3IDWA

Crystal structure of sla1 homology domain 2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
66
structure length
66
Chain Sequence
KYDWFEFFLNCGVDVSNCQRYTINFDREQLTEDMMPDINNSMLRTLGLREGDIVRVMKHLDKKFGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin cytoskeleton-regulatory complex protein SLA1
publication title Regulation of clathrin adaptor function in endocytosis: novel role for the SAM domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Endocytosis
total genus 27
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2009-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3idwA00
2ESEA 2EAPA 4NJ8A 5JU5A 2D3DA 1UCVA 1F0MA 1SXEA 2F44A 2KMDA 4NL9A 1LKYA 2D8CA 2E8MA 5J8YC 3BS5A 2EANA 2K60A 2L5YA 1LKYB 1SV0C 1WWVA 2B6GA 2KE7A 1B4FA 3BS5B 2F8KA 2FE9A 1V85A 2K4PA 3TACB 5JTIA 2DKXA 1DXSA 2QB0A 1SV4A 5J8YA 2KSOA 1B0XA 5F3XB 1KW4A 3IDWA 1SV0A 2E8PA 2LMRA 3HILA 2QB0B 4MHVA 2KSOB 5KNIA 3TADA 1JI7A 3BS7A 1SXDA 1OXJA 4PZNA 3KKAC 1WWUA 2QB1A 3K1RB 1SGGA 1PK1A 2YTUA 2QKQA 3SEIA 1PK1B 1PK3A 2ES6A 2KIVA 3SENA 1RG6A 2KG5A 2LPEA 2Y9TA 2EAMA 4NL9C 1UQVA 1COKA 4PZOA 4IS7A 3BQ7A 2EAOA 5L1MA 4RQNA 2Y9UA 2DKZA 2QARA 5JRTA 1X40A 2GLEA 3KKAA 1X66A 1Z1VA 2DL0A 3H8MA 4RQMA 2QARB 2F3NA 2E8OA 1X9XA 1OW5A 1V38A 2JV3A 2E8NA 3TADC
chains in the Genus database with same CATH superfamily
5L1IA 3FAHA 2I1QA 4YMOA 1QQ7A 3HRDD 2GO7A 3PSFA 3Q8KA 9ICQA 2BDPA 8ICIA 2JMGA 2XI9A 5BOMA 9ICMA 2CXYA 3BS5A 4OJPA 5J0PA 4E0DA 4CF3A 1ZRMA 1KKXA 5J29A 5AI0A 1FFUA 2BQRA 2ZJ8A 5KFAA 3TACB 3RJJA 5KTQA 3KHHA 5C0YA 5CRXA 2KSOA 4RT3A 1ZQHA 5DGAA 5DQGA 4K4GA 2LMRA 4RUCA 2ALZA 2ZIXB 3OSPA 5ALEA 4MF8A 2W3SA 1CI4A 4Y2YA 5J2HA 3PX4A 3IN5A 4J03A 2IOFA 4DLGA 5L1KA 4TUSA 4Y2TA 1WWUA 2OH2A 4BXOB 5KFMA 4YMMA 2HHWA 5HNKA 2BPGA 1CRXA 1X42A 1K1SA 3ISDA 2M9NA 5AI6A 1NK8A 3Q8RB 3LYSA 2WB1F 3F5AA 1ZQKA 3NRZA 1DK3A 5CA7A 4C8LA 1C20A 4G3IA 1X9WA 3RH6A 2YB1A 4YVZA 4UBBA 4O3RA 3TARA 4TQRA 4P0QB 4PZOA 3UMBA 1KEJA 3I1YA 1Z00B 3Q8QB 7ICKA 5ALDA 3ZI4A 1IXRA 3N4MB 2ZXIA 4KMUA 3RBDA 4Y2VA 1RYSA 2A1JA 2KZMA 2VKQA 2BHNA 3GQCA 3KHLA 4I2GA 2P6UA 4DOBA 4HAIA 5DLGA 4O3QA 1SXEA 1N63A 3C28A 4QIWF 3H8SA 4EENA 1SB3C 1WG8A 