3IDWA

Crystal structure of sla1 homology domain 2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
66
structure length
66
Chain Sequence
KYDWFEFFLNCGVDVSNCQRYTINFDREQLTEDMMPDINNSMLRTLGLREGDIVRVMKHLDKKFGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Regulation of clathrin adaptor function in endocytosis: novel role for the SAM domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Endocytosis
molecule keywords Actin cytoskeleton-regulatory complex protein SLA1
total genus 27
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2009-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3idwA00
2E8PA 2QB0A 1KW4A 3TACB 1SXEA 2QB1A 1V38A 2LMRA 4NL9C 1X40A 2GLEA 1UCVA 1PK1A 1WWUA 5F3XB 5L1MA 2KE7A 2E8MA 1PK1B 2K60A 1SV0C 2DKXA 2ES6A 3BS7A 1OXJA 1V85A 4MHVA 2L5YA 1JI7A 2JV3A 3IDWA 4PZNA 2YTUA 1F0MA 2QB0B 5JTIA 3KKAA 3BS5A 1PK3A 1X9XA 2KIVA 1SGGA 5JU5A 1UQVA 4IS7A 2QARA 4RQNA 1Z1VA 2EANA 1WWVA 2KSOA 5JRTA 1RG6A 2EAMA 1DXSA 2KG5A 4NL9A 2K4PA 2QARB 2F44A 1LKYB 1LKYA 3BQ7A 3HILA 2FE9A 2EAPA 2D8CA 2ESEA 1B0XA 3SENA 2E8OA 2KSOB 2DKZA 1SV0A 5KNIA 3H8MA 2F3NA 2B6GA 2E8NA 3KKAC 1OW5A 5J8YC 1SV4A 3BS5B 3SEIA 5J8YA 1X66A 2D3DA 4NJ8A 2F8KA 2Y9TA 2Y9UA 2KMDA 1COKA 2EAOA 3K1RB 4RQMA 1SXDA 3TADC 2DL0A 2LPEA 3TADA 2QKQA 1B4FA 4PZOA
chains in the Genus database with same CATH superfamily
2G5IB 1TV9A 3KZIU 2RHFA 8ICVA 3FC4A 7ICOA 4B9MA 3PW7A 2W55A 4LVSA 1BNPA 3C2LA 1S0MA 1YT3A 3WK9A 2KN7A 4UATA 1PK1A 5J2HA 1NK5A 3SI8A 3T5HA 3VCBA 2I6XA 7ICQA 2OM6A 1BNOA 3ZDEA 4NM1A 4DS5A 2BCSA 2QB0B 1SL0A 1ZQEA 4YQWA 2JZBB 3I28A 4Y2XA 4IQWA 3DDHA 1JXEA 5ALSA 1RXWA 1DK2A 5IIIA 2F1HA 1X9XA 8ICMA 3KHGA 1SL2A 3SD7A 1N5XA 2KK0A 1RPLA 2DF4B 2GH1A 5KG1A 3QU9A 5J29A 5KG4A 3ZD9A 3CNHA 4ECRA 4YXMA 4USAA 4EBEA 2F76X 3GU3A 2KHVA 5J2BA 2VIXA 2W3SA 3KZXA 3ZD8A 5ALFA 1T8EA 4DQQA 1XO1A 3C5FA 1F5SA 4I2IA 3M9OB 1NI3A 3QZ8A 1Y88A 3UXNA 1NKBA 2MA1A 2F3NA 4BWMA 4CF3A 2A19A 4KMOB 4F3OA 4FFDA 5HP4A 2HCFA 3MDAA 4YD2A 2JHDA 2VA2A 4F5NA 1WYGA 7ICIA 4B9VA 1URJA 3I76A 1ZQFA 4KLTA 5H2FU 1U4BA 4UBBA 3AEVA 4F5OA 1QLNA 1T94A 1L7PA 1HUZA 4QWAA 9ICXA 1Z1BA 2KFNA 4GC6A 1QCKA 4XUSA 5GTIU 1L7NA 4OJPA 4LZDA 2LBOA 2PFQA 4ED2A 2KHQA 3ED5A 5DLGA 4EZ6A 1ED1A 4RPYA 7ICGA 2HOQA 2NO5A 1J97A 2YMMA 4NL9C 4RQ6A 4TUQA 5AM2A 4FS1A 4F4ZA 2FJ6A 5AI8A 4GC7A 2WF8A 9ICCA 1L3VA 1NK8A 1PK1B 1U49A 2K60A 1WG8A 3Q8MA 3KHRA 4O3NA 4NV0A 4BXOB 1D9DA 2YB4A 3NASA 4K4IA 2W11A 2R8IA 8ICLA 1NK4A 3GIJA 1Q3VA 4DSKA 4R63A 2LHTA 5J0XA 3JPNA 1XS9D 4P4PA 1D9FA 4P0QA 8ICZA 2OXOA 3OTQA 4IS7A 1JN3A 4F5PA 1X9WA 3NGDA 8ICXA 3WKCA 7ICUA 1IM4A 4BGDA 2P35A 5AM0A 8ICIA 5KFLA 4JV2A 2IMWP 3WK7A 3LK9A 9ICVA 2R18A 3HILA 1MC8A 2KKVA 3ZDDA 2W9CA 1N56A 2JEJA 2DFLA 4DO9A 3AN1A 4QZ9A 5J0WA 4F5QA 4Z6FA 4DL7A 1U47A 2FLNA 2WHEA 5DG7A 4ECUA 4CCHA 4MFCA 2KJ8A 3RJFA 1ZQPA 2W43A 3IG8A 3KD3A 7ICKA 2VJ5A 4FO6A 2K4IA 2Y0SF 2EAOA 5ALVA 3GILA 4RQMA 1AROP 3OGUA 2HHQA 5ALXA 7ICSA 5DGBA 1U45A 3T3FA 2C2RA 4OO1J 5ALHA 5KG5A 1ZQIA 4Q8FA 3PW4A 3B9JA 5CWRA 2HBLA 5HHHA 4Q43A 4CNQA 2BDPA 4QZDA 4F50A 2GOLA 4KLIA 2K8AA 2W7OA 5ALWA 3DEEA 1KN5A 3RJEA 1LB2B 2QLTA 3HX0A 4QZ8A 5ALYA 2E1FA 1N63A 2MSNA 3PX4A 2VKQA 1F0MA 4EZ9A 4G3IA 5L1LA 5K4LA 3GV7B 4Z6CA 9ICTA 2ZIWB 4M04A 3NVWA 3RR8A 4UAVA 5ALIA 4G9BA 5EWEA 3C29A 5KFFA 1T7PA 2UVUA 3AMZA 1ZQQA 4KN7A 1Z19A 4F5RA 4RQ0A 4NLZA 5ALUA 3LVVA 4F92B 5AM1A 7ICHA 4I2GA 5AM5A 5DBBA 7ICMA 5EOZA 3V7LA 2HOIA 7ICJA 5D46A 8ICCA 4O3MA 2W54A 2MAXA 4P2HA 4JMUA 1U48A 4YR2A 3ISCA 4EX6A 1D8BA 3LVWA 3PMLA 2A3VA 4I2DA 2ODGA 2UVRA 4B9TA 3WKDA 3L4PA 3PR4A 5G5GA 3D2SA 4PZOA 2E8PA 2KVSA 5AKHA 3C28A 5AK6A 3EYZA 3AL0B 2YY6A 4RT2A 1NOMA 4DFJA 2GLEA 3RJGA 2HW3A 3BQ1A 4KLGA 4ZH4A 1T3QA 3QU4A 2DQNB 2KTQA 5CA7A 3OHBA 3UQ2A 1ZQ1C 4PGXA 3SAFA 2YB1A 2WB1C 5AI9A 4PL2A 3C5GA 2MU2A 1ZQXA 1QTMA 4FZMA 3V72A 1ZQKA 4UARA 3UXPA 4J9SA 3KKAA 4ELTA 3LWMA 4BX9C 5EWGA 4O3RA 4JK1A 1MSWD 5KFHA 5AKLA 4ACOA 4I29A 2Q0ZX 3MBYA 3RRGA 4BJQA 2KG5A 2C22A 3C23A 2I1QA 2QARB 4UB2A 1XWLA 3SZ2A 3C21A 1RM6C 4PPXA 2ZIXA 4ECWA 3WKAA 4US9A 1RXVA 1Q46A 2IHNA 4DSEA 2VJ4A 3UM9A 