3IDQA

Crystal structure of s. cerevisiae get3 at 3.7 angstrom resolution
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
362
structure length
272
Chain Sequence
NLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFANCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLEIRGLNNLTKFSQFLNKEYNPITDGKVIYELEDKEGLHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Model for eukaryotic tail-anchored protein binding based on the structure of Get3
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords ATPase GET3
total genus 77
structure length 272
sequence length 362
ec nomenclature ec 3.6.3.16: Arsenite-transporting ATPase.
pdb deposition date 2009-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3idqA01
3AKEA 2DFKB 2B8WA 2JJ2A 2WJVA 1F60A 3QQ5A 3TVDA 5CLQA 1FNNA 4NYIR 3MWYW 4ACAA 2ERYA 4URWR 1ZM7A 1JB1A 1P2SA 1KO7A 2FU5C 4POAA 4EKDA 4L4UA 3I62A 1E2KA 1XD9A 3THYA 3U3RA 1DAEA 2OSBA 1SVMA 3TLXA 4F92B 3VR4A 3FKSA 3M4YA 4NCHA 3HPRA 1QVRA 4WXPA 3GEIA 4YMSA 1VYVA 2LWIA 1XNJA 1CIPA 2IYZA 4A0RA 3S1AA 1YZLA 2ZJZA 1H8HA 3H0KA 1R8SA 2EQBA 2J46A 4JVMA 4TQUS 3U3JA 3NDBB 5SZKB 4QJ5A 4EIWA 1ELOA 2ZR7A 1OYYA 4IJMA 1HQYE 3GLIE 4CEJB 4KU4A 4OI0A 1N6IA 4KFRA 1KDRA 4LGMA 3E5HA 3BC1A 2G77B 4KXFB 2O8FA 2WWFA 3A1WA 4TTPA 3GEHA 521PA 4QKQA 4GZLA 1O87A 1EX7A 3NBFA 3B7GA 2DCUA 2IX3A 3A1TA 1OFTA 4DT1A 2IWRA 2E9SA 3M6AA 2UKDA 4PXAA 2FSHA 2IUUA 1GFIA 2BKUA 2F1RA 4HEJA 2OCYC 3BK7A 5KU1A 4W5WA 3PUVA 3TNFA 2HF8A 2GF0A 2P67A 3E70C 3NIBA 5CYOA 5AJYA 5FR1A 3K0AB 4IOMA 2A30A 4B74A 4PPNA 5FH9A 4Q5IA 3UANA 4OYHA 4CRWB 2P6UA 1COWA 1XX6A 5IRCD 1S0UA 2FOLA 4LYHA 4GZMA 5TVKA 2OFXA 3B60A 2JLZA 4I81A 1NI3A 4A8JB 3CPHA 3CPEA 1W0KD 1KSGA 5LDDC 1ZD9A 2AXNA 3DL0A 1Z0DA 3OE7A 4URUR 2ZI4A 4U02A 3CR8A 2JATA 1HYQA 1CF4A 2GZDA 1CXZA 4PPGA 1Z28A 4OHYA 2JLXA 2IF2A 3KXKA 2RGEA 4PO1A 4LYFA 2GXUA 1IN4A 2Q3MA 1E32A 2OBLA 3K1JA 1UAAA 2GJKA 2XTMA 1KK3A 3K8YA 3MFYA 3VU9A 5GADl 3QVVA 2ZRKA 3SJZA 4BFSA 2QM8A 5EJEA 4QHYA 3MG9A 4DEXA 3CF2A 4KSCA 3ZQ6A 1OB2A 1OH7A 2FNAA 1GIAA 4Z51A 2J41A 4LCBA 2Q9AA 2FG5A 2G6BA 2PEYA 5CM8B 3B13B 2VYFA 4L8GA 2WJHA 3B8HA 4O2LA 1IY0A 5CIWA 2ZROA 4QL3A 2BJWA 1LW7A 2QPOA 2VH5R 4EPXA 1C9KA 2FV8A 3ZVMA 3U6BA 2EU8A 1VHLA 3D6TB 4QBFA 4QOSA 2G1KA 2CK3D 4M0LA 1RC8A 3TSOA 3OIYA 4HDQB 4IOLA 3THWA 2WSMA 2ZS8A 5EP1A 5E3HA 5DI9A 3AP1A 4PQFA 4NPHA 4Q4HB 3BRWD 1NSTA 2PBRA 1Z06A 3P4YA 1KZGB 4BECA 3CH4B 4WBSA 2OXRA 3UMFA 4F7WA 4RZ2A 3CBQA 5IK2D 4P31A 1UEIA 4PPQA 4M53A 3R9IA 4D4LA 1ZCAA 1Z6XA 2YWFA 5FUXA 2WOJA 2F3TA 2MSDB 4MRVA 2BIFA 3L0PA 2DB3A 4XIGS 2VSXA 2QRNA 1KAGA 1Q22A 2C99A 4M4SA 2WHXA 5HTKA 4TMWA 1F2TA 3EIEA 2MSCB 3U44B 4OHXA 1G8PA 2NMVA 5JI2E 2I1VB 2ZETA 3T1VA 2QQ0A 4C30A 1E9BA 2QU8A 3EWSA 4I1SA 1J90A 3Q3JB 3LX5A 2XSZA 4FINA 4DEYA 2CNWD 2PZGA 3K70D 1MRSA 4B35A 2HJVA 2ATXA 2ZVQX 3KTAB 4A2PA 3FYHA 5KDDA 1IJFA 1JECA 3SI7A 4LBVA 3EZFA 3FHCB 5AUQA 4C0JA 3MMPA 4LC1A 2XAUA 2QAGC 4TT3A 3RNLA 4TQAA 3UWOA 4B2IA 1XPRA 4OI1A 2C04A 3MUFA 2XX3A 1LF0A 4HZIA 1ESMA 4OL0A 1JAHA 2RMKA 5JSZB 2H18A 4ILEA 1G7TA 1Z5ZA 3FPAA 5EP2A 3SJAA 1Z6TA 1MRNA 5K8LA 4W9MC 2P5TB 3RDPA 2MSEB 2W2VA 1NSFA 2YOFA 4PAMA 4LBZA 3KL4A 1A4RA 3UG6A 4EPRA 2MMGA 1OKKD 3REGA 5HKKA 3B1VA 3EPHA 5G40A 1Z08A 3ZQJA 2XTZA 4X8MA 4ZDJA 4D4MA 1QHYA 3GJ7A 4A0FA 2JLVA 2JAQA 1CLUA 4DCNA 1FW6A 3CB4A 3HDTA 4PQRA 1KK1A 2AR7A 3NEYA 1HQCA 1P9WA 1T8TA 2R44A 3W6PA 4OK3A 4A82A 1JXOA 2V7QA 1UBCA 3ZVNA 5CIQA 2QMOA 1NP6A 2BVNA 2QROA 3CRQA 3KJEA 4MUBA 5FL7A 3Q72A 3AH8A 3QXSA 3U61B 3SN6A 4MGYR 1XCMA 1QZXA 2H8KA 1VG0B 2C9YA 4JBXA 2W2TA 4B34A 1XTIA 2PLRA 2WWIA 4W5JA 3NC1C 4M1TA 1E99A 3LBIA 3LFUA 2ZRHA 3CWQA 4C0SA 5F9HA 1A7JA 1VHTA 1J2JA 1JR3E 3GQBA 2ZRFA 5GJCA 4PFSA 1W4RA 2EWVA 2UZ3A 4PZLA 3ZGXA 2WWHA 4C3ZA 5K8TA 5KPDA 4JYCA 4JBYA 5E95A 1E1QD 2K5UA 4DLXA 2EFEB 3RRZA 3FTQA 1U2RA 1JJVA 3QKRA 2WIAA 1TNDA 2FEMA 1GSIA 2ECKA 2OILA 3K0AA 4KCGA 5DISB 2QBYA 4WVFA 4LV5B 3TQFA 5AUOB 5TXGA 2PJZA 3GMTA 1C4OA 4H9GA 2CNWA 1JR3D 4K81B 4GPTA 4LC0A 1P2TA 3EA5A 3CO5A 1P60A 4FMCF 4RFVA 2D74A 3CH5A 4Q1CA 4HB2A 5B30A 1KI1A 2OT3B 3EPJA 4JJKA 1W4CA 5H8WA 2XNSA 1U98A 121PA 2VL7A 3O8BA 3EASA 3RS7A 5E7IA 1W0JA 4B76A 4MDEA 1B23P 4IVRA 1XBTA 2AK2A 4Q9HA 4JVSB 4W7SA 4MDFA 3DMDA 1CJMA 2OBMA 4LX0A 3EZ9A 2QY9A 3SQWA 3C14C 4OK6A 5H70A 3ICEA 5LB4A 4HATA 4KO8A 4FMDB 3K53A 5FL3A 3SDZA 1E0SA 1GNRA 1ZBDA 2I3BA 2W0MA 1KJZA 1M74A 1TUIA 4G1UC 2GHIA 5HPYB 1BKDR 3UWKA 3M1IA 4HLUA 4L15A 3OIUA 4D6PA 1P9RA 1VTKA 4NU0A 3A37A 4OQLA 5L3SB 4MRRA 1EFRA 3B1ZA 3CWZA 2AD5A 2IEZA 3THXA 3IPYA 3CRMA 3HU1A 4TLDA 5EE0A 2RCNA 2C98A 1CKEA 2CL6X 5GJVC 3IDQA 1R5BA 2VSFA 2B21A 4CGZA 3TE6A 1KY3A 2G9NA 1KGDA 3SJCA 4JVLA 1VG1A 5CDFA 5EZ6B 1E2NA 4XD7A 5JRJA 2GZHA 3KQKA 1XCGB 4TTRA 3H86A 1NN5A 1DELA 2IYTA 2VQSA 1KTVA 1TQ4A 1H65A 3NHAA 3SBEA 3V4FA 5DHAA 5KSZA 1LNZA 1ZVQA 5J40A 5KSPA 1NBMD 1Z0AA 5KO2A 2H1LA 1GG2A 4K8OA 2HLDD 2R6GA 1RFLA 1Z83A 4A92A 2GXAA 1GNQA 1E1RA 2ZRAA 5CJ2A 1ZCBA 1XCPA 3I8XA 4EUNA 4HUQB 4DSNA 2H92A 3B9PA 2WKPA 3FMOB 3LQQA 3MGCA 3CF6R 3PITA 2QNRA 3QKTA 4PAOA 3CKLA 2G83A 2BM1A 2F9LA 4QBHA 1GITA 3KJHA 3UXMA 2J0UA 