2L5YA 2F2AB 4FBTA 5AKEA 2F1IA 3NGDA 5GTIU 3RB4A 2BCRA 2H3ZA 1NK7A 2HBJA 1PVRA 3NASA 5AM0A 4O3OA 2YY6A 4O5CA 1SL1A 7ICHA 2QB0A 1WCLA 2RHFA 8ICYA 4XQ8A 3UQ2A 4JB3A 2Q4TA 2KKPA 3QU7A 4DL6A 3ED5A 3OJUA 2I9GA 1SL2A 7ICPA 2NRZA 1JIHA 2ZTDA 1RDFA 2YMMA 3RH5A 3GIIA 5KFNA 4A8EA 1NK9A 3JPSA 2ES6A 3T5HA 5J0YA 2BCVA 1ZQJA 3SD7A 3V7KA 5HHHA 4DF8A 2DWQA 3U26A 3WKAA 4AP9A 5J0UA 2Y1IA 4UAYA 2EZYA 4C8KA 9ICBA 2EAMA 2HVIA 5ALSA 2C28A 1ZQPA 1ZQXA 9ICGA 2H3IA 2F1JA 2BPCA 2YQEA 1XSPA 4KN4A 1ZQLA 3S6JA 2KKVA 2ISPA 3NS1A 3G6VA 3RR7A 1XSLA 3OTQA 4I27A 2Q0ZX 1N61A 2DPIA 3BZCA 4DFDA 5ALFA 4GXIA 2H3QA 4TQSA 4AYBC 3F2BA 1ZQSA 7ICIA 5KFIA 2XY7A 3PMLA 3F2DA 4FZLA 1Q8KA 5KG3A 4RQ7A 3PY8A 1ZQUA 1KL9A 2AQ0A 4C7ZA 1XSNA 2YB4A 1CUKA 2AGPA 4QZ8A 2CRXA 1LKYB 5ALNA 3BQ0A 4R8UA 1MA7A 4ACOA 1P7DA 5DKWA 8ICVA 4YCXA 4RPXA 1KBUA 2ZTEA 4DCCA 9ICJA 1B0XA 1NZPA 2DF4B 1XU4A 3IDWA 3AQEA 2E8PA 2HW3A 2XIDA 5GTHU 4DL4A 4EEKA 2LHTA 1QSYA 5TISU 1U49A 3C2LA 5AM5A 5DG8A 2QB1A 4RNNA 3SAHA 3OHBA 2WF6A 4QZFA 2JH7A 3N28A 5AKGA 4QW8A 4IQVA 3SENA 1A77A 3TI0A 2G5IB 4DOCA 4PGXA 5C5JA 2XC9A 2AHOB 1NKEA 2F8LA 4EBDA 1Q46A 1NK4A 2Y0SC 7ICLA 3MDCA 1BPYA 3IG8A 4QJFB 3N97B 4KLOA 2AU0A 1PVQA 4YG2A 5EE0A 3C21A 4QW9A 3VCBA 3AMZA 3MC1A 1AROP 5IIJA 5KT6A 5ALXA 5AM1A 3PW7A 2LYAA 3TFRA 1FIQA 1HUZA 4KLHA 2B0CA 3QNMA 4RQ8A 1X6IA 4ECRA 3HT3A 3UMCA 3HJEA 2HHXA 2KVSA 4Q44A 4F4KA 2KJ8A 2C22A 4UARA 1Y88A 1ZQNA 2KZZA 2F44A 3E2EA 1L8LA 3RB6A 4Y2UA 2C2RA 2HOFA 4GFJA 4OCZA 3PV8A 3SAGA 4Y2JA 5A0LA 3D2SA 1KFDA 1UA0A 3EW9A 5HMMA 2PI5A 3AL0B 5AKZA 4KLQA 3IHQB 3Q8LA 1U9LA 1BPXA 2HVHA 5ALGA 1QTMA 1Z1BA 4PZNA 2ZIVA 4I2IA 2P66A 4I29A 2KFNA 2KOBA 4DQQA 3M9MB 3D2NA 5J0SA 5IINA 2OXOA 4GC6A 5D4BA 2K8AA 4UBCA 2KIVA 4R63A 4MEXA 2YMLA 1ED1A 2LBOA 8ICEA 2ODGA 1QQ6A 4DL7A 5DQIA 5ALWA 2WAQF 3Q8PB 3PX0A 7ICGA 1H38A 4RQ0A 3B9JA 2HOIA 4KLMA 2CPRA 1UQVA 2EDUA 4KITB 2I6XA 1ZD2P 2XO7A 4KLJA 5KG4A 4Q8EA 1A6SA 2ATLA 4Z6FA 1RXWA 1ZQGA 5KFBA 3T5KA 1Z4NA 4JWNA 1X40A 8ICXA 2QARB 2GWSA 1L3TA 5DDMA 2R8IA 4P4MA 4XUSA 3B0XA 3GIKA 2ZIUB 4DO9A 4RQ5A 7ICJA 2RRDA 2DBYA 1VDVA 2LYHA 2A19A 2XY5A 1NK6A 3FDSA 2NO4A 5J8YC 2NRVA 2KICA 4O5EA 5KFQA 4ELTA 5KT3A 3CRXA 4QIWC 4O3MA 