA 4LV5A 2LGCA 2R0UA 4FT9A 3W32A 4U6RA 5JQ8A 3F82A 3QXPA 5AIKA 4GUEA 1B39A 5GJGA 2QKWB 3TNIA 4D9UA 4YTCA 5C4LA 4AWIA 1IASA 5JGBA 3UIMA 5K4IA 3O71A 4L44A 3DOGA 4OW8A 4AW5A 3UDZA 1I44A 4S34A 5EYKA 2OH0E 3ZFMA 2W4KA 3FMKA 4DH1A 5CASA 4CKRA 2F9GA 3NWWA 4IWOA 4MX9A 3LFBA 4ZK5A 3W8QA 3EMGA 3QTQA 4EOJA 4BCQA 4CQEA 3NNWA 5A4TA 2FSTX 4GK3A 1ZYLA 4R7IA 1T46A 3EFWA 4A9TA 4BICA 2RKUA 1UNHA 3CP9A 2ESMA 4CZUA 4IAKA 3HMIA 2JKMA 4OTGA 3RZFA 3BZ3A 1LPUA 4ASEA 4O7LA 2BRNA 2UW8A 1GOLA 5BNJA 1VYWA 3I7CA 4C8BA 3H9RA 1IA9A 3V04A 4I0RA 4DHJA 4BJJA 3OEFX 5DVRA 4FRFA 2W96B 2J0JA 3P23A 4BBMA 2CCHA 3KA0A 3H0ZA 3FC1X 4D1XA 4TWPA 3MN3A 4F0FA 3VBVA 3ZO4A 2A4LA 4FUXA 4X2NA 4M69B 5HBHA 3AMAA 2XMYA 4JR7A 4YTIA 1OPLA 2FA2A 3SW4A 4HVHA 2ITVA 4RJ8A 1ND4A 3KXNA 1O6KA 4LRKA 2OGVA 5AUUA 5DMZA 3TKHA 2AQXA 4YO4A 4IXPA 4IZ7A 4JJRA 2JFMA 3OOGA 3MVJA 2R3JA 4ZLYA 4QEBA 5J7BA 3JUHA 4WG3A 4AZTA 4QMQA 3BEAA 4CT1A 3OCGA 5DEYA 2YCRA 1E1XA 5TO8A 2CKOA 2W1HA 5JZJA 1B38A 3NVMB 4CD0A 4DF3A 2R3PA 3U87A 1J7IA 1RW8A 1W2DA 4RIXB 5ANEA 3GU8A 3UO6A 2B9FA 3ACKA 1SM2A 2ZV8A 4RX9A 3UNJA 4CV8A 5IZFA 1IA8A 2W5BA 1PXIA 4EOOA 1BI7A 3AT2A 5AV1A 4YJSA 4EH3A 2BZIB 2R64A 4PMPA 1G8SA 3S0OA 3V5QA 3OHTA 1NA7A 3BEGA 1OKYA 2IO6A 2Z7SA 5AUXA 4AGWA 2P0CA 5CAPA 2FYSA 2GSFA 2HZNA 2Y8OA 3DB8A 3HMMA 4FGBA 3ZMMA 4AQCA 4MKCA 3CE3A 3UIXA 2Z60A 3R7GA 4K6ZA 3NIZA 2GHMA 4ZEGA 4DITA 2JBOA 4HGSA 1E9HA 4JDHA 2XJ2A 3QQJA 5LOHA 4ERWA 2XM9A 1RJBA 3RNYA 3BYSA 4MWHA 3R6XA 4F70A 2IW9A 5IA3A 1L8TA 3BU6A 4JDKA 4O21A 4UWYA 4AGUA 1OIYA 4BDGA 4HZRA 3BLHA 3ZRKA 5M53A 3LCSA 4XG8A 3ZDUA 3KMUA 3GU5A 5EHLA 1GNGA 3Q5IA 3QGWA 4O7YA 3PUPA 4C4GA 4EUUA 3NW7A 4TNBA 2WFYA 2Y9QA 3E87A 4BHZA 5M4IA 4I5PA 1KE7A 4DYMA 4AW2A 4F6SA 5CENA 3WOWA 2V7OA 3RWQA 3PRIA 3VS3A 2OO8X 4XMOA 3F66A 3DNDA 3T9IA 4TZRA 4DG0E 1M2PA 4AP7A 1XH9A 2NRYA 2OJJA 1E1VA 5CVGA 