3A4NA 5FTLA 3GLIA 2X2FA 3P20A 1YHNA 1KK0A 2GBLA 1FNMA 1AA9A 4HAWA 4Z54A 2O8CA 1G3IA 2OZEA 1N6OA 2YYZA 1X8KA 4CEIB 3VKGA 1KO1A 3B5JA 3VQTA 2ZXUA 3CF0A 2HF9A 5FPHA 5FBLB 4B33A 2PH1A 2IS4A 1YR7A 2OAQ1 3BAFA 4OQXA 2GA8A 2RAPA 3EX7C 4LHYA 3AVUA 4LV6A 1EWQA 2OHFA 2GJSA 1ETUA 1CTQA 4LPSA 5DYIA 3T5DA 1AK2A 1NMZA 2IXEA 2PT5A 4BZPA 3U7GA 4Q1FA 1BOFA 1S96A 4L9WA 2A5JA 2AKYA 2IHBA 1XD2A 4AYXA 3UMRA 2FPMA 5FPKA 4NYMR 4LUCA 2RGBA 3PQCA 1X1RA 3TSZA 4ZDKA 3PUZA 4JLAA 4BZQA 1GVNB 2PMKA 2QQEA 1KY2A 2MMCA 5JJLA 4G5OA 2BBWA 3I3SR 2Z4RA 2KI5A 2LCFA 4R7ZA 3ZLJA 1KI4A 2KB0A 4BUJA 4UNQA 2QT0A 2AK3A 2XZPA 2DFNA 3U5ZB 1XD2B 4TYYA 2OG2A 2BHRA 4MRNA 4C7OA 1OT3A 1AIPA 3KFVA 2EYQA 1Z47A 4D0NA 3GEEA 4B3CA 5JECA 5CDFE 3NEJA 5HZKA 2QSYA 3R8FA 4DSOA 1RW4A 1T3SA 1D2NA 1ZNZA 2F7SA 3NBYC 3ZJYA 1E6CA 1E2FA 2JJ2D 1F2UA 2ZR0A 5FOVA 1UADA 1P2UA 2FWRA 3AQ4A 3QIAA 2G0NA 1IXRC 4KHZA 2GEUA 2QAGB 3JZMA 4QBIA 4EFMA 2ZSAA 4TN1A 4V0ME 2NPFA 3REFA 3TBKA 3OEED 4D25A 4IFEA 2EFDB 3P27A 3KKPA 4J0QA 1NJGA 1X6VA 1II0A 3U3OA 2OXCA 4B47A 3V00A 1U99A 2ZSFA 3LO5A 2JIZD 3JVVA 3IIKA 1R2QA 4Q9IA 1G3QA 5DYGA 3KB1A 2WMNB 2A5DA 4B32A 3ADCA 1US8A 2C03A 4PC6A 2HYIC 2GILA 2PCJA 2ZJ8A 4BGDA 5J4VA 2BKEA 4IDOA 4IXNA 4EFLA 2IYLD 4A4DA 2WMOB 1XTKA 2ZRIA 3VNVA 2F43A 1YVDA 2ORVA 2RB4A 3K70B 2DWQA 3GLFB 1FUKA 4ZDIA 4AYTA 1NKSA 3MJRA 3PEUA 2B8TA 1OH8A 3TIFA 3UG7A 5HE8A 3RANA 1QHNA 1N0VC 4JLKA 4LYAA 4RZ3A 5F3WB 1GRRA 5CLLA 1E2HA 2QP9X 3IBGA 3QXHA 1T6NA 3IHLA 1Z3IX 4JL8A 1WBDA 2R65A 2G3YA 3WBJA 2VP4A 3BH0A 2FSGA 3B82A 1EWRA 2W6IA 1TF5A 2RHDA 3KKNA 1ZINA 5LBIA 3SHFA 1Q57A 4A6XA 2RGNC 4BFUA 1XRJA 3BS4A 3LA6A 4PTLA 4JJZA 2GETA 4UJ3A 1SXJA 2GK7A 2QMEA 2J7PA 1U8AA 5FBRB 1ONBA 1NKTA 1JALA 1ZM9A 2KJQA 3KXIA 3QJYA 1DAGA 2CLSA 3JVUA 5DE3A 1E2JA 2QRZA 3MD0A 2LKCA 4D81A 4HZUB 1HE8B 4OHWA 1QHXA 4UXIA 4P0TA 5FFMA 4ASUD 1MABB 2BJVA 4HLDA 2ZIAA 4H1VA 3F5FA 3T1QA 1OFIA 2EWWA 4BEJA 3QY0A 2OV2A 2HJGA 1ZP6A 1XD8A 2J1LA 4M9ZA 5CK5A 5FPSA 4AKHA 4R98A 2IBMA 3GD7A 5HZHA 4AI6A 1ZNYA 4NZYA 4HDCA 621PA 1DEKA 1ZM2A 3GJXC 1QHSA 1MABA 3Q8XB 2IW3A 2ZS9A 5JEDA 3HR7A 1E4VA 1AS3A 1XJCA 2ZRLA 5IT5A 3C16C 3QG1A 2J7KA 3HYRA 1I2DA 1Y3AA 3G5UA 3ECCA 4I99A 3O8RA 4KSBA 1CRQA 2NOAA 2XITA 3KJIA 4V0OA 1GKYA 1GWNA 4ACBA 2JLWA 1ZUHA 5AJXA 5CJPA 2N1BA 3RWOA 4HUQA 2GWHA 1E79D 2FA9A 4ITRC 1BMFA 4RD0A 5KNCA 3LVQE 2JLUA 4DLTA 3P4XA 4RZXA 3AF3A 4CW7A 1P2VA 1HA3A 2DYKA 1AQYA 5GJBA 1G64A 2EYUA 2Q6TA 4N1AA 1Q1QA 1XWIA 1EFHA 2CVHA 3L82B 5C46F 3UPUA 4LHWA 1EX6A 3ADKA 1XMSA 2ANCA 4US2R 3GLHE 1XTQA 2QZ4A 1DAHA 4Q4AA 3C5HA 1S9HA 3FVQA 1OF1A 3DO6A 4AK9A 2A5YB 1DS6A 1G41A 4HAVA 2AN9A 1T0HB 3K09A 3VAAA 1H8ED 4BRWA 1WP9A 2IS6A 4NDZA 5FTNA 1TMKA 2BMEA 3WRYC 1CJVC 1Z22A 3A4LA 2QMUA 4EQ6A 5F9FA 4WW0A 4ZI2A 5TARA 2QSZA 4TYQA 4EFNA 3P26A 1W44A 4DT1B 4B3BA 2YJTD 5EXXA 3MWJA 5K8UA 5JJIA 1KMHA 3L43A 3Q7PA 2DR3A 3VR5A 4QM7A 1IN6A 3GPLA 5BYKA 2BMDA 1N25A 3AVQA 3SOPA 1G8HA 4ARZB 4HI0E 5TMPA 5JJKA 1YR8A 2BM0A 3I1FA 5G53C 3OHMA 2GESA 1ZRHA 2G1JA 4L16A 3GP8A 1G21E 4IRUB 4TQ9A 3AF2A 3SHWA 2P65A 2BC9A 2IL1A 1Z0FA 3MAAC 5JCPA 2QMHA 3RS5A 2GZAA 1FOEB 3WMFA 5AJVB 3QKRB 2DY1A 4EJSA 2O8FB 2ZAOA 5FOTA 2C95A 4PR0A 1TF7A 3DOEA 1IM2A 1CULC 2C78A 2A7QA 1OKKA 3OF5A 2RGNA 2F9MA 5JHGB 1GKUB 3RHFA 2ZYVX 4DZZA 2NZ8A 5DIFA 2J45A 3DPUA 2QTVB 4LZZA 1IXSB 1GP2A 2ZJBA 4P4SB 4TMZA 3VR6A 1XTRA 1XFAA 5EZ5A 1S3GA 1FQKA 2ZRDA 3LLUA 3O8CA 4XD7D 2Q9BA 3AF1A 3CW2A 4PSVA 1MKYA 1TQ6A 4LPKA 4A2QA 1TAGA 3C8UA 4M1YA 4R2IA 2P6RA 4FMDF 1YZGA 4FCVA 4GMXA 4ZCLA 4DUGD 1NF3A 3RSOA 3EC2A 1G16A 3QF4A 4A9AA 4A6PA 1PUIA 2OCAA 2BBTA 3KKOA 4DVGA 3A1SA 2IA5A 1KSFX 3QVUA 1JI0A 2FZ4A 1P72A 1H8EA 1NJFA 5BXQC 4HLUC 4ZV4A 2O5VA 3AVXA 4GL2A 3RC3A 4V0MA 4DLSA 1TQDA 1EFTA 1ZW6A 1SZPA 1SQ5A 1G3RA 2V8OA 3DOFA 2VF7A 3IGFA 4LJ8A 5CYPA 5AUPB 1DTSA 1K5GA 2P3SA 3R20A 4XH9B 5JFGA 4PZYA 1JQJC 1G8FA 1UKZA 2IYQA 3NDPA 3OIWA 1XZQA 4R2HA 3UMSA 4YLGA 3X1XA 3OAAA 4ZI3A 2JASA 2GDJA 1SKYB 4RCYA 1IN5A 1JPNA 1QG4A 2X8AA 3N70A 4AIIA 4KFUA 2W0SA 5TDHA 2HUPA 2GCOA 3EIHA 3E1SA 5FBQB 5F98A 2CJWB 1GM5A 3B6EA 2TMKA 3DZDA 3K9LA 3AKYA 5DGXA 4MYTA 4LJ7A 2JLRA 4HB3A 2XZOA 2AX4A 4QGFA 5DN6D 4HLQB 4TMXA 2Z43A 3EIQA 3MJHA 1P75A 2CHVA 2HYDA 4BFTA 5DNYB 1G291 4IVPA 3X1YA 2CEAA 3WHLA 4B75A 3TAHA 1SVSA 3GLGB 4LY6A 2YINC 4A36A 1F48A 4RY2A 2CJWA 2QI9C 1F5NA 5EQTA 4O3MA 4NHOA 1NVWQ 4UXJA 1Q12A 1KJWA 2ZVPX 3IPXA 3QOFA 4RCZA 1G17A 3NHBA 3HR8A 4PHGA 4GT1A 1GZSA 2WJIA 3KUCA 4D0GA 1AJEA 3LV8A 1WXQA 3AGQA 3I5XA 1GRNA 3U7EB 2ATVA 2GCNA 3BGWA 4FCWA 4PHHA 3WYGA 5UKDA 2FSFA 1AGRA 4B44A 1G19A 2G88A 3TGPA 4GOXA 4S35A 4TL7A 2Z4SA 2NO9A 1WDTA 1XXHA 3HP1A 3GFPA 4OQFA 2IS2A 1SKQA 2FEOA 3K0FB 4JLJA 2EVWX 1KDOA 5L8VA 1U9IC 3W3AA 3ETLA 3LD9A 5JZVA 4DUGA 3C5CA 2FN4A 2GBLC 1DARA 4G5QA 2J7PD 2EFCB 1N6HA 1S1MA 1P3JA 2QN6A 4Q4JB 3TRFA 3TUIC 2IWHA 3TUJC 1PLLA 3BIFA 4DHEA 4NKRA 2GCPA 2PZEA 1GL9B 4Q4AB 1KI8A 4RD4A 1N6KA 1KO4A 4M9QA 1XU4A 5JHHB 4RFSA 3QSYA 2E87A 4ASUA 4YDHB 4C0KA 1ANKA 2D3WA 2DPXA 3LW7A 3AVOA 3KQHA 1KI6A 4URZR 3QKUA 5EE9A 2ZSBA 1OH5A 3SNHA 4LJ4A 2YWHA 4Q18A 2OCBA 4CIDA 1XXHE 1D8TA 2JJ1A 1KI2A 3C41J 3A58B 1UF9A 