3BDPA 4IL6U 1JRPA 4ECWA 4ED6A 4Z6EA 5ALIA 4KLGA 1S5LU 4QWCA 2WFAA 2EQYA 9ICTA 2WF9A 4YR3A 2KZ3A 1L7NA 3WK6A 5G5HA 4EEYA 9ICCA 4FZMA 4FS1A 2KEYA 5CP2A 3FM9A 4DL2A 1D9FA 2A1AA 2KD1A 3C5FA 1SKWA 3HW8A 1WUDA 1BPDA 4BGDA 3DEEA 3QUCA 3T5JA 3H8JA 2R8KA 9ICUA 5AI4A 2VJ4A 1BNPA 3WK4A 1ZQMA 5AK3A 1ZD3A 3RJGA 1GO3F 1K1QA 5IIKA 2LPEA 3C23A 4F5NA 4RQ6A 5DG9A 4O3SA 2NO5A 3A0BU 4UAVA 5J2CA 2G06A 5TZVA 5B66U 3SI8A 1S0VA 1V97A 3HKZF 1U4BA 1L7OA 3MR3A 2FI1A 4ICAA 3HPOA 8ICZA 4M6WB 4RNMA 1NOMA 2GLEA 1IM4A 3KHRA 1ZD5A 4K4IA 2QLTA 4JMUA 3N7SC 3HWTA 3GV5B 4RQ1A 3HP6A 1PVPA 2HOQA 4KN7A 2E8NA 3WKCA 4DSKA 2EAPA 1Q3VA 3V72A 3GIMA 4OJOA 3ZD8A 4NY8A 5J2GA 1F0MA 2ZIWB 2W7PA 1J2NA 4UAWA 5KG0A 4MFFA 1C7YA 1D8BA 4ED1A 1T3QA 2W9BB 2W9CA 3JPNA 4DFMA 2W8KA 2DUYA 8ICQA 2DKXA 4C80A 2BQUA 2E5SA 2LI6A 4FBUA 4YD1A 4I2CA 3T5LA 4ED2A 1A0PA 1TV9A 4BDPA 4J9SA 2JEJA 3AM9A 4DS4A 1UHUA 2A3VA 1N56A 2R8HA 2W55A 4DL5A 1O03A 2H3VA 4J9QA 3WK7A 3JPPA 4PH5A 4ELUA 4C8MA 8ICUA 4QZHA 2KHQA 1SKSA 2HI0A 2W3RA 3WK8A 4Q8FA 2GH1A 5KG1A 1S77D 3KFUF 5KAFU 1TE2A 2E1FA 5D46A 2JZBA 2HHQA 4FZNA 3NTUA 2FLPA 5L1MA 5KFXA 4US8A 1ZQDA 2Y9UA 1JN3A 2MRLA 5JUMA 2H3FA 1RYRA 4NM2A 1N60A 2YMQA 4F92B 1B43A 1CEZA 3QZ7A 4MFAA 1MC8A 3EZ5A 4DL3A 1X9XA 2ZJ5A 3ZD9A 3AEVA 2N1RA 2E3TA 2AQ4A 4DFKA 4USAA 5DBCA 3CNHA 3PX6A 2MSNA 4O3NA 3KD3A 1BPBA 4B9VA 3CP8A 3SV3A 3C2KA 3UPQA 1BGXT 3RB0A 4UW9A 1N2XA 9ICRA 2XGPA 4IRKA 5J2JA 3RAXA 4CRXA 4QZIA 3IV6A 1LVHA 3BS5B 5DQHA 4OD0A 1NJWA 5KG7A 1QH9A 5KFSA 4F2SA 5AI8A 9ICPA 4YXMA 1KN5A 1Z19A 3L3FX 3RJEA 4GC7A 4ECUA 4RT2A 5KFFA 3LK9A 3ZDCA 2KSOB 4QZ9A 5KT2A 1JI7A 1OXJA 2KVCA 3EPGA 9ICVA 4F3OA 1SGGA 3KBBA 1KFTA 3QU5A 2D6FC 5DBAA 3OJSA 8ICCA 1PK3A 3MGHA 4DQRA 4BWJA 4DFPA 2MAXA 3IP4B 4J9RA 1U47A 4FO6A 1NK5A 1SZPA 2W8LA 4DS5A 1XNSA 5KG2A 4PJ0U 2WAQC 4P0PA 3FYHA 2G09A 4DEZA 5DB6A 3F2CA 5KFCA 1V9PA 5AKIA 4TUPA 5EOZA 3IRUA 5CHGA 5J2AA 3E58A 3PVXA 2W11A 1Z3EB 5CJ7A 1TK0A 4RQMA 3H8MA 3WU2U 2OYYA 4DWIA 5EE1A 2LYBA 2UVRA 4PHPA 4I28A 1OW5A 1SWWA 2A1JB 9ICKA 1X9SA 8ICKA 1TFRA 2ESEA 4NLKA 4EZ9A 1DGSA 4J9NA 4JWMA 5ALYA 3G6YA 2ASJA 4BJQA 4NL9A 4QZCA 5KFOA 2JHDA 4GXJA 3LVWA 4UB2A 2EANA 1ZQEA 2IA6A 4PHAA 5AKLA 2J6UA 