3PSIA 5KFJA 3MFIA 3IP4B 4KLMA 2OCEA 4EYIB 2YX8A 5AI0A 5CR0A 4QWBA 3F2CA 4KX5A 2BCQA 4C8OA 3H4BA 5AK3A 5KG2A 8ICAA 3Q8LA 3J81j 2NYVA 3QEAZ 4M9HA 2BGWA 4GIBA 3ORYA 5AKJA 3FDSA 1S77D 1QQ7A 3QU2A 4QIWF 2AQ0A 3HWTA 2FMQA 4JWMA 2JR5A 3Q8PB 2HBMA 5KFBA 4AYBC 3BQ0A 1JI7A 3IDWA 5DG8A 2ZJ5A 2JH1A 3Q8SB 2HSZA 1BPYA 1ZQJA 5L1JA 1N60A 4PGYA 2LM1A 5KFDA 4TURA 1SGGA 4GFJA 2P6RA 2G5HB 3H8WA 1L3UA 1TAMA 3RRHA 4UB8U 5J2GA 2FLPA 3ICXA 4QZCA 4UASA 1M6YA 1A6SA 2JRZA 4IC9A 7ICLA 2WAQC 5CB1A 4BUGA 1DXSA 3IRUA 3UQ0A 1D8LA 2F44A 4C8MA 2LM4A 5KFYA 2D8CA 4ED0A 1X6JA 4LJXA 1MA7A 3KFUF 7ICRA 2KP7A 2DBYA 5J0OA 5B5EU 2MUTA 3B0YA 3RH4A 4DL2A 4NLNA 2KOBA 5A0LA 4PHEA 4DLEA 4QWEA 1UT8A 2JEIA 5DB9A 4QW9A 1ZQYA 4Y2YA 3F2BA 4M9LA 3TADA 5J0TA 5KG0A 4F93B 3M9MB 4B9SA 2XO7A 1TVAA 3AQFA 2ZXHA 4Z6DA 5KAIU 4O9MA 2NRXA 1WUDA 3RB0A 5F3XB 1BPZA 1TK5A 1L5UA 8ICUA 2E8MA 5HR6A 1FO4A 4C8NA 1L8OA 4R8UA 3JPOA 4KLUA 1IIPA 1PUZA 3QU7A 4OJLA 4IRKA 2JV3A 5J0RA 2Y1JA 2MUTB 4ZOHC 3RJIA 3A0BU 1UA0A 1NNLA 1N5WA 4P4OA 1DGSA 4MF8A 1ZQCA 2KIWA 4ED8A 4FE3A 1SZHA 1MQ2A 3SYZA 4BWJA 4PHPA 1KBUA 5AKIA 4PL1A 9ICSA 4RNOA 2ZIVB 4EBDA 3K4GA 1Z00B 3M8SA 4I2BA 4P0QB 2ZIXB 4RQ5A 1ZQZA 2XICA 3AU6A 2E5SA 2KSOB 4O3QA 4OD0A 5EWFA 3V7JA 3RR7A 1T4GA 3PO5A 3ONNA 3RFAA 2EZXA 2ATLA 4UB1A 3IG5A 4O0IA 3OJUA 2FLLA 4C80A 3EW9A 2DL0A 1L6NA 2JZBA 3NTUA 1X9MA 2QB0A 1KW4A 1RDFA 4RQ4A 1ZQVA 3CP8A 2BPGA 1SXEA 4DF4A 4IQVA 3GV5B 2OEHA 4F72A 5DBCA 4CE6A 4EEKA 3H0LB 1JX4A 4JV1A 4QWCA 2XGQA 1ZQBA 5AHXA 5KL1B 3OHAA 2AGQA 2YMLA 4RPZA 1TAUA 4EYHB 1S0VA 1OXJA 3GQCA 3RH5A 4DF8A 4ELVA 4P4MA 4QWDA 3OSPA 2AGPA 4GXKA 3PSPA 1TKDA 4YCXA 3LWLA 2R8GA 7ICNA 2OHFA 4Q44A 4DOAA 3GV8B 2CPRA 4ELUA 5KFQA 3TFSA 2YMQA 3S6JA 4RUAA 4IRCA 3PSTA 2E3TA 4KLJA 2EZYA 4F4XA 3NVVA 3HW8A 2BCRA 4RT3A 8ICYA 3PY8A 3AQEA 4U7CA 2OWOA 3R9KA 2KNJA 2VA8A 1RQNA 2E8OA 4RU9A 5KFWA 1S8OA 8ICEA 2XY7A 5HMMA 5AKEA 1COOA 2PMZC 3RJHA 4CF4A 1CUKA 3GDXA 1O08A 2BQ3A 7ICTA 2Y9TA 4Y2PA 4I2FA 3TANA 2W8KA 2HDOA 5KFKA 1X42A 4YXJA 4J9KA 1KDHA 3L3FX 4C7YA 4GXIA 1VDVA 2HI0A 4DS4A 1ZD5A 1YZ6A 2QKQA 4YR0A 2AQ4A 3M6ZA 5ALNA 2HBJA 3NRZA 1L3SA 2EH9A 9ICHA 1ZQMA 3N7SC 1XSPA 3ALRA 2LI6A 5BOMA 1K1SA 2WF6A 1Q8KA 3RF9A 2J6SA 3C2KA 5KFGA 1V97A 3MABA 4KX3A 3BS7A 5ALZA 5J2EA 1SB3C 5F9NA 3RJKA 4PZNA 3TFRA 4NLGA 5IILA 4DQPA 3RBEA 2IOFA 1HJPA 1LV5A 2Y0SC 3SR6A 4Y2VA 2FPKA 1V9PA 2KIVA 3H0RB 2PMZF 2ASDA 4Y2RA 4ECQA 2ZXIA 3ETRA 4ECYA 1Z1VA 4NXZA 1WWVA 3O0FA 2W9MA 1ZQTA 2EAMA 2ZIUA 1JXLA 2WF7A 2K8BB 3NRWA 9ICFA 2XI9A 4R64A 3TAQA 4NY8A 4XRHA 3MFHA 2KFZA 4Y2TA 5KFOA 1B0XA 3VC8A 2JEFA 3NVZA 1QSLA 3MDCA 5EE9A 2WF5A 3T5KA 4FZLA 2XCAA 4YD1A 2AH5A 4C8LA 4IR1A 5KFCA 4MFFA 3M1YA 5KFUA 5E79U 1X66A 4UW9A 3H40A 2HHXA 1S97A 4I2AA 5KFZA 3K1ZA 1PVPA 2IOHA 3C1YA 8ICNA 5IINA 2DGZA 5HR7A 2ZUCA 3LDAA 4TQSA 3EZ5A 3PR5B 4DSJA 3N4MB 4QZIA 8ICKA 2KD1A 2IA6A 2QB1A 4KLDA 5J0PA 2LYBA 5J0SA 1N48A 2YQEA 3JPQA 3N28A 4F2SA 2FDRA 3OSNA 5DQGA 4YMMA 3QX7A 5L1MA 4A8EA 4M0AA 4KLLA 4M6WA 4P0PB 9ICNA 2IOFK 4Y2UA 4PHAA 2W03A 1UPHA 2JGAA 2PFPA 8ICGA 8ICFA 1ZD4A 3HP6A 3KBBA 5KT7A 2C28A 1ZQSA 1ZQLA 3C1ZA 1IXRA 4YN4A 3PMNA 2PXIA 3V6HA 1UQVA 4BDPA 1FIQA 2CRXA 1K5OA 1VLBA 3JPSA 5J2DA 3JPTA 2HHSA 1XSLA 1NK6A 4XA5A 4QZBA 1J2MA 4DL6A 4LZGA 4DSLA 2PI5A 1JALA 5BPCA 1H38A 4RNNA 1UT5A 4DSIA 4UAUA 4CF5A 4MEYA 2FE9A 2RP5A 2FMSA 1S0NA 5DB6A 2ASJA 1ZYQA 3QE9Y 5AKXA 4QZHA 8ICOA 2O6KA 1QQ6A 3QZ7A 4UQGA 5DQIA 1A76A 1ZD2P 2BZFA 4RQ2A 5J8YC 5HNKA 2R8HA 4BXOA 2ZJ8A 3T5JA 5KFMA 1KFTA 2XVTA 1C20A 5KFSA 3AM9A 2BDUA 4DQSA 3K1RB 4RZRA 4I28A 3H8SA 5ALGA 3EWAA 1CEZA 1BPBA 3E58A 1NJWA 4JB3A 4EENA 4KLEA 2B0CA 5KFTA 4UAYA 4R8UB 4QIWC 4F91B 3RH6A 9ICLA 1V38A 2ASLA 3QNMA 3GFKB 3IN5A 1XSNA 2EZZA 2HVIA 5J2JA 4O3SA 5KT5A 1ZQOA 1HEKA 1KTQA 1GO3F 2NRZA 5KFVA 2ES6A 1YZ7A 2YMPA 3V7KA 4TUSA 4AP9A 3C2MA 4RQ1A 3BZKA 4DOBA 3RJJA 4YMNA 4TUPA 2V4RA 4KLFA 2NRVA 1FEZA 1NZBA 4EELA 2RDJA 5KG6A 2AHOB 3QUBA 2NRWA 1U9LA 1PK3A 3BS5A 4DFDA 1KKXA 2G07A 1Z00A 5JU5A 2GO7A 1DOQA 2K89A 4PJ0U 1N2XA 1ZQAA 2FPMA 1N61A 3GIIA 3RTVA 4QJFB 5J0YA 2K4PA 2Q4TA 4IQUA 2KZMA 3BQ2A 1A0PA 4IQTA 