1EFRD 3I72A 1SXJD 5FPYA 4M9XA 2Z0MA 5JCZA 1UJ2A 3W8RA 5E7JA 4PZZA 4V0NA 3LBNA 2GEDA 5AJZA 1WA5A 3PEYA 4OI2A 1QHHB 4CZ2A 1YZKA 2QE7D 2OCPA 4N0DA 4RD3A 2D62A 2FJUA 2NGRA 2BMFA 2ZQ5A 3I32A 3RWMB 4TYNA 3HWSA 5CB8A 2H16A 8OHMA 4AG6A 3WYFA 3PG5A 1GILA 3GJ8A 3R7WA 4DC9A 2ZI3A 4MH0R 2O8BA 4IFBA 5FOXA 2ODBA 1G7RA 2GF9A 2OEPA 2J87A 2OBNA 2V6IA 5KHOC 5L3QA 4ESVA 4Y0VA 3WNDA 1HH4A 4WA7A 3TR0A 2ODNA 3FHOA 1R0XA 2BEKA 3QPWA 1KDTA 1AQUA 1IHUA 1MR3F 2SHKA 3IIJA 4Q01A 4BLSA 1LS1A 4OJKA 3AKCA 1G6HA 4CYMA 3PCRB 1MO6A 1VKJA 3NG1A 4PPFA 5KOYA 4C2UA 1OFUX 1U0HC 2J0VA 3EWAA 3FWYA 5TB5A 2IYVA 3BB3A 2GTPA 1Q3TA 3LAWA 4Q7KA 1LB1B 3LQRA 2HT1A 2VP9A 1T9HA 2ORIA 3ZS8A 3P1JA 1A1VA 2EFGA 2ZRGA 3NVAA 5D3QA 2PX0A 1SHKA 2Z6VA 2HCBA 4DLVA 5FUYA 4BLRA 2B7BA 2YV5A 3FKQA 5B58C 1RRFA 2X77A 5C18A 3L8ZA 4G5GA 4C2TA 3GFOA 3GFTA 4KVGA 1S1CA 3SEAA 4Q9LA 4JLPA 5F2EA 2NO0A 3I73A 3Q5DA 4F4JA 2XNDA 2QAJA 4WZ6A 2JGNA 1M8PA 1NL3A 4KI0A 2VSOA 2C96A 4WXRA 4WIAA 4A2WA 2YNMA 1XEFA 1OE0A 4QJ4A 3AVPA 3W6NA 5C2JB 1NBME 3THXB 2IS1A 2WIBA 4CDGA 5DN6A 4JZKA 4GI7A 1CJUC 1N5LA 5AUNB 4LHVA 2XZLA 1DG1G 4UKDA 3QNUA 4CVNA 5FOWA 1NVUQ 4MKIA 1X3SA 2F55A 4LBYA 4TMTA 3L2OB 2ZE7A 3KQLA 1BMFD 1G4AE 1UDWA 2J9RA 2FX3A 1DVRA 2ORWA 2W00A 1JNYA 3OFND 3DZ8A 5B2ZA 2X1VA 2PEZA 4URVR 4YMVA 3LRPA 1S4QA 3KKMA 1RYHA 1MT0A 3F8TA 4D82A 3FFAA 4DCVA 2JDIA 1N6PA 2I1QA 1IONA 4JLDA 4GFDA 1NMXA 5DO9A 4AWXA 4FW9A 2JA1A 4PX9A 4B6EA 5AR1A 1UKVY 5IF9A 4OHVA 1OV4A 4KFSA 4URYR 4A0GA 4CT5A 2YOGA 1XP8A 2IUTA 3A36A 1OPXA 2Q3FA 3C4JA 5HCIA 3U44A 1R0WA 1G6OA 1SULA 3RS4A 6Q21A 4II7A 1N2CE 4B2LA 2BEJA 3LBHA 4EPWA 3DVLA 2GXQA 1N6LA 2BV3A 3EAQA 1YRAA 3MLEA 1W2GA 5FR2A 5G3YA 5EP4A 3CX7A 2CXXA 3WY9A 1NVVQ 4GNKA 3WNBA 2BDTA 3CNNA 1AZTA 1A82A 3EG5A 2BWJA 2RGCA 2IXFA 3IUYA 1E2GA 3X1ZA 2O8EA 1NLFA 2PLFA 3FFBA 3PUWA 4DLYA 4C0QC 1JBKA 4JL6A 1XF9A 4DDUA 4HUTA 1VG8A 1JJ7A 1R4AA 5JSZA 4UNNA 3VHLB 2REXB 3B1XA 1RPZA 1PVOA 3N2EA 1KO8A 1SHZA 221PA 2AFIE 2QT1A 4CEHA 3BJIC 5LB2A 2PX3A 1BH2A 1E69A 2ZS7A 4A8JC 1KDPA 1CS4C 1NIPA 2DWOA 3VX3A 2ZRJA 5HR5A 3KTAA 4KODA 3RRNA 2AXPA 3ZZ0A 2VTKA 2IUSA 1ZUIA 4JT4A 1JEDA 3HU2A 1CP2A 4OKSA 2QE7A 2VP6A 1IOZA 2WWGA 3CR7A 3I4LA 2HXYA 3IO5A 4EPVA 3A6PC 1IJEA 3WBKA 1IXZA 1HTWA 3NWJA 4M1MA 5J4KA 3R8CA 2IHYA 4FMBB 4GMDA 4IVQA 5KNBA 2G0TA 1EXMA 3TK1A 4GOKA 2R6DA 3L0OA 3QPVA 1U0JA 1T5IA 2P2LA 1SKYE 3SBDA 4LJ6A 3A4MA 2WSSA 1NIJA 5FOSA 2WPDA 2J3EA 4BWYA 5FUVA 4G01B 4D2IA 4TSFA 3OE7D 1WCV1 1TEXA 1L4YA 3LLMA 4MGIR 4TL8A 2REOA 1E9DA 4P3YA 4Z8XA 4A1FA 3I5YA 2HEIA 2FSIA 3RLFA 2VHUA 4NMMA 1F6BA 1TL7C 4NYIQ 2CK3A 2NZJA 4KLZA 1T3LA 3PUYA 2Z5FA 3LH5A 3AVWA 1GTVA 1R5OA 2ZE5A 5KPJA 1KHTA 5FOUA 3B1WA 1E79A 3EXAA 2XTNA 2RKOA 5JRZA 1BIFA 3W3ZB 2PZFA 4Q4LA 2XB2A 2QP3A 4UNSA 2GKSA 4JVNA 3VHXA 1E2MA 4NP6A 4E07A 5G3ZA 3CRW1 1G5TA 4O2RA 5DH9A 1YJ5A 4YONB 5BQ5A 1U81A 3ZIAA 3SS8A 1WMSA 1E0KA 3TW4A 1HURA 4EDHA 5EUQB 2XJ4A 4PC3A 3ADDA 2FE4A 4UJ5A 4UNPA 2ZEJA 4BEBA 4YC7A 3QBVA 2V1XA 3D3QA 1HEIA 4M1WA 3L8YA 2CBZA 4P33A 3QF7A 4PSKA 3TSWA 1XTSA 4L5BA 4BFZA 3BBPA 4DSTA 2ZJYA 1NN0A 2HDNB 2OFOA 2VHTA 5E7MA 5A5GA 2KBEA 1VYTA 2VLIA 2ZU0C 1EGAA 4HYYA 1YZQA 1XEXA 4KVAA 4TLEA 3FKSD 5J4LA 1CRPA 5SZHB 1NBMA 4FCTA 3OFNA 1ZM4A 1XEWY 1VCIA 3KQUA 1HT2E 1BYUA 1W49A 1ZIPA 3EPLA 5KYKA 3RS0A 2IYYA 2WWYA 4FN5A 3PV0A 1NY5A 3NH6A 4MKGA 4WOPA 1P61B 4B43A 3VKHA 2WVJA 3CLVA 1KYIA 1JEEA 1FMJA 3IKJA 2BOVA 1US8B 1SXJE 2WV9A 3QEJA 1YKSA 3H4MA 1N6RA 2B6HA 4Q66C 4JKYA 1D5CA 4ZIRA 2UVQA 3MRSA 1ZUNB 2KWIA 2ZYUX 5FL7D 1KI9A 3GLFA 4PC1A 3TW8B 4TL6A 2ZTSA 2KSQA 2ZI5A 4LHZA 1L8QA 4ESHA 3BFXA 3DKPA 1ZC3A 4ZPXA 5EXPA 2V7QD 1SGWA 3BB1A 2XGJA 1M7HA 3W90A 4BFWA 1G1MA 3THWB 4QHTA 4M1KA 1W7AA 3D8BA 1E9RA 2VBCA 2ERXA 1W4AA 4Z1MA 1PJRA 3SYLA 3PENA 4JKIA 5JS8A 2ASEA 4PQYA 4V0LA 1K8RA 3E2IA 3KDSE 2W6ID 1SXJB 3GJ0A 3VTKA 3ZH9B 3ZS9A 1MO5A 1OW3B 2ZI9A 1DAIA 1XEWX 1UKEA 1ZD1A 1TU3A 2V55B 3TR5A 2IEYA 5IHPA 4BFVA 2ZJ5A 4Q9KA 4BLOA 4B48A 4XSGA 4OI4A 5KUTA 1D6JA 1Z2AA 3QXCA 5DSZA 3SC3A 2WM9B 3RS2A 2F1IA 4KAXA 5BYJA 5GJWC 3AP2A 3MWKA 4MITA 4P4TA 4Q7JB 3VNUA 4U00A 1KZ7B 1TADA 3WP1B 1W36B 3NC0C 5KTYA 3THYB 2VIIA 4JSYA 3KZ1E 4WZAE 1OLOA 3GLIB 3FGNA 3LY5A 3FMPB 3IQWA 4V02A 4DDWA 1MOZA 1OIVA 1UM8A 421PA 5AJWA 2PJRA 5FI1B 3B9QA 3TKLA 4GDFA 1OXTA 4DWJA 3AM1A 2NQ2C 4MYCA 4I1OA 1E3MA 4JBWA 3PEWA 2FDCA 1OB5A 5E4FA 1NLYA 2QP4A 5CM9C 4IOKA 2XNDD 4M21A 1AS2A 4GRAA 4OQNA 2ZRPA 2EFHB 4AKEA 4V0KA 2JIZA 1QHIA 2WTUA 1W0JD 2JLYA 1F3OA 2X2EA 2NIPA 1XZPA 2AHOA 3AEZA 3THOA 2ONKA 3Q5EA 3W5JA 1E98A 1W47A 3AVVA 3LDAA 2JCSA 1XMJA 2RGXA 2C8VA 4RFSB 5JWOA 1Y63A 1Z63A 3FHTA 4FIDA 4LYJA 4FWTA 3TJZA 3OZXA 3IIMA 4NYJR 3ZIAD 3A8TA 3RABA 4DRZA 4ABYA 1WF3A 3R9WA 4JLVA 3AKDA 1E2EA 4TL9A 4M1SA 1LVGA 5A4JA 2KBFA 2FF7A 1W46A 3CZQA 2QM7A 3CUEF 3SFZA 1QHHA 4ZKEA 1W5SA 2X19A 3IBYA 1VIYA 1MH1A 2ZANA 1FX0B 2O0HA 4DBLC 4US0R 4V03A 3KFXA 1T3HA 2AL7A 2REBA 4BZXA 1Q20A 5SZIA 4QHSA 1GL7A 1Q0UA 2O8BB 2FMXA 1O3YA 1G9XA 4DCUA 5ELXA 3GJ3A 2VO1A 4H1UA 2NG1A 1OFHA 1Z07A 4W5HA 3UIEA 5JI3E 3U4QB 4NYJQ 4AC9A 3P32A 2V3CC 2VHCA 2GVDC 1XPOA 4PC2A 1R6BX 3AB3A 2HLDA 2FPKA 2GAAA 4JT2A 4P4SA 