3IDUA

Crystal structure of the cardb domain of the pf1109 protein in complex with di-metal ions from pyrococcus furiosus, northeast structural genomics consortium target pfr193a
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
118
structure length
116
Chain Sequence
TDYDKLSNLTFEFPDLTVEIKGPDVVGVNKLAEYEVHVKNLGGIGVPSTKVRVYINGTLYKNWTVSLGPKEEKVLTFNWTPTQEGMYRINATVDEENTVVELNENNNVATFDVSVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Northeast Structural Genomics Consortium Target PfR193A
rcsb
source organism Pyrococcus furiosus
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 22
structure length 116
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07705 CARDB CARDB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3iduA00
3QUYB 1S5IL 1S7QA 2VO5A 4U7SA 3K2UL 3V5HB 5B22A 4G6JL 1HH6B 4U1NB 4NQXA 4WI3A 4PGEA 3GNMH 3RU8H 1NCWL 3N85H 1KN4H 2AI0L 4HIIB 4GBXD 3QDMB 4OJFH 5T1LA 1WZMA 2D7OA 3PWNB 2WM0A 3KXFA 5IW3A 5SX5H 1KCUL 5J56B 1VEOA 3IDMA 1ZVYA 1KN2L 3CDFA 4WO4A 1DUZA 3GMOB 3F5WA 3WIHH 5EZLB 1JNLL 5F9JA 5DK2A 3RVWC 1IKFH 1MIEL 1XZ0B 2M26A 2MJWA 4GBXA 3G5VA 4MA7H 1CGXA 2DRUA 2EDJA 4Y5VC 1OGAA 1UB5B 4JY6B 4N0CD 2CIIB 5D5MB 3M17A 3ELAT 2P7TA 2ZPKH 4Y7MA 3MA7A 1D5IL 3RWCB 4XP5H 1SEQL 5D7SH 4CADB 5FKPA 4FABL 1HZHH 3TBVA 1MHHA 5HI5C 5IK3B 5TQ2H 3MJ8B 4PGCB 2KZWA 4TVPH 1MWAH 1S8DA 3TH3T 2A6IB 3BGMA 2XA3A 5DJCB 5KS9E 4MNQB 3RGVC 3I6KA 2X4PA 3BI9X 2EE3A 3VFTA 5J0BA 3V79C 4YBLB 4GRMB 4PREA 1K3IA 4S2SA 3BIKB 5IMOA 3H7BA 1O7SA 4X98A 3VFUA 3B5GA 4M5YL 2DQCH 3SGEI 4WO4D 5JDSA 5IMLA 2JF1A 5HVHB 4ODSL 1Z2KA 4WV1A 5DDHA 5FYKU 1DUYA 3GSVB 5CSZB 2QQKL 3OJ2C 1AXSB 3ZKQD 1T1WB 4ZFGH 5EO0B 1UYWH 5DUBA 4XCCL 5JDJA 5CJXA 1S7XB 3UO1L 2IADB 2W0FB 2VLJE 5FYLE 5F93C 1G7HB 4PLJD 4Y5YA 3MCLL 1XCTB 4BKLB 1F3DH 1TVBB 5IFHH 5D4QA 5ETUA 3MO1B 2IBZX 3QYCA 1W0VA 4KK8C 1A2YA 3D39D 1GZQA 4KMTL 4PJGA 3WFDL 5E2UH 4DEPB 3U4EB 1OP3H 3W5MA 4RDQG 4JFXA 4NZDA 1LO4L 4JE4B 4LU5L 1HIMH 4P57A 2ZJSL 3CZFA 4AENB 4DOHB 5F7WC 1GGTA 1I7ZB 1PSKH 3EOBB 4FP8L 4PJBA 1S5HB 2GK0B 3QNYA 3OKLB 5JW3H 4LLMB 4XXCA 4FQXA 4EDXB 1BEYL 1H3TA 2P5WB 4XBGB 4YQXL 4JGJA 1GJIA 4Y1AE 2OJZL 1AGFB 3RAJH 2VLJA 3FL7A 4MMZC 1BBJA 5JMRA 2E3VA 4HPYH 4JO4H 3UZQA 2HVKA 3FT3A 5ICZA 2UWEF 4XB7A 3OBAA 2XWTA 3B5HA 5FO9A 4OLWH 3P30H 5ISZE 4M1CC 4C83A 1WIPA 4H8WL 1RV6X 4ZXBA 2BVPA 3O6FC 4JVUA 4U7KA 1QLRB 2D03L 4HWEH 4RGNC 1OSPH 4D0CB 2RIKA 3B43A 5D2NA 5C6TH 2IWGA 4O5LL 2HT4D 4XRCB 1F90H 1H0DB 3CUPA 5J06A 4BUGA 4TVPL 4X6CF 2Q1EA 4DAGL 1G9NL 1QO3A 3TN0B 1T7VA 4Y5XC 3ZO0A 3VI4E 3QIUC 5HGDA 4I0CC 1SJEB 5F72S 4OZGA 3DXAD 5FK9B 4HAFA 5C07E 3IFPB 3P9LA 2AJXL 4WW2B 1G7QB 3K8LA 1N7MH 3RTQB 1QBMH 2R2HA 5IEHA 3SGJA 2Q87A 4G42A 5LVEA 1CF8L 3H3PL 1AP2A 4O4YH 3RY6C 1QSEB 4OLYL 2UYLA 4YXKH 3AB0C 1XR9A 2IANB 1KIQB 3NAAH 3RL2A 3QULB 5IFAL 5KTEL 3D1MC 3K8MA 2H9GB 5F1IA 1UKSA 2BK8A 4S0TD 3PWUA 2FD6H 1T22A 1A21A 3H6JA 2IH3A 4HS8L 1IGFH 3VXRD 5I66B 1ULVA 1JGEA 3OAYK 3TBYB 5D1ZD 2DJ4A 3MROA 4P23D 3E2HC 4KV5E 3FMGH 1L0XA 4B50A 5DYOA 2H9GA 3NH7L 1TLKA 3RL2B 4MZ3A 4NT6A 1XR9B 2ORBL 4LHUA 5D7IE 1Z0NA 4HIEA 3UTTD 4M93C 4ETQB 3LRSA 3OKYA 3PDDA 2NTSP 5MEOB 5BCAA 3P4OB 5K9OB 4KJQC 3O6LH 4JG0L 4OV5B 2R8SH 4WW2A 5GRXG 5F88B 4O00A 2A9NL 4WU7B 1DFBH 2Z4QA 3QP3A 4M9PA 5IOPA 1MI5E 2Z4QB 2EO9A 3C2AL 5SWQA 4H88H 3IDGA 4XNXH 2EDFA 1IGMH 1ZGLB 4GLRH 4D9LH 4F7PA 2WUBH 5KS9B 1TCRB 3R0NA 5DD5L 2X89A 3MNZA 4LU5H 4TQEH 3V6ZB 4JO2L 3JV6A 3K4ZA 4HIEB 5CGYD 1F8TL 3CUPB 1N6VA 4P2QD 1NGZB 3U9UA 2J5LC 4FZEL 1XGYL 2C4FT 3R4DA 2D7TL 3VGAC 4D0BA 1YC7A 3G08B 1G6VK 1YMMD 2VLJD 3BP6B 1G7PA 4L29A 4WTZG 4JPKL 1JGEB 3JWOC 1MLBB 1X6NA 3MV9D 4I13B 2YHGA 4NRZA 2NXZD 2VAAA 2GT9B 2Z91B 4PPTA 2FDBP 4MJID 3GUTA 2QL1A 1L7IL 3DLQR 5ICZB 3DBXA 5TH2A 3TZVC 4LVOB 1G0XA 5MEPA 1IARB 3T1FB 1RVFL 3EOYG 2G9HB 1XF2B 4NN6C 2P8MB 3RGVB 4TPRH 4XBGA 1NUDA 2W9DL 5DJ0B 5DQDL 2HA1A 4ORGA 1UZ8A 3C5ZA 3ULVE 2V2WB 4NRXA 5ITFA 4G6MH 3WIFB 2XN9A 4ZUVA 4YXKL 3DHJA 3VWKA 3KPRA 2EE9A 3U1SL 5ALBL 5KBNC 3MV7B 3P9LB 1DVFA 1YQVL 1B2WL 1EDQA 5IR1B 3QJFA 4FFZH 4HKXB 5HHMB 2E7CA 1UCBH 1MY5A 2ZCKL 3RWJB 1EFXB 4WGWB 2DYPB 1MAJA 4X6DB 5DUMH 2BVTA 4UDTA 3C9NB 3QQ3A 4L5FH 3QRGL 1QO3B 2CKNA 2R0WL 3FOLA 3FAWA 1DBJL 4BUHA 5EU6E 4DCQA 3MV8D 5C0DA 4Y5YB 4G6AD 4U1LA 4ZFOA 3BP5A 1W0WA 1NAMB 4RFOH 4EI5D 4M7JH 1WBYA 2J8UA 1M71A 3BD5A 4JZOB 4UDUB 4R96B 3EDEA 2FYYA 2ZP0T 1T1XB 5EO0A 1K8IB 4G9FD 1MQKH 1FRGL 3HI1B 4QTHA 3QA3B 3ARTA 4PUBH 4QT5B 1YEJH 1BOYA 4X8JB 3UTSD 1MHPH 3HNTH 2ZNWA 1H9VA 3LS4L 1UH2A 1XGUB 4X7SL 3T3PE 1IT9L 5C07B 4Y19A 4AMKL 5C08B 4FQLL 2RB8A 3LH2L 3T0DA 2YD3A 4M5ZL 4GRWB 5JXED 3UTSB 1Q0XL 4QRRD 3LKNA 1OD9A 1ED3A 5T33L 5FO7A 5FEBA 5HD8D 2XTJC 2VE6B 1ZLUK 4R2GB 4PGCA 3QNYB 3SE4C 4RWHA 1J05A 1UC6A 4XCYB 5EOCL 3WKMH 2UUDH 4YH6A 2VDQH 4GKSB 5FKPB 3G6AA 2Q3ZA 4P57B 3OAZH 4KTDH 2AJVL 4UBDD 1UT9A 3LN9A 1LO3L 5C6PB 1NLDL 4QRQB 5AWNL 5CBAB 5F9AC 2Y25A 3GJEA 1GZQB 4YBHA 4RRPG 4OSUH 4AEFA 2GAZA 4LKXA 3JXAA 1JPTH 4H88L 5CSGA 4GBXB 5DK2B 1RURL 1A4JA 1GC1C 1I85A 4G8GE 4ENEC 4PJ7A 4NQEE 3IT8D 2BDNH 2IH1B 2WLZA 4PJEF 4C56B 3KPSA 4P46C 5IVNA 1OTSD 3A0OA 