4RPYA 2IHNA 5BOLA 3AU2A 3BQTA 1HJPA 3TAPA 3D2QA 4LJXA 1ZQRA 2ZUDA 1JROA 5JTIA 4J9KA 4RQ2A 1N5WA 3MR6A 4UB1A 4RQ3A 1SV0A 2JRZA 3HILA 4IR9A 2QB0B 3UXPA 5J0XA 4GIBA 1WYGA 4EX6A 4NWIA 4ECYA 4ZOHC 3L5KA 1VLBA 3MFHA 5KT4A 5L9XA 1NNLA 3RB3A 4F72A 8ICBA 8ICGA 1MN8A 1ZQZA 5EE3A 2KK0A 1RZTA 2PI4A 4I2AA 4G9BA 2WHEA 9ICEA 5IILA 7ICFA 3I28A 4P4PA 2K8CB 4Z6DA 8ICNA 3ETLA 5ALPA 4ED8A 2W54A 5J0TA 3GFKB 4M9HA 1NZBA 1PZNA 3MABA 5ALMA 4B6JA 2BCSA 4KLIA 5KT5A 4M9GA 4IS7A 4DSLA 2FJ6A 2BDUA 4J9OA 4Y2PA 4YQWA 1L5UA 2HSZA 2VANA 3TKAA 5F9LA 1NJZA 3HKZC 2JH1A 3SMVA 3PW5A 3C2MA 2UVVA 2F3NA 2VA3A 4C7YA 1J2MA 3CYMA 1ZQIA 5IIMA 2ZTCA 5ALKA 2G08A 1S0MA 1ZQCA 4NJ8A 4M9NA 8ICSA 3RAQA 4MEYA 4F91B 1KLNA 2KJ9A 4FS2A 1ZQAA 5CR0A 4C4SA 5IIOA 3K4GA 4M47A 1MSWD 4QWEA 4WJ3B 4KMOB 2Y1JA 3ALRA 4QWAA 2FPMA 2MUTA 4DF4A 2V9WA 1UA1A 4R8UB 1JALA 3OSNA 4R66A 5FP0A 1L3UA 3UMGA 3MFIA 3RJKA 1M6YA 3PSTA 4IQTA 5KFVA 1YZ7A 5KFHA 2BZFA 3BQ2A 2FPKA 4ECQA 2ASLA 3J81j 3H0MB 1PK1A 5EWEA 2YTUA 4CGZA 3GDXA 5J0OA 4ECTA 4I2JA 3SEIA 8ICPA 2XCPA 2WF5A 5K4LA 1COOA 5ALZA 1WCNA 1X2IA 3L4PA 3RTVA 7ICMA 3IM1A 2BCUA 3RH4A 4X5VA 4UASA 4IR1A 4DSFA 1QQ5A 4F71A 1ZQFA 3TANA 1JMSA 3QU2A 5J2BA 2YX8A 3TFSA 2E8OA 4NLNA 2BKEA 4IRCA 3PSPA 5EWGA 2XGQA 2AH5A 1DGJA 2K8BB 2V4RA 4MFCA 2ZG6A 4Y2RA 1S76D 5HMLA 5HHIA 4BUGA 4IQUA 4ECXA 2AJQA 2KMDA 1Q3UA 5BPCA 2NRTA 2BCQA 2UVUA 2R8JA 2NRWA 4XRHA 5EWFA 3RRGA 5IIIA 1T94A 4UQGA 3V7JA 2FLNA 2FE9A 1HEKA 4ECVA 4F5RA 3RRHA 4EBEA 1DXSA 2PMZF 1SV4A 1X9MA 2BGWA 4UB3A 3RBEA 1KFSA 4F5OA 3G6XA 4MHVA 3PO4A 5ALLA 1PUZA 2F1HA 4ED3A 5KNIA 2W7OA 3TQ1A 3TADA 3ONNA 4C8OA 1RM6C 3AN1A 2PKEA 5CWRA 3H7IA 1TVAA 5HR7A 4CF5A 4B9UA 4KLSA 1JXLA 5KFKA 3NVWA 5J2DA 2ZIVB 3EWAA 4U6PA 1L7PA 4NXZA 2JEIA 2HHTA 3JPRA 9ICXA 3ISBA 4US9A 4QZBA 4NL9C 9ICFA 4C0ZA 2FMPA 4F2RA 4C8NA 4M9JA 4PL2A 5B5EU 2FDRA 2VIXA 4KLUA 3QUBA 3GZFA 1ZQTA 7ICVA 2W43A 2W04A 1EXNA 1N48A 3PR4A 2KIWA 5AM2A 1BVSA 2WF8A 1X66A 3IG5A 4UB5A 2XY6A 1X6JA 3C5GA 3OHAA 1L3VA 5DDYA 3RR8A 4DFJA 2M0NA 4PHEA 5KFDA 1L7MA 5EE9A 1D8YA 4I2EA 4ZH4A 5JU5A 4JV1A 1UCVA 2C2DA 4F4WA 4YXJA 2PFNA 4OJ5A 3SV4A 5KAIU 3LWMA 2WF7A 3QU4A 1ZQVA 1KSPA 5DBBA 1Z4OA 3Q8MA 3QUTA 3PNCA 3V6KA 