4XWOA 1YRBA 2WBLC 3AUYA 3GLFE 1Z6GA 3U7HB 2ZRCA 5EUMA 1Z8FA 3UATA 1W2HA 2NO1A 2ZYWX 4GOJA 4BLPA 4BLQA 4JSTA 3LVRE 1IN8A 3ZZTA 4B2PA 1G7CA 4B73A 5FTKA 3BFKA 4IDNA 4F4IA 1N6NA 4JMPA 1FP7A 5FTJA 2OESA 3U4QA 4NE2A 1TEVA 2OAP1 3IO3A 3T5GA 1UKYA 5D3MB 4C0LA 3MCAA 1WB9A 2Q3HA 3SE0A 4JLMA 2H7VA 5J5CA 1OIWA 3FMIA 4DB4A 5GVRA 4Q4HA 1PUJA 3BXZA 4EJSB 4MYUA 4K46A 1GAJA 4NTZA 3RRYA 1C1YA 5J47A 1IY1A 2ZREA 1OSNA 721PA 1RZ3A 2QG6A 3EZ2A 1W36D 4Q00A 1GKIA 2J0SA 1SVWA 4RVCA 4Y0AA 3AF0A 4HB0A 2D7CA 3DEFA 2VEDA 1W48A 1E9FA 5FTMA 3K0EA 5JS7A 4DLRA 4TMKA 3OIVA 3OESA 4MGKR 2FFAA 3VR3A 2VA8A 2O8DA 3BFVA 1II9A 5LD2B 3T06B 1L7VC 2GAOA 2QEQA 1ZU5A 2VP5A 4HZUA 4NONA 3PUXA 4QGHA 4UNRA 1GOTA 4MUAA 2OLKA 4KFTA 1DAKA 5EXSA 1G20E 2P0EA 3QG5A 4FMCB 2OO7A 4S2EA 3MWLA 2JLQA 4QC2A 1D9XA 3EZ6A 1G8YA 3O8DA 1A5TA 3EC1A 4TSFD 2A78A 4Q1AA 5JWRA 2ANBA 2J0QA 3F0TA 1PLJA 4NCNA 2YWGA 4ZCIA 1CU1A 3D31A 4U7DA 3TVTA 2RGAA 1XDBA 1ZU4A 3AVTA 4IOJA 3RSLA 2CHGA 4X8OA 3RAPR 1BYIA 1RIFA 4QRHA 3KJGA 1YZTA 1T91A 2ZU6A 5B57C 821PA 1J99A 1FTSA 2CL0X 3WHKA 2NTYC 3VFDA 1KO5A 1Z6YA 2A9KA 1Z6AA 3SFVA 3K0FA 2QPAA 3U3MA 2V54A 3QKSA 2YVUA 4JLBA 1CR0A 4C0HA 1YE8A 4CEHB 4DXAA 1ZJ6A 3LW8A 4LDJA 2ZE8A 1X86B 3PXGA 2C9CA 4XWKA 1DAFA 2OM2A 4CEIA 2CHQA 2A3RA 1DO2A 3B2EA 5FBWB 3X1DA 4EPTA 2WKRA 1RRGA 4QFMA 4ERNA 3Q9LA 4NH0A 3CPJB 1OXUA 3SYNA 4G3XA 4XOIA 3RVBA 1RRCA 2GRJA 1LF5A 2V1UA 1E0AA 1G5PA 1NG1A 4UQOA 4DKXA 3CRRA 1Z0KA 2UZIR 1QBKC 2CLCX 1QDEA 1QRAA 3DMNA 3RYTC 1JXMA 3U3KA 4LK2A 3GLGE 5K8IA 2O52A 2PMDA 1LS6A 1ZIOA 2WICA 4IDPA 4MKHA 5KDLA 5H1YA 3DHWC 3K09C 4A8JA 1RE0A 3G0HA 3SYKA 4DB2A 1HE1C 1AS0A 3TQCA 2Y8EA 1AGPA 2Q0HA 2ZI6A 2N42A 3SQXA 4BPBA 4HDOB 1F2UB 4NCKA 2FPLA 4JS0A 4URXR 3OEHD 2XJ9A 2GVZC 3IQXA 3QI2A 4GP7A 1UEJA 2DFLA 1LY1A 3ASZA 3Q85A 2W6JA 2CE2X 2AFHE 1CR1A 3R7WB 5EE3A 3GCGA 4E22A 1XMIA 1R5NA 1UFQA 1TU4A 4EQ6B 1A2BA 4PSAA 3K0CC 4LWZA 5KSOA 3BORA 2XXAA 3CX6A 2W83A 5GVSA 3D7MA 3IILA 3G82C 1NG9A 1Z0IA 4BQSA 1KOFA 2D7DA 2ZYTX 4O0MA 2QGZA 4IW3B 4MKFA 1DBSA 4KV9A 1W36C 1KI6B 4R9UC 4LJAA 4QBGB 3RRMA 3LXXA 4Q9JA 4QG7A 3CNLA 1ZC4A 3WMGA 1OH6A 4IDQA 2IT1A 4PAQA 4DCSA 4DCTA 4LJ9A 3AGPA 1ZAKA 3SR0A 2CCKA 2YZ2A 4G0NA 3W9YA 2DWPA 5LPNA 3K9HA 1KAOA 3BERA 4TZ6A 2YC2C 1IY2A 1SXJC 1J8YF 4EJSC 2CVFA 4BE7B 2DFTA 1BS1A 4Q47A 4HAYA 4CF7A 2IK8A 3X2SA 1U90A 4FXPA 3IEUA 3W8NA 2LKDA 5TV2A 1N0UA 4QXAA 4OK5A 1YQTA 5IK2A 1VYUA 3LXRA 1E9CA 4E5UA 4LRWA 2D06A 1RRPA 1T8UA 2IYXA 2XB4A 4TLBA 1E96A 3T61A 1MO4A 2ZSDA 2JEOA 2NO7A 4DLZA 1AM4D 3QPUA 4HAXA 4RD6A 2HXSA 3QXXA 1KSJA 4PC7A 3C7KA 1ZM3A 1OHHD 4DSUA 5DLQC 1N5JA 4DDTA 5FUWA 2D2EA 1R8QA 4D4JA 3DKVA 2A5GA 1M7GA 4JLOA 2R6FA 1RYFA 2H5EA 5BW8A 1NVVR 4CT4B 4ZIRB 2H17A 2BCGY 1Q3HA 3WNCA 1Q44A 3QEOA 5EE1A 2C9OA 1JQLB 1E2LA 4FI3C 3QF4B 2KE5A 1P73A 3I92A 2CDNA 1U0LA 1DADA 3K70C 5DI3B 4TTQA 3ZVLA 3CIOA 3VMFA 3MSXA 3J81k 2JLSA 3ZZUA 3OEHA 4MGZR 4C9BA 5TY0A 1P9NA 3I61A 5HE9A 5KDOA 3U2QA 3U7FB 1N0WA 1ODFA 1EG7A 3K9NA 3PEVA 4QGAA 2WJGA 3H84A 2ZITA 4R71A 3B1YA 1H8HD 2P6NA 1VCMA 3BOSA 4Q02A 4E09A 2ZJ2A 3LX8A 4OJQA 5DI3A 3CNOA 1XJ0A 2E1RA 1M2OB 1PLKA 1VG9B 2V6JA 4PANA 1A2KC 1T4GA 4OBEA 4A15A 5JBQA 2QA5A 4AD8A 1W4BA 2QUZA 4B3XA 2NO6A 3NTUA 2WOOA 1EFCA 3ND8A 1WQ1R 2WJJA 1E94E 4BFYA 3SU8A 1TQ2A 4Q1EA 4DLWA 1OXVA 1FPMA 4JIMA 3T1OA 3VR2A 4I1VA 2QGNA 1HUQA 3T15A 4WZBE 1E0JA 1G5RA 1K5DA 1ESNA 1Q1BA 5CK4A 1IN7A 1GRQA 4RKEA 1P62B 2J59A 4EAQA 1S8FA 2YWEA 1W0KA 1DAMA 1VMAA 2PT7A 4A0HA 3LWNA 4PO9A 1TPZA 3EARA 1P5ZB 5JLJA 1LFDB 2L0XA 4YXWA 1II8B 2YC4C 2O0JA 4AKGA 2VP0A 1P7CA 5BN3A 1GUAA 1YR6A 4KBGA 3WYAA 2RH5A 2JJ1D 4IXMA 4DDVA 4D80A 2BBSA 3S1AB 4HAZA 1VPLA 1KNXA 1I4DD 4NCIA 1KKLA 3ND9A 2FZLA 3V9PA 4LBWA 3NXSA 1S9DA 1XXHB 4KITB 2ZM5A 4CEJA 3KKQA 4KLNA 1II8A 3ZVRA 4EPYA 3T1TA 4M2LA 1UPTA 3EA0A 4E03A 4TYPA 4TZ0A 2QBYB 3QBTA 3QENA 3TMKA 3BWDD 4LOAA 3NBZC 1PV4A 4G5RA 1W1WA 2BBOA 2IF0A 2IYSA 1TF2A 2WWXA 3DM9B 4D26A 4C7OB 1XJQA 3I8SA 2GJ9A 1Z0JA 2R6CA 4YDSA 4DIDA 2OLJA 2R8RA 3WMEA 1LTQA 1ZNXA 1SVKA 5P21A 1OIXA 1FX0A 1ZNWA 3B85A 3CM0A 2CMKA 3H2YA 4C0AC 4ZCMA 4GSYA 2XOKA 2IC5A 4N0EA 2CL7X 1VCNA 2ZUDA 2ZJAA 1I4TD 1XMVA 2AKAB 1QVAA 2CLDX 1U9IA 4AG5A 3GLHB 1N5KA 2CCJA 2F3RA 3JZAA 4G5SA 4RSGA 4B3GA 2ZRNA 4XVUA 2QTFA 1D2EA 2XXAB 4BFXA 1KKMA 1K6MA 3PR1A 3HPQA 2YKGA 1IAQA 2QENA 2IXGA 4XWAA 3N5CA 3FOZA 1JR6A 3NBXX 2WSSD 4Q7MB 1YZUA 1VIAA 1YR9A 2F1JA 2V4ZA 4RD2A 3HYTA 4B6FA 3GLHA 1KMQA 1ZYUA 3FE2A 2FFBA 1SVOA 4N3NA 4Q48A 4NCJA 5L3SA 1I4LD 2F43B 3U60B 1T0JB 3W5IA 2R6AA 2GNOA 1EESA 3L0SA 2QPTA 2OFWA 1U8YA 1FMLA 2QL6A 2Q9CA 3WP0A 3BB4A 1AKYA 1D2MA 2VHJA 3A1VA 4YXWD 3K0SA 5SZJA 3AF4A 4DLUA 5B64A 3BE4A 2CCGA 4C0BA 4NYMQ 1J7KA 1P6XA 1XB2A 3CX8A 3RS3A 2XSZD 2VF8A 3KQNA 4QNRA 2WJYA 1FL9A 5AWFC 5HCNA 1LV7A 4TMVA 1JAIA 1OXXK 2N46A 3GJ6A 4LV8B 1E1RD 2IYRA 5DHFA 4C4PA 3A1UA 3KUDA 3SZRA 2VP2A 5KSYA 4D4KA 1FP6A 3X1WA 3T12A 2VHQA 1FUUA 5G41A 3V4RA 1JPJA 4MYHA 4GBMA 1KNQA 1YZNA 2VRWA 2W6JD 4ZKDA 1X8LA 5HKKD 4XSHA 5BN5A 2GK6A 2HT6A 3FMFA 4BLTA 5C1BA 3UKDA 3ADBA 4F38A 4LI0A 1FTNA 1SVLA 5L3RA 3K0CA 5C4MA 2FGKA 1Q1ZA 3WRXC 3KX2A 4ZO4A 1V43A 1N5IA 2HV8A 1GNPA 