1KC5H 4MJ6B 3UBXG 4DZ8A 2WBJC 1EVUA 3UYRL 4PJ8D 4P9HL 1TJGH 5E5MA 2OMBA 1VGKB 5F7EH 1DQML 4RAUB 1F00I 4BA8A 3VFUB 4H1LH 3MRMB 5LGKA 5JPNB 2W9EH 3HN3A 3H0TB 1FAKT 5EBMA 3VGFA 5J1SC 4GAGL 1CCZA 4P5TA 1YUHA 2OL3H 1R0AH 2Y6SD 2XT1B 5J13C 2BOBA 4WJ5B 5IVZA 2NXZC 2PYED 1L0QA 4UUJA 5I9QC 5GSRA 3VW3H 1ED3B 1VEPA 1YN6A 5F89B 5HTSA 1HZHL 4PJCE 4KQ3L 3N9GL 4G43B 3BKJL 3MV8E 5FCSH 1ZGLM 5DK0B 1B2WH 1VA9A 2UZIH 1RI8A 1LP9F 1HHJA 4FG6D 1A5FL 1NMBH 4MB3A 3T08A 5MHSD 1I9JL 4Y0GA 3FO1A 4QXTB 2KKQA 3B9AA 3FQNB 3QCTH 1E6OH 2VDMH 2H3NA 3N50A 3U0PA 2YPLD 1JZ7A 1YY8A 3UX9B 2A0LD 1HDMA 2NY0B 1CDHA 3BP5B 2ZCHH 5E8NB 1B9ZA 3QUXD 1CFSB 5TQ0H 5ADPH 4NKIH 1ZAGA 1E4XL 1NBYB 3CK0H 3D39B 1R3JB 1WBXB 4L4VD 3BWUC 5FYJD 2J88H 1DQQB 3V6BR 4NO3A 2DYPA 4F2MA 2CPCA 1EFXA 1E4KA 3DI3B 1BOGB 1PG7L 3GMMA 1IAOA 1ZS8A 2FJFB 3QUXB 3MGTB 2P5WE 1RY7B 4HPOH 3THML 3DYPA 4K8RD 1OT2A 5KSUA 4RCAA 4I8DA 4KVNL 4LLVB 1EVTC 3D3VA 2OSLA 4FZ8L 4OUUA 4K2UH 1WWCA 5CEZD 4CVZB 2NY2D 3KDMB 4U1HB 3NABH 3VH8A 1OP5H 3VXTB 4ORGB 4E0RB 5D7IA 3B9VA 2G9HA 3NCYS 1XF2A 3HTLX 4Z76A 1HHGA 1TZHB 3RY6A 3WE6A 3TIEA 5ID0B 4ZS6D 5KN5B 5AYUL 4JHZA 4XPBH 1I4FA 3SDCA 4NZUH 1NFDA 2BX5A 3VXMD 4AM0B 4LQ1A 3GMRA 4QXGL 4G9FE 4OFIA 4D9QE 1DANT 5E8DL 2VAAB 5L88L 3VXUE 3TBSB 4QTHB 5ID1B 4FFYH 1UH3A 3TZVD 4BZYA 4GG6A 3HG1A 1LO2H 1KCVL 4MD0A 5CZXC 4NM4L 4ZTPH 2QLVB 4YGAB 1RZ7L 2NLJB 4Q0XH 3T0EC 3U9UB 1Z9LA 4ZYKB 1I8KA 4GW1B 4PRPD 4XP6H 5FO8A 4DN4L 3HNVL 2DM4A 3W9EB 4NN5B 4KQ4L 2D0HA 1KTRL 4XVJH 4QF1B 2NYYC 5JNYB 1FGVH 1OGTA 4ALAH 3WLBB 4FABH 4NCC2 4L9DA 5IB2B 2XZAH 3F7QA 1EXUA 1MFNA 2BVYA 1Z3GL 4LP5A 4HLZH 2P42B 5BW7C 1AE6H 3UMTA 4JKLA 1F4HA 3U6RB 4WU7A 1W72A 2BNQD 2FHBA 3CGTA 2Z31B 3OWEA 4PS4L 3QQNA 3HUJB 4BFIB 2GKIA 3BRFA 2OR9H 1QBBA 1G6RH 5EWIH 1EA9C 2ZUVA 2IJ0C 3IJYB 4P23C 2MPAH 2OS7A 3IFLL 1T66C 3IJHB 4IRJC 1KBGH 4PIRF 2P8MA 1N7ML 2JJVA 3ARBD 4H0IA 2FATH 3OGCB 1PQZB 4OZFA 2ICES 4DVBB 5DMIH 3T2OA 2W92A 3FHAA 3T1FA 2MQCA 3MROB 4TNWK 4ONOA 2H26A 5BRZA 2IFGA 4EEEA 1FG2B 1TJIL 5IQ7L 4JDVB 4V1DA 4P4RA 3QEHB 5CZXD 1NCBL 1RIVH 3VRLF 5DVNA 1YMME 3LV3A 4DN3H 2E27L 3GSQB 2B4CH 4OCYL 4OGAD 2X9YA 4P3DB 1ORQB 1JPFA 1JNHB 4YHYB 4KDVA 5BV7H 3ES6B 4FQXD 4LBEA 3O0RL 1FVEA 1SJHA 2ICWA 3MLUL 4FXKB 4R90H 5C0CD 5D71L 2IANA 1JF5A 5D2NE 1RUKH 5J3HC 1GOFA 1G0YR 5HHOD 4DZBB 1JHLL 1FIGL 4L4TA 2ITDB 4UINH 3V6ZA 3TO4A 5KG9B 3S3SA 4X6FB 3RWGB 3I75A 4LCWD 1BGXL 4MNHB 4JZJC 4PYHA 5F6HJ 4HUKB 5EA0L 3RTQA 4FOMA 3V52H 3PHOA 3GBLA 5E56A 4PJ9D 2OK0L 3KYNB 3BZFA 5JIHA 1F58L 2PCPA 4UI2A 1F8TH 1UQSA 3QNZA 3SKOA 1I8MA 4YDVA 1T6VN 4M00A 4NC1C 2RJMA 3D85A 1IFHL 3GHEH 4XPGL 3LQAC 4O51B 3HS0A 3L6FB 1DE4B 5DC9B 1NSNL 3CFIC 5DUPH 1LO2L 4ZTPL 3VWJD 4OZIE 4NM4H 4TSCH 4ENED 3AAZA 4OAWB 2BNQB 3OR6A 3QDGE 4G7VL 2C26A 4N8VA 1DEDA 4UTAH 3MRNA 1NGQH 4LLQB 2VDPL 1OARL 4TQEL 2XZCH 5F7KC 4K8RC 1MCOH 2GY5A 3DVIA 3W39A 3NIDE 5I66A 3T3ME 2E7HA 3N1GC 2AEPH 5FYJL 1BFOB 1MREL 5I18H 3PWUB 1MHEB 5B4MD 1KCSH 1URLA 3RL1B 2R8SL 3GJFK 4M1CD 3JUZA 5KVDH 2NY1B 5E2TL 1KIQA 2P8LA 5D7JD 4O2CB 4JREC 1A3RH 4I4WA 3SCMA 3LS5L 4MXVF 5KVMC 1YPZF 4FFZL 4OB5H 4NDMB 5FGCE 2LABA 3GSOB 2DDQH 3T4YA 3PQYD 5DJ2A 1T0MA 1QBML 2NY3D 4AENA 4HUUB 1V7NL 2XTJB 4ZTOL 3HI5L 2NY1D 4X7FC 4YHOH 1KF9B 3MJ7A 4U31A 2LV4A 5D72L 2KL6A 4K7PY 1RIVL 4K9EH 3ZE1E 1A6TA 1Q9LA 1E27A 1HXMA 3B3IB 4ZFZB 5T1DL 5D2LF 2GJ6B 3MNVA 4XH2A 1JPSH 3OG4B 4JFYA 1FHGA 4PRID 3RPIB 3OKMA 3I3EA 2R56L 2W0FA 3C5JB 4ESKA 2MOVA 3P73B 3GSWB 2BP3A 3KNBA 5D2NB 4TVPE 1OTTD 3LKPB 1QRKA 4WCYH 2A6DB 1T0NA 4QTIL 2AAVA 3QEQD 4H1LB 4PGDB 2NXZB 3VFSB 4CRPA 2HFTA 5HYEA 4IMKC 2B2XH 5EH1A 4ODWA 1ZE3C 4RGMC 3ZT7A 2LU3A 2RBLA 5D2LE 5GRJH 3TBWA 2VJXA 4HZAA 1CFQB 4GAJH 3HE7A 5T5FH 3RA7L 3WHXB 2FGWL 1AGFA 1HKFA 3QEUB 1MCPH 2DD8H 4A6YL 3FB8A 3PWLB 3I6KB 4JFFA 1QRNB 2D7QA 4WU5B 2NY7L 3WXVL 5I1LB 3BSZH 5TFSH 3O45A 1RD6A 1UM5L 2VDOH 2XXMB 5L2KA 3BH9B 2Y5EA 1OOAA 2DQGH 1XIWB 3PDGA 3BEVB 2Q8AL 1YY9C 4HH8A 4PJXF 2HP4A 4XCNB 1OAZL 3V4PH 1B90A 1Q0YL 4N0RA 2FNBA 3B8SA 2VXSL 1BQHB 4OCWH 5D5MA 1IM9A 2CO6B 5I15L 4ACPA 2D9CA 5J1AA 4I48B 3GIVA 3LN4A 3RX7A 1JYXA 4M6MH 2PW2B 2FEEL 1JIBA 4PRIA 3FO0L 1PFCA 2K7QA 3CDGB 3S36L 3DMMD 4HD9A 4X7EC 5AWNH 2VZ3A 1WGOA 1DUZB 3JWNC 3IXAB 1OSZA 1QKZH 4MJ4A 3SDAA 4OCXL 4QCIB 2J6EH 5D93B 4EZMA 2VC2H 5GS1B 4KWUA 2Y36H 4QHKI 4XT1C 5HHVH 1P7KA 3VFRB 5CP3A 1RUPH 4R3SB 2VDPH 3MYJB 4IMLB 1HIML 2VQTA 3QUYA 2MHAB 4JRYD 4XHJD 3KVQA 4OZHA 3QSKB 3VWJC 4GRMA 2LFGA 3L7EB 1N4XL 4PG2A 3MV9E 3PGCB 5BJTA 5ALBH 5C9JA 3QO1A 2HLAB 4RWYH 1OP3K 1HHIA 1KCSL 1AH1A 4KZDL 5D6CB 2XNAB 1JCKA 1S9VB 2EXWD 5IT2L 1Z9MA 1NH6A 1EJOL 2C7UB 4NSKA 3RWCA 3DUSA 3AROA 4BQ8A 2RFXA 4ERSH 2J1KA 12E8L 3G6JA 5E8OB 4L8DB 3SJVA 5KOMC 4CVXA 5IGXL 1E4XI 4UAOC 3WMSA 5I17B 1U8OA 4LASL 2FBOJ 1V3MA 3ZKXC 2EC8A 4LLWA 2APVA 3QO0B 4K3JL 4G8IB 4KRPB 5E2VH 5T5FL 3EAKA 5BO1H 4FTVA 1MFEH 4OM1H 1IGCH 2P5EA 4OGAC 5HDQH 4JKPL 1YNLL 4BELD 2Y5TA 5JOEA 3ZSSA 1B4JH 3BPLB 5J9PA 4U6HA 2B1AL 3EYVB 1Y0LA 1ND0A 1HSBB 3K7UA 1HOCA 4LFHD 5D70L 3SCMC 1M7XA 2OP4L 3F6IA 4XMKH 4KTYA 3JWOH 2AGJL 4PV8A 2RR3A 4U1NA 5BZDB 5DRWB 2Y72A 2CJUL 3L3OB 3IU3B 2L7JA 