5EK7A 1BUHA 5JFWA 4XV2A 2IF8A 1G8JA 3RAHA 2WXVA 5CT7A 3HV5A 4I23A 3NYXA 5FRIA 5DH3A 5BUEA 5DG5A 2QODA 5CZHA 3KY2A 3MFTA 4GT5A 1W8CA 3QYWA 4KD1A 4MBJA 4O96A 3LOKA 5I9UA 4QDEA 4MWIA 3DCVA 3MI9A 4EH5A 2ONLA 2OZAB 3E8NA 3ZUUA 1U5QA 2W17A 2PMIA 3QZIA 3WE4A 4FIHA 2R3RA 4M97A 2ZV9A 3JVSA 2G2HA 4HYSA 5E8XA 4IAZA 3RTPA 4O6EA 2CHLA 4RIWB 3RM6A 3N4TA 3DGKA 4YR8A 4J52A 4YTHA 3R7YA 2HOGA 2YACA 4FTAA 4EH7A 1WBSA 4NUSA 2A19B 4D2TA 5E91A 4L45A 4ITHA 3CBLA 4KBCA 4EH2A 3B2TA 5EM6A 3FYJX 5EQEA 3E7OA 5C27A 1QL6A 2FO0A 2YDKA 3GCSA 3FJQE 3KXMA 2ZMDA 5D9HA 3UGCA 3PVUA 4U41A 3S4QA 2C3JA 2BFYA 4QYYA 4E73A 4E5AX 2QC6A 3TZMA 2XK3A 3F5XA 2C6MA 3ANRA 4EOMA 2XA4A 2XCKA 4GW8A 4BGGA 3W0RA 4OTHA 1OIUA 3HV7A 2WTKB 2OK1A 2O8YA 1ZYJA 1Q3DA 3T3VA 3A7IA 4CMTA 3LMGA 2XNOA 3I81A 4OLIA 5IEVA 1QCFA 2F49A 2W99B 1GIIA 4U3YA 5CY3A 2IZUA 3MPTA 3V5JA 4O0TA 3V6RA 3LFSA 5IMXA 4D58A 5B2MA 3EWHA 3NYOA 5DOSA 3RCJA 2YIRA 5BVNA 4ZMEA 4FTOA 4EOPA 5CQUA 3FZSA 2PUIA 5TF9A 4DTAA 3SXRA 5M51A 4USDA 4O22A 3ETAA 2UW7A 4RWLA 3RAWA 2EB3A 2WHBA 1ZZ2A 3H0YA 1BI8A 3UIBA 3VO3A 4AT4A 4TYIA 3FKLA 3PY1A 3WBLA 4UMPA 3ZDIA 4B9DA 2WNTA 3QFVA 3OWPA 3RM7A 4BR3A 3VUIA 2Y4IC 1M17A 2QCSA 3NNVA 1OPJA 1AD5A 2O5KA 4MBIA 4RIOA 4BTKA 4YC3A 3W0OA 1YXSA 4X3FC 1KOAA 4WIHA 1CTPE 4L3PA 4EK5A 2WMAA 4BVUA 1LEWA 3SV0A 3U51A 2UZWE 3PFQA 3TV6A 3UVPA 4AA0A 4AUAA 4MBLA 4BN1A 3HP5A 4FT7A 3R1NA 5EDQA 4MXCA 5EI2A 5M07A 2BHEA 3CCNA 3R04A 3ZLSA 4QMPA 3R63A 5I3RA 2X9EA 1UKHA 1WCCA 2P55A 4GU9A 4HNIA 3LFDA 4EL9A 4BZNA 4MNEB 3WZUA 3QAME 1PKDA 1FGKA 4C4IA 5AFVA 3HMOA 3W55A 3FLSA 5J9ZA 4EKLA 3TM0A 2XNMA 3CR0A 3FSKA 3P0MA 4L01A 4ANSA 2HZ0A 5HIEA 4WHZA 3SD0A 5KE0A 5E9EA 3VIDA 3OXZA 2CNUA 2YN8A 1KV2A 4K1BA 3RAIA 4EWHA 3QQFA 3NPCA 5C8KA 1DS5A 4XHKB 1H1QA 4ITIA 4WSQA 4YJTA 4D2PA 2PSQA 5C9CA 4BDIA 3EZVA 4D28A 4BTMA 2VNWA 4IWDA 2YA9A 