4F91B 2FFQA 1G4UR 2GJAA 2AD1A 1YU9A 4BASA 1HV8A 4DJTA 2EW1A 1KI3A 2IYUA 3O47A 3TUZC 3PIRA 3CRVA 1SVIA 2IYWA 4YQFA 3GLGA 2XOKD 2ZSEA 3N2IA 4JL5A 4PO8A 2P5SA 2WZQA 2GEVA 4M22A 1UBFA 2D4HA 3AV0B 4DIEA 1J8MF 1Q1EA 4TLCA 1CJTC 2JJ8A 2I4IA 3T35A 5L3VA 5CB6A 4M1OA 1JR3A 4NBSA 1TTTA 1DO0A 4I4LA 1AN0A 2A5FA 2WPDD 3VX4A 4M9SA 4F4CA 1E9SA 4Q19A 1VCOA 3AVYA 2W2XA 2HCJB 3OAAD 1EK0A 1DPFA 1R7RA 3IHWA 3NKVA 4P32A 3BH6A 5JWHA 1HY3A 3TAUA 1I2MA 5JEEA 4I1UA 4ZDWA 1AZSC 2ZPTX 2GJ8A 4X8HA 4YMWA 1E1QA 3ASYA 2RHMA 2ZI7A 4B3DA 2B7CA 1VDZA 1NN3A 5A0FA 4PHTA 5IDVA 3EPKA 2FGJA 3KXLA 3WXMA 2J0UB 4L9SA 3T34A 4X8LA 5EXTA 1KJYA 4LJYA 3M0EA 4O25A 2XEXA 4XVQA 1FQJA 4GP6A 4RKFA 4Q1BA 3W34A 1M7BA 2YHSA 1D9ZA 2O0KA 4HSEA 2O8CB 1DG3A 1OHHA 3KB2A 4BRUA 4QJ3A 2R62A 3ONWA 2C77A 1KMHB 2Q21A 4Q1DA 4Q21A 3CONA 2C5LA 3GJ5A 4ARZA 1G3UA 2QORA 5FBVB 1OYWA 1VECA 3ZDQA 4KYIB 5EE5B 2OE2A 2QAGA 2WAYA 3Q7QA 2FFHA 3R9XA 2ZRMA 2BCJQ 1L4UA 1KI7A 1QHGA 4QM6A 4Q7LA 4TWZA 2Z83A 1W5TA 2DBYA 3EW9A 3CZPA 4TT3D 2J5XA 4UXHA 1KK2A 4HB4A 1M1YE 3VKWA 1NNEA 2ODWA 1CBUA 5LD2C 1M6NA 2ZE6A 4FWIB 2C2HA 2ZUCA 1QF9A 1E2DA 4LSGA 5M04A 2ZJOA 4TYWA 1G8GA 2R2AA 2ODEA 2D2FA 1E2IA 3K9GA 1OXSC 4AKIA 4KYUA 1Z29A 2V9PA 5EP3A 4IHQA 3QXJA 1E4YA 4KJZA 1UDXA 3U6KA 1R0YA 1EFUA 2ONJA 1G7SA 1WBBA 1RJ9A 2OUKA 2GXSA 4TLAA 1PZNA 2VPPA 2ZRBA 1E2QA 4LJ5A 1IQPA 1TUEA 3ZD6A 4D0LB 3RC8A 5C4GB 2ZR9A 1CR2A 1U94A 1WE2A 3PVSA 3TH5A 3B78A 1UBEA 2JDID 4XTCS 5KNDA 1UBGA 3IEVA 2ZAMA 1X8JA 4LHXA 4RD1A 1NLZA 5FPTA 1R0ZA 3VU9B 4YMTA 1IBRA 4MRPA 3ZD7A 1KIMA 4FD2A 3DDCA 5L3QB 1CJKC 1XPUA 1FFHA 1RJ9B 3FDIA 1T5LA 3C15C 4B3FX 1Q21A 3H1TA 1E9EA 1N3BA 1S3SA 3PFIA 3F3YA 1ZD8A 2FH5B 1XEXB 2A2ZA 1R10A 1J70A 2H57A 1COWD 1OJLA 1B0UA 2F6RA 4HLCA 3LNCA 1NRJB 1NVXQ 1RKBA 5AK0A 1RVDA 1XTJA 1U8ZA 4ON9A 1BO6A 4RZUA 4XTRA 1MO3A 1DE0A 3HJNA 1G18A 2WKQA 1GDDA 1DOAA 2RGDA 4YMUA 2RGGA 3AUXA 1HT1E 3HU3A 5FI0B 4QNMA 3QE0A 2W58A 4OHZA 4MRSA 3VR1A 2AWOA 4XVRA 2PL3A 4Q03A 4IDHA 4IEEA 4Z1MD 3EZ7A 1QG2A 2NPIA 4Z8YA 5H68A 1CR4A 2CE7A 5J4HA 1FZQA 2F1HA 4B71A 4JLNA 2B92A 4MA4A 5ANRB 5BN4A 4AY2A 4M8NE 2QTHA 1CEEA 1MV5A 1P4SA 5D3MA 3UK6A 1M34E 1V5WA 1AKEA 3W6OA 1E9AA 4WAUA 2R9VA 1NY6A 3L0IB 1F2TB 5BWMA 5JMTA 4HAUA 4JYBA 2GCOB 1WRBA 3OEEA 3GJ4A 4P4UA 4AURA 1GL6A 3FB4A 3ZYCA 2YOHA 4AYWA 1NMYA 3BD9A 1G3MA 4KBFA 4IEIA 1Z2CA 2BMJA 1E2PA 3QUSA 3SJBA 3ICQB 1TX4B 2DHRA 4US1R 3PJRA 1S2MA 2PCLA 2ZUBA 2O8DB 2O8EB 3AP3A 4U5XA 3BH7A 1X1SA 2AWNA 3NH9A 4QGGA 2WAXA 4NL4H 4OQMA 4F93B 1L2TA 2WWWA 4IKEA 1ZMXA 4MQBA 3QKSB 1NN1A 4XJXA 5J4YA 4RJLA 4PHFA 4Q4JA 1KSHA 5CITA 3DM5A
chains in the Genus database with same CATH superfamily
2QX4A 4M8SA 1V7ZA 1RWBA 4IL5A 1R15A 3AKEA 2C9MA 2DFPA 2HDHA 3QQ5A 4PZDA 3TVDA 5A4FS 2DQYA 5AMXA 2EGUA 3I6YA 4J43A 4CKCB 4ACAA 1ABBA 1V4BA 5K2MA 1RXSA 2D4AA 3CEHA 3WC4A 4HNTA 3ROXA 1WABA 1KO7A 1AN9A 2FU5C 4OHFA 4M7OA 1PSZA 1VP3A 1PFYA 1QLHA 2FN7A 2WSBA 1E2KA 1XZHA 2AC7A 4LAFA 5B53A 4CODB 1NRWA 2WIDA 4DIMA 2MYUA 2P1ZA 1Z2PX 3GVPA 9LDBA 3FKSA 3HPRA 1QVRA 2VXYA 3GEIA 4PXSA 1YJBA 2QNBA 3NANA 4UTPA 3DYBA 4A0RA 2IYZA 2B6NA 4ZOQI 1YZLA 1FXWF 4K28A 2YXNA 2OK7A 4P34A 3H0KA 5T8KA 3ZWWA 3TPZA 1R8SA 2J46A 3RJZA 4TQUS 5FWXA 3V8PA 2PMCA 3GJYA 3P0RA 3A32A 4EIWA 1ELOA 1GZUA 4EHFA 4G41A 2QZSA 2UVDA 1SCJA 3ML1A 1KDRA 1YZ3A 5CYGA 4LGMA 4UUQA 5JMWA 5LUAA 4CR6A 3GO4A 3A1WA 1JSLA 2OL4A 4JP2A 1WZEA 2HA2A 3N87A 4CFSA 3ZJVA 521PA 3FCAA 2QN9A 4QKQA 1VL2A 4GXQA 4X3PA 3U26A 3NORA 2DHEA 4X1IB 3B7GA 1SU8A 2DCUA 1VIDA 1FU8A 2AOTA 5I3ZA 2IX3A 1YQWA 1OFTA 4OLAA 2IWRA 2GHTA 3R6WA 1J8VA 3KBOA 4FOPA 4AAYA 3OMLA 1GZ5A 3FTNA 2CHUA 5FLXA 1J39A 1L7QA 1HM5A 5CAEB 4ZT4A 4W5WA 4E4TA 4FOLA 4WJKB 4B3MB 2HF8A 1PDWA 2GF0A 2OCDA 2P67A 2XNKA 2BGTA 3E70C 3PJEA 4ISBA 4MP3A 3K0AB 3DUFA 2A30A 2YIJA 5AJYA 3ZDZB 4V1CI 3DDWA 2W8BA 5FH9A 5KYTA 4DV5B 1BXGA 1COWA 1RRKA 5HMMA 1XX6A 4NH4A 5BSRA 4BDTA 1UP4A 2FOLA 2GN6A 3ND5A 2Z2ZA 5LQSA 1N9GA 4LYHA 1YDHA 4IIBA 5TVKA 3L7JA 3E5MA 1NI3A 2AS0A 3CPHA 3CPEA 1W0KD 3FLEA 4OSOA 5ENZA 1ZD9A 4N47A 5LDDC 2H3HA 2AW3A 4URUR 3PHCA 4ZI7B 2XMDA 4U02A 4DQXA 4KQFA 3CR8A 2JATA 1HYQA 1A9YA 4C89A 4EMTA 1CXZA 4PPGA 3M89A 1G59A 3JQBC 1D1SA 2JLXA 3MCVA 1QIFA 1U1EA 2IF2A 3ORHA 2XE6A 1BXGB 4GEKA 3R5SA 4B3IA 3HJGA 2XTMA 3K8YA 4NMWA 1CUAA 2UYQA 1K6JA 4AS2A 1WUHS 5REQA 5EJEA 1B1CA 2GH1A 2QLMA 2I80A 5K6AA 3MG9A 1VGRA 3CF2A 3IVRA 2VDMB 4LCBA 5GV8A 2Q9AA 2G6BA 1JZSA 1YS4A 5CNIA 5JVDB 3O8OB 3DGFC 2EBHX 4HEA1 2VYFA 1DEXA 2INGX 3E48A 4TRNA 3A28A 4FFBB 5CLJA 3WQSB 3FDZB 1R0CA 4YJ3B 3JQRA 4PO3X 2C3MA 3OE5A 2QPOA 4Y2TA 3R5FA 1WY7A 5LMUB 4DRXB 4G24A 3B1KA 3AIIA 4GHWA 4AJHA 3U6BA 2EU8A 2ID9A 4JYMA 3L4JA 4EY3A 3PKJA 4WZZA 1F7UA 1CUZA 1LBSA 3PFKA 2NTVA 3EEIA 3SOZA 1CY4A 1RC8A 2FYTA 4MMYB 3TSOA 3G0OA 2PGAA 1V6AA 1WV0A 1P7WA 3ACCA 3THWA 1V5IA 4J91A 2WSMA 4Q37A 5EP1A 3VPSA 1NW4A 1P77A 3MOIA 5A06A 3CT6A 4JUIA 4Q4HB 3MWEA 3OJLA 1GPUA 3N5KA 5B2EA 3P4YA 3OTOB 2GPWA 1SOVA 4QO8A 4XDHA 2JARA 3BL5A 3FDFA 4MVJH 5E1MA 3KEQA 1BDBA 2FEWB 4BKPA 4S1PA 3T54A 5HYVA 5IK2D 3LS2A 3TW8A 4M53A 2YX1A 3U7GA 3R0XA 1OA1A 1ZLXA 2AN3A 1UXJA 4HH0A 1YONA 2F3TA 8ATCA 