4GRLB 4LVNC 4PV8B 2HJKA 1V3JA 3FTGA 4TOYH 3F58L 5J89A 3GSUA 3TWCH 5IW1A 4U6HB 2VDQL 1QYGL 5CJQH 4LF3B 3B83A 3DIFB 3HRPA 3RI5K 1CFNB 3LQMA 3JV4A 4U33A 4AJ0A 2LTQC 3MJ9L 3UAJD 2VLKE 2KZ1B 3EKCA 3AUVA 1MJ7L 2XA8L 4GRWH 2C3WA 3L3IA 3OKEA 1F3JA 1VPOH 2UZIL 3GGWA 3BE1L 1MQ8A 1F6AB 3H3KA 2ZKHH 2I9TA 4JHWH 3TP4A 3CD4A 4L8DA 5JR1L 3GO1L 3VXUB 4JANB 4WGVB 3HLAB 1JWSA 1R3HB 5D7JA 1AHWC 4L1HA 3L5XL 3EDFA 4FFWC 4QXUH 1DN0A 5FECA 2C7UA 1T0PB 4DUXA 3NABL 4L8SA 4YO0B 1FO0H 4OZ4B 2BSSA 3WUWB 5CINL 3U46A 4P59L 1MRCH 5GZOC 4FQJL 4LDOB 2YWZA 3QXAA 2CK0L 2XNAA 1HN1A 1MCLA 4KAQL 1ES0B 1LO0L 1JHTB 2PO6A 1X4XA 2CH8A 4EVNB 5CEYB 4JG0H 3C60B 1PAMA 1DQDL 2CLRA 5FYLH 1TJHL 1KOAA 3FTGB 2ERJB 4HKBA 1IM3B 4OZIA 1KEML 4YXHH 4L3EE 3ROLB 3IU3A 4GRLA 2PXYB 9CGTA 1MNUH 1BWWA 3GZKA 4XNXL 2IGFH 4BJLA 5EFIA 2EDLA 1G7JA 1MPAH 5E00B 2YUZA 4OGXL 2NY6D 3IGAB 2IEPA 2BSTA 3NZ8A 2Z31D 3IXAA 3OXSB 4OT1L 3HRZA 3RDTB 3NCCB 3ARUA 4DKFL 5EIVA 5E2VL 3DUHA 4QWWD 3DETC 4YE4H 5HI3C 1CDUA 3OZ9L 4K7PX 2XRAH 2XWJA 4JZNB 1U92B 3DRTB 4QXGH 2FJHB 1A6VH 4YDJA 5HHME 4L4TD 4OFYA 2APXA 3DVNA 1IRAY 3QCVH 1CZ8L 4AEIH 1XH3B 3ILPA 2XOTA 4HIJA 5AYQA 4OLUL 3LN5A 5I1JL 1A7NL 2DB8A 4U0RB 5SWZB 1KV3A 1T1YA 1BWMA 4LRNH 1KSRA 1QHOA 4XWOC 4JDTL 3O6ML 4Z6AT 4RQQB 4WDIB 1KPUB 3MOQA 3MXVH 4HK0B 1Q94B 4ZO8A 3BIAX 1P7QA 3IDNA 2YPVH 5GGVY 2R69L 3U4BH 1Q8MA 4QOKD 2R4SL 3RWFA 2MNUA 4OM1L 3DXAE 4PJEB 3CVHH 1G6RB 4RBPH 4OZHB 5JHDA 1A9BA 3QJHB 2EZ0D 4XB8A 4PV9B 1FH5H 2NW2A 2X9WA 2AXFA 4MB4A 1I7UB 2BVQB 4I0PA 3QFDB 1AGEB 3TT3L 3MYZA 4N0UE 5F7DB 4QCIA 3VG9B 4NO0B 2FZ3A 5CINH 3VE0B 2VLLA 5TDNB 32C2B 4Q9CA 5L8JB 3BPOC 3CDGA 3CSGA 4OD1L 2QQKH 1FL3A 4NKDA 4PRPB 1G9MH 4XH2B 1Q9WB 4KKCD 1GGUA 5DHYB 2EDWA 3WSQH 4IOFD 4PFEA 1D6VH 2EICA 1MY7A 2A0LC 4OZGF 5FUZH 4Z18A 4Q9QL 3ARDB 1R5WA 4J1UB 1A02N 1S7VA 3BQUD 3T2QA 1BEYH 1JYVA 4U1IA 5DJAB 1IAIM 4HEPG 4Y1AD 5I9QB 1H8SA 4JM2C 3CMOH 4MX7A 3MLUH 4PGBB 1K8DB 2DL2A 1ZA6B 4XNQB 3O45B 3VCLB 3FQRB 2GK2A 1YYLH 1H15B 1OTUD 5HDBF 5T33H 1BVKB 4JRXA 2PYEA 1S5IH 2XQBL 3DWTA 4QYOB 5ICYA 2R2EA 3TVMB 4MDIB 4RGMB 5B39G 4AIZA 4NO2A 1VFAA 2VXUL 4M7ZC 3DVGA 1FN4A 1TITA 5JW3L 2AV1A 4KUCF 5D96B 4HKZA 5AEAA 1H5BA 3P40A 5C0IA 4LSVH 3PQYB 3VGBA 5FUCC 2DWEB 3MNWB 1MJJA 4LLYB 3W39B 1FFNB 4PRHD 2BRRH 3A6CL 2ZUXA 3PGDB 1ZVSA 5AAWA 3MGOA 5BMFH 3GB7A 3OTTA 3PGFH 4FQIH 3PDOA 1R5IA 1UJTA 1U3YA 6CGTA 3S3PA 1KPVB 1FVCA 2A6DA 3BN9D 3GSWA 3S5LB 2A73B 3KPPA 3KPLA 4PY8J 5E70A 4P9MH 3SPVA 2LVEA 2OCFD 5HYJD 1W0YT 5KSBA 2CRYA 2GJ6A 2EH7H 2ZCLH 5IROC 4FXGB 3GSXA 5L6YL 1HILB 3KPLB 5TQ2L 3HZYA 4F9LA 4NZRL 4QHUB 1T1ZB 4WFHD 4RGOL 1A6VL 3RBGA 3MGOB 3QUMH 3VXOA 1ZT7B 4H20L 3RP1A 3FB6B 4GW4A 3I75B 4MNHA 5MERB 5D6DA 3E1F1 4F37K 2DTSA 4NC2B 5EIIA 1TMCB 1BLNB 2R1YA 4IRSD 5E9DD 2BNRD 1IC4H 1EO8H 1NGXA 3QHFH 4M1DL 5KVEH 5MHSE 4FFVC 1GGIL 1MH5B 2R2EB 5LXGH 1NFIA 2QBWA 2WAHA 1EHNA 1EEUA 2IMMA 1TTFA 5DZNA 3QNXA 5KS9F 4GKZB 1K8DA 2QADD 4XZUB 5HVWA 1LK2B 4QHLA 1KB5A 3NCEB 4O2EB 5LKNA 3MRNB 3RJQB 2M8XA 3WFHB 5DWUL 1JZ8A 2J7LA 3IJHA 2LVCA 4P5TD 5L0QB 3PIQA 1C8PA 3UTQA 1DDHA 4HC1L 1CU4L 1DQLH 2APFA 4O51A 4C58B 4L8CA 4CL7A 2VXTH 1RZIB 4OIIL 5C70A 3S96A 3MLTA 4EJ1C 4JQVC 4XVTL 4MA8L 1AO7E 4N5UA 1KUMA 1PVHA 4I0PD 4F37F 4TSAH 4WIQA 1SBBA 1VFMA 5I75C 5EZJA 5DS8B 5I8OH 3I02A 3FHQA 3T0VA 5BS0E 4UT6H 3HPLA 2DD8L 4A6YH 4PP2A 3IAGC 2ADIA 2YSSA 4JRYB 5F7UA 5GZNC 5ESVA 4J12A 5EZIH 1ZV5A 1VB9A 1MF2H 3MLXL 3UJJL 3DHMA 4ZOEA 4GFTB 4O2FA 1QLEH 3OF6A 2HKHL 5EOTA 1FPTL 5KSAA 1ZXQA 2L7UA 4WW1B 3CLFL 2AK1H 2VUYA 4LVNB 4W6XB 3SKNB 3EO1B 3ZKMD 3MLZL 5JUEL 5DD5H 4GQ9L 1UA6H 5CJ8A 5EULV 5C7XL 3TO4D 1LD9B 1RVFH 3F12B 1EO7A 3C2SA 2FEEI 5I1IH 3WIHA 3P4MB 2CRIA 3C6LD 3MUY1 4MD4B 2Q8BL 3S5LG 1AO7A 2H26B 4JN2A 2VQUA 4YC2B 5ESQA 3S36H 4Y4KD 1LK3H 1C7SA 1N59B 4R4FL 3L95A 3V4VL 3LKQB 2JELH 3DROA 2FO4B 5ERWB 2JCCE 3AS2A 4MWFA 5J6GA 1QFWH 2CD0A 1AQDA 3ZSTA 4KMQA 3VFNA 1XF3B 3GI8H 4DW2H 5BRZD 3LPGA 4GMTH 4TULH 1D6EB 3A6OA 2HYMA 1LE5B 1EFQA 1LNUA 1F97A 2JJSC 4G7YH 3TV3H 5I8CB 1RMFL 2KH2B 3SQOL 1FDLL 2GTWB 3PL6D 4OUOA 3VFWB 2XZAL 1F3DJ 4JR9H 5K9JL 1YEFH 1O0VA 2X70A 3W81A 3CU7A 5B8CC 2KQNA 1ZSDB 3OKNA 1CD0A 2GITB 4POZD 3MJ9H 1IM3A 5EN2B 4ZYKA 3JBG7 2NLJA 3W0WB 1YY8B 1J0ZA 5CS7A 1EHXA 5C0BA 4J4PC 4J3VA 2P4AB 3QWOB 1BPVA 4WFGE 5ID1A 2HFGL 2YRPA 1OAZH 1FL5A 1IKNA 3WNKA 2VXTL 1IAIH 4JLRA 4YIQB 3TA3D 1I8IA 3DNKA 2ATPB 1UACH 1LP9A 2A6JB 2BSSB 1YJDC 3D0VA 1VHPA 4YBLC 5JW4R 3VXSA 4P4KC 3CMGA 1X9QA 5SWZD 3WE6B 2OTPA 5FB8B 1LHZA 3NN8A 2NR6D 1QSFE 3QXWA 4LHJB 3W9DA 3BDYL 1D7FA 3BGFB 3ULVD 1YECL 2DICA 3L3IB 1QR4A 4X5XA 4Y16B 4LSTL 5C08E 4FQLH 1I1AA 2ZOLB 4MLSA 5DEFA 4OSUL 4XP1H 1I9EA 1CFNA 2F19L 4HG4K 1NBQA 2ZZUT 4Y2DC 3QUZD 5F7FA 1UEYA 4JY4A 5DHVH 3WS3A 3U79A 2QHRL 1QD0A 3BPOB 3MACL 4XXDB 5DEGB 1NMCC 3MLWL 4ODXA 1NMAL 4DVRH 1N5YH 1VESA 3RUGA 1INEL 3AS3A 5IG7A 35C8L 4CN1A 3MRMA 4P2QA 3UEZA 1K5NA 4LSSH 1F11B 1NLBH 2QQNL 4L3CA 1IL1A 3VH8G 8FABB 2E8YA 15C8L 5TF1H 1ZVHA 3OJDB 3RVWD 3S97C 4YWGL 2HT2D 4PJAB 43CAA 1JPGA 5BQ7A 2H3NB 1FBIH 5J9PB 4OZIF 1OB1B 4HWZA 2AJZB 1MVUB 4L4VA 3T77B 1AY1L 4LSUL 5JQHC 4ONFL 3QCVL 1XGQA 3QPXL 