4EELA 5AI9A 2G5HB 3WKDA 4DQSA 3RF9A 2ZIXA 1U45A 3H4BA 4J9MA 3QUQA 2HBKA 2OEHA 2W9MA 3K1ZA 2HBLA 4QZGA 4ED0A 4PPXA 2HHUA 5AKHA 2IBKA 4Y2XA 3M8SA 1XC9A 4BXOA 2R18A 5G5GA 1B22A 2G07A 2NYVA 4TURA 1T3NA 3RJIA 3PSIA 2H5XA 2MU2A 9ICSA 4PL1A 4KLDA 3Q8SB 5KL1B 7ICEA 7ICNA 9ICNA 2HBMA 7ICQA 4UB8U 4PGYA 3WKBA 3LDAA 4P0QA 8ICAA 4RUAA 3O0FA 1ZQYA 4QZDA 3SYZA 5KFPA 1Z00A 3M8RA 2ZUCA 3GU3A 3AU6A 3BJYA 3MR2A 2OHFA 3BQ1A 4JUZA 3VC8A 1MQ3A 3PR5B 3FC4A 2VA2A 5AM3A 3KKAA 4K4HA 1MQ2A 1YZ6A 4B9LA 3QE9Y 4O0IA 1QLNA 7ICRA 1TAUA 2UVWA 2W9AA 4PHDA 4LZDA 3H40A 1IV8A 4CCHA 3PZPA 4CNQA 5KFGA 2K4EA 5E79U 3UXOA 2EH9A 2E8MA 4UAZA 2K60A 1JUDA 3M7DA 4RNOA 1QCKA 7ICSA 4B9TA 1WWVA 1ZRNA 4C4RA 2IHMA 5DB7A 2F8KA 4F4XA 3R9KA 4B9NA 9ICLA 2JEGA 2JEFA 1F5SA 2W9CB 1ZOLA 7ICUA 5L1LA 5AHXA 3ZDDA 1KW4A 5KG5A 5ALUA 1U48A 3ZDAA 4TUQA 1SXDA 4F93B 4DQIA 5J0WA 5AM4A 1ZQBA 1NJYA 3M6KA 4JV0A 4LZGA 1ZQQA 2QKQA 4UB6U 3UM9A 3C1YA 8ICLA 2G0AA 2KG5A 4F4ZA 3PW4A 4JK1A 2IOHA 2JGAA 4YFKA 3OGUA 2DGZA 1NK0A 2DPJA 3BQ7A 1BPEA 1TAQA 5DB8A 2RLTA 4O3PA 1DRGA 2JZBB 1ZD4A 2FMSA 4P2HA 5KFWA 4P4OA 2HHVA 1NKBA 4QWBA 4NLCA 4O9MA 2YN4A 4RU9A 5J2FA 5AIBA 1SWVA 2PFOA 4NLBA 5ALOA 3GV7B 3TADC 1S0NA 3DDHA 3SQIA 3WKEA 3EYZA 4FE3A 1NKCA 2D3DA 5J2KA 2MA1A 2E1EA 3H8WA 2GOLA 4HYKA 2BPFA 4QZAA 1LKYA 2IOFK 5KL8B 3UXNA 4Y2QA 2KNJA 1FO4A 1B4FA 2V4QA 1OUQA 4KLLA 1V85A 3TAQA 4EX7A 3GV8B 5J8YA 9ICIA 1KDHA 3T79A 8ICHA 4M0AA 3AQFA 5J2EA 2KP7A 2PMZC 3PW0A 1S9FA 3NVVA 2JR5A 1N62A 3PMNA 1RQLA 4YD2A 1T7PA 2PFQA 2KFZA 3NRWA 3JPOA 8ICWA 4NLZA 4R65A 4IC9A 4DSIA 3KZXA 1RPLA 2AGQA 2FMQA 7ICOA 3M6ZA 1AQ6A 3KOOA 3JPTA 1KTQA 1D9DA 1SZHA 2P35A 1L6NA 4KX5A 1COKA 4ELVA 4IQWA 1SIJA 2NV3A 2J6TA 4DLEA 5ALRA 2EAOA 2W03A 3BZKA 1SKRA 4CDGA 3N7RC 2F76X 1LB2B 4FFDA 4CE6A 4P0PB 5JRTA 1QSSA 3WK9A 2DL0A 2DFLA 4OJLA 4EBCA 1XO0A 4DOAA 3QU9A 4UAUA 4ED7A 1J97A 1RYUA 5ALHA 3M9NB 3THVA 1TK8A 1ZXIA 5HP4A 3HX0A 3SAFA 1UT5A 2O6KA 4F5PA 3ISCA 3QXGA 5HR6A 3LVVA 1ZETA 3N7PD 3D6JA 5AKJA 4YN4A 3DV9A 1T4GA 3ZDEA 2B6GA 1JXEA 4OJ6A 2ZXHA 3KTQA 9ICOA 4MF2A 1ZJNA 2KTQA 4DSJA 4O5KA 5H2FU 4I2FA 1IIPA 5KFEA 4RPZA 3LWLA 4GXKA 8ICJA 4RZRA 2ZJAA 4B9SA 2FPLA 1ZQWA 4KLEA 3KKAC 4GLXA 3MDAA 