1TB4A 1J07A 2HJHA 2DR2A 4RHYA 3L0PA 4IX1A 1Y48E 3GRRA 2ZIZA 3GY0A 3FCYA 4WNYA 2BFWA 3WWZA 3AU9A 1FDIA 1O57A 3F4KA 1F2TA 3NWBA 1XO1A 4OSPA 4TMWA 4E07A 3P5BA 2JD2A 2Q29A 3HKBB 1IL0A 5I7HA 1XMOB 1V11B 4D46A 2A86A 1PSWA 4YGXB 3H65A 4F3YA 1EIZA 1KS2A 2ZETA 4L3VA 3T1VA 2QQ0A 4K40A 2WKWA 1W8DA 1T5TA 2NU6B 1O95C 2PJUA 3RGWS 2IKQA 1K0FA 1QDUA 2XBUA 3A1FA 7YASA 1WXFA 3WLAA 5C7LO 2ZVQX 5AXDA 1Z5OA 3FYHA 1IJFA 1ORDA 2VDWA 4IYRA 4Q6BA 3KQMA 2VK2A 3BDVA 3HXMA 3RVDA 2AMYA 5LMZA 2F4NA 3CURA 4Q82A 4C0JA 3SSOA 5IC6A 4EW2A 5AW0A 5EIOA 3MT8A 3HKBA 4XGKA 4OI1A 3MUFA 4GPEA 4HZIA 2E4VA 1ESMA 2O1XA 4MCJA 1T5OA 4CT0A 5HK9A 1PNRA 3N8DA 3EC7A 2D1YA 3RSFA 4ILEA 2DRIA 2ATIA 1FFBA 5BT8A 2YYSA 3ABZA 4QXMA 3WO1A 2JJYA 4HFMA 4KRXA 1TAHA 1MRNA 3FA2A 4URFA 3RDPA 1XYVA 2E3JA 2MSEB 5K8LA 5A5VA 5KTNA 4NCBA 1JXAA 3QUCA 4JOCA 1ZWKA 5A0VA 5BMOA 2J3KA 1AX9A 1RLOA 3GJZA 4PYOA 5JAIA 2HSZA 1HNXB 2OAGA 1ZIXA 2AE2A 3VOBA 3ZWPA 1AKQA 4YMLA 2JAQA 5AI9A 1CLUA 3IJRA 3STHA 1YB1A 4ZVRA 4F2PA 2YASA 4PQRA 1KK1A 3NEYA 3W6PA 2R44A 1T8TA 3OJFA 3KQOA 2H54A 2YJ6A 3A6JA 3QNWA 1B6TA 4X3CA 4A82A 5TLSA 2FR8C 2GLTA 1GEGA 1OQAA 1FF9A 1GAWA 1JXOA 1PQ4A 2GF2A 4KACA 4WN9B 1S6YA 1THZA 3ZVNA 2HQBA 4MUBA 2ILVA 3KAQA 4MYSA 1GVHA 5DLDA 3Q72A 3U61B 3SS7X 1E4EB 2Z8YM 2EKQA 3DMPA 4MGYR 4RAOA 5JNRA 2C9YA 1MXHA 3KR9A 3VZCA 5KNCH 3ENQA 2W98A 2I9PA 2AUNA 1XTIA 3L07A 4B34A 1XN4A 2N0SA 4W5JA 4ZHQB 3NC1C 4CIYA 4M1TA 1EIWA 1JHVA 4E08A 3LBIA 1TQHA 1K4KA 4GPBA 4QUEA 1H5NA 1NVMB 4PCLA 2X0DA 2QTAA 4AJ9A 3MINB 5F9HA 1A7JA 1VHTA 4MYRA 1N3IA 1KVUA 1Z7BA 3O0DA 1W4RA 2EWVA 4PFSA 5K0BA 1K3TA 1L5HB 2WWHA 3IOBA 4JP3A 4YUAA 4DMMA 2CXQA 4JYCA 5KPDA 1ZS9A 1FP4A 1PJLA 2AZXA 5IJ9A 5E95A 1J6UA 3TG2A 1L5ZA 4QQRA 2BYTA 3RRZA 1RXVA 2QGFA 3E84A 2OVFA 1QCDA 4KG7A 4NU8X 4PYKA 5ESDA 3C6BA 5BY2A 2CVOA 4NV3A 3JASA 5BSVA 1KMMA 5HX7A 1F3LA 2ECKA 1YRWA 2XR1A 3ILHA 5B3LA 2D2XA 2QBYA 1QK3A 4LDZA 4EUFA 3W2FA 3C24A 4G36A 4QU9A 2QQFA 4RIFA 1V3UA 1DX4A 4ZAWA 1RKQA 4M98A 4N7BA 3PLRA 1CQZA 1G8AA 3M7IA 3DDHA 4LC0A 4WD3A 2PGJA 3CO5A 4IIJF 4L4XA 3QPAA 3H5RA 4RFVA 4RUKA 1M0EA 1X38A 3JARA 3MHPA 4HB2A 4Q1CA 4QEDA 4RLQA 3D9QX 4UU7A 2W4QA 4JFAA 3SZ3A 4RDIA 3EXFA 1FDSA 1X1TA 2QX7A 4E46A 2D1SA 5AD1A 1FXWA 4B3RB 2HKIA 3WKAA 5FORA 2PX6A 3WGVA 2Z09A 5AI4A 4L3WA 4AUMA 2ZM6B 2Q5CA 4R3UC 2W6MA 3RIYA 5JMPA 3SIRA 2PTHA 1ZN2A 1DNPA 5ERGB 4C7XA 1NI5A 2VJCA 3TI9A 3IQHX 2I91A 4G9EA 2OBMA 4R9VA 3P8ZA 3DVSX 3EZ9A 5I7OA 2VYND 2QY9A 1IM8A 4GLOA 4P7FA 3JARB 5E6SB 3SQWA 5H70A 1JH9A 2G9VA 3QSGA 4KDCA 3ICEA 1R12A 2QVLA 1P6UA 4IDFA 2AN4A 4FB5A 1BJRE 4FMDB 1DQYA 3UJ7A 4RDXA 3SDZA 1N2ZA 5CFQA 5IJAA 4MULA 1FDVA 3MTQA 4NNJA 1CS0A 1ULZA 3M1IA 3GNTA 4HLUA 4L15A 1ULAA 4D6PA 4DIOA 5CB0A 2B30A 3GUHA 3BQMB 5GMOA 5CHEA 1ODIA 2I2AA 4II3A 1EFRA 3B1ZA 3CWZA 2AD5A 3KSZO 3I5UA 4W8OA 5FBKA 3WGYA 4TTJA 3CRMA 3BBLA 5EE0A 3WGZA 4C07A 4MVJG 2O3SA 3ZHTA 3RRBA 2YZKA 5GJVC 4L9AA 4CGZA 2JFFA 1P4RA 1TMYA 1BDJA 2JIMA 1HDZA 2O20A 1KY3A 2P2NA 2WLTA 3Q7SA 3CRZA 4GXNA 2JZOA 4OMUA 2AG6A 2G9NA 3S70A 4DOMA 1IDN1 1RZVA 3KYBA 4LMRA 4O2BF 4HX5A 3RS8A 4H6WA 1Z2OX 1C7IA 2J5KA 2P2YA 2VEOA 4GI3A 3ZQKA 1U9ZA 3H86A 4RDHA 5BV1A 5AVRA 1QU2A 2PKRA 1TQ4A 1VE7A 1H65A 1ODKA 1XTUA 1LZKA 3V4FA 4ALNA 4X5OA 4ZJZA 5I01A 1FBNA 4O59O 3TFOA 2JAXA 3SFTA 5LNK1 2H1LA 3RU2A 3NIWA 2C3UA 2P9EA 4K8OA 2HLDD 4XD2A 4U2KA 5G1OA 1Z83A 2MU1A 3JD0A 4NEHB 5I5GA 2GXAA 2OO5C 2Y9MB 4IQ4A 1ML3A 5CJ2A 4Q05A 1ZCBA 1XCPA 1JJAA 2G4LA 4EW1A 4PG8A 3ROEA 3FPFA 2QX9A 3LU1A 4IIHA 4NZNA 2WKPA 3VVLA 3LQQA 3B70A 1GLGA 2ECPA 4RKQA 2AQKA 2PV7A 1ZNQO 3BXXA 2RHOA 4NLLA 4D97A 2H00A 5CVCA 1GLNA 2BM1A 2OOKA 4JEIA 4N7JA 1PFUA 4Q3DA 1Y8RA 1A9OA 3KJHA 2YVLA 1J23A 1NUSA 5C37A 1FVXA 3B20A 1ADGA 2NTJA 1YHNA 3O0TA 1KK0A 3DBRA 1JDJA 3HBFA 1A2QA 1ECCA 3AB8A 1N6OA 3GB9A 1SKUA 1JLMA 4CEIB 4PHCA 1RHMA 3QTBA 3L4EA 2IP1A 4RDCA 5C8YF 2W2LA 1XR3A 1I51A 3DVAA 1QO9A 2ZXUA 1NUHA 1CYEA 3QVMA 2OAQ1 2IGTA 1W19A 4X94A 2FPPB 2GA8A 3K5HA 5JO0A 4IKOA 1W29A 4PZUA 5TMDA 3U7JA 3OUTA 4LV6A 2GJSA 1ETUA 2OHFA 3GELA 1R64A 4XGRA 3FYUB 4RVDA 2XE8A 3WL7A 5AVXA 1F6WA 1QCYA 1S96A 1Y1TA 3EEBA 4L9WA 4MUJA 5TEWA 5CB4B 1TGYA 1QFZA 1UBRS 3H5LA 3UMRA 1BCSB 2VG8A 3TSZA 4HX2A 3W5AA 3DTVB 1U8UA 4JLAA 3U9TA 2VATA 3ZWBA 2QQEA 2MTBA 1KY2A 2IZ1A 2MMCA 5JJLA 2CXPA 3M1AA 5KYWB 2Z4RA 1VE3A 4PSUA 4GWLA 2UZ4A 1QG6A 2R6R1 4C29A 1JSXA 2KB0A 2YW9A 5JFOA 4DC1A 1NW9B 4L0QA 4UEJA 1RNLA 4DBLE 1QYCA 1FRVA 4G4SP 3NWPA 1N2BA 4Y2PA 3F9IA 3L7YA 4Q4CA 2OG2A 4CNBA 4WBNF 1AIPA 1CUSA 5FA5A 3AHDA 4QOFA 2DMRA 3DAYA 4U9HS 3FTCA 1ZGCA 1ZI8A 2G9UA 1RYEA 1QAQA 4RWEA 1ZCJA 4TROA 5DRTA 5JYEA 1E9VA 1HTTA 1IPHA 2HMVA 4DSOA 4M76B 4YNBA 2A14A 2E55A 4GM4A 4D9HA 2WF9A 4NICA 4QIHA 1LLUA 2X1MA 1CX9B 3LYHA 5FIUA 1KP9A 5FOVA 3H5VA 1UADA 2XXJA 3QIAA 3INGA 3STTA 1J00A 4P2BA 4JJFA 2GEUA 3UVEA 4L0MA 2WYOA 3FNQA 4QBIA 2ZSAA 4V0ME 4ADSG 4GGOA 1T9ZA 3TBKA 4DNPA 1VLMA 1BX1A 2HHCA 1OVMA 2VF2A 2HSWA 3ILVA 3N8KA 2BFMA 5ER9A 5JCJD 1X6VA 1VL0A 4YAEA 2P30A 2RAUA 3DT9A 1L5HA 3FIJA 4B47A 1F0YA 3LO5A 4CV3A 4ZN6A 1X80A 1ST2A 3CYFA 2PNFA 2XKBA 3IIKA 4FLMA 5KKCA 1SCKA 3A4IA 4WKNA 3HI6A 3ADCA 1XLTA 4WFQA 