3G6JE 1B0GB 4OLVL 2ZG3A 3QO0A 4EI5C 1T4KB 4JFEB 1HHJB 1X5IA 4JB9H 1HCVA 2DQEH 4P3CH 1YEDB 2YPLA 1JUFB 1ZHKA 5IG7B 2D3VA 1T3FB 4K7PL 2G60H 3GJEB 1AD0B 1HYRC 1SVZA 5D96C 4E5XB 4P2OD 1ZLUH 4AT6B 5IWLC 3U4BL 2XV6B 4MQ7A 1U8IA 1KN2H 4HULB 2V5RA 4X5XB 5AZEH 3S34H 5IVZB 1K4CB 2PYFB 4ZAKC 2PR4L 2BOBB 2VXVL 3ESVF 3P4LA 2IGFL 3GMQA 1NC2A 2GSIA 3B6SA 2CDFA 2J4WH 2AQ2A 1JPST 4WY7H 1NCDH 5I1DB 5I16A 3H2WA 1KJMB 3VXSB 3OHXB 3D0VB 3CC5A 3BN3B 3QIUB 1A4KA 2AEQH 2DTMH 4JY5L 3SY0A 3VFRA 4Y4KC 1NDGA 5JOPE 1TJGL 3DI2B 4M93B 2OYPA 3O3EA 4LSRH 3U7AA 1GVIA 3HI1A 3GK8L 3RTQC 3SDAB 4CVUA 4G6KH 5GS3A 3U2SA 1Q9KB 4XP4L 4LPCA 3SE8L 2BSRA 1S7SB 5DMGC 4M1GL 5E03A 5J7CC 1D5BA 1J8HE 4HIHB 3OKNB 1KXVC 2PW2A 4I2XE 3KPOA 4P2QE 3THMH 1Q38A 2EDBA 3GIVB 4U6XB 4X6DA 2I26N 4APQD 1EZVY 3LEVH 1FGNH 5KAQG 5DD0L 5FM4A 3VFWA 5FYKL 3MLWH 1BQHA 5DC0A 2J6EA 5HHQB 4U1MB 2JK5A 2AJVH 2BCKA 5DD6B 1REIA 1AFVL 1FFQA 2DJSA 4O02L 4HQQH 3VWKB 1R3LA 5BW7A 1RJZA 4XCYA 1G7LA 1WT5C 4E41D 3WN5C 1FL6A 1PG7H 4ZUVB 1KGCD 2IMNA 5E1AB 1MJ8H 2ESVE 1LEIB 1QA9B 4LARH 4YGVB 3DROB 1QBLH 1U42A 4I18B 3BO8A 1ZWIB 2EYTA 3KPMA 3TPUB 4ZUWA 3LKSB 4NOFA 4Q58C 3WN5A 2FR4A 4WUUB 3ZDYE 4EXKA 1ETZA 5C07A 2DQEL 2OR8A 4N0UA 2HTKC 4LLAA 1AKJA 3ZE1F 5I1CL 3HMXL 3UDWC 4YX2H 2Z91A 1RJLB 2X4TA 1Q9OB 4QT5A 3QEQA 4DKFH 3HNVH 35C8H 4CU8A 1D5XB 1S7UA 1T0NB 3SOBH 4U2ZA 3EZJB 1F2XK 4NBXB 4Y19D 1EJ6A 2CGRH 1WBYB 2J8UB 5HY9B 1F4XL 3SDCC 5HYQA 1NGWB 4HUMB 1BFSA 4RIRB 3ULUL 1DBBL 5B3NA 1JZ2A 4HS6B 4Z7VB 3IETA 4X83A 1R0AL 1AY1H 1JGLH 2YSSB 3QZWB 3QQ3B 2YUXA 1EEQA 1ZGLA 5D7LD 4XP9L 1YEHL 2W07A 2N7AA 3A67L 4EI5A 4ZAKA 1ADQA 4NC1E 2FL5A 1NEUA 3RZWA 2EC9U 1MUJA 2HMIC 1S9XB 1U6AL 4HUUA 4RFNC 3L3DB 1ZKAA 4O5LH 5BS0A 5F8RC 5MEOA 3EZ8A 3OKDB 3P11H 3UTQB 4XP5L 1GC1H 3WIFA 4RNRA 3OB0K 4I4WB 1CGTA 4XWOD 4HUWA 5IMMA 1JGUL 2JCCA 4BQ6A 4J3TA 4YBQD 3MJGX 3LEYH 5ISZB 3H42H 2PR4H 5EBWB 5C0GA 4R26H 3B2UD 3AVEA 3SE3C 3O3DB 4U1GC 4PJFA 5EC2A 1M7DA 1CQKA 3LEVL 1DLFH 1XGRA 1QOKA 5EC2B 4KQ4H 4XVJL 4LCCB 5ANMB 2LQRA 2F53B 4QHKJ 4IIQA 3BP6A 4L29B 4HC1H 2WBJB 1H3XA 1HI6A 1YA5A 3MFFA 3T0AA 3A6BL 1AFVH 5J6HB 1N6QH 3OR6B 1MCDA 2IC2A 5EA0H 1A64A 3FN3A 1TCMA 1OAQH 5IBUG 4MA7L 4QHNB 1FNSH 1CXHA 4ZAKD 1OPGH 3JV6B 1DE4A 4BFBD 5ESAA 1T21A 3MREB 3MRDB 5ADOH 3X13A 5BS0B 4PS4H 4Z0XA 2EXYC 5J13B 4KUZL 3VDAA 3IDGB 3ROOA 3WJLA 1IAKA 4BSWA 1IKNC 2FL5B 3RVTD 3KXFE 2DQHL 1JTTA 4F15B 3FCTA 4LCWA 5IVXB 4KY1H 2BY1A 2BY3A 4XPAH 4TTDD 1K85A 3WNOA 4M5ZH 5HHXL 4CN6A 4ODHH 1HEZA 3OR7A 4JN1H 2Q7YB 1DCLA 3MLVL 5BVPH 1H3PH 3CAFA 2EDEA 3BKML 3SPVB 2JB6B 2VL5B 4AEHL 4H1LG 2VKXA 1QEWA 2VRAA 4PLJC 5GGUB 1CDCA 4A2LA 1HE7A 1JPFB 2BVEA 3PGDA 1Q9OA 4PR5A 1MJJB 3O3AA 3KJ4C 2IH3B 1AKJB 4B7LA 4UV4L 1D9KA 4N90D 4KRLB 1T22B 4E41A 1FE8L 2MCPH 3KYMB 4LPXA 3MLSH 1JL8A 4D9RE 1NPUA 1MCNA 4O58H 5LGJA 4EN3A 5EO9A 4MDIA 3MV9B 4KDTA 4ZS7L 2JIXA 2AEPL 5C0AD 4CN4A 5IMMB 1F58H 3QI9B 4R97C 1QSEA 4L3AA 5DQJA 3IJYA 1KXQE 2YD5A 5HPMB 3VCLA 2XWBB 4K9EL 4G42B 2BSED 4XNQA 5IEHB 4FTVE 1CTOA 3FFCB 3QXVA 4URTB 4FQ1H 1M05B 2BCKB 3HR5A 3HCVA 4UIKL 5EZIL 2JK5B 4Z9KB 1RUML 4QRPA 4TSCL 3GRWL 3RZCC 2JJTA 3VFGL 2V2XB 2KQMA 5T3XL 4XNZB 1CLZH 5E9DE 2P46B 4TPRL 4M61A 2EEAA 2QEJA 5E2WL 2A6KA 3KPOB 4NQED 5EU7E 1OTUC 5F7MC 4QF1A 5KSBE 1C5DA 2ED8A 4GW1A 3HB3D 1C16A 4AG4H 2YK1L 3NFNA 4MNGE 1Q9KA 4X6CB 1IJ9A 3EYOA 2RGSA 4KXZH 5GJTL 4ZXBB 1NC2D 5DDHB 2ARJA 4LAQL 3GMRB 1V5JA 2HG5A 2CKBA 4U49A 3MLRH 3QJHA 2KPNA 3CXHJ 4O9HH 3WDHA 3DO3A 1B0RB 3DUUB 1M4KA 1IEBB 2DI9A 1G6RA 3WN5B 2FR4B 1KXTB 4F7TA 3WFZA 5ID0A 1DLFL 2CDFB 5DZOA 2H2SC 2X4UB 1ZWIA 5FIEA 4P2OA 2I07A 2P5WA 4FA8A 2OK0H 4EDXA 1FDLH 5E1AA 5IB4B 1Q94A 3R1GH 1K4CA 5CD5C 1RK0A 1R3LB 1I7ZA 1NAKH 4PRIE 4GAFB 4XNYH 5C0NC 5KSUB 2W9LA 2CLZA 3ARED 3I2CL 2C1OA 1FC2D 2VDKL 3EYQD 3PP3H 1G1YA 3MGTA 3RHWF 2CIKB 2Z35B 4QO1A 4E5XA 1IAOB 1BOGA 1JZ5A 4KMTH 1A2YB 4PJGB 1T3FA 4OQTH 4PJFE 4LIQE 1OGAB 4JAMB 3MTRA 4IRJB 5ETUB 3K81A 4YHNB 1P4IH 4HIHA 2XACC 3C08H 3IJSA 4M48H 4JFDA 3IDIB 4MD5B 3U2SB 3VWKC 1UB6B 43CAB 5IKCB 2G60L 3KPSE 3GSVA 5CCKH 5FYJU 5DMKB 4NQEA 3OB8A 1LK3L 4M7LL 4WV1B 4KUCD 5IMLB 2HH0H 5JDSB 4GRWE 5DD1L 4KHXH 1FYTA 2VSDA 4Z7VE 43C9A 2BXYA 4QRPD 1WFOA 2NW3B 1C12A 3CZJA 2V7NA 1HKLL 4ELMA 3CX5J 1U8MB 4KROC 3V6OA 4NN7B 2XQBH 3EYFA 1JHTA 2PO6B 5C09A 5B38B 1RFDL 1RAMA 4HUXB 4MJIB 2PYFA 2YS4A 3MJ8A 4S1RH 5D7IF 4DK3A 1N5AA 5T5NG 4E42A 1MHHB 4YDLB 1DFBL 3JWDH 3BMVA 3VJ6B 1ZEAH 1J5OL 4KI5E 1OAKL 1YUHB 2YC1A 4PJGF 5E08H 4KDWA 3FFDA 4YHMH 5JW5A 15C8H 2V5YA 1H5BC 3O4OB 2X2YA 4L4JA 4NJAH 3O2DA 2H45A 5BMFL 2M1KA 5EU6D 2XKNB 4K8RL 3MRKB 5C0BD 5I1KH 3GGWB 4YPJA 4X80L 1UB5A 4RGND 1LP9B 2A6JA 1ZT1B 2ATPA 2J3SA 5DTFB 1IC7H 2XFXB 1T4KA 4JFEA 3GKWH 5E99H 1IKFL 4FZEH 1B88A 1UKTA 4F57H 5CMAA 2ZOKB 4PP1C 4N8PA 2KDGA 5I1HH 1KCRH 4GKOA 4LF3A 1OB1A 4RFNB 3IDMB 1DTUA 3HE6A 5C0BB 4P48A 5HYIA 2NX5D 3Q5YA 3UPRB 5LGHL 4KQ3H 5CWSB 1RZJL 3ARZA 2OTUB 2ZUSA 3L9RB 4YDIH 4YUEH 5BZDA 4N9GB 5HYJB 3SN6N 4J8RB 1ZGLP 4M6NH 3KHOA 3ZTNL 4BH7B 2VTFA 4HBQA 5CBAA 4QRQA 4U1GB 5DI8B 3VFVA 4DJMA 2EIZB 4YNYA 3ZYOA 1BVZA 4HJGB 3SDXA 4LPTA 4HGWB 1UENA 4FTVB 4WENB 3WFCH 2MQ0A 