4UB4A 2KVCA 3JPRA 5B66U 2RQ5A 4DWIA 5L9XA 3KHLA 4EX7A 4U6PA 5IIOA 2ZUBA 1LVHA 8ICSA 4ECSA 1TFRA 3KTQA 1DRGA 2G09A 3MGVA 4QNLA 2W9AA 2HVHA 3BS5B 1DGJA 1BPEA 3IM1A 2J6TA 2Y9UA 3KHHA 5DKWA 4R66A 4J9QA 4DL5A 1SXDA 3ZDAA 3HT3A 9ICMA 5ALLA 3WKBA 4F4KA 2BHNA 3AUOA 2LPEA 2ZIWA 1B4FA 3PX6A 2BPCA 1X6IA 1KSPA 2DUYA 3D2NA 2F2AB 2XY5A 3I1YA 5KG3A 5EE1A 1UCVA 4J03A 1ZQUA 3CW2C 3H0MB 3OJSA 1NKCA 1KLNA 4F2RA 1SKWA 2CN1A 4RPXA 1XC9A 3MGHA 3RB3A 4EEYA 3TARA 5L1KA 5DDMA 3V6KA 1ZQNA 2AXTU 3SMVA 5AI6A 2Y1IA 4QZAA 4OCZA 5GTHU 4B9LA 4PHDA 1BGXT 3BQTA 3HKZF 3MR6A 2D6FC 3PVXA 4I2JA 1S0OA 4YMOA 2XC9A 2I9GA 5KT6A 2XY6A 2IBKA 3PO4A 1B43A 2G0AA 2KSOA 3EPIA 5J2IA 3RB6A 5L1IA 9ICUA 5J2KA 1C7YA 5DB8A 5ALKA 9ICWA 1RQLA 1JMSA 1LKYB 8ICHA 8ICWA 2EAPA 5IIJA 5KFEA 1ZQDA 2ISPA 2RRDA 4B9NA 5C0YA 2ALZA 3QU5A 4Y2JA 3T79A 2IHMA 4ED3A 1TK8A 1F44A 9ICJA 2E8NA 1CRXA 3PW2A 3PNCA 1JROA 1SV4A 4NLBA 3THVA 5DDYA 3TQ1A 4HYKA 5AKZA 5AM4A 2D3DA 5FP0A 4C4TA 3MC1A 1KFSA 3UMBA 2BCVA 4QZFA 2OH2A 5HHIA 1NK9A 3MGIA 5KG7A 3HJEA 2ZTEA 3CRXA 1ZETA 1L7MA 2FMPA 3PZPA 4UB6U 3F2DA 2ZTCA 9ICRA 4KTQA 3NS1A 1PZNA 5DB7A 5EE3A 5AICA 3EPGA 4Y2SA 4O5EA 1SV0C 4C7ZA 3SV4A 1Z3EB 4MHVA 3ZDBA 1BPXA 4DOCA 2HOFA 3M8RA 3HKZC 1XO0A 2KZZA 2PKEA 4ECXA 5KL8B 2AU0A 1XU4A 2P6UA 4JWNA 4RQ7A 4RQ8A 3ZI4A 3TAPA 5KTQA 3Q8KA 3T5LA 4KMUA 2PI4A 4NLKA 1BVSA 2PFNA 2QARA 2EDUA 2CXYA 2R8JA 3QEBZ 5DLFA 2HHTA 1HIWA 1PVQA 4OJ5A 5KFPA 1Z4NA 9ICQA 3FM9A 5AM3A 1RZTA 5CRXA 5CEHA 1LKYA 1X2IA 5DG9A 3KOOA 3BZCA 4YP3A 8ICTA 2NV3A 4FBUA 2PFOA 5ALEA 2K8CB 4M9JA 4F4YA 1FFUA 2DKZA 5J2FA 4UB3A 2ZIUB 3H8MA 4C4RA 4P0PA 1JIHA 2B6GA 1L8LA 1OW5A 9ICOA 2JH7A 5KFIA 3SEIA 2WAQF 4O3PA 4Q45A 1JRPA 2KMDA 3E0FA 1L7OA 4X5VA 4QZGA 1ECWA 5AI5A 5KT2A 5AK5A 9ICEA 3BDPA 3TADC 4J9RA 2B21A 4ECZA 1L3TA 8ICRA 5EE0A 4MEXA 1A77A 2A1JA 1ZJNA 4KN4A 1O03A 1MN8A 2KJ5A 3H7IA 2JXJA 4F71A 1MQ3A 2GWSA 1TE2A 3E2EA 1SKRA 3HRDD 2K4EA 1AQ6A 2W9BB 4ED7A 4NM2A 2KV2A 4C8KA 1T3NA 3SAHA 2BCUA 9ICIA 4B6JA 4YFKA 3F5AA 4M9NA 5KFRA 1NK0A 1JUDA 4Y2QA 2YTUA 5ALQA 3G6YA 2I5HA 4Q8EA 9ICPA 9ICBA 4YVZA 3NUQA 3K75D 5AKGA 3UPQA 4NWIA 4M2YA 5BOLA 2AGOA 2DWQA 4CRXA 1XNSA 4IRDA 9ICKA 5J2CA 5JRTA 8ICBA 5CHGA 2EQYA 4C0ZA 2KEYA 4E0DA 5KFNA 1ZJMA 2WF9A 3QYPA 2XIDA 2KKPA 1CI4A 4XQ8A 4R65A 4JUZA 1NKEA 3D2QA 2G08A 5KT4A 1SV0A 4AYBF 3PW0A 5D4BA 4K4HA 4J9LA 1P7DA 1X9SA 2DPJA 2LYAA 3TI0A 2NO4A 3WK5A 2DPIA 4FS2A 4CGZA 3QXGA 3Q8QB 7ICEA 4OJ6A 3IV6A 4MFAA 3PSFA 4CDGA 5CJ7A 2C2EA 2H3IA 9ICGA 5J0QA 3WU2U 2KJ9A 8ICJA 2W7PA 4NJ8A 2FPLA 5CP2A 2FI1A 5HMLA 3TACB 4O5KA 1WCNA 2KZ3A 4GLXA 4PGQA 5KFXA 2V9WA 2HBKA 5ALDA 2LMRA 4J9NA 3A0HU 2ZJAA 2H5XA 2J6UA 4O5CA 1TK0A 2KE7A 3G6VA 2JEGA 4KLQA 3PV8A 4RQ3A 2P66A 2DKXA 5J2AA 2XCPA 4M9GA 2H3FA 1QSSA 3M9NB 1RYRA 1UHUA 1RYSA 1KRPA 4KLHA 3QUTA 2NRTA 5G5HA 1KQQA 4J9OA 4IR9A 3ZDCA 5JTIA 1WCLA 2KICA 1S9FA 4US8A 1K1QA 4FBTA 4ECTA 4K4GA 2F8LA 5AI4A 2G06A 3AU2A 4PH5A 4OJOA 4GXJA 3RBDA 3CYMA 3IHQB 2XGPA 4NL9A 4TQRA 3JPPA 4J9MA 2E1EA 2UVVA 5F9LA 4DL4A 1N62A 2ESEA 4ED6A 1IV8A 4DLGA 3SENA 4DSFA 1NZPA 2YN4A 1SIJA 1ZD3A 3UMCA 3B0XA 3WK8A 4YG2A 4DL3A 3SV3A 3SAGA 2WFAA 4UAZA 2ZUDA 5J8YA 2JMGA 1ZOLA 1DK3A 5KAFU 4DFMA 3DV9A 3ISDA 1COKA 1SL1A 3OPXA 3WK4A 3N7RC 2HHVA 4C4SA 2A1JB 4UAWA 3GZFA 5ALRA 2A1AA 1SZPA 2HHWA 3G6XA 2H3QA 3MR2A 3N97B 2BQUA 2RLTA 1ZQWA 2H3ZA 2BR0A 1ZRNA 3GIKA 3UMGA 3RAQA 1Q3UA 1WWUA 2F1IA 2ZG6A 3EUB2 3M6KA 3M7DA 1ZQHA 5TZVA 1KEJA 2H3VA 4MF2A 2M9NA 3H8JA 4HAIA 4KLOA 5ALTA 1PVRA 2L5YA 5ALMA 5AIBA 1ZQRA 4RNMA 3RB4A 1NJYA 1S5LU 4DFKA 2F77X 2OYYA 7ICVA 3U26A 1D8YA 5ALJA 3FYHA 4F8RA 2MRLA 4DQIA 2F1JA 2EANA 4DEZA 4M47A 1OUQA 5IIMA 1RG6A 4JV0A 2RDIA 1B22A 3QUQA 2W04A 1HUOA 8ICQA 2ZTDA 3MR3A 2WTFA 4WJ3B 3N7PD 1IG6A 3ETLA 1SKSA 5KFAA 3SQIA 2LKYA 4UBCA 3KKAC 5TISU 1ZXIA 4IL6U 5DBAA 3D6JA 4RUCA 2F8KA 2BQRA 4M6WB 3GIMA 2M0NA 2W8LA 1ZRMA 1S76D 2AJQA 1EXNA 1QH9A 5JUMA 1NK7A 3UXOA 9ICAA 4QW8A 2VANA 1KL9A 3F5EA 3WKEA 4F4WA 3NVYA 1FFVA 5C5JA 4J9PA 1X40A 4DCCA 2HMXA 2N1RA 2ISOA 2WB1F 5J0UA 5D49A 5T14A 3TKAA 3Q8RB 4YR3A 1UA1A 1NJZA 4DFPA 7ICFA 1V85A 7ICPA 2UVWA 3BJYA 3H4DA 3PX0A 1ZQGA 1RYUA 4ECVA 1KFDA 2R8KA 2BPFA 3FAHA 3QUCA 3WK6A 2W3RA 1Z4OA 3HPOA 2Z7JA 4ICAA 5AKYA 4O3OA 4Z6EA 3PW5A 4DQRA 4RQNA 4I2CA 1J2NA 2BKEA 1BPDA 2ZIVA 2C2DA 4EBCA 3RAXA 4FZNA 4I27A 4KITB 4I2EA 5KT3A 4I2HA 5ALOA 1S10A 1SWVA 4NLCA 1NJXA 5IIKA 3BQ7A 8ICPA 3F53A 2W9CB 3LYSA 4B9UA 4KLSA 1QQ5A 5ALPA 1VJ5A 5KNIA 5AK4A 2HHUA 5AIAA 5DGAA 2W9BA 4QZEA 4ED1A 2K4HA 2V4QA 5DQHA 3V6JA 3L5KA 1TAQA 2VA3A 2LYHA 3ISBA 1SWWA 5AKKA 3MR5A 1QSYA 4UB5A