1X1EA 5BSGA 3RIXA 2VNAA 5ALJA 2PCJA 4TWIA 4HGQA 2IYOA 2PQMA 1CVLA 4BGDA 1QRRA 2BKEA 5J4VA 4MB6A 3Q8LA 3BJZA 2XUQA 3DDSA 1QZTA 1MAAA 3R6DA 1ZGHA 2BFCA 3IS3A 2F43A 3IUJA 3B8EA 2DWQA 3GLFB 3REQB 2XYVA 3FETA 2AV6A 1V39A 4AYTA 2UUBB 1NDQA 1NKSA 1NQVA 1TKAA 1VBKA 1QV6A 3PEUA 4HYEA 4XCVA 5EKDA 1NXTA 1XHEA 3TIFA 4FFDA 3UG7A 4EYSA 4FMPA 2XYHA 3RANA 4ZOLF 4JLKA 1L5MA 1DCMA 2PKEA 4RZ3A 1R9NA 5CX1A 3DEJA 2QP9X 3T7IA 4IQGA 3IHLA 2A67A 4IWXA 2GTHA 2R65A 2G3YA 2O7NA 4RM3A 5K3FA 4ZVQA 3UUWA 3UB4A 3V7UA 2FUG6 3B82A 3LY7A 4LVCA 1ZINA 4A6XA 1DOHA 1RC1A 1C1XA 3BS4A 2YMPA 3LA6A 4PTLA 4JJZA 3R3XA 3WGGA 4RTJA 1BWSA 3U81A 3N53A 2B1GA 2QMEA 4BN5A 1ZJWA 3OLZA 5HFJA 5FAKA 1FJHA 2JAOA 3E2PA 3QUTA 5AKLA 1MC8A 3ZWOA 1ONBA 2EX0A 2VHVA 2XQFA 1RI5A 4QULA 5FP0A 1ZM9A 2F62A 3QJYA 5IWCA 2CLSA 1RQRA 4RO0A 1WTCA 5KTKA 3WGIA 4B6OA 4G65A 1LI7A 4CMCA 3VNRA 3OZVA 2CLKB 4D81A 3LQFA 4OHWA 4QWMA 1QHXA 5IXJA 2DUNA 3SSNA 4HLDA 3ZWCA 2FJ0A 3RUPA 1YMUA 2Y1FA 2BFBB 2WSIA 3HKCB 2P9QA 2DPMA 2EV9A 4UEKA 4XQGA 3T1QA 1FMTA 3TJMA 4CI0B 1QGZA 4PG4A 1OFIA 4UHCA 4V3CA 1TIKA 2VXBA 1YFKA 1NFQA 1U6IA 1M6WA 1NP3A 3U7QB 4S1TA 1M2OA 5FPSA 5BVGA 4F2WA 1U0OC 2ZBQA 3L05A 4GX5A 3UAOA 1GDTA 2HQ1A 4XYBA 5EJ2A 2HUNA 4NIMA 1L8OA 5INTA 2I76A 3GBSA 3NP9A 4BVBA 3RRFA 1JYFA 3MTGA 5CT6A 2TMYA 3PNVA 3Q8XB 1VL6A 1DBVO 2FQYA 5IT5A 4RTNA 2PX8A 3SQMA 3SS9X 2C5BA 3H8JA 3HYRA 5AICA 3AW8A 2ADMA 2J5RA 1SVNA 2JG3A 3I45A 1SO8A 3BEDA 1AF7A 3DT6A 1A88A 1IDOA 3FR8A 3AR9A 2HJWA 3KJIA 4N65A 2XA1A 1UZAA 3EMDA 5IYZB 4TLMB 4I5EA 1GKYA 3CLSC 2VZ0A 1GWNA 3MMNA 1ZUHA 4C78A 3NCTA 3UWPA 3LYLA 2FA9A 2BFFA 2G07A 3LKVA 1KY4A 3LVQE 4DLTA 3GDHA 5KX5B 3ZY2A 4YACA 2XNJA 2P75A 3AF3A 3P4XA 4K9DA 4YAOA 1HA3A 3K8ZA 4B2YA 3TTVA 3FZYA 4J94A 4DMCA 5GJBA 2GA9A 2Y99A 4Z4FA 1Q7CA 2ZQZA 5DHUA 1T25A 1ZA1A 4TXJA 3L82B 5AW8A 5ITVA 1M2KA 3F97A 2IY7A 1C81A 1ZKMA 2FXVA 3U37A 4B3HA 1EUDA 2ANCA 2Q3CA 3D64A 3WO0A 1CQXA 3NHKA 4KXXA 2ZKIA 4O2AB 5JZSA 4Q3LA 5K0SA 2VPYA 5BRNA 3Q3HA 2GAJA 4MPJA 5H16A 3C5HA 1L7OA 2CFRA 1S9HA 2B37A 2TYSB 1PJ4A 2VJLA 3LUHA 2X2OA 4Y9UA 4I3HA 3WQRA 2IXAA 5EQJB 1GQQA 2V4MA 2PRZA 3DA8A 3A27A 1JL3A 2GPAA 2Q5OA 3I1YA 3HB7A 3SICE 3IMEA 6AT1A 1ZOOA 1MC5A 2IS6A 2VKTA 3AWIA 3LXUX 3TJRA 4ESOA 3E9MA 4I9GA 1P1HA 2RJ3A 4N5MA 4QELA 1GR1A 1OJ7A 2BMEA 2C61A 2Y3IA 5LQKA 4H2DA 1YR3A 2D2VA 1Y5LA 1XA0A 2GD6A 2ONCA 4J0EA 4WW0A 4DWOA 4ZI2A 3COPA 3O4FA 3CG4A 3VH3A 4AMVA 3H19A 1EDEA 2JPDA 3M5DA 4G1CA 4XX0A 3ZJ4A 2JEZA 2XQIA 2WJAA 4G1VA 4G4IA 2IXTA 4AS3A 4DT1B 2XRZA 1XVUA 3K20A 4QM7A 1M1UA 3AWDA 3DE2X 3ZHBA 2BMAA 4TM7A 5JPCA 5BYKA 1TOAA 2BMDA 4P53A 3SOPA 4HI0E 1K9VF 4FILA 5CNJA 2G06A 1Y7PA 2XECA 1UK7A 2ATCA 4NOMA 5G53C 5A7GA 3JRXA 3G0GA 1YJXA 3SCZA 1W75A 4BPRA 3N3AC 3QE9Y 3TLEA 3DHNA 3QX9A 3SPXA 1BA2A 4L16A 3GP8A 4P7KA 4QDJA 3L7LA 1U80A 1XU9A 5EHIA 3RLIA 3WB0A 1QFJA 1XKTA 2P65A 5FI5A 3IAEA 2GNAA 3PNSA 1H2AS 1UANA 2DZDA 9GPBA 3GA7A 5LMNB 4OAOA 4TKLA 1LDMA 3VHXB 2J6BA 3WMFA 1P1IA 4ZD6A 1L0BA 4FEGA 2DY1A 5KQRA 1YHYA 2NTNA 2O8FB 1OWMA 1ADYA 2AA3A 3NT4A 1IULA 3H1GA 1F0PA 4ZYYA 4Y2XA 1RBQA 5IVPA 3KSAC 2ZPAA 3DOEA 3IE1A 1ESEA 4N7RA 1L8XA 2XNCA 2C78A 2H2WA 2PYZA 3QK7A 5DIFA 2J45A 4DZZA 2QTVB 2ISQA 4K6CA 1IXSB 1A3CA 3G7NA 4P4SB 5IDYA 4TWJA 3E3LA 1XFAA 2XODA 3ZJUA 4D9JA 3P9RA 4PTZA 3CW2A 3VO2A 3LQ2A 4MEAA 1ID8A 3NVMB 5DOZA 4R2IA 1KQPA 5K3SA 4YJDA 4L8FA 1WD7A 3SLRA 1YZGA 4ZCLA 4EHKA 5A04A 4KLCA 3ET5A 2W42A 1G16A 3IUNA 3IHTA 3X1KA 3PE3A 3RVOA 2BBTA 3KKOA 3OQ6A 4J2OA 4X9XA 4IMRA 2DJ5A 4MEJA 4OMDA 1JG6A 3O8LA 4JA2A 1ORIA 1Q92A 1ZWLA 2C5GA 3C45A 4DUGD 2J30A 4EARA 1NJFA 2VF4X 3H9GA 4J0IA 5BXQC 4HAOA 4ZV4A 1Y8CA 1TW2A 1RVV1 2O5VA 2JIQA 4GL2A 3OE4A 4FHGA 4H3KB 4QDOA 4DLSA 4LF8B 4YI5A 4NAHA 3W1EA 4TVBA 1SQ5A 2V9ZA 3HXKA 4X3OA 1G3RA 1L7DA 4H7HA 2OSVA 3DOFA 5C4IA 2Y1LA 4LK3A 4GOMD 5AUPB 1K5GA 1UDAA 2P3SA 4N49A 5EMJA 5L4NA 3ZDDA 2WT4A 4FBLA 5DM60 3Q15C 3WSWA 4DTIA 1GYQA 1U7HA 3PNPA 1O95D 3F6CA 4IV0A 1Z62A 4YLGA 4JI1B 4AB1A 1VM6A 5LOVF 4JXKA 2O7VA 3VZPA 1JPNA 1QG4A 3N70A 3ZKWA 4AIIA 2WUDA 2W0SA 4DN6A 3GFRA 5KVCA 3E9NA 3MB5A 4ITUA 1A9PA 4L6IA 1JDBC 3EIHA 5FBQB 4YRKA 1Z17A 3M6MD 3EAFA 1GM5A 3U31A 2YZ7A 3ZV3A 2I34A 4EG3A 1Q2XA 2YXPX 1H6DA 2RHCA 4FYYA 4IS2A 3O74A 4LJ7A 1HYHA 4ZALA 5DN6D 1U63A 3H05A 3AR5A 1NJ2A 4LECA 4YQYA 1JHOA 5E8RA 3V1NA 5JBIA 4HQNA 2HYDA 2CDRA 3PF9A 5DFAA 5B1IA 2PD6A 3ESXA 2QJTA 4M7RA 1TPYA 1BOOA 5EXDA 3U1VA 3WHLA 1OI2A 1SVSA 5JD6A 1Y42X 2YINC 3NAZA 3O93A 4XFJA 4ZQIA 5KCMA 4F12A 4A36A 2UXDB 2PN1A 2YZGA 1JJBA 3HMQA 3PTLA 1QG0A 3HA5A 2NYAA 2NSLA 1KMCA 3O4GA 4DMRA 4O3MA 4NHOA 2O23A 3RUDA 3RTDA 3DJFA 5ALRA 3GLUA 2CLHB 1G17A 3NHBA 4AN0A 4GT1A 5KEIA 2HPAA 2ILTA 4ZPJA 3KUCA 3I28A 4QU0A 4XDGA 3AGQA 2R96A 4KOEC 4B3TB 4LGCA 3BGWA 3PLNA 2G71A 5BR8B 3AEUB 1AGRA 4LTMA 1KJQA 1XZCA 2G88A 5K0ZA 3TGPA 4GOXA 1ZIDA 2QTRA 5TQ0A 2NO9A 3OC0A 3OQOA 4OM8A 1U7TA 1XXHA 1A9TA 3HP1A 3M6XA 3G5MA 3T6KA 2YCBA 3NB0A 4A26A 1OAAA 2FEOA 4QTZA 2VTBB 2VT2A 1ORRA 4PZEA 2XVZA 3MJSA 6PFKA 3LD9A 4EH1A 2PAFA 3FYCA 4Z7JA 3UB2A 3DNMA 2EDAA 3CVXA 1DARA 3VYRB 4G5QA 4CM1A 2H08A 2BZ0A 4Q4JB 3TUJC 3Q7TA 4L5AA 1TEZA 4LXTA 3IX7A 4L5JA 