4R1YA 3TT0A 4EZ3A 3W0NA 1ST0A 2GFSA 3CY2A 3NCZA 4BZDA 1GZKA 3I1AA 4QMWA 1P2AA 5LVNA 4NM5A 5J1WA 4AQKA 2PL0A 3AKLA 5AP3A 5E4HA 4AT3A 1R3CA 3C5UA 1SVGA 3QQHA 3HA8A 3GBZA 4D2RA 1OL1A 3O2MA 2HELA 5LCJA 2JDRA 3D7TA 4P2KA 2WTWA 2P4IA 4ZTSA 4AZWA 2W1DA 4Y5QA 4CRLA 5A14A 2RL5A 3QXOA 4FKLA 5HE3A 2Y6OA 4A7CA 3TMOA 2CGXA 2GMXA 1WBPA 3A8WA 2QO9A 3UO4A 3W2RA 2CCIA 5E8ZA 2Y6MA 2ITNA 3MVLA 2UZTA 3QTIA 4H3PA 4J7BA 4WG5A 3M11A 4XEYA 3KKVA 4YBKA 4FMQA 3I5NA 3R8ZA 5M57A 3UVQA 2C68A 2CSNA 2GNLA 1OECA 3BV3A 4TN6A 3WYYA 4ASDA 4DFYA 4FE2A 4I20A 4PY1A 3DBDA 1JVPP 3PJ3A 5ACBC 2C47A 2PZRA 2XIXA 2Z8CA 3NX8A 5CS6A 3ROCA 3T8OA 1BLXA 1QMZA 2I1MA 3S1HA 3TACA 4H1JA 3F3TA 4LUEA 2XYUA 1M7NA 5L6PA 4ANNA 4DH3A 4J8NA 4E5BA 3QTWA 5KUPA 3OBJA 3FQEA 4RRVA 4O7WA 2PVYA 3DA6A 1ZMVA 3QD3A 3V3VA 3BWJA 3DKGA 2IVVA 3WZDA 1G8AA 2ITTA 3FLYA 4DEAA 3E92A 5I9VA 3EQDA 2CMWA 3QBNA 3NYNA 2O63A 3C13A 3LXPA 3ORMA 3NUNA 5B2KA 1UU3A 4C3RA 1KE5A 4FEUA 2Y4PA 5J9YA 4K8AA 4P4CA 2VTAA 4BGHA 3MA6A 3UQFA 5ETIA 3HL7A 3HLLA 4NK9A 3Q04A 3RPRA 1KOBA 2RGPA 3COMA 3CTQA 3IK3A 4NW6A 3ZBXA 4QMYA 1PXJA 5CF4A 1UNLA 4ACDA 3AKJA 3FV8A 1U46A 3GUBA 4YMJA 1H0VA 3PPKA 3L8VA 2CLQA 3VQHA 3W2QA 1BKXA 3CLYA 2OIDA 3COKA 4PDSA 1ZMUA 3GU4A 5BMMA 1ZRZA 1YWVA 4AW1A 2HENA 4C4HA 4BI0A 4BBFA 2HCKA 5A46A 4XJ0A 5DR6A 2XK6A 3Q4UA 3R7IA 1H0WA 3PXFA 4EBVA 4ACMA 2ZM3A 2C3LA 2JKOA 3FY2A 5T3QA 4JS8A 2BVAA 4P7EA 4LOQA 4U0IA 5CNOA 1YOMA 4NTTA 2QLUA 3LE6A 3OTUA 2WMSA 4RMZA 3ZU7A 3BU3A 4BWPA 3JS2A 3F88A 4QTEA 3KB7A 3W2OA 2E9NA 2YM6A 4O91A 2WGJA 5M4FA 5M09A 1YHSA 4XG9A 2PPQA 5C4KA 3EH9A 3ORIA 3RNIA 4OT6A 4MXZA 3THBA 3MB6A 3KC3A 4O4CA 4RJ7A 1NVRA 4UZHA 3Q5ZA 4O0VA 4CV9A 3MH2A 4HZSA 3SLSA 2CPKE 5AP4A 3WARA 4YURA 5CF6A 3FZPA 4GL9A 4RZVA 4FC0A 4YZ9A 3GU6A 4G2FA 2V5QA 2V7AA 5KHXA 2GQSA 1DI8A 3IDCA 1NY3A 3V8TA 2F2CB 3EQHA 3KMMA 4GKHA 4TL0A 