4Y2SA 2EZXA 5DG7A 3QEAZ 2JXJA 1S97A 5KFLA 4R64A 5AKXA 1ECWA 5AK6A 4KLFA 1RG6A 2LM1A 2C2EA 1JX4A 2IMWP 4LVSA 2K4HA 1SL0A 1IG6A 1ZYQA 5CEHA 2ISOA 7ICTA 5ALQA 3NVYA 4ECSA 1HUOA 2AGOA 4NV0A 3V7LA 3MBYA 1KRPA 4C4TA 1TAMA 1NI3A 4F50A 4I2BA 2QARA 5AK4A 5AK5A 4CF4A 1UPHA 4IRDA 5KFUA 2PFPA 5KT7A 3UQ0A 1KQQA 4YR2A 3H0LB 5ALTA 5DGBA 1ZQOA 2ZIUA 3RJFA 2OM6A 1N5XA 1A76A 1BNOA 2RDJA 2OWOA 4RQ4A 1RQNA 3NUQA 4BX9C 5AKYA 4M04A 4F5QA 4M2YA 4DSEA 2WTFA 3I76A 1L3SA 9ICAA 2D8CA 2RQ5A 2XICA 9ICHA 1URJA 3RFAA 1L8OA 4J9LA 1XO1A 8ICMA 3C29A 1YT3A 4Z6CA 2KE7A 8ICOA 3GIJA 4YP3A 1K5OA 3C1ZA 3JPQA 3CW2C 5AIAA 3WK5A 1LV5A 1HIWA 5F3XB 2MUTB 4YR0A 1BPZA 5L1JA 2J6SA 2NRXA 3H0RB 5AI5A 2RP5A 2LM4A 1XS9D 2WB1C 3B0YA 3K1RB 3NVZA 3E0FA 1S0OA 4M9LA 3T3FA 2YMPA 2AXTU 4DQPA 2KV2A 2ASDA 1O08A 1F44A 1PK1B 4EYHB 1RXVA 3F53A 1UT8A 2HMXA 2BQ3A 1S10A 1DOQA 2FLLA 3MR5A 4KTQA 3EPIA 2Y9TA 3KHGA 3M9OB 1FFVA 4Q45A 3ETRA 3AUOA 2EZZA 9ICWA 4M6WA 1XWLA 3ZDBA 2KN7A 4RQNA 3SR6A 2KJ5A 2F77X 4PGQA 4Q43A 2DKZA 5D49A 2PXIA 3EUB2 5J2IA 4AYBF 1FEZA 4XA5A 1Z1VA 8ICFA 3PW2A 3GILA 5ALJA 2ZUBA 4EZ6A 2JV3A 4KX3A 5F9NA 3M1YA 2ZIWA 4YMNA 3V6HA 3OPXA 4F4YA 2B21A 1DK2A 5T14A 5KFRA 2LKYA 2HCFA 8ICRA 5J0QA 2W9BA 4ECZA 1TKDA 5DLFA 3MGIA 1SV0C 3QEBZ 2K4IA 2XCAA 4UB4A 2KHVA 2K4PA 4U7CA 2Z7JA 3KZIU 1VJ5A 3H4DA 2DQNB 3ICXA 3ORYA 2BR0A 4JV2A 2CN1A 1TK5A 4QWDA 3BS7A 2K89A 4I2DA 1ZQ1C 4QNLA 4QZEA 3PO5A 3F5EA 1ZJMA 4J9PA 2HHSA 4I2HA 3QX7A 5AICA 3QYPA 5AKKA 2R8GA 2HDOA 5KG6A 5KFZA 1T8EA 2Y0SF 2VA8A 3QZ8A 3V6JA 4OO1J 4NM1A 5KFYA 4UATA 1QSLA 5CB1A 5J0RA 3RJHA 4NLGA 1D8LA 4EYIB 1S8OA 1NJXA 3MGVA 8ICTA 2RDIA 4B9MA 2OCEA 3SZ2A 5KFTA 4KLTA 3A0HU 4F8RA 5DB9A 4BWMA 5ALVA 2I5HA 3K75D 1V38A 2P6RA 2XVTA 2VJ5A 5KFJA
chains in the Genus database with same CATH topology
2ESEA 2EAPA 4NJ8A 5JU5A 2D3DA 1UCVA 1F0MA 1SXEA 2F44A 2KMDA 4NL9A 1LKYA 2D8CA 2E8MA 5J8YC 3BS5A 2EANA 2K60A 2L5YA 1LKYB 1SV0C 1WWVA 2B6GA 2KE7A 1B4FA 3BS5B 2F8KA 2FE9A 1V85A 2K4PA 3TACB 5JTIA 2DKXA 1DXSA 2QB0A 1SV4A 5J8YA 2KSOA 1B0XA 5F3XB 1KW4A 3IDWA 1SV0A 2E8PA 2LMRA 3HILA 2QB0B 4MHVA 2KSOB 5KNIA 3TADA 1JI7A 3BS7A 1SXDA 1OXJA 4PZNA 3KKAC 1WWUA 2QB1A 3K1RB 1SGGA 1PK1A 2YTUA 