4WY7L 4G8GB 3DTXB 2F5AL 4Y16A 4GKNA 2DLEA 4MNGB 4G6ML 4LLUB 1L6XA 2DI8A 1YEIH 2HT3D 1FO0L 1N0XH 3I85A 3MXWH 3SJVB 4XPTL 5CZVL 5MI0B 5CJOL 1NCWH 1YQVH 1ERNA 4K9EC 2MKWA 5CSBA 1B4JL 4MQXD 3DX9B 3G04A 2WMPA 3AY4A 4Z78B 1U41A 5EUOA 2ICEA 2V2TB 3EFFA 4NUGH 4NNXB 5L2JA 4BSVA 3X3GL 3O2VL 4RMVA 2ENSA 4GS7B 1BP3B 4I1NB 2DMBA 3K8KA 3QO1B 3PL6B 2FYYB 4JZOA 3L7EA 2K9UA 5TDPA 5EOTB 2Z93B 5FGSA 3G6DH 1E6JH 3ZKNC 2E7LA 4X9BA 1N4XH 1YEGL 2WLYA 4WRLA 4I2XA 1KYOK 1BJ1H 4APQB 4JRYA 3ZDZE 1N3NA 4MJ5A 1U9KA 4IRZL 5DJ8A 2DQTL 3PJSB 1A6ZB 1MI5B 3KPRD 3VWKD 2HJFB 3V6FA 1JGLL 3KPQB 5IEKB 3S96B 3MRIA 3GKZA 2R0LL 4GO6B 4PJXB 4PRIB 3PNWA 4R7NB 5DQDH 3P4NB 1UA6L 1SEBA 5I74C 1FLRH 3PIQB 1I9IH 2AXHA 3C5ZB 4RZCB 3RWEA 4J23A 5ERWA 5JPMB 1IAMA 5DSCA 3AU1B 3QI9C 1MVFA 3EBAA 4QRRB 3P0YH 5GS2D 4KI5F 4D0DA 4XCNA 4LEOA 2WWKT 4YHKL 5MEPB 2D03H 4QY8B 4AH2B 1MWAA 2BNRA 1QNZL 4NCDA 3OAZK 3QNXB 1AC6A 1U93A 5I1LA 3HZVA 4ZPTB 3H42L 2OP4H 2W60B 4D0BB 2VZ1A 5ADOL 3KR3L 5DRXB 1ADQH 5IM7A 3QFJD 4ODUB 5JOFB 3HB3C 5EO1B 4NO5A 3RY5A 4LOUC 2YPLE 2UY7A 4KK5C 3MNZB 4HWBH 2LE9A 1TCRA 1QVOB 3OXRA 1O5DT 4Y5VA 5DFTA 5GRVL 5IQ9A 3VFSA 1R3IL 4X99A 2YN3A 1FZJA 3LKPA 2YD1A 4Y4FA 3NAAL 2G75A 3L3KA 4WEBH 4KKAD 3ARGD 4NUGL 1I1FB 1RZIA 4JFYB 2OQJA 3FN9A 2VMFA 4J3WA 4JFZL 4XWGH 5E5RB 3X12A 3MRRA 5F6IB 4ZFZA 4K3DH 2YD4A 5TGBA 5D1QA 3P0GB 3D3VE 4N1HB 3MV11 5GZND 1N0XL 3ZZ1A 3U0WH 1I1AD 4KTDL 5IB3A 1ZVSB 3BEWB 3VFPB 1EUUA 2XICA 3BPLC 3T2NH 3QAZC 4JRXD 2B5IC 3CXHK 3MCLH 1TDQA 3PQYA 2F5BH 2VIRA 2ESVB 5BV7C 3ARFD 4XPHL 1MRDH 5GGSY 4O2CA 1NJ9A 5CFHA 2IPTL 5FOBB 5IW6A 3VI4F 5IIEB 3MUJA 4Y1AA 5FXCH 5FDWB 1SYSB 5FOBA 4XI5C 4QYOA 1VFBA 3EOAB 1BVKA 4JRXB 4JFHD 2JKXA 2VWEE 4MQXC 4UTAL 1X5AA 3VXNB 1TTGA 4L8BB 1T80A 1F45A 2HN7A 4Y2DA 2AXGA 3UYRH 3VFMA 2GCYB 2LU4A 3JVGC 4Z7WB 2FX7L 5JXEC 1CT8A 4NFCA 4X7TB 4PLKC 5FK9A 1H3PL 2NY6C 4DGIL 3TNNB 4PBVC 4ZNEA 4LNRB 4R8WL 1WBZB 5GGQL 2EEBA 1IC1A 4M02A 1R5WB 5E0QA 4Z7NE 3MRGA 1MFCH 4OI7A 3QISA 1NCAH 3C6SB 1JK8A 3O4LB 1YPZB 1U2CA 3MUGA 4LSUH 4QRSB 4ZUUA 2VLLB 1CLYH 4OKVB 1UQSB 3QNZB 5F8QC 5IT2H 1L7IH 1QQDA 4ZPVA 2C3HA 1G7IB 4LNRA 3SGDI 1FC1A 1WITA 4M3JA 4YHOL 1AGEA 4X7TA 5GQBA 2BVPB 2R4SH 4YDLC 5FHBH 1I7UA 2BVQA 4ZFFA 5C92A 5D8JH 4WHDA 4XBEL 3MRLA 1OAYH 5KG9A 3U7YL 1ONQB 4TRPH 3D0LB 4JFOA 2F54E 1QNZH 1VFBB 2YZ1A 2BZDA 4Y4KA 1FVEB 1SJHB 2WANA 5FDWA 2WUCL 1QSFD 3ES6A 3QUYC 5HYSA 2B1HL 2AEWA 2IAND 3V7MA 4CJ0A 3V4UL 2I60H 4KRPC 3STLB 4P4KD 1U3HD 5T3XD 3OKLA 1Y18B 1U93B 1WWWX 1TXKA 3BPNB 4PB0H 2JJSA 4XP6L 4HMCA 5HJ3B 3DV6A 4MCYA 2OTWA 4R4NC 1KEGL 2X1XR 1Z5LB 4NHCL 3UTZA 5KSAD 3T0EE 4TTGA 1UXSB 4WHCA 1QR1A 3NFPA 4G8FB 5IJKA 1U3ZA 2FJGB 3OF6D 4CGTA 4P23B 3HHRB 1TETH 2EDRA 4PJ8C 4I3RL 4PJHF 3TA3A 4RGOH 4Q7DA 5C0RL 5DHYA 1XCTA 1MFAH 3DX6B 3HZKB 2VDNL 1G6RL 1M6OB 1B6UA 5EORH 2HJFA 4ZNEE 4LRIC 2G2RA 1CI5A 1TNNA 4JJ5B 5DT1L 4X99B 2EYSA 3ZHLA 5IESH 2X4RB 3GO1H 3QFDA 2FHCA 2BC4B 1LDPL 1MCFA 3OXRB 5GHWL 5MP6L 1Z0MA 3DMMB 2NW2B 4X9FA 4ELKA 5SWSD 4IBLT 1GGCH 1MCOL 1MRCL 4PJIA 4FP8H 2WINA 1ACYH 4MAYC 4ODUA 3EJZD 1UADC 3VFTB 4WWID 4BQCA 2NXYD 5IB1A 3PQYE 5HYSG 3NACH 4M6OH 1WAAF 3C2AH 3VG9C 5L2JB 1JZ3A 1YMMB 3RUGF 1JP5A 3ZDYF 5IK3A 1G7MB 4HF5H 5JO5A 3VD4A 4PP1D 1KEMH 5BZWA 4JPVL 3PWPD 1CLZL 4V1DE 2DIBA 5D1ZC 1CU4H 1DQLL 3C60C 2IALB 3TIDA 2D0GA 3UBXB 3CFDB 2D7PA 5TF0A 5E99L 3HR6A 3DGGB 1CK0L 1WV7T 3M1BB 3RU8L 1N26A 3GEWB 1OGAD 1WISA 1RIUL 1DANU 3VXTA 3DRTA 1KLFA 1J0KA 4JY6A 4LLUA 1QFPA 3PWPB 5C6TL 3G5VB 1ITBB 4KRMB 4YZFF 3KYOA 3IDXL 1R3KB 3BAEL 3MRIB 4KJWC 1IGYA 3RWHA 4FMKA 4KHTL 3V6FB 1AR1C 4NQCB 5KVFL 1ZS8B 1GGBL 3M45A 5DFVC 1U8QB 5DF0A 1HYSC 1D5ZA 5HYJA 3LH2H 4BZ1L 3L3OA 3UP1A 3ZYZA 1DLHA 4FXLA 1QSZA 4PRHE 1NCBH 4NQDB 4JFQB 2F5AH 1HDMB 2AW2A 1Y6KR 5FYJH 1LQSR 3BH8A 4MHHI 1MEXH 2R0KH 4LPVA 3KJ4B 1EBPA 1YNLH 2JTDA 2P5EB 4YHML 2ZOKA 1OQXA 1BECA 2FGWH 4S1QH 1R3KA 1BIIA 5BV7L 4Q6IB 4NNXA 2FSEA 4EOWH 4HV8B 1JMZA 5EUOB 3FB7B 4HC1A 3NCYP 5K59E 2FGZA 2VDRH 3BSZL 5TFSL 5MENB 1KTKE 2B5IB 1IQWL 1P4IL 4G43A 4GW5B 4U1SA 5E95B 5BV7B 5F9OL 5I1GL 3UBXA 3IFOB 4JQIL 2IALA 2PF6A 1NUFA 2HRLA 3DX7A 1RZGA 5IBLD 2A77L 2B39A 1U3JA 3GSRA 3RIFK 1RZKH 1CICC 1NMAH 3MCKA 2VZOA 4R2GD 5IJVA 3JV4B 1QUNA 2VZTA 4NKMA 2HT3C 3WSQL 2GEEA 1VADB 4HCRH 5FUZL 3GDBA 3BH8B 1WEJH 3H0TA 4G8EB 4Q2ZB 5C0ND 1NGYA 3FT2B 1XF5A 2DJUA 1FYTB 3BUTA 5CLWA 2BFVH 2EDOA 2VQ1B 3QWRD 3UJTL 5CEZE 5LWYH 2BC4A 2GSGB 3UPRA 4S1RL 3OX8A 2QJDA 1Y6NR 4KPHL 3ZDZF 4NQCA 2CXGA 1JZ6A 4GG8A 3RWHB 4M43L 1CDBA 5F44A 2OI9C 4IEFB 1IMHC 4FFWD 3TVMC 4MCZB 2H8PA 4PRPE 4D8PB 1SJVA 2XKNA 3TA3B 2VR9A 4OB5L 5E8DH 1C5CL 25C8H 3FFCE 5KZCD 1J0YA 4LVEA 5HSFA 3DGGA 1P7QD 2YA2A 4ODVH 1UXSA 4DFHA 1GOGA 3QPQD 3TIDB 3I6LD 2QHRH 3G6AB 3KR3H 2R1WA 1X5KA 1G7MA 2PW1B 5D93C 4MA1C 3GMLA 1IC5L 5F21B 2EXWC 3OZ9H 3EYSL 3T2PA 5C0BE 3V7AE 4Y4HA 5D7KD 3MRBA 2X4UA 1WAAE 2DOCA 1KJ2L 2QV2A 1C12B 5F7LB 4ZODA 2A9MH 4JKPH 4HK3N 4YHPA 1T7WA 4PJIB 5TE4L 43C9B 1BIHA 3EO0B 4KRPD 4XMLH 5IFJB 4UT7L 2A74A 5C0AB 3Q1SH 2PUQT 3BT2H 4JB9L 1K8IA 5E6ZA 3QT2A 1GZPB 3M8OH 1V3LA 1YEIL 4UBDC 1M71B 5C0FA 2LU7A 1PY9A 3P73A 1M6OA 5KSVA 1CG9B 4U1LB 