chains in the Genus database with same CATH topology
2E8PA 2QB0A 1KW4A 3TACB 1SXEA 2QB1A 1V38A 2LMRA 4NL9C 1X40A 2GLEA 1UCVA 1PK1A 1WWUA 5F3XB 5L1MA 2KE7A 2E8MA 1PK1B 2K60A 1SV0C 2DKXA 2ES6A 3BS7A 1OXJA 1V85A 4MHVA 2L5YA 1JI7A 2JV3A 3IDWA 4PZNA 2YTUA 1F0MA 2QB0B 5JTIA 3KKAA 3BS5A 1PK3A 1X9XA 2KIVA 1SGGA 5JU5A 1UQVA 4IS7A 2QARA 4RQNA 1Z1VA 2EANA 1WWVA 2KSOA 5JRTA 1RG6A 2EAMA 1DXSA 2KG5A 4NL9A 2K4PA 2QARB 2F44A 1LKYB 1LKYA 3BQ7A 3HILA 2FE9A 2EAPA 2D8CA 2ESEA 1B0XA 3SENA 2E8OA 2KSOB 2DKZA 1SV0A 5KNIA 3H8MA 2F3NA 2B6GA 2E8NA 3KKAC 1OW5A 5J8YC 1SV4A 3BS5B 3SEIA 5J8YA 1X66A 2D3DA 4NJ8A 2F8KA 2Y9TA 2Y9UA 2KMDA 1COKA 2EAOA 3K1RB 4RQMA 1SXDA 3TADC 2DL0A 2LPEA 3TADA 2QKQA 1B4FA 4PZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E8P A;  2QB0 A;  1KW4 A;  3TAC B;  1SXE A;  2QB1 A;  1V38 A;  2LMR A;  4NL9 C;  1X40 A;  2GLE A;  1UCV A;  1PK1 A;  1WWU A;  5F3X B;  5L1M A;  2KE7 A;  2E8M A;  1PK1 B;  2K60 A;  1SV0 C;  2DKX A;  2ES6 A;  3BS7 A;  1OXJ A;  1V85 A;  4MHV A;  2L5Y A;  1JI7 A;  2JV3 A;  3IDW A;  4PZN A;  2YTU A;  1F0M A;  2QB0 B;  5JTI A;  3KKA A;  3BS5 A;  1PK3 A;  1X9X A;  2KIV A;  1SGG A;  5JU5 A;  1UQV A;  4IS7 A;  2QAR A;  4RQN A;  1Z1V A;  2EAN A;  1WWV A;  2KSO A;  5JRT A;  1RG6 A;  2EAM A;  1DXS A;  2KG5 A;  4NL9 A;  2K4P A;  2QAR B;  2F44 A;  1LKY B;  1LKY A;  3BQ7 A;  3HIL A;  2FE9 A;  2EAP A;  2D8C A;  2ESE A;  1B0X A;  3SEN A;  2E8O A;  2KSO B;  2DKZ A;  1SV0 A;  5KNI A;  3H8M A;  2F3N A;  2B6G A;  2E8N A;  3KKA C;  1OW5 A;  5J8Y C;  1SV4 A;  3BS5 B;  3SEI A;  5J8Y A;  1X66 A;  2D3D A;  4NJ8 A;  2F8K A;  2Y9T A;  2Y9U A;  2KMD A;  1COK A;  2EAO A;  3K1R B;  4RQM A;  1SXD A;  3TAD C;  2DL0 A;  2LPE A;  3TAD A;  2QKQ A;  1B4F A;  4PZO A; 
#chains in the Genus database with same CATH topology
 2G5I B;  1TV9 A;  3KZI U;  2RHF A;  8ICV A;  3FC4 A;  7ICO A;  4B9M A;  3PW7 A;  2W55 A;  4LVS A;  1BNP A;  3C2L A;  1S0M A;  1YT3 A;  3WK9 A;  2KN7 A;  4UAT A;  1PK1 A;  5J2H A;  1NK5 A;  3SI8 A;  3T5H A;  3VCB A;  2I6X A;  7ICQ A;  2OM6 A;  1BNO A;  3ZDE A;  4NM1 A;  4DS5 A;  2BCS A;  2QB0 B;  1SL0 A;  1ZQE A;  4YQW A;  2JZB B;  3I28 A;  4Y2X A;  4IQW A;  3DDH A;  1JXE A;  5ALS A;  1RXW A;  1DK2 A;  5III A;  2F1H A;  1X9X A;  8ICM A;  3KHG A;  1SL2 A;  3SD7 A;  1N5X A;  2KK0 A;  1RPL A;  2DF4 B;  2GH1 A;  5KG1 A;  3QU9 A;  5J29 A;  5KG4 A;  3ZD9 A;  3CNH A;  4ECR A;  4YXM A;  4USA A;  4EBE A;  2F76 X;  3GU3 A;  2KHV A;  5J2B A;  2VIX A;  2W3S A;  3KZX A;  3ZD8 A;  5ALF A;  1T8E A;  4DQQ A;  1XO1 A;  3C5F A;  1F5S A;  4I2I A;  3M9O B;  1NI3 A;  3QZ8 A;  1Y88 A;  3UXN A;  1NKB A;  2MA1 A;  2F3N A;  4BWM A;  4CF3 A;  2A19 A;  4KMO B;  4F3O A;  4FFD A;  5HP4 A;  2HCF A;  3MDA A;  4YD2 A;  2JHD A;  2VA2 A;  4F5N A;  1WYG A;  7ICI A;  4B9V A;  1URJ A;  3I76 A;  1ZQF A;  4KLT A;  5H2F U;  1U4B A;  4UBB A;  3AEV A;  4F5O A;  1QLN A;  1T94 A;  1L7P A;  1HUZ A;  4QWA A;  9ICX A;  1Z1B A;  2KFN A;  4GC6 A;  1QCK A;  4XUS A;  5GTI U;  1L7N A;  4OJP A;  4LZD A;  2LBO A;  2PFQ A;  4ED2 A;  2KHQ A;  3ED5 A;  5DLG A;  4EZ6 A;  1ED1 A;  4RPY A;  7ICG A;  2HOQ A;  2NO5 A;  1J97 A;  2YMM A;  4NL9 C;  4RQ6 A;  4TUQ A;  5AM2 A;  4FS1 A;  4F4Z A;  2FJ6 A;  5AI8 A;  4GC7 A;  2WF8 A;  9ICC A;  1L3V A;  1NK8 A;  1PK1 B;  1U49 A;  2K60 A;  1WG8 A;  3Q8M A;  3KHR A;  4O3N A;  4NV0 A;  4BXO B;  1D9D A;  2YB4 A;  3NAS A;  4K4I A;  2W11 A;  2R8I A;  8ICL A;  1NK4 A;  3GIJ A;  1Q3V A;  4DSK A;  4R63 A;  2LHT A;  5J0X A;  3JPN A;  1XS9 D;  4P4P A;  1D9F A;  4P0Q A;  8ICZ A;  2OXO A;  3OTQ A;  4IS7 A;  