4FTCA 4WNOA 4U3ZA 3QX4A 1A48A 2BAQA 3D0EA 3O8UA 3O23A 4CFMA 4TYJA 4L52A 2XANA 4L42A 3MY1A 4IFGA 4IM0A 2BDWA 5CALA 4Z16A 5FUTA 2VUWA 4DCEA 4QO9A 3VVHA 4DTKA 4PX6A 4CKIA 1M52A 3DZQA 2XEZA 3O7LB 3DKCA 3MIYA 4GYIA 3IDBA 3AOXA 4YJVA 4I24A 1V0OA 3QKMA 1CKJA 4BJJB 5HCZA 1KWPA 4BHNA 2YAKA 1UWHA 1EH4A 5M44A 5DHJA 1WVYA 1GIJA 2UW3A 4WRGA 4B8MA 5IQFA 2I0HA 5F94A 3V51A 4OGRA 4WT6A 4YJOA 4DGMA 4TW9A 3LXNA 3ATSA 2WO6A 3PG3A 4MVFA 5T68A 3F7ZA 3WI6A 5AM7A 4RC2A 4BIDA 3GC0A 3R7EA 2O3PA 5GINE 1O6LA 4O4FA 3CSVA 3AMYA 4PPAA 2NPQA 1GZNA 3G9LX 3GQIA 3VNTA 2I7QA 2BALA 4IFCA 3TXOA 3L9PA 4UXLA 3MH0A 3DKFA 1XMMA 3PXKA 4XH6A 5DT4A 2JKKA 3SHEA 2GQRA 3QTXA 2YITA 4UB7A 3TN8A 4BZOA 4BFMA 1OL6A 2IW6A 4NFMA 2QURA 5B0XA 4JQ8A 3ZOSA 4A9YA 3BYOA 5KMLA 2EXEA 2KULA 5HNIX 3F2NA 3RJCA 1YI3A 3SOCA 3I4BA 1M14A 4Z7GA 2E9UA 3NAXA 4G31A 4G3CA 2UUEA 2ZM1A 4QTDA 3NW5A 4XP0A 3FZ1A 5I9YA 1OB3A 4YU2A 4F9YA 4G6LA 1R0PA 4I21A 4DHIB 3FMNA 4X6QC 3VUKA 3I6WA 3QTZA 4JDJA 5HBEA 4FTIA 4HGTA 4FT3A 1ZOGA 5CZIA 3SC1A 4B7TA 5KNJA 3VBYA 2PE0A 5FDPA 3QLGA 5IPJA 1VZOA 5DRDA 4RA4A 4X2FA 5EHYA 2VWWA 2VX1A 2PVNA 4BWXA 4D4SA 3U9CA 5A6OA 2QOKA 1JSVA 3ZC5A 4XBUA 5DWRA 5HVKA 3U55A 4XP2A 2XNBA 3HMNA 4ASXA 1YQJA 2ZYBA 3E5AA 3BHTA 2YIYA 3ORLA 3QL8A 2QVSE 3VS6A 3H3CA 4EK4A 4FA2A 4QMZA 4M66A 3VHKA 4BCHA 3RVGA 2ZFYA 1PMEA 2BIKB 4XG6A 3UOHA 2OZOA 4H3QA 4Z55A 4BF2A 4IH8A 2PZ5A 4O84A 3PVGA 4LUDA 2HZ4A 2KTYA 4O0UA 4F6WA 2AC3A 4DLIA 5JN2A 2OIQA 3UDTA 2BRGA 2JDVA 3KK8A 3PSBA 1OL2A 4M68A 3C7QA 3ORNA 4O7ZA 2VTMA 3KU2A 4PTCA 4EH6A 4WOVA 1HCKA 4QNYA 5F95A 3RALA 3KF7A 3C0IA 5IQEA 1OUYA 4EHZA 4FODA 3UTOA 3O17A 4I5MA 4QQ5A 3OC1A 3E3BX 3OXIA 4D5HA 3ZZWA 4BI1A 4O2PA 3BQRA 5ANJA 3QGYA 2ZVAA 3PJ8A 4BKYA 4CRSA 5CLPA 1GIHA 3LQ3A 4FYNA 4PDPA 4ZJVA 2G2FA 4Z9LA 5JKGA 3K5VA 3CTHA 4UX9A 1SYKA 2XNNA 5I9WA 4RBLA 2XNEA 3MTFA 3KXZA 