3OKMB 3KLHD 1A7PH 4F33A 4HW6A 4YC2C 4ISVB 4MXWL 4JAMA 1YEKH 3LN4B 1RULH 1YYMH 1VSCA 3LQAH 4NO0D 1IM9B 1I9JH 2EIEA 1AI1H 2Z8RA 5IR1A 3BKYH 5EU6A 4F58H 4P5KA 4RDQF 5JTWA 3UTZB 3HR5B 2BXZA 3FMGL 3S9DB 1AD9B 2OTWB 3DV6B 2VXSH 3BH9A 4OLZH 1FLTX 1Y18A 3TGXA 3NA9L 5HPMA 5CILL 3V5DA 4NRXB 3AREC 3SCMB 3GJFB 3VD9A 1ZA3B 1IGIH 2EKJA 3UZVB 5E4EC 4LLDB 3AS0A 5B3JE 5HYSB 3HA0A 2QQNH 5D1ZB 5SWSE 5HHOB 4XNYL 2F8OA 1R3IH 1KT2A 1GAFL 1CFQA 3WEXA 3O81A 5LJYH 3S88H 4YHZH 5FDYA 3FRPA 1JBJA 3DSFH 2XIDA 4NRZB 5DJZA 1MLBA 4C4KO 2OZ4L 3QXDB 2OR9L 5A3IC 1CLCA 1MQKL 1MF2L 3K80A 3BPNC 3Q3GA 2DLTA 4G6FB 5JORA 3DMMC 3JTTB 4N8VG 2ZSVA 2VYRE 4HHAA 3C5JA 5D1QB 4M7KH 2YBRB 2DQJH 4H25A 1XGYH 2DBLH 4KC3B 2OM5A 3JSSA 4JFDD 2DQIL 1JK8B 3RTQD 4MJ2A 5KS9A 1A7RH 1V7ML 4S0SD 4R8WH 4Z0BH 4MXQD 1HXMB 2G75B 3L3KB 3SKOB 2JE8A 3MV8B 1CD9B 4GSDL 3BZFB 3MJ7B 4KH2A 3KYNA 4HFWA 1JHKH 3WFBL 1JV5A 1CLOL 1T2QH 2PTUA 1CXIA 1GYAA 4NQSA 2WUCH 1CZ8H 3VFMB 4AEIL 4Z0XB 4S10A 1BD2E 2X7LB 2GW5A 2MQ3A 4QGTA 1XF4B 1BZ9A 5E6IC 3O9WC 4FN0A 3VDBA 3EOAA 1WQVT 2E6QA 2X09A 3GI8L 2NY2B 4NO5B 4DW2L 3QUMB 3L3JB 1GIGL 1SYSA 5FHBL 2B20A 5IM7B 3AXLB 5TE7H 3VW3L 3NPSB 2UVEA 1W72L 4OJFL 2FH8A 2RCSL 3L1OL 2RQ8A 5CIPH 1KFAL 1F4XH 1BFOA 5GJSH 5H94B 2OXGA 3UO1H 4DFIA 4XP4H 3LHPH 4AEEA 1M7DB 3MV01 2BNRB 4P5TC 4P4RB 1IEAB 5EOQL 2VLKD 1NFKA 3MRFB 2ZJSH 4PJ5D 4D0DB 2FIRT 3OGCA 4R7DB 4YXLL 3ARFA 1KJ2A 1KIRB 4ODBD 5JPMA 2VAJA 3HUJF 2VL5A 3G5XB 4PJ5E 5KVEL 1LO5A 3B2VL 5E5UB 3HPJA 1TQCB 3EJYD 4OV6F 3T8XB 3PNWB 4R7NA 5FM5M 2R2HB 4BFIA 3D85B 2VITA 2FCBA 1BX2A 4NKIL 5IB5B 1NC4D 4U4BA 4C56E 3KLDA 1NFDE 1A6ZA 5D1QD 5LAXA 1EERB 1SJEA 4K71C 2HTKD 4IRSC 4OBSA 4DQOH 5ITBL 2F8XC 5KW9L 3ROOB 4K23H 4KKLD 5JR1H 1U8HB 3M07A 2VOTA 4CU6A 3WLBA 4HWEL 5ESAB 1DL7L 4HCRA 1ITCA 1T5XB 2W0LA 1HSAB 2A1WH 5IBLC 3PXJA 2JB5H 1E4WH 1XFPA 5EC1A 5EO1A 4LBEB 2WSKA 3FO9A 1J1PH 5J6HA 5DO2D 5DRXA 3LQZA 1F4YH 1S7RA 4DUVA 5J3HD 1BVLB 4JRXE 1HI6B 7CGTA 1S9YB 4Y16C 4LSPL 3V4PL 1P4LB 4QGYA 5HBBA 4YK4B 1CGYA 1WIOA 3RWDA 2F74B 1RJLA 4XMPL 2VXUH 3ETBF 3EFFB 1FFRA 4I77H 1FNSL 1X5LA 2VZUA 3H9ZA 3TVMD 1WWBX 2BHZA 3QEHA 5JIKA 1J1OL 1TFHA 4M6ML 1NMCB 4R4BA 3D3VD 1MCJA 4WUUA 1NLBL 1CLOH 1T2QL 3LKSA 2DLIA 4M6OL 5HDBE 4G80B 4B5EA 5J57B 1KJVA 4KHTH 3RWEB 4E0RA 2JCCB 1LEIA 3DVFA 4RNRB 1SEBB 4WCYL 3ARYA 3ULUD 3OJMB 4LHUG 1F5WA 4JVWA 3D69B 5J11C 4OUUB 2VLKB 1KPRB 4RGNB 3LKRA 3CZFB 2FWOB 2VXQL 4PJ9C 2X4NA 1OTSC 3QUXA 3PJSA 3V6OE 4NN5C 1A0QH 3S35L 1EGJH 2YMXL 5CD3B 2OJZH 4UNVA 4Y89A 1RUAH 1U95A 3B9EA 3WIIH 1NBYA 3H7LA 5I1JH 3QFJE 5E6IA 4XNUH 3UCRA 1IBGL 4RIRA 3TC9A 1ZHNA 3SDAD 1S7SA 5I73C 1OCWH 4J3SA 1I9IL 3QAZB 4A2MA 4UMGA 4XC1H 2AJ3A 4JFDE 4RISH 3QEQB 1NDGB 4XPFH 3PWJA 1HK6A 5KVGL 5GSVB 1P84K 3AS1A 5EZOL 4JM4H 3ARFC 3H7BB 2PTTA 1NFDB 2DM3A 1KJMA 1G9EA 4PD4J 5GRVK 3CSYA 4RFEA 4UV7H 3SKJH 2N1KA 4TUKH 5JW5B 4YEEA 5IHUL 2XZQH 3T1WA 1B6DA 3I3DA 5FHAL 3WD5H 4I18C 4MNQA 3X11B 1U8KA 5T1MA 3O9WD 4OQTA 1G7LB 3E2HB 4G8GA 4LLVA 4LSQL 4UT9L 2X4SA 1U8IB 3VG0L 4MQ7B 3S36X 4LPUA 5C09B 1U36A 2EDDA 2Z31C 4JN1L 2VABB 1FJ1B 1MIEH 3TZVB 3BUYA 1AD0A 7FABH 4K07A 1MIML 2I9LB 1DQQA 4UILH 3TCLB 4J8RA 4UOW1 1R3JA 2GQHA 3BZ4B 3I2CH 4NUJA 3VGHA 4RX4A 1I3GL 2FIKB 2ICWJ 1BBDH 3BWAA 1VGEL 5ILTL 4KK9C 4U1JB 2WWMC 3WJLC 4LIQL 1OAUH 3O3UN 3C09C 1L7TH 3ULVF 3HE6B 4LARL 3E3QC 2Y9RT 1UZ6F 2ICWI 1JRHI 4X0KA 3UC0H 2PETA 2XFXA 3BZ4A 3RQ3A 5C0CA 1JJUA 1P4BH 3OHXA 4Y5XA 3MRKA 1KJ3L 1IEHA 3SGKC 4G6JH 1WIUA 4XXDA 3S4SA 1IILE 4J2XA 1T2JA 2HWZL 3GMQB 4QRPE 2YC1B 1NL0H 2CLZB 4JZJB 1MCQA 5GSRB 1OP9A 4UUJB 4OF7A 3ARGC 5JIPA 1J05B 4XTRC 2FBJL 4MA8H 3BQUC 1U8KB 4FQHB 4JZJA 3UTSA 2X42A 4JREB 5HXMA 5DRZB 4P5TB 1I1CA 2BDNL 2EYRB 1AGCA 3FZUD 4G9FA 2VXQH 5C0EB 3ULVH 3PG2A 4JO3L 2FEDD 5D72H 5JPNA 2ITCB 2QQLL 1I8IB 3NA4A 5CCKL 1JYWA 4G5ZH 3HE7C 3QUML 1HQ4B 3QA3A 2AJ3B 4QEGA 2XG4A 2Y7QB 4NQEB 3CFEA 1TQCC 4G7VH 3H9HB 4E9LA 1MCCA 2XZQL 3LDBB 3UJJH 3IB4A 4NQCE 1FO0A 1JPGB 3ULUC 1GPOH 3NFNB 2IAMD 3QDJE 1W0WB 3OJDA 1CGVA 1ZHNB 5ENWB 3D85D 3U0TB 3L7FA 1JGVH 1ZSDA 2A6KB 4LKXB 3CH8A 4UDTB 2QTEA 4XC1L 5GIRA 4UNTA 4HGMA 5K9QI 4HBCH 4X4ZA 4KI5D 3S7GA 3TFKC 4HS3B 4QRPB 3QQ4A 2O5YL 2XQYG 4ZSOB 1XMWA 4WUKL 1CXKA 3LKRB 4X7DC 1I1AB 4LGPB 1OAQL 5FYKE 1RK0B 3ZDXE 3U30B 1I8LC 4MZ2A 2V2WA 5SV4A 1XGPB 2APBA 3MV9A 4EN3B 3BT2L 3V0VB 5K9JH 1JTPA 4HDIB 4MAUH 1JE6A 1B0RA 3DUUA 1MELA 5TH2B 3TV3L 4UQ2A 2CR6A 4KFZC 1FV1A 1P6AB 2N7BA 1XGUA 3QFJB 1SY6L 1A3QA 3QHZL 2HG5B 4CMMB 3HC4H 4JR9L 4M7KL 1F6LL 2F74A 3WO3B 4PUBL 2IBGA 1CFTB 3T65B 2QSCL 3O3BB 4L4VE 4ZUSA 5C0RH 3LIZH 3O6KL 1EEZA 3EYOB 1AR1D 1T1XA 3LQZB 5GZOD 4GXVL 1MAML 5BOPA 1JNNH 4R0LB 1IGTA 2NY5L 1FZOA 2DS4A 3P0VH 1KACB 1MHCB 4J4PD 5FM5O 1YMHA 3FOLB 4Z7WF 2HFGH 3OR7B 4MXVE 5FUOL 5C0AE 3P77A 3HPLB 4LCIL 4KKBD 2DMCA 1PJ9A 3P30L 5DS8A 2V2XA 5E24E 1YYLL 4EUPB 2D31A 4FFVD 2DQJL 1NCCL 5IOPB 2FD6L 3ARGA 4Q6IC 3MODH 5EUKA 3GBNL 2YPVL 5GGTL 2O5XL 1LNUB 4BSWB 1JF1A 1OLZA 2YKLL 1OSPL 1EX0A 3UAJC 3MLTB 4BH8B 3QUZA 2WWKO 5D7LB 2V7HA 3BZDA 1TJHH 2XWBA 1PY4A 4DTGH 5I1KL 4MWFB 1JF6A 2YEZB 2JIXB 2FX8H 5B21A 3RGVA 2Q6WA 3DURB 3ARFB 4R97B 1UM6L 5LGJB 