1JN3 A;  4F5P A;  1X9W A;  3NGD A;  8ICX A;  3WKC A;  7ICU A;  1IM4 A;  4BGD A;  2P35 A;  5AM0 A;  8ICI A;  5KFL A;  4JV2 A;  2IMW P;  3WK7 A;  3LK9 A;  9ICV A;  2R18 A;  3HIL A;  1MC8 A;  2KKV A;  3ZDD A;  2W9C A;  1N56 A;  2JEJ A;  2DFL A;  4DO9 A;  3AN1 A;  4QZ9 A;  5J0W A;  4F5Q A;  4Z6F A;  4DL7 A;  1U47 A;  2FLN A;  2WHE A;  5DG7 A;  4ECU A;  4CCH A;  4MFC A;  2KJ8 A;  3RJF A;  1ZQP A;  2W43 A;  3IG8 A;  3KD3 A;  7ICK A;  2VJ5 A;  4FO6 A;  2K4I A;  2Y0S F;  2EAO A;  5ALV A;  3GIL A;  4RQM A;  1ARO P;  3OGU A;  2HHQ A;  5ALX A;  7ICS A;  5DGB A;  1U45 A;  3T3F A;  2C2R A;  4OO1 J;  5ALH A;  5KG5 A;  1ZQI A;  4Q8F A;  3PW4 A;  3B9J A;  5CWR A;  2HBL A;  5HHH A;  4Q43 A;  4CNQ A;  2BDP A;  4QZD A;  4F50 A;  2GOL A;  4KLI A;  2K8A A;  2W7O A;  5ALW A;  3DEE A;  1KN5 A;  3RJE A;  1LB2 B;  2QLT A;  3HX0 A;  4QZ8 A;  5ALY A;  2E1F A;  1N63 A;  2MSN A;  3PX4 A;  2VKQ A;  1F0M A;  4EZ9 A;  4G3I A;  5L1L A;  5K4L A;  3GV7 B;  4Z6C A;  9ICT A;  2ZIW B;  4M04 A;  3NVW A;  3RR8 A;  4UAV A;  5ALI A;  4G9B A;  5EWE A;  3C29 A;  5KFF A;  1T7P A;  2UVU A;  3AMZ A;  1ZQQ A;  4KN7 A;  1Z19 A;  4F5R A;  4RQ0 A;  4NLZ A;  5ALU A;  3LVV A;  4F92 B;  5AM1 A;  7ICH A;  4I2G A;  5AM5 A;  5DBB A;  7ICM A;  5EOZ A;  3V7L A;  2HOI A;  7ICJ A;  5D46 A;  8ICC A;  4O3M A;  2W54 A;  2MAX A;  4P2H A;  4JMU A;  1U48 A;  4YR2 A;  3ISC A;  4EX6 A;  1D8B A;  3LVW A;  3PML A;  2A3V A;  4I2D A;  2ODG A;  2UVR A;  4B9T A;  3WKD A;  3L4P A;  3PR4 A;  5G5G A;  3D2S A;  4PZO A;  2E8P A;  2KVS A;  5AKH A;  3C28 A;  5AK6 A;  3EYZ A;  3AL0 B;  2YY6 A;  4RT2 A;  1NOM A;  4DFJ A;  2GLE A;  3RJG A;  2HW3 A;  3BQ1 A;  4KLG A;  4ZH4 A;  1T3Q A;  3QU4 A;  2DQN B;  2KTQ A;  5CA7 A;  3OHB A;  3UQ2 A;  1ZQ1 C;  4PGX A;  3SAF A;  2YB1 A;  2WB1 C;  5AI9 A;  4PL2 A;  3C5G A;  2MU2 A;  1ZQX A;  1QTM A;  4FZM A;  3V72 A;  1ZQK A;  4UAR A;  3UXP A;  4J9S A;  3KKA A;  4ELT A;  3LWM A;  4BX9 C;  5EWG A;  4O3R A;  4JK1 A;  1MSW D;  5KFH A;  5AKL A;  4ACO A;  4I29 A;  2Q0Z X;  3MBY A;  3RRG A;  4BJQ A;  2KG5 A;  2C22 A;  3C23 A;  2I1Q A;  2QAR B;  4UB2 A;  1XWL A;  3SZ2 A;  3C21 A;  1RM6 C;  4PPX A;  2ZIX A;  4ECW A;  3WKA A;  4US9 A;  1RXV A;  1Q46 A;  2IHN A;  4DSE A;  2VJ4 A;  3UM9 A;  3PSI A;  5KFJ A;  3MFI A;  3IP4 B;  4KLM A;  2OCE A;  4EYI B;  2YX8 A;  5AI0 A;  5CR0 A;  4QWB A;  3F2C A;  4KX5 A;  2BCQ A;  4C8O A;  3H4B A;  5AK3 A;  5KG2 A;  8ICA A;  3Q8L A;  3J81 j;  2NYV A;  3QEA Z;  4M9H A;  2BGW A;  4GIB A;  3ORY A;  5AKJ A;  3FDS A;  1S77 D;  1QQ7 A;  3QU2 A;  4QIW F;  2AQ0 A;  3HWT A;  2FMQ A;  4JWM A;  2JR5 A;  3Q8P B;  2HBM A;  5KFB A;  4AYB C;  3BQ0 A;  1JI7 A;  3IDW A;  5DG8 A;  2ZJ5 A;  2JH1 A;  3Q8S B;  2HSZ A;  1BPY A;  1ZQJ A;  5L1J A;  1N60 A;  4PGY A;  2LM1 A;  5KFD A;  4TUR A;  1SGG A;  4GFJ A;  2P6R A;  2G5H B;  3H8W A;  1L3U A;  1TAM A;  3RRH A;  4UB8 U;  5J2G A;  2FLP A;  3ICX A;  4QZC A;  4UAS A;  1M6Y A;  1A6S A;  2JRZ A;  4IC9 A;  7ICL A;  2WAQ C;  5CB1 A;  4BUG A;  1DXS A;  3IRU A;  3UQ0 A;  1D8L A;  2F44 A;  4C8M A;  2LM4 A;  5KFY A;  2D8C A;  4ED0 A;  1X6J A;  4LJX A;  1MA7 A;  3KFU F;  7ICR A;  2KP7 A;  2DBY A;  5J0O A;  5B5E U;  2MUT A;  3B0Y A;  3RH4 A;  4DL2 A;  4NLN A;  2KOB A;  5A0L A;  4PHE A;  4DLE A;  4QWE A;  1UT8 A;  2JEI A;  5DB9 A;  4QW9 A;  1ZQY A;  4Y2Y A;  3F2B A;  4M9L A;  3TAD A;  5J0T A;  5KG0 A;  4F93 B;  3M9M B;  4B9S A;  2XO7 A;  1TVA A;  3AQF A;  2ZXH A;  4Z6D A;  5KAI U;  4O9M A;  2NRX A;  1WUD A;  3RB0 A;  5F3X B;  1BPZ A;  1TK5 A;  1L5U A;  8ICU A;  2E8M A;  5HR6 A;  1FO4 A;  4C8N A;  1L8O A;  4R8U A;  3JPO A;  4KLU A;  1IIP A;  1PUZ A;  3QU7 A;  4OJL A;  4IRK A;  2JV3 A;  5J0R A;  2Y1J A;  2MUT B;  4ZOH C;  3RJI A;  3A0B U;  1UA0 A;  1NNL A;  1N5W A;  4P4O A;  1DGS A;  4MF8 A;  1ZQC A;  2KIW A;  4ED8 A;  4FE3 A;  1SZH A;  1MQ2 A;  3SYZ A;  4BWJ A;  4PHP A;  1KBU A;  5AKI A;  4PL1 A;  9ICS A;  4RNO A;  2ZIV B;  4EBD A;  3K4G A;  1Z00 B;  3M8S A;  4I2B A;  4P0Q B;  2ZIX B;  4RQ5 A;  1ZQZ A;  2XIC A;  3AU6 A;  