4UV0A 5HNBA 4O7NA 2PVLA 3IPHA 4YJRA 5FTQA 3UPZA 2BRMA 2GQGA 3K5UA 5A9UA 5E8WA 4IACA 3GFWA 4BDAA 5E7RA 2J2IB 5BUIA 5IA4A 3CJGA 4RZWA 3QHRA 4NH1A 1S9IA 2VRXA 1YI6A 5AMNA 3P86A 5HE1A 4AZVA 1OKWA 2R3HA 4KS8A 1JSTA 4BDFA 3EKKA 5AV0A 3TZ9A 4N6ZA 5LMKA 5EKOA 4CMUA 2PMOX 3AKKA 5FLFA 2I40A 4I4EA 2HW7A 2ITQA 4K77A 4M12A 5BQ0A 5DN3A 4YZNA 3WILA 3CGOA 4F1TA 2YM3A 3FLQA 5HKMA 1URCA 4C61A 3FKNA 3GC8A 3LQ8A 3IW8A 3BYMA 4F1OA 4PPBA 3ORXA 5FP5A 3JR1A 3CJFA 3LJ2A 3EIDA 4OTWA 1H01A 5IISA 3OFMA 5L2QA 2QOLA 2YCSA 3WF6A 4IJ9A 2XZSA 2B4SB 5GZAA 3P5JC 2XF0A 5ACKA 3RPSA 4DFNA 2WMTA 2ZOQA 3A7HA 5GJDA 4MAOA 2IWIA 4FOBA 3S3IA 4EEVA 1Q61A 4AOTA 3D2IA 3D5UA 1PYXA 3H4JA 4I0SA 3ODYX 4X7QA 3MTLA 3PVBA 1H1RA 3ZCLA 3C9WA 3F7WA 4IQ6A 4RVKA 5FEDA 4CCUA 4D2SA 4DG2E 3N4VA 2E9OA 1SVEA 4NEUA 2BIYA 2XJ1A 1XBCA 3R71A 4OTDA 4H05A 4U40A 2B52A 4N6YA 2CNQA 5FQDC 5HE0A 4C0TA 3UC3A 3LKMA 4DFBA 1ZYSA 5AP2A 4PL3A 4ZSGA 3A4OX 2GS6A 3BIZA 4P90A 4FF8A 4FT0A 4UY9A 5TR6A 4AAAA 4C02A 4J1RA 3TV7A 1Q99A 2XIRA 4HVDA 5CF5A 3W0PA 3GOPA 5G6VA 3QKLA 2OI4X 3M42A 5AP6A 2R5TA 3PWYA 1JKLA 4CXAA 1Q4LA 5KCVA 2PVMA 2HYYA 3U8WA 2R9SA 4QMUA 3TDWA 1XMLA 2H34A 2YJSA 3RHKA 4F9BA 4DFXE 4XG7A 2IZSA 5BYLA 3GC7A 4FICA 3MGYA 4LGDA 2PE1A 2PMNX 5BYZA 4M8TA 3BLAA 2VU3A 2F4JA 4MH7A 3NYVA 4QMOA 3D4QA 4KRDA 3KXXA 4HPUE 5J5TA 3OP5A 2EUFB 1PY5A 2XNPA 3G90X 2WQNA 1XR1A 2Z7QA 5C03A 3NR9A 1Q5KA 2YERA 3QRUA 3II5A 5E8VA 2REIA 4FOCA 4BWKA 3UZRA 4DCAA 1FMOE 4H39A 4IAFA 5AP1A 4BGQA 4DGGA 3QA0A 3VWAA 4I6LA 4FTTA 1OIRA 2HXLA 2CKEA 4A9UA 4BKZA 2QOFA 5IMEA 4MD7E 2HW6A 2PY3A 4F7SA 4DDIA 4GG5A 4FNXA 3NIEA 4LOOA 3IQ7A 5AWMA 3A99A 3Q6UA 3DB6A 5K0KA 1OBGA 4YHTA 3ZFXA 1STCE 2HY0A 3OVVA 3PE1A 4CG8A 4I92A 3L9NA 3PXRA 3WF5A 3FUPA 4PMTA 3ENMA 4MCVA 5CVHA 2QOBA 2HAKA 3PA4A 4RG0A 4TNDA 2X39A 4ZLZA 4WD5A 4D0WA 3QRIA 4ZY5A 1IG1A 5CANA 2WTJA 