1PKQE 1YDPB 3OSKA 1P1ZB 1QSFB 4KZEL 4IIQB 4BFEA 1DBAH 3F65A 3QUZC 1WVZA 3SKMB 3QBTB 1DBMH 4MD4A 1D9KB 2E9IA 2HKFL 4WO4C 2IF7A 2AK4E 4GKZA 3UJIL 2J4WL 2YD7A 4DVRL 4Y2OA 3ZTJH 4PR5B 3QIWB 4W81A 5J12C 1I8LA 5I6XC 1CDYA 1NFDF 1A1MB 3HAEB 1MOEA 1F6FB 1BVLA 1WZLA 3SKNA 1L9NA 3VXQB 5AUMA 2WP3O 1AXTL 2DQFB 3L3JA 3IFNL 5DD3L 4Z8FL 1QLFB 1AC0A 5EC1B 3CSPA 4O2FB 1AI1L 1O7VA 1NUNB 3WFBH 4QTIH 3V8OA 1HNGA 5ESVB 1NC4B 5ALCL 4F7PB 4OF5A 4KVCH 4NN7C 5JMOC 5IVXA 3LMJH 1KELL 4OCNC 2HTLC 5HHNA 1WF5A 4OZGB 1NANI 1T1ZA 2CMRH 2DYPD 4NZUL 5LAXB 3I84A 4ZAKB 5TE6L 1IAKB 5F88A 3UDWA 2NZ9D 5D9SB 2P43B 4BSJA 4NRYB 4N0FB 1UCTA 5DRNB 3LRSB 4NKOB 4O02H 5TDOB 4LQFH 4Y8DC 2A73A 2PXYC 3KPPB 1NGWA 3MC0A 4LSTH 4UB0L 3JTTA 4Z7OE 1A7QL 3BE1H 3L3HB 4POZC 4C54A 5KSBF 4LCCA 2W38A 5ECJE 2X4TB 5EBLB 1PZ5B 4AIXA 2BY0A 1Z3GH 5HDOA 1KULA 1B3JA 1SY6H 1G9ML 4F7MB 4FG6C 5EB9A 4N8CL 1CL7H 1BBJB 4FRWA 3QDGA 1V05A 5EBWA 2NY3B 1VFAB 1MAKA 2MSPA 1GOHA 4JKWA 3BO8B 4XMPH 5D7LE 3KLHC 2BMKA 4YWGH 5ICXB 1FP5A 3SOBL 4DGIH 2MPAL 3QUKB 2D7TH 1NGPH 1U8NB 2Q76A 5IVOA 5GGQH 1RJZB 2MKLC 1BZ7B 3MGAA 1ORSB 2D2OA 4PJHB 5DD1H 4RA3A 1I9RL 4S1DC 1LO4H 3KYAA 2NCMA 3EHBD 4XAWL 3FQTA 4DOHE 4EBQL 3HAEG 1R6VA 1CVRA 2YR3A 2W65A 1KLGA 4FQQA 1WZ1L 4KPHH 4YHYC 3F7PC 3GBNH 3MO1A 5GGTH 4X7SH 3IETB 3EJJX 4N68A 4PRDA 3MJ6A 1KB9K 1U6AH 5HVFB 4JHWL 3S37X 32C2A 1H0DA 2YBRA 4U6VL 2D7MA 1ZLVH 3RDTC 2FZ3B 2NR6C 1RZ8A 5IBUB 5JZ7C 2DKUA 5GGTA 2J2ZA 3VXRE 1D5XA 1S7UB 1YPZE 4JO1L 2IPTH 1OQOA 4MSWB 4X6EA 3HMXH 1D5MA 5GGRY 1CIUA 5HHPA 1RJCA 5I0ZA 5DJZB 4DGYL 4ZFOL 2NXYB 3UYPA 3KLAB 3EUUA 4G9DB 4P46D 2UWEE 3LMJL 4PV9A 4P9ML 5FO9B 2APTA 4OCSH 4N0UB 3CC5B 3GJFH 1I1AC 3WEXB 1I1YA 2AV1B 3VI3F 4MQTB 1FN4B 2ERJC 2VLRD 4GUPA 4LK4A 3B6SB 5I1DA 1SBSL 1T7ZA 4QRRE 4RISL 3MRBB 4WI9A 1HCFX 3WIHL 5L6YH 4OIIH 5DZLA 2YRZA 1FFPA 3RX8A 2X4PB 2YK1H 5ICYB 1KCUH 4Y16D 3GJFA 5E9DA 2WW8A 2GK0A 4RQQA 3Q2CA 4I3RH 1E28B 5L7XH 2B0SH 5TE4H 3QDJD 2ZWLT 3L5HA 4P2CG 4OM0L 4M62H 5FHAH 3ZLQC 4U1MA 3F7VB 1S7VB 1K4DB 1LEGA 1PYWB 3CFJB 2A1WL 4PJDA 2HRPL 3NTCH 4PB9H 1CLYL 3TBTA 5F7EL 3NCJL 4LMQI 3IS0X 4JZNA 3V0WH 3KXFD 3V6OC 2XRAL 2VN4A 1QSEE 2E9BA 3MLZH 1FL3B 2XZZA 4NKDB 4I9WE 4CDGC 1G84A 3HE6D 1CG9A 4ZUTB 3VFOA 3GMOA 4GG8B 4XI5D 3HRZB 2BSRB 4JO4L 5C0FB 4GG6E 4UTBL 3I3BA 3GHBH 5E00A 5T1LB 4QNPF 4KKNA 2OJEB 3O3EB 3OB0H 2C3GA 2QADC 3BP4B 1SMOA 3O41B 1XR8B 4ZFGL 2X41A 3BIKA 5IMOB 3QG7L 3CCHA 4XAWH 2DN7A 5JHDB 1VEMA 2H2PD 4ODXB 2DM7A 4ODSH 2ZUWA 5DEGA 2ESVD 1J7VR 2ORBH 5CEYA 3W0WD 1U8LA 5I19H 4NKMB 3VXRA 1CGWA 3NIGF 1ES0A 3DRQA 5GRZA 2YN5A 5D1XC 1P7QB 2XN9D 3IDNB 1RUQL 3O11A 4LCUA 4F9LC 1I3VA 4XBPA 4OBRA 1VFOA 3C8HA 2NY4B 2XTJE 3BYTA 3GSNA 1SY6A 3T4AA 3MA7B 1T7YA 1GL4B 3SO3C 1C1EH 1IGML 3L5WA 3LB6D 3M17B 3LRHA 4JGMA 1TVHB 1TZGL 3UTTB 1PSKL 3R8BB 1I9RH 5D6DC 2CIIA 3N1MC 3VD7A 1N2RB 1YEDA 3B9KD 5JUEH 5TPWL 1F3JB 2CDEB 2ENYA 5GISH 5D5MF 5GRYA 3BRGC 4Q6IA 1XZ0A 2R0LH 3REWA 3DXAA 2I5YL 1P2CA 1OWRM 3C8KB 1UWEH 1EIBA 2ARJQ 4GJTB 4YE4L 3LPFA 3QPQC 2EH7L 1GGCL 2ZCLL 2NPLX 3KXFB 4JM2A 4X8XA 4XAKE 5C71A 3BKJH 4KROD 4NQXB 1OWWA 1M7IB 1A7NH 4QRUA 4Z95L 4ONGH 5A2LH 3S35X 5AZEL 3IAQA 4WI6A 4HH9B 3VRJB 4OI8A 3NCJH 4TULL 2ZUQC 3TN0C 3LPWA 3DO7A 1D6EA 3QIWC 4ZOCA 5GRWA 3JV5A 5GGRA 4LLWB 4Y8AA 4GMSH 4XC3H 1N5YL 4OZ4A 1T2XA 1VDGA 5SX4I 4DAGH 4YDIL 4FS0A 4YUEL 4G5ZL 3LHPL 5JHLL 1QSED 1N59A 2ICCA 2BHUA 5MENA 1FNHA 3T4AB 1MFDH 2AP2A 3DARA 5E94A 1RHFA 2AK4B 2B7DT 4YR6A 1Z6JT 3T09A 1U2HA 1RJYB 1BIIB 1FZMA 2NY5H 1VENA 1HHIB 3DRQB 3SDYL 3CJJA 1P69B 1OT1A 2C1PB 3QDAA 4PLOB 1CGUA 4G6AC 2NY6B 2EO1A 3CCHB 1MCPL 4LCYB 1X5HA 4QNPE 1OW0C 4R3SA 3BIBX 1CD1A 2R23A 1UVQA 2IAMA 3O8XC 4GRWF 1U8QA 1C1EL 2BRQA 4HS8H 2XYCA 2GTWA 1R5VB 5A2IH 1EJOH 1OSZB 4HXBH 4IM8A 1FYTE 3ARRA 1YQ2A 1QBLL 3R06B 2BFVL 4YHLL 1KCVH 3DX6A 1A7OL 3KYKL 3U1SH 4HXAL 4IOIA 2C3VA 4U05A 5HVGB 1BHGA 5LBSL 3D25A 5HDQL 1XF3A 4ZS7H 1INEH 5ISZD 5I17A 3IRZA 4EN3D 5DQ9A 4Z77B 2QQLH 2FO4A 3WDJA 1NAKL 2XTLA 4HSQA 4PJDB 3GIZL 1X5ZA 3G9VA 4HFUH 3GM0A 3LY6A 1KB5B 2GTZB 2CJUH 4F80A 4W70A 4POUB 2X5PA 3EO9L 4NQDE 4MCYB 5BZWB 5FYLL 5L2KB 2EKSA 3HUJE 3O11B 2K7PA 4LCUB 3ULUH 1PZUB 3D9AL 4YAQA 3BHBB 1BD2D 3RNQA 3FB8B 1UM4L 4KZEH 1FFPB 3MLYH 4D94A 1BQLL 3PGCA 4OLEA 3WHXA 2X4OB 1YEJL 2G5RA 4HBCL 3SE9L 4X9IA 4OFPA 3UXFA 2PYEE 5HI4D 1I3UA 3U4AA 3J8F7 4PRNA 5MERA 1FSKB 4PP2B 4M7LH 4DKEH 3VMOA 3SJVE 1OY3B 3BD4A 4HQQL 2O26U 1DQMH 4YFEA 4EI6B 4PGDA 3VDCA 5D2LB 2AQ3A 4WFFD 1HXYA 4Z7UB 4Z5RA 2ZG2A 1MCEA 3B9DA 3QEGL 1EO8L 2P49B 1AHWA 3HMWH 2W9DH 1VKXA 4JRYE 3VXPA 2CUIA 4MMXC 4C4KT 3WNPA 1A1OB 1Q9LB 4XPFL 1BFTA 4ZDHB 5CHNB 2BNRE 5DUML 4EUPH 5F3BA 3Q0HA 1KPVA 1Q72H 2DLFH 4G8GD 5ACLA 4QHLB 3TH2T 3ORJA 2VR4A 3GSOA 3TFKD 2DWEA 3MNWA 3VXNA 5HI3D 3EW3B 2XI9A 4XMLL 4V2CB 4F7EA 3S88L 3MOAL 1NFIB 5M95B 5ALCH 3NOIA 3O8XA 4Y1AB 1BD2A 1OHQA 2YD6A 3QEUA 1A7OH 1RURH 3KYKH 4P5MA 3QDGB 1NJ9B 1E6OL 3HE7B 5IW6B 4P3WA 1MHEA 3BP7B 3K2MC 4F7MA 2PN5A 2VIRB 5CJQL 4KI1A 5BS0D 1YEEH 3FQRA 5EIIB 1ONQA 1QFUH 4G9DA 4AMKH 1FZKA 1CXEA 3TEUA 4CMHC 4ZFFB 4CW1A 1ZT7A 3L3HA 4R4ND 4KJPD 3VXOB 2AXJA 4H1LA 4U1IB 3ZTJG 4QHUA 3RNKA 4D2NA 