2E5S A;  2KSO B;  4O3Q A;  4OD0 A;  5EWF A;  3V7J A;  3RR7 A;  1T4G A;  3PO5 A;  3ONN A;  3RFA A;  2EZX A;  2ATL A;  4UB1 A;  3IG5 A;  4O0I A;  3OJU A;  2FLL A;  4C80 A;  3EW9 A;  2DL0 A;  1L6N A;  2JZB A;  3NTU A;  1X9M A;  2QB0 A;  1KW4 A;  1RDF A;  4RQ4 A;  1ZQV A;  3CP8 A;  2BPG A;  1SXE A;  4DF4 A;  4IQV A;  3GV5 B;  2OEH A;  4F72 A;  5DBC A;  4CE6 A;  4EEK A;  3H0L B;  1JX4 A;  4JV1 A;  4QWC A;  2XGQ A;  1ZQB A;  5AHX A;  5KL1 B;  3OHA A;  2AGQ A;  2YML A;  4RPZ A;  1TAU A;  4EYH B;  1S0V A;  1OXJ A;  3GQC A;  3RH5 A;  4DF8 A;  4ELV A;  4P4M A;  4QWD A;  3OSP A;  2AGP A;  4GXK A;  3PSP A;  1TKD A;  4YCX A;  3LWL A;  2R8G A;  7ICN A;  2OHF A;  4Q44 A;  4DOA A;  3GV8 B;  2CPR A;  4ELU A;  5KFQ A;  3TFS A;  2YMQ A;  3S6J A;  4RUA A;  4IRC A;  3PST A;  2E3T A;  4KLJ A;  2EZY A;  4F4X A;  3NVV A;  3HW8 A;  2BCR A;  4RT3 A;  8ICY A;  3PY8 A;  3AQE A;  4U7C A;  2OWO A;  3R9K A;  2KNJ A;  2VA8 A;  1RQN A;  2E8O A;  4RU9 A;  5KFW A;  1S8O A;  8ICE A;  2XY7 A;  5HMM A;  5AKE A;  1COO A;  2PMZ C;  3RJH A;  4CF4 A;  1CUK A;  3GDX A;  1O08 A;  2BQ3 A;  7ICT A;  2Y9T A;  4Y2P A;  4I2F A;  3TAN A;  2W8K A;  2HDO A;  5KFK A;  1X42 A;  4YXJ A;  4J9K A;  1KDH A;  3L3F X;  4C7Y A;  4GXI A;  1VDV A;  2HI0 A;  4DS4 A;  1ZD5 A;  1YZ6 A;  2QKQ A;  4YR0 A;  2AQ4 A;  3M6Z A;  5ALN A;  2HBJ A;  3NRZ A;  1L3S A;  2EH9 A;  9ICH A;  1ZQM A;  3N7S C;  1XSP A;  3ALR A;  2LI6 A;  5BOM A;  1K1S A;  2WF6 A;  1Q8K A;  3RF9 A;  2J6S A;  3C2K A;  5KFG A;  1V97 A;  3MAB A;  4KX3 A;  3BS7 A;  5ALZ A;  5J2E A;  1SB3 C;  5F9N A;  3RJK A;  4PZN A;  3TFR A;  4NLG A;  5IIL A;  4DQP A;  3RBE A;  2IOF A;  1HJP A;  1LV5 A;  2Y0S C;  3SR6 A;  4Y2V A;  2FPK A;  1V9P A;  2KIV A;  3H0R B;  2PMZ F;  2ASD A;  4Y2R A;  4ECQ A;  2ZXI A;  3ETR A;  4ECY A;  1Z1V A;  4NXZ A;  1WWV A;  3O0F A;  2W9M A;  1ZQT A;  2EAM A;  2ZIU A;  1JXL A;  2WF7 A;  2K8B B;  3NRW A;  9ICF A;  2XI9 A;  4R64 A;  3TAQ A;  4NY8 A;  4XRH A;  3MFH A;  2KFZ A;  4Y2T A;  5KFO A;  1B0X A;  3VC8 A;  2JEF A;  3NVZ A;  1QSL A;  3MDC A;  5EE9 A;  2WF5 A;  3T5K A;  4FZL A;  2XCA A;  4YD1 A;  2AH5 A;  4C8L A;  4IR1 A;  5KFC A;  4MFF A;  3M1Y A;  5KFU A;  5E79 U;  1X66 A;  4UW9 A;  3H40 A;  2HHX A;  1S97 A;  4I2A A;  5KFZ A;  3K1Z A;  1PVP A;  2IOH A;  3C1Y A;  8ICN A;  5IIN A;  2DGZ A;  5HR7 A;  2ZUC A;  3LDA A;  4TQS A;  3EZ5 A;  3PR5 B;  4DSJ A;  3N4M B;  4QZI A;  8ICK A;  2KD1 A;  2IA6 A;  2QB1 A;  4KLD A;  5J0P A;  2LYB A;  5J0S A;  1N48 A;  2YQE A;  3JPQ A;  3N28 A;  4F2S A;  2FDR A;  3OSN A;  5DQG A;  4YMM A;  3QX7 A;  5L1M A;  4A8E A;  4M0A A;  4KLL A;  4M6W A;  4P0P B;  9ICN A;  2IOF K;  4Y2U A;  4PHA A;  2W03 A;  1UPH A;  2JGA A;  2PFP A;  8ICG A;  8ICF A;  1ZD4 A;  3HP6 A;  3KBB A;  5KT7 A;  2C28 A;  1ZQS A;  1ZQL A;  3C1Z A;  1IXR A;  4YN4 A;  3PMN A;  2PXI A;  3V6H A;  1UQV A;  4BDP A;  1FIQ A;  2CRX A;  1K5O A;  1VLB A;  3JPS A;  5J2D A;  3JPT A;  2HHS A;  1XSL A;  1NK6 A;  4XA5 A;  4QZB A;  1J2M A;  4DL6 A;  4LZG A;  4DSL A;  2PI5 A;  1JAL A;  5BPC A;  1H38 A;  4RNN A;  1UT5 A;  4DSI A;  4UAU A;  4CF5 A;  4MEY A;  2FE9 A;  2RP5 A;  2FMS A;  1S0N A;  5DB6 A;  2ASJ A;  1ZYQ A;  3QE9 Y;  5AKX A;  4QZH A;  8ICO A;  2O6K A;  1QQ6 A;  3QZ7 A;  4UQG A;  5DQI A;  1A76 A;  1ZD2 P;  2BZF A;  4RQ2 A;  5J8Y C;  5HNK A;  2R8H A;  4BXO A;  2ZJ8 A;  3T5J A;  5KFM A;  1KFT A;  2XVT A;  1C20 A;  5KFS A;  3AM9 A;  2BDU A;  4DQS A;  3K1R B;  4RZR A;  4I28 A;  3H8S A;  5ALG A;  3EWA A;  1CEZ A;  1BPB A;  3E58 A;  1NJW A;  4JB3 A;  4EEN A;  4KLE A;  2B0C A;  5KFT A;  4UAY A;  4R8U B;  4QIW C;  4F91 B;  3RH6 A;  9ICL A;  1V38 A;  2ASL A;  3QNM A;  3GFK B;  3IN5 A;  1XSN A;  2EZZ A;  2HVI A;  5J2J A;  4O3S A;  5KT5 A;  1ZQO A;  1HEK A;  1KTQ A;  1GO3 F;  2NRZ A;  5KFV A;  2ES6 A;  1YZ7 A;  2YMP A;  3V7K A;  4TUS A;  4AP9 A;  3C2M A;  4RQ1 A;  3BZK A;  4DOB A;  3RJJ A;  4YMN A;  4TUP A;  2V4R A;  4KLF A;  2NRV A;  1FEZ A;  1NZB A;  4EEL A;  2RDJ A;  5KG6 A;  2AHO B;  3QUB A;  2NRW A;  1U9L A;  1PK3 