2QKQA 3SEIA 1PK1B 1PK3A 2ES6A 2KIVA 3SENA 1RG6A 2KG5A 2LPEA 2Y9TA 2EAMA 4NL9C 1UQVA 1COKA 4PZOA 4IS7A 3BQ7A 2EAOA 5L1MA 4RQNA 2Y9UA 2DKZA 2QARA 5JRTA 1X40A 2GLEA 3KKAA 1X66A 1Z1VA 2DL0A 3H8MA 4RQMA 2QARB 2F3NA 2E8OA 1X9XA 1OW5A 1V38A 2JV3A 2E8NA 3TADC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ESE A;  2EAP A;  4NJ8 A;  5JU5 A;  2D3D A;  1UCV A;  1F0M A;  1SXE A;  2F44 A;  2KMD A;  4NL9 A;  1LKY A;  2D8C A;  2E8M A;  5J8Y C;  3BS5 A;  2EAN A;  2K60 A;  2L5Y A;  1LKY B;  1SV0 C;  1WWV A;  2B6G A;  2KE7 A;  1B4F A;  3BS5 B;  2F8K A;  2FE9 A;  1V85 A;  2K4P A;  3TAC B;  5JTI A;  2DKX A;  1DXS A;  2QB0 A;  1SV4 A;  5J8Y A;  2KSO A;  1B0X A;  5F3X B;  1KW4 A;  3IDW A;  1SV0 A;  2E8P A;  2LMR A;  3HIL A;  2QB0 B;  4MHV A;  2KSO B;  5KNI A;  3TAD A;  1JI7 A;  3BS7 A;  1SXD A;  1OXJ A;  4PZN A;  3KKA C;  1WWU A;  2QB1 A;  3K1R B;  1SGG A;  1PK1 A;  2YTU A;  2QKQ A;  3SEI A;  1PK1 B;  1PK3 A;  2ES6 A;  2KIV A;  3SEN A;  1RG6 A;  2KG5 A;  2LPE A;  2Y9T A;  2EAM A;  4NL9 C;  1UQV A;  1COK A;  4PZO A;  4IS7 A;  3BQ7 A;  2EAO A;  5L1M A;  4RQN A;  2Y9U A;  2DKZ A;  2QAR A;  5JRT A;  1X40 A;  2GLE A;  3KKA A;  1X66 A;  1Z1V A;  2DL0 A;  3H8M A;  4RQM A;  2QAR B;  2F3N A;  2E8O A;  1X9X A;  1OW5 A;  1V38 A;  2JV3 A;  2E8N A;  3TAD C; 
#chains in the Genus database with same CATH topology
 5L1I A;  3FAH A;  2I1Q A;  4YMO A;  1QQ7 A;  3HRD D;  2GO7 A;  3PSF A;  3Q8K A;  9ICQ A;  2BDP A;  8ICI A;  2JMG A;  2XI9 A;  5BOM A;  9ICM A;  2CXY A;  3BS5 A;  4OJP A;  5J0P A;  4E0D A;  4CF3 A;  1ZRM A;  1KKX A;  5J29 A;  5AI0 A;  1FFU A;  2BQR A;  2ZJ8 A;  5KFA A;  3TAC B;  3RJJ A;  5KTQ A;  3KHH A;  5C0Y A;  5CRX A;  2KSO A;  4RT3 A;  1ZQH A;  5DGA A;  5DQG A;  4K4G A;  2LMR A;  4RUC A;  2ALZ A;  2ZIX B;  3OSP A;  5ALE A;  4MF8 A;  2W3S A;  1CI4 A;  4Y2Y A;  5J2H A;  3PX4 A;  3IN5 A;  4J03 A;  2IOF A;  4DLG A;  5L1K A;  4TUS A;  4Y2T A;  1WWU A;  2OH2 A;  4BXO B;  5KFM A;  4YMM A;  2HHW A;  5HNK A;  2BPG A;  1CRX A;  1X42 A;  1K1S A;  3ISD A;  2M9N A;  5AI6 A;  1NK8 A;  3Q8R B;  3LYS A;  2WB1 F;  3F5A A;  1ZQK A;  3NRZ A;  1DK3 A;  5CA7 A;  4C8L A;  1C20 A;  4G3I