2DLHA 1S9KC 1G7IA 5CHNA 1QLEL 3AAZB 4OAWA 3ARDA 3AY4C 4NHUB 1MCIA 4IRZH 1F3RB 2BERA 4RMUA 5F6HI 3RPIA 3X12B 4NP4L 3L6FA 3RY4A 1LGVA 2OQJB 1J87A 1AGDA 2GUOA 3C6SA 1WC7B 3D2UB 1KLGB 2V5MA 2FHFA 3B3IA 5CJOH 3QQ9C 3UJIH 1KCLA 3NA9H 2UWEB 3ZT6A 3NCBB 5DK3A 3BGFC 3CFKB 3RNKB 2X4QB 1IM9D 5D2LA 3EHBC 4C57C 5DGRA 3ALPA 3PHOB 4P46B 1S7TB 1TZIB 3E3QE 1QVOA 4LLYA 2HN7B 4Y2DB 1NC4A 4NQDD 4GQPH 3F8UB 3CVHL 5T1DH 4NDMA 3TO4B 2VDML 5GPRA 1QFWL 5DFWH 3NMEA 1OPGL 3MPCA 1QLFA 5JIIA 2DIJA 2QADB 1IGJA 3I6LE 1TIUA 5E8EB 3QI9D 1VFUA 4WTZA 4EUPG 3TVMA 1ORQA 1BJ8A 4IOFC 1PDKA 2UV3A 1GGBH 3QIWA 3QDJB 2DQHH 4FQCH 5JW4M 5CGTA 1SYVB 1UKQA 4I5BA 3HFML 1FGVL 3PHQA 3LN5B 2GTZA 3HC0B 1OAXH 2VH5L 1XH3A 3ILPB 1JYNA 4OCMC 5J1TC 3F62A 5DSCB 4LAJH 3LVEA 2YEZA 4AEHH 3QXUA 1DQJB 4HGKC 1FLRL 1I3RA 2YWYA 3P4NA 3HS0B 5EOQH 3SKUD 1Q9WA 3QH3A 5L9DL 4H20H 4N5EC 3MBXL 1AR2A 2C3VB 3SO5A 4X4YB 3IU4H 1I8MB 2ZNXA 2HLFC 3NGBC 5EDXA 1HXYB 1TJIH 1KB5H 3IGAA 5DJ8B 1OF2B 5MENE 1CN4A 4N8CH 1OL0A 3E6HA 4CNIA 1F42A 1N3NB 2GI7A 2IAMB 4KJWD 1GGIH 4X6FA 5CUSH 5IQ7H 5JNYA 2PXYA 4P9HC 2AVGA 2XPGA 4JM2D 4W4OA 2CLRB 2DBJA 4RMQA 5HGBB 5F1KC 2L4OA 4JJHA 3IXTA 3RDTD 3NZHL 4NYLA 2C1PA 3PP4L 2BRRL 5T3ZD 5INCB 1J18A 1EEZB 2FLBT 3LOWA 5DVMA 5C0CB 1FZMB 3AC0A 3UTTE 2E9WA 5C8JB 5BRZB 1P1ZA 4ZNCD 1UCBL 4WHTB 1JZ4A 5IMKA 1PQZA 3CXDL 3HLAA 4OZFB 2VISA 2H2PC 5H37H 2Q6WB 4RMWA 2I9TB 1BM3L 5DQ9B 3GHBL 1JFQH 2AJUH 1FORH 1S78D 3DOSA 2NZIA 4OCRL 3IFLH 4JHAL 3OAUL 3D25B 5GGRB 3RGHA 3VWJA 1JGDB 1CICD 1X6LA 1TQBB 5DMIL 5C2UB 3KPQA 4B53A 4EDWH 5DC4B 2UVFA 4J6RH 3QQ4B 4OCSL 2OI9B 3VFVB 5AYUH 4K3DL 1E4WL 4UOW0 5DI8A 5K59F 4HS3A 4HH9A 1R5VA 1EXUB 1FPTH 3PWVA 1YEHH 5IB2A 4PG9A 4F7CB 4UU9A 3V5KB 4NBZB 1PKQB 1NCCH 4N9GA 5E4EB 4P2OC 1UWEL 4FQ2H 1A6AA 5DRWA 1CFVH 2YRLA 3T0EB 1KGCE 4LCYA 1CFSA 3T2NL 1HOCB 1KIUA 2AABL 1I8KB 4R0LA 5FO8B 4NGHL 2Z93A 4HUVA 3LZFH 4QHMB 4DN4H 2NYYD 2SEBA 2Y5TB 3PL6A 2ARWA 4ZUSB 3FQNA 3WNMA 3C8KA 1P2CB 4NJAL 1KJ2H 4OFVA 3QXAB 1RJYA 1V7NH 4QWWC 4WVRA 1ZHBB 5JXAH 4NN6B 5E94B 3DX9A 3G04B 2R39A 3P3YA 1J8HD 3JUYA 1KG0A 4OI9A 3MA9H 1F90L 3V0VA 1KCKA 1KCRL 1PX3A 3T3MF 1U3HB 5A3ID 1OTTC 4PJ5B 5FM8A 1G9NH 1F6AA 2XG5A 3ALXA 5HVHC 3ARBA 3ZDXF 3VH8B 4JG1L 3FQXA 4KI5C 3R8QA 5I8OL 4XCFL 4WJ5A 1MPAL 4WTXA 4HGWA 3NZHH 5F97E 5B38A 5L9DH 5JZ7D 2HLAA 4KK5D 1S9WB 2EIZA 1U8MA 2FJFA 5I71C 5D7SL 3QG7H 4MYWB 3QRFM 5AZ2L 2WIIA 3D48R 3KPNA 4PJDE 5DD0H 2FB4L 2EECA 4XAKD 3GSNH 3MYJA 4IMLA 3FO2B 4NKQB 5K93A 1WJ3A 3BP4A 1EMTL 4LSDA 3WUWG 2OTUA 1GCFA 3RAJL 3T0WA 5CEXA 3MBEC 5E8NA 5DMKA 4FQJH 1HSBA 4DZ8B 1AGBA 4JM4L 4ONHA 3INUL 1UB6A 2NXYC 2H32A 2V17L 4UZGA 3IDIA 4MD5A 3PWPE 5HD8C 3KPSB 4GXUM 1OAKH 4JHAH 3TJEH 4LCCC 4YZFE 1IGFL 2D4FA 2Y7QA 5SWSB 2Q20A 3FO1B 3O0RH 4QXTA 1WEJL 2BVOB 2ID5A 4TNVF 1EZVX 3IRPX 5E6YA 1JI2A 3KWWB 4PJ8B 1ZT1A 1FYHB 4M03A 5CP7B 2WP3T 3SDDB 2I9LA 3B5TA 1T20A 1TETL 2QHLA 3EIFA 1AGCB 3F7RA 2VABA 4R2GC 1K4DA 1LEGB 2COQA 3CFJA 3FFDB 3F7VA 1MCHA 5C2BL 4NSKB 1C5BL 5DVOA 3C6LA 4KJYA 4OT1H 2AABH 3W0WE 4TNVK 4HJ0D 5E9DB 1TPXB 4HUXA 1FCGA 4P2RD 3PWLA 4JFFB 1QTYT 1V7MH 2F58H 5BJTB 5B38G 1AJ7L 2WBJD 1K2DA 5C08A 2GYSA 4DKDC 4Y5XB 4GAGH 3NCFB 5HGGS 5FGBA 4MAYB 3WHE0 5JXAL 1NGQL 1P84J 4Z7UE 5DXWA 3KPTA 4RAUA 5DJ6A 3RBSA 3PWJB 1UZ6E 1P5VA 3QPXH 5GHWH 5MP6H 1CGSH 4IS6B 5I1EH 3FJTA 3RZCB 4MSWA 4X6EB 5E2TH 3SE9H 5KVGH 3VXSE 3RVVD 1CF8H 3WXWH 1A3RL 1WFUA 2QQQA 3V7AG 2E6PA 2PKDA 2VKWA 5E08L 3QIUD 4K2UL 2IH1A 4ZFOB 4PJ7B 4KK9D 5C0DB 4UV4H 1HYSD 1TVDA 2B1HH 5E6IB 3VD5A 3ZKMC 2C5DC 3DYOA 3B2UC 4UIMB 4RWYL 2BOCA 1IZKA 4XVSH 2APWA 4I48A 1FH5L 1E27B 3D18B 4U6YB 5GGVH 4G3YH 4HKJA 4PJCA 3TYGH 1T03H 4ETYA 5DLML 4IDLA 3VI3E 3FT4B 4NHCH 2Z8WC 3FO0H 1DEEA 1WICA 1XIWA 4NZTL 3KPRB 1BZ7A 1HINH 5C3TA 4RSVA 1OP5K 3N0PB 5I15H 2Q76B 2MFNA 5IB4A 1A7PL 3LKOB 5DQJB 3U36A 4WU5A 3CU1A 1VERA 5C0JB 2DAVA 3EJZC 1VGEH 5E8PA 4PJAF 3K4AA 2WV3A 1RUPL 4JCMA 4XMKL 2AGJH 4PJIE 1IEBA 4Y19B 3RKDD 4E41B 5KVFH 5I73B 4HCRL 4RAVA 4OZFH 2DQDH 3SGEH 1AXIB 1QP1A 4JFFD 2ARJB 5EBLA 4XNMB 4Y4FC 4OFDA 2OLDA 1XIWD 2NNAB 1TQBC 4PTUA 3SBWA 3S34L 3UYOD 1QBAA 4WW2F 2OL3B 4NIKB 4PRDB 1HEZB 1KYOJ 5F7YC 3VGAB 3KJ6L 1A6TB 1VPOL 3H9SE 3DYMA 5DA4A 3BFOA 3LAFA 1EUTA 3WYRA 5DEZA 5HHNB 3MLSL 4H5SB 4PJHA 4OV5A 3Q6FA 2V5TA 4J4PA 1MI5D 3FFCA 5F71A 3C6LC 4YDKL 2VLKA 5DJ2B 5F9WC 3N1FC 4YFLF 5I1EL 3OMZA 4QHNA 4YX2L 1UZ8B 2IAMC 1LMKA 4U6TA 1X4ZA 3LD8C 2ICWB 5EO9B 2DQFA 3JTSA 5JHDD 4KU1A 3MRFA 1JNHA 4B0MM 5HYFA 3O2WL 5HHVL 3HAEA 2WBJA 5IBTL 4R4BB 1IEAA 2BVUA 5J8OA 2F58L 3GSQA 4QXWA 1AQKH 5CP3H 2B1AH 1QG3A 3BDBA 1NAML 1EEYA 3DETD 4X6DE 4I3SH 4K3EL 2W59A 3BQUA 2YZ8A 3CPLB 1P4LA 1QFOA 1G7PB 5TPWH 3PXHA 1JGVL 4W68A 4LLQA 3DJ9A 4P4KA 3PV6A 3MBXH 4N8VB 1FNGB 1QFHA 3DURA 3KPRE 4IDJL 2E7BA 1HINL 3BPCA 1GH7A 3BKCH 3RVXD 4XPGH 4WI7A 2CO7B 5INDB 5TE7L 5I71B 1CD8A 1BJ1J 1T5XA 5DRNA 1E4KC 4N0FA 2YKLH 3JZ7A 4LKCA 2IFFL 1ZTXH 2Y1VA 1OAYL 4OGZA 3HMXA 2DI7A 4QXUL 1JV5B 2H1PH 3ZKXB 5CAYB 3MR9A 4XVSL 1Z9SA 3V95A 1MJUH 1FG9C 3MBEB 2D31B 2BY2A 2ADFH 4LVHC 2CK0H 3HE6C 2VLME 4ODVL 4F58L 3TN0A 5I1GH 1YMHB 1J5OH 2OL3A 4HJJL 4L4TB 3W9EA 1FZOB 3WCYA