A;  3BS5 A;  4DFD A;  1KKX A;  2G07 A;  1Z00 A;  5JU5 A;  2GO7 A;  1DOQ A;  2K89 A;  4PJ0 U;  1N2X A;  1ZQA A;  2FPM A;  1N61 A;  3GII A;  3RTV A;  4QJF B;  5J0Y A;  2K4P A;  2Q4T A;  4IQU A;  2KZM A;  3BQ2 A;  1A0P A;  4IQT A;  4UB4 A;  2KVC A;  3JPR A;  5B66 U;  2RQ5 A;  4DWI A;  5L9X A;  3KHL A;  4EX7 A;  4U6P A;  5IIO A;  2ZUB A;  1LVH A;  8ICS A;  4ECS A;  1TFR A;  3KTQ A;  1DRG A;  2G09 A;  3MGV A;  4QNL A;  2W9A A;  2HVH A;  3BS5 B;  1DGJ A;  1BPE A;  3IM1 A;  2J6T A;  2Y9U A;  3KHH A;  5DKW A;  4R66 A;  4J9Q A;  4DL5 A;  1SXD A;  3ZDA A;  3HT3 A;  9ICM A;  5ALL A;  3WKB A;  4F4K A;  2BHN A;  3AUO A;  2LPE A;  2ZIW A;  1B4F A;  3PX6 A;  2BPC A;  1X6I A;  1KSP A;  2DUY A;  3D2N A;  2F2A B;  2XY5 A;  3I1Y A;  5KG3 A;  5EE1 A;  1UCV A;  4J03 A;  1ZQU A;  3CW2 C;  3H0M B;  3OJS A;  1NKC A;  1KLN A;  4F2R A;  1SKW A;  2CN1 A;  4RPX A;  1XC9 A;  3MGH A;  3RB3 A;  4EEY A;  3TAR A;  5L1K A;  5DDM A;  3V6K A;  1ZQN A;  2AXT U;  3SMV A;  5AI6 A;  2Y1I A;  4QZA A;  4OCZ A;  5GTH U;  4B9L A;  4PHD A;  1BGX T;  3BQT A;  3HKZ F;  3MR6 A;  2D6F C;  3PVX A;  4I2J A;  1S0O A;  4YMO A;  2XC9 A;  2I9G A;  5KT6 A;  2XY6 A;  2IBK A;  3PO4 A;  1B43 A;  2G0A A;  2KSO A;  3EPI A;  5J2I A;  3RB6 A;  5L1I A;  9ICU A;  5J2K A;  1C7Y A;  5DB8 A;  5ALK A;  9ICW A;  1RQL A;  1JMS A;  1LKY B;  8ICH A;  8ICW A;  2EAP A;  5IIJ A;  5KFE A;  1ZQD A;  2ISP A;  2RRD A;  4B9N A;  5C0Y A;  2ALZ A;  3QU5 A;  4Y2J A;  3T79 A;  2IHM A;  4ED3 A;  1TK8 A;  1F44 A;  9ICJ A;  2E8N A;  1CRX A;  3PW2 A;  3PNC A;  1JRO A;  1SV4 A;  4NLB A;  3THV A;  5DDY A;  3TQ1 A;  4HYK A;  5AKZ A;  5AM4 A;  2D3D A;  5FP0 A;  4C4T A;  3MC1 A;  1KFS A;  3UMB A;  2BCV A;  4QZF A;  2OH2 A;  5HHI A;  1NK9 A;  3MGI A;  5KG7 A;  3HJE A;  2ZTE A;  3CRX A;  1ZET A;  1L7M A;  2FMP A;  3PZP A;  4UB6 U;  3F2D A;  2ZTC A;  9ICR A;  4KTQ A;  3NS1 A;  1PZN A;  5DB7 A;  5EE3 A;  5AIC A;  3EPG A;  4Y2S A;  4O5E A;  1SV0 C;  4C7Z A;  3SV4 A;  1Z3E B;  4MHV A;  3ZDB A;  1BPX A;  4DOC A;  2HOF A;  3M8R A;  3HKZ C;  1XO0 A;  2KZZ A;  2PKE A;  4ECX A;  5KL8 B;  2AU0 A;  1XU4 A;  2P6U A;  4JWN A;  4RQ7 A;  4RQ8 A;  3ZI4 A;  3TAP A;  5KTQ A;  3Q8K A;  3T5L A;  4KMU A;  2PI4 A;  4NLK A;  1BVS A;  2PFN A;  2QAR A;  2EDU A;  2CXY A;  2R8J A;  3QEB Z;  5DLF A;  2HHT A;  1HIW A;  1PVQ A;  4OJ5 A;  5KFP A;  1Z4N A;  9ICQ A;  3FM9 A;  5AM3 A;  1RZT A;  5CRX A;  5CEH A;  1LKY A;  1X2I A;  5DG9 A;  3KOO A;  3BZC A;  4YP3 A;  8ICT A;  2NV3 A;  4FBU A;  2PFO A;  5ALE A;  2K8C B;  4M9J A;  4F4Y A;  1FFU A;  2DKZ A;  5J2F A;  4UB3 A;  2ZIU B;  3H8M A;  4C4R A;  4P0P A;  1JIH A;  2B6G A;  1L8L A;  1OW5 A;  9ICO A;  2JH7 A;  5KFI A;  3SEI A;  2WAQ F;  4O3P A;  4Q45 A;  1JRP A;  2KMD A;  3E0F A;  1L7O A;  4X5V A;  4QZG A;  1ECW A;  5AI5 A;  5KT2 A;  5AK5 A;  9ICE A;  3BDP A;  3TAD C;  4J9R A;  2B21 A;  4ECZ A;  1L3T A;  8ICR A;  5EE0 A;  4MEX A;  1A77 A;  2A1J A;  1ZJN A;  4KN4 A;  1O03 A;  1MN8 A;  2KJ5 A;  3H7I A;  2JXJ A;  4F71 A;  1MQ3 A;  2GWS A;  1TE2 A;  3E2E A;  1SKR A;  3HRD D;  2K4E A;  1AQ6 A;  2W9B B;  4ED7 A;  4NM2 A;  2KV2 A;  4C8K A;  1T3N A;  3SAH A;  2BCU A;  9ICI A;  4B6J A;  4YFK A;  3F5A A;  4M9N A;  5KFR A;  1NK0 A;  1JUD A;  4Y2Q A;  2YTU A;  5ALQ A;  3G6Y A;  2I5H A;  4Q8E A;  9ICP A;  9ICB A;  4YVZ A;  3NUQ A;  3K75 D;  5AKG A;  3UPQ A;  4NWI A;  4M2Y A;  5BOL A;  2AGO A;  2DWQ A;  4CRX A;  1XNS A;  4IRD A;  9ICK A;  5J2C A;  5JRT A;  8ICB A;  5CHG A;  2EQY A;  4C0Z A;  2KEY A;  4E0D A;  5KFN A;  1ZJM A;  2WF9 A;  3QYP A;  2XID A;  2KKP A;  1CI4 A;  4XQ8 A;  4R65 A;  4JUZ A;  1NKE A;  3D2Q A;  2G08 A;  5KT4 A;  1SV0 A;  4AYB F;  3PW0 A;  5D4B A;  4K4H A;  4J9L A;  1P7D A;  1X9S A;  2DPJ A;  2LYA A;  3TI0 A;  2NO4 A;  3WK5 A;  2DPI A;  4FS2 A;  4CGZ A;  3QXG A;  3Q8Q B;  7ICE A;  4OJ6 A;  3IV6 A;  4MFA A;  3PSF A;  4CDG A;  5CJ7 A;  2C2E A;  2H3I A;  9ICG A;  5J0Q A;  3WU2 U;  2KJ9 A;  8ICJ A;  2W7P A;  4NJ8 A;  2FPL A;  5CP2 A;  2FI1 A;  5HML A;  3TAC B;  4O5K A;  1WCN A;  