A;  1X9W A;  3RH6 A;  2YB1 A;  4YVZ A;  4UBB A;  4O3R A;  3TAR A;  4TQR A;  4P0Q B;  4PZO A;  3UMB A;  1KEJ A;  3I1Y A;  1Z00 B;  3Q8Q B;  7ICK A;  5ALD A;  3ZI4 A;  1IXR A;  3N4M B;  2ZXI A;  4KMU A;  3RBD A;  4Y2V A;  1RYS A;  2A1J A;  2KZM A;  2VKQ A;  2BHN A;  3GQC A;  3KHL A;  4I2G A;  2P6U A;  4DOB A;  4HAI A;  5DLG A;  4O3Q A;  1SXE A;  1N63 A;  3C28 A;  4QIW F;  3H8S A;  4EEN A;  1SB3 C;  1WG8 A;  2L5Y A;  2F2A B;  4FBT A;  5AKE A;  2F1I A;  3NGD A;  5GTI U;  3RB4 A;  2BCR A;  2H3Z A;  1NK7 A;  2HBJ A;  1PVR A;  3NAS A;  5AM0 A;  4O3O A;  2YY6 A;  4O5C A;  1SL1 A;  7ICH A;  2QB0 A;  1WCL A;  2RHF A;  8ICY A;  4XQ8 A;  3UQ2 A;  4JB3 A;  2Q4T A;  2KKP A;  3QU7 A;  4DL6 A;  3ED5 A;  3OJU A;  2I9G A;  1SL2 A;  7ICP A;  2NRZ A;  1JIH A;  2ZTD A;  1RDF A;  2YMM A;  3RH5 A;  3GII A;  5KFN A;  4A8E A;  1NK9 A;  3JPS A;  2ES6 A;  3T5H A;  5J0Y A;  2BCV A;  1ZQJ A;  3SD7 A;  3V7K A;  5HHH A;  4DF8 A;  2DWQ A;  3U26 A;  3WKA A;  4AP9 A;  5J0U A;  2Y1I A;  4UAY A;  2EZY A;  4C8K A;  9ICB A;  2EAM A;  2HVI A;  5ALS A;  2C28 A;  1ZQP A;  1ZQX A;  9ICG A;  2H3I A;  2F1J A;  2BPC A;  2YQE A;  1XSP A;  4KN4 A;  1ZQL A;  3S6J A;  2KKV A;  2ISP A;  3NS1 A;  3G6V A;  3RR7 A;  1XSL A;  3OTQ A;  4I27 A;  2Q0Z X;  1N61 A;  2DPI A;  3BZC A;  4DFD A;  5ALF A;  4GXI A;  2H3Q A;  4TQS A;  4AYB C;  3F2B A;  1ZQS A;  7ICI A;  5KFI A;  2XY7 A;  3PML A;  3F2D A;  4FZL A;  1Q8K A;  5KG3 A;  4RQ7 A;  3PY8 A;  1ZQU A;  1KL9 A;  2AQ0 A;  4C7Z A;  1XSN A;  2YB4 A;  1CUK A;  2AGP A;  4QZ8 A;  2CRX A;  1LKY B;  5ALN A;  3BQ0 A;  4R8U A;  1MA7 A;  4ACO A;  1P7D A;  5DKW A;  8ICV A;  4YCX A;  4RPX A;  1KBU A;  2ZTE A;  4DCC A;  9ICJ A;  1B0X A;  1NZP A;  2DF4 B;  1XU4 A;  3IDW A;  3AQE A;  2E8P A;  2HW3 A;  2XID A;  5GTH U;  4DL4 A;  4EEK A;  2LHT A;  1QSY A;  5TIS U;  1U49 A;  3C2L A;  5AM5 A;  5DG8 A;  2QB1 A;  4RNN A;  3SAH A;  3OHB A;  2WF6 A;  4QZF A;  2JH7 A;  3N28 A;  5AKG A;  4QW8 A;  4IQV A;  3SEN A;  1A77 A;  3TI0 A;  2G5I B;  4DOC A;  4PGX A;  5C5J A;  2XC9 A;  2AHO B;  1NKE A;  2F8L A;  4EBD A;  1Q46 A;  1NK4 A;  2Y0S C;  7ICL A;  3MDC A;  1BPY A;  3IG8 A;  4QJF B;