4DHEA 5CFOA 1UMBB 3TKYA 2VDUE 2F8MA 2O7SA 3EYWA 3TD9A 3N76A 1VHQA 3VO1A 3LTNC 4JJEA 3MQFA 5BOSA 5HDQA 4RFSA 3EXG1 4EY4A 4ASUA 4YDHB 1ANKA 2G9ZA 1ZH4A 4UOEA 1T1RA 3DDZX 3KQHA 4URZR 5ALFA 3QKUA 4AZTA 1OYVA 3BG5A 3FPBA 4PEVA 3LQKA 3VISA 4DEVA 1OH5A 4LJ4A 3EVDA 2RK6A 4WKGA 5HS4A 1FUYB 2OCBA 4IHKA 4LW8A 3E4DA 4ZVTA 3MK31 4CIDA 4U3JB 1PR1A 2QOEA 3AESB 2QUIA 3Q87B 1UF9A 1EFRD 3G2OA 3I72A 4M9XA 5LZ5A 5T6BA 4XX0B 4YV0A 4NOLA 5JCZA 2VJKA 1Z4IA 1K97A 1UJ2A 3TAXA 3W8RA 1JKXA 1GD1O 2ECQA 3ZBTA 2GEDA 2AJCA 3QTTA 4RKRA 5AJZA 5G0SA 3ZG6A 3ADBA 3PEYA 4F3KA 2WNHA 2VXCA 4RD3A 3GGOA 4CNQA 1P1CA 2FPGA 3TVYA 5ALNA 4V24A 1QWSA 2AW5A 4KLAA 4QPZA 3VYUB 8OHMA 3AUJB 1YQQA 1G5FA 3Q6MA 3TD2A 1C5KA 5BSTA 2HA3A 2V97A 2VT6A 2O8BA 4IFBA 3K70D 5CCDA 2ODBA 1G7RA 4PZ0A 2OEPA 2J87A 2OBNA 3ORQA 5E3JA 2X0JA 4RVUA 2O3QA 4UNIA 2W9XA 1J22A 4G1FA 5D51S 2X41A 1RI1A 5K3DA 4R2WA 3W8EA 3ZHCA 1PG5A 2PUFA 1AQUA 1IHUA 1MR3F 2SHKA 3KWMA 3OURA 4RMJA 3QFCA 1AURA 3ORRA 4AXBA 3IUSA 2JH8A 3NTXA 4M1EA 3PCRB 4CYMA 1VKJA 3HEBA 3LT1A 5KOYA 4NVRA 1OFUX 1U0HC 2VNJA 2FQQA 3TS1A 2ZUUA 3E22B 3FB1A 3LAWA 2AOUB 2V0CA 1U7UA 2ORIA 3EFBA 3HXPA 1A1VA 2ZRGA 3ABOB 1B8NA 4YFYA 5ALYA 1C9YA 2QNIA 4HC4A 5D3QA 1YFJA 4XB6B 3DC7A 2Z6VA 4TSKA 2GASA 3QOWA 2WU1A 4F2GA 2XWSA 1IXKA 1PNOA 3KCNA 3RSCA 1SRQA 1RFGE 3TZHA 3BXOA 3FKQA 4BLRA 3K96A 2FETA 4L6CA 5DM70 1BFDA 5FO0A 2ID4A 4JLPA 4PQGA 2QX6A 3TO5A 3Q5DA 3AC0A 1BDIA 4F4JA 5I45A 3HCBA 4WZ6A 5JAMA 1JEJA 1NL3A 4KI0A 2VSOA 4AUNA 2Z1MA 4PF1A 5I8PA 5K6RA 3EMBA 1OR8A 1NBME 3THXB 2IS1A 3EOZA 5J1TB 2WIBA 2P91A 2X5NA 2FDXA 4GI7A 3T0FA 2ZYIA 3OMXA 4RYLA 1ULUA 4NZMA 2X6TA 1DG1G 5KYNA 5FOWA 1NVUQ 1U2GA 1B8VA 4MKIA 3HJHA 3M3PA 5TQ2A 2P77A 5BV2P 4FYJA 1K7CA 5KI6A 1EVZA 3ZTYA 3OI7A 4QLBA 5LU8A 3KZVA 5KYXB 1HKHA 5CDGA 2FX3A 2ORWA 2W00A 4C7MA 4EI2A 3C1TA 4JOBA 3UGKA 5B2ZA 4LTDA 5EJGA 4URVR 5EPUA 1E3LA 4YMVA 3SWWA 4GYWA 3LUCA 3KKMA 4EA8A 4D82A 3BWCA 3G8YA 3CMMA 1Z7YA 3HDGA 3HVJA 5T4HA 5TX7A 5I7UA 1MOSA 4L9RA 4JLDA 4DCPA 1NMXA 1EFVB 4E2FA 1SA0A 2D59A 4FW9A 1UP7A 2OOSA 3D7KA 3SJUA 5IF9A 1PV2A 3OH8A 2YS6A 1U1DA 1QX3A 3K2QA 4WKBA 3CQ9A 4IF4A 3ETEA 1JLLA 4U2BA 1TW3A 4Y2HA 3IKMB 2J3QA 4GAEA 4ZAZA 4MIYA 2YFQA 4LVUA 3RS4A 6Q21A 4CLRB 4DM7A 2D1QA 1Q1AA 2PH7A 4O1IA 5K0NA 4B2LA 2BGRA 5HOQA 5JYCA 1PWHA 1M6EX 1VLHA 4TKUB 2VQ3A 1FDRA 2AZMA 3AQIA 4MWBA 3MLEA 5FR2A 1YRAA 3PT9A 4L8WB 4KKXB 5IPFA 4ARAA 4S0ZA 3MJCA 1WX1A 1NQWA 2QN7A 3QX8A 3DB2A 2ZTLA 4RTSA 3A7DA 1DL5A 1BE0A 2CXXA 2VK1A 2I65A 3N6RA 2G76A 2BDTA 4IIUA 4AZVA 2B5VA 1D5WA 3I8OA 4XARA 16PKA 3F49S 4X64B 1NLFA 2PLFA 3FFBA 4DLYA 3JQFC 4JL6A 1XF9A 1A8IA 1XDSA 1ZISA 1VG8A 3WLKX 5K0TA 1G55A 2JGFA 1EUZA 3B1XA 1VQ1A 1NW6A 1C7JA 1GQ2A 1QYVA 1ZDMA 2ADOA 1KO8A 1SHZA 2AFIE 5FFFA 3AY0A 1EXNA 4HS4A 3RROA 2WC1A 3ZWNA 4CEHA 1BH2A 1E69A 3HWX1 5LFAA 1EXVA 1E5DA 1RWQA 1EA7A 1UQUA 2IEIA 1L1EA 4I08A 1EVQA 4KODA 1QIDA 2J3IA 3RRNA 2AXPA 2CB0A 2HNKA 5LBTA 4BMCA 4GI1A 3V80A 5BSMA 3WHIA 2Z6QA 3L1HA 3PX3A 2VTKA 1V16B 3AHEA 2XNHA 1P3Y1 1CP2A 3WGOA 2GARA 1A96A 4GC5A 3S7ZA 4CUKA 1FB5A 2NZWA 3A6PC 4X0EA 3C6YA 2WSLA 1HTWA 3WBKA 4U5QA 1AKWA 3HC7A 3CNBA 5EMMA 2G0TA 2H4WA 2K87A 4RELA 5IG2A 2B98A 3WLSA 1IPFA 3R6TA 3UK0A 3R9KA 2P8SA 4RANA 3RTGA 1FQOA 1VXOA 2IYPA 5T67A 1F2VA 1KEWA 1T5IA 1UMBA 4LSMA 3GVCA 4LJ6A 3A4MA 3UAXA 1P4GA 4LDNA 2JGIA 2WSSA 1NIJA 4AKSA 2WPDA 4BWYA 4BYMA 3OX3A 5FUVA 4DADA 2Y1KA 3TQOA 4TSFA 3OE7D 2II6A 1A50B 4RK6A 5CT9A 4BKQA 5HKAA 1MJ5A 1E1KA 1TEXA 2WHYA 2QTGA 1VHWA 3KHKA 3UGTA 4Y98A 2REOA 1PWZA 4PAWA 3PFBA 4WLEA 4TVSA 1E9DA 3IH5A 3QX3A 2ZYGA 3KHUA 1CDOA 4EFKA 2JIRA 2H1IA 3A9VA 1KC1A 3PXEA 2DSNA 1F6BA 3IVXA 5THQA 3EGOA 4TXLA 4BP8A 2IU0A 2JCXA 2B9EA 3MJVA 3CUYA 3AVWA 1AE1A 1GTVA 4W1SA 2VUTA 1C14A 4ZZIA 2NN3C 4XIFA 3EXAA 3OPYB 2PBLA 5JRZA 5LR6A 2CV2A 2PZFA 4OLHA 3QE3A 5BYBA 5KBYA 1WUTA 4UNSA 2HTFA 3UUEA 1N32B 1YR2A 4NP6A 1X14A 1OLXB 3IVCA 5FRDA 3CRW1 3K9BA 1G5TA 3VH2A 4BVHA 5IKEA 1UMCA 2DUMA 1ECLA 2GRAA 3CF4G 1CUYA 4ZT3A 1W1IA 5BQ5A 1E0KA 1HURA 4WK4B 3CH7A 2D0PB 3O03A 4GSKA 4EDHA 1PKXA 2XT0A 3QLVA 3ADDA 4S1WA 1HXHA 1N9GB 1U0BB 1JLKA 2YL2A 2ZEJA 2FZKA 2V7GA 4YC7A 2WHRA 4M86A 4N76A 5B3JA 3VJRA 1HEIA 2RIPA 3QZUA 3WDMA 4BGVA 4INAA 4PSKA 1SUCA 1BQ3A 1XTSA 4L5BA 3M3DA 5BMVF 3H04A 3B38A 2OFOA 1JWAB 4MQFA 1HNNA 4C03A 1DTEA 4HSGA 5A5GA 3ANXA 2VLIA 2ZU0C 4B4DA 4JJ8A 1J2YA 4IEFB 2J3LA 3AYZB 3OZ7A 1U6KA 5J4LA 1CRPA 2X9GA 1EGHA 5C1IA 3O1IC 3F4BA 3ZI0A 5AVUA 5KJCA 3PA8A 1XLVA 3EUEA 2FMUA 1N8KA 1XC7A 4R9NA 3KQUA 1HT2E 1BYUA 1CZUA 1JIIA 1ZSVA 3OP4A 5KYKA 3RS0A 2VHWA 3NH6A 4HDNA 1PWXA 4L78A 1Y8QA 3QNMA 3ESBA 3KE9A 3MPUA 1RXWA 1B41A 3CPSA 3VKHA 1L4NA 1KYIA 1WW2A 3P2EA 5DX8A 1HEYA 1S02A 2RSLA 2ZQYA 1M2JA 4M1ZA 3DS8A 4BWVA 4BZWA 4KN5A 2BGWA 1NOIA 1XRMA 2WV9A 1RQXA 1UIRA 1JFFB 2VHYA 2ZLBA 4MUNA 4P92A 5JNSA 4Q66C 4K26A 4WHMA 1HYEA 2LUOA 2OV6A 3OX1A 4CQMB 1JKIA 2JGAA 2UVQA 2ZYUX 1FYVA 2XBLA 3GRKA 2G8NA 2MHCA 4JC4A 4PC1A 4HRAA 3SHTA 5CG1A 2D5AA 3JD3A 1I5EA 1FYWA 2ZI5A 4CLEA 4KN8A 2HPVA 1MJNA 3BFXA 3DKPA 3R0IA 4FFVA 4F4UA 2IPAB 2V7QD 4XI9A 3N1UA 3DNPA 3PD1A 4XSVA 1UZNA 1X9GA 3THWB 4M1KA 1A04A 3FXAA 4O08A