2KZ3 A;  4GLX A;  4PGQ A;  5KFX A;  2V9W A;  2HBK A;  5ALD A;  2LMR A;  4J9N A;  3A0H U;  2ZJA A;  2H5X A;  2J6U A;  4O5C A;  1TK0 A;  2KE7 A;  3G6V A;  2JEG A;  4KLQ A;  3PV8 A;  4RQ3 A;  2P66 A;  2DKX A;  5J2A A;  2XCP A;  4M9G A;  2H3F A;  1QSS A;  3M9N B;  1RYR A;  1UHU A;  1RYS A;  1KRP A;  4KLH A;  3QUT A;  2NRT A;  5G5H A;  1KQQ A;  4J9O A;  4IR9 A;  3ZDC A;  5JTI A;  1WCL A;  2KIC A;  1S9F A;  4US8 A;  1K1Q A;  4FBT A;  4ECT A;  4K4G A;  2F8L A;  5AI4 A;  2G06 A;  3AU2 A;  4PH5 A;  4OJO A;  4GXJ A;  3RBD A;  3CYM A;  3IHQ B;  2XGP A;  4NL9 A;  4TQR A;  3JPP A;  4J9M A;  2E1E A;  2UVV A;  5F9L A;  4DL4 A;  1N62 A;  2ESE A;  4ED6 A;  1IV8 A;  4DLG A;  3SEN A;  4DSF A;  1NZP A;  2YN4 A;  1SIJ A;  1ZD3 A;  3UMC A;  3B0X A;  3WK8 A;  4YG2 A;  4DL3 A;  3SV3 A;  3SAG A;  2WFA A;  4UAZ A;  2ZUD A;  5J8Y A;  2JMG A;  1ZOL A;  1DK3 A;  5KAF U;  4DFM A;  3DV9 A;  3ISD A;  1COK A;  1SL1 A;  3OPX A;  3WK4 A;  3N7R C;  2HHV A;  4C4S A;  2A1J B;  4UAW A;  3GZF A;  5ALR A;  2A1A A;  1SZP A;  2HHW A;  3G6X A;  2H3Q A;  3MR2 A;  3N97 B;  2BQU A;  2RLT A;  1ZQW A;  2H3Z A;  2BR0 A;  1ZRN A;  3GIK A;  3UMG A;  3RAQ A;  1Q3U A;  1WWU A;  2F1I A;  2ZG6 A;  3EUB 2;  3M6K A;  3M7D A;  1ZQH A;  5TZV A;  1KEJ A;  2H3V A;  4MF2 A;  2M9N A;  3H8J A;  4HAI A;  4KLO A;  5ALT A;  1PVR A;  2L5Y A;  5ALM A;  5AIB A;  1ZQR A;  4RNM A;  3RB4 A;  1NJY A;  1S5L U;  4DFK A;  2F77 X;  2OYY A;  7ICV A;  3U26 A;  1D8Y A;  5ALJ A;  3FYH A;  4F8R A;  2MRL A;  4DQI A;  2F1J A;  2EAN A;  4DEZ A;  4M47 A;  1OUQ A;  5IIM A;  1RG6 A;  4JV0 A;  2RDI A;  1B22 A;  3QUQ A;  2W04 A;  1HUO A;  8ICQ A;  2ZTD A;  3MR3 A;  2WTF A;  4WJ3 B;  3N7P D;  1IG6 A;  3ETL A;  1SKS A;  5KFA A;  3SQI A;  2LKY A;  4UBC A;  3KKA C;  5TIS U;  1ZXI A;  4IL6 U;  5DBA A;  3D6J A;  4RUC A;  2F8K A;  2BQR A;  4M6W B;  3GIM A;  2M0N A;  2W8L A;  1ZRM A;  1S76 D;  2AJQ A;  1EXN A;  1QH9 A;  5JUM A;  1NK7 A;  3UXO A;  9ICA A;  4QW8 A;  2VAN A;  1KL9 A;  3F5E A;  3WKE A;  4F4W A;  3NVY A;  1FFV A;  5C5J A;  4J9P A;  1X40 A;  4DCC A;  2HMX A;  2N1R A;  2ISO A;  2WB1 F;  5J0U A;  5D49 A;  5T14 A;  3TKA A;  3Q8R B;  4YR3 A;  1UA1 A;  1NJZ A;  4DFP A;  7ICF A;  1V85 A;  7ICP A;  2UVW A;  3BJY A;  3H4D A;  3PX0 A;  1ZQG A;  1RYU A;  4ECV A;  1KFD A;  2R8K A;  2BPF A;  3FAH A;  3QUC A;  3WK6 A;  2W3R A;  1Z4O A;  3HPO A;  2Z7J A;  4ICA A;  5AKY A;  4O3O A;  4Z6E A;  3PW5 A;  4DQR A;  4RQN A;  4I2C A;  1J2N A;  2BKE A;  1BPD A;  2ZIV A;  2C2D A;  4EBC A;  3RAX A;  4FZN A;  4I27 A;  4KIT B;  4I2E A;  5KT3 A;  4I2H A;  5ALO A;  1S10 A;  1SWV A;  4NLC A;  1NJX A;  5IIK A;  3BQ7 A;  8ICP A;  3F53 A;  2W9C B;  3LYS A;  4B9U A;  4KLS A;  1QQ5 A;  5ALP A;  1VJ5 A;  5KNI A;  5AK4 A;  2HHU A;  5AIA A;  5DGA A;  2W9B A;  4QZE A;  4ED1 A;  2K4H A;  2V4Q A;  5DQH A;  3V6J A;  3L5K A;  1TAQ A;  2VA3 A;  2LYH A;  3ISB A;  1SWW A;  5AKK A;  3MR5 A;  1QSY A;  4UB5 A; 
#chains in the Genus database with same CATH homology
 2E8P A;  2QB0 A;  1KW4 A;  3TAC B;  1SXE A;  2QB1 A;  1V38 A;  2LMR A;  4NL9 C;  1X40 A;  2GLE A;  1UCV A;  1PK1 A;  1WWU A;  5F3X B;  5L1M A;  2KE7 A;  2E8M A;  1PK1 B;  2K60 A;  1SV0 C;  2DKX A;  2ES6 A;  3BS7 A;  1OXJ A;  1V85 A;  4MHV A;  2L5Y A;  1JI7 A;  2JV3 A;  3IDW A;  4PZN A;  2YTU A;  1F0M A;  2QB0 B;  5JTI A;  3KKA A;  3BS5 A;  1PK3 A;  1X9X A;  2KIV A;  1SGG A;  5JU5 A;  1UQV A;  4IS7 A;  2QAR A;  4RQN A;  1Z1V A;  2EAN A;  1WWV A;  2KSO A;  5JRT A;  1RG6 A;  2EAM A;  1DXS A;  2KG5 A;  4NL9 A;  2K4P A;  2QAR B;  2F44 A;  1LKY B;  1LKY A;  3BQ7 A;  3HIL A;  2FE9 A;  2EAP A;  2D8C A;  2ESE A;  1B0X A;  3SEN A;  2E8O A;  2KSO B;  2DKZ A;  1SV0 A;  5KNI A;  3H8M A;  2F3N A;  2B6G A;  2E8N A;  3KKA C;  1OW5 A;  5J8Y C;  1SV4 A;  3BS5 B;  3SEI A;  5J8Y A;  1X66 A;  2D3D A;  4NJ8 A;  2F8K A;  2Y9T A;  2Y9U A;  2KMD A;  1COK A;  2EAO A;  3K1R B;  4RQM A;  1SXD A;  3TAD C;  2DL0 A;  2LPE A;  3TAD A;  2QKQ A;  1B4F A;  4PZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...