2NP8A 3D7TB 2PHKA 2UW6A 3DAJA 4F9AA 4C34A 4ZY4A 1OZ1A 4FTJA 3AD4A 3FLZA 2X0PA 4I4FA 3LVPA 3VW6A 5KKRC 3PG1A 4O7VA 1YWNA 4Y85A 3V5TA 3FHRA 2PVJA 4FT5A 4W8EA 4EOSA 3FDNA 2QO2A 5CU6A 5LARA 2QO7A 5C8NA 3ENHA 4EOLA 3KRLA 3P7BA 1Y91A 2G01A 2YDIA 4C37A 3FZOA 1Y6BA 3DDPA 3SXSA 4IB0A 3OF0A 2OG8A 5IDPA 4TWNA 5HO7A 3P08A 2XK4A 4IE9A 3VC4A 5IA2A 5HICA 3RI1A 1KE6A 1BMKA 2DQ7X 3KRJA 4FZAB 3DQXA 3FZTA 3QYZA 3QWKA 4U80A 4CCBA 4F0IA 4E4NA 5I4NA 5EI8A 4R3CA 4B6LA 4ZMFA 5D12A 2QU6A 3Q9ZA 1H27A 2IJMA 4QNAA 3FLNC 2I0EA 4JLCA 3FPQA 3CKXA 3IGGA 4CFNA 4R3RA 3EJ1A 3OWLA 3IW5A 2FH9A 4V0GA 5FXSA 4FG9A 4GEOA 4D2VA 1ST4A 4D0XA 2BTSA 4BDEA 4U42A 3B8RA 5J79A 3FI2A 2YHVA 2XBAA 2R3FA 4FTMA 2I0YA 4HNFA 4IC7A 5FXRA 3HEGA 3WF9A 4FV6A 2WQMA 4FKVA 2WMXA 3W10A 3L8SA 4U45A 3E88A 3FXWA 5HO6A 4N57A 1OL5A 5DLSA 5HEZA 5EDPA 3SG9A 3A2CA 2QOCA 3LCKA 5C1QB 3JY0A 4AN2A 4L43A 4O83A 5CAQA 4Q5HA 3DY7A 4HGEA 4GK4A 5FXQA 4LV8A 5A4LA 3DK6A 3UC4A 5FP6A 1SVHA 3NMUF 4TY1A 5I9ZA 1YHVA 5DPVA 3ZZEA 2OU7A 3MWUA 3QZFA 5ANKA 3UJGA 4ASZA 4RWKA 3Q9WA 3LJ0A 5AX9A 3FXZA 2H8HA 3KVWA 3RMFA 3KVXA 4FKPA 4F6UA 3KCFA 4YUQA 4GVJA 1VYZA 4O0SA 2G9XA 1YXUA 2OXXA 2CGUA 4QT1A 3EKNA 3F6XA 3PTGA 3RPVA 2UZOA 4BDDA 4KAOA 5CU2A 2V22A 4NJDA 3OWKA 4FVPA 2VTNA 3MSSA 4XRJA 4IZ5A 5G1XA 5A3XA 3UVRA 1IAHA 1GJOA 3DS6A 4FV9A 1PW2A 1XWSA 2BAKA 2DYLA 4L46A 4M14A 1Z57A 4L7SA 3G33A 2C5XA 2QR8A 5HBJA 1DAWA 4HCTA 4FKJA 4F7LA 3UQCA 4G5JA 2ITOA 2OJ9A 4FKWA 1GZOA 3RWPA 2WELA 3DTWA 2JLDA 4TRLA 3VBWA 3WE8A 2XVDA 3PPJA 3UE4A 5KBRA 3EL8A 2ZAZA 1I09A 3G6HA 2PVFA 2XKCA 4EYMA 1ZZLA 3ERKA 3DV3A 5KMNA 3TUDA 3P1AA 4Y46A 2B9JA 3CQWA 2XAOA 2HXQA 4FEQA 2XKFA 4J71A 4NT4A 5LVMA 2GHGA 1UNGA 4QTCA 1A06A 3QC9A 1QPDA 5KZ0A 4FSWA 4FUYA 5C01A 3V5LA 1PJKA 4PTEA 4K2RA 2VN9A 5BPYA 1XQZA 5K0XA 4H3BA 4UMUA 3EN5A 4ZSLA 3P7CA 2W9ZB 4O0RA 2BTRA 3LHJA 4YO6A 1KV1A 4AX8A 5CEMA 4C62A 3D94A 3MYGA 5FBNC 4OTIA 3KCKA 4RGJA 3CEKA 3QCXA 4FZ7A 4YBJA 5DI1A 4YPSA 4AF3A 3OUNB 4RC4A 4O1PA 1YOJA 4X6RA 4AXCA 2VTIA 5EG3A 3LMHA 3ALNA 4FKUA 2X7GA 4IB3A 4KINA 2H96A 2R3LA 4I41A 5HG9A 3VUGA 1H00A 3U6HA 1R1WA 2YEXA 5FEQA 2C5YA 2BKZA 3OUKA 1IRKA 2LAVA 3I0OA 4LGGA 5D11A 5ETAA 3TG1A 3V6SA 4PDOA 4CFFA 4IWPA 2R3IA 3POOA 4J98A 4OUCA 2HZIA 3RKBA 3U9NA 4APPA 1BL6A 3QTRA 1PRYA 2VO7A 3W2PA 4DHFA 2JDSA 4MXYA 4IAYA 4EQMA 2ZJWA 3NAYA 5BMSA 3HP2A 3I5ZA 5JRQA 3G2FA 4F78A 3PPZA 2OF2A 4L6QA 3TJCA 5IDNA 1OITA 5AP7A 2JEDA 4Y83A 5HVYA 2YIXA 2Z7RA 3CTJA 4NCTC 2QOIA 4FR4A 1JQHA 4O27B 4BL1A 5AV4A 4QTAA 4O82A 5HIDA 4PL5A 4ZTRA 4G6OA 4OR5A 5HTBA 1BX6A 2HY81 2VTQA 5CEIA 5IA0A 4MXAA 3CIKA 3LPBA 3NFFB 4S32A 2PMLX 5D1JA 3VS1A 3FMEA 2WB8A 3NEWA 3AT4A 1XH8A 4FKRA 2X2MA 1YDSE 2RFNA 4FV0A 4ERKA 2QI8A 4M7IA 3FLWA 4IVBA 4F7NA 3HDMA 3DK3A 4JT3A 4YTFA 4FV3A 2VO0A 2GHLA 3A7FA 3SGCA 4X3JA 4FTLA 4I6HA 5KMKA 3QHWA 4WKQA 4F64A 3KXGA 3R8MA 4F1MA 5A6NA 4DHZA 2X8IA 3BYUA 4A9RA 1TVOA 3ZLXA 4MF0A 4MHAA 2EWAA 3PLSA 1OIQA 2BZJA 3PVWA 4J53A 3VUHA 4S2ZA 5CTPA 4YHFA 1H1SA 3OZ6A 4S33A 4LFIA 5CI7A 4F09A 3RHXA 5CU0A 1U5RA 1W84A 4QD6A 2UVXA 2ZV2A 4LMUA 3EL7A 3VULA 4G9RA 3EQPA 2R7IA 4DGOA 1LUFA 4RVLA 3C4XA 2JAVA 5FG8A 5CSWA 4CZYB 4D4YA 4DEEA 2G2IA 2UW9A 4MXXA 4FZDB 4O7TA 4QYGA 5DYJA 3SG8A 4E6AA 5FD2A 3HKOA 3IW6A 3NZ0A 2JDOA 3G0EA 3PZEA 4LL0A 2WMUA 4LRMA 1YW2A 2W05A 4KABA 4BCNA 4DT9A 4O4BB 3O8TA 2PVHA 4ZSEA 4NFNA 4AGDA 1JWHA 3A8XA 5CU3A 3SQQA 2RFDA 2P33A 4RWJA 3W33A 2X2LA 4FKSA 3SRVB 4AA5A 1A9UA 3W0QA 3GENA 3Q4ZA 4MD8E 5GIPE 3BE2A 5HCYA 4AXAA 1PXPA 1JAMA 2Y7JA 5DR9A 5L4QA 3C1XA 4KSPA 3DBFA 1J1BA 4RFYA 4BDBA 5IU2A 4IBMA 5IEXA 4GT4A 4M0YA 3DT1A 2VWZA 1CDKA 4ANOA 3ZBFA 1ZYCA 5FM2A 4WUAA 2GCDA 1XBAA 3VHEA 1YI4A 3LQ5A 3TEIA 1PXMA 3DQWA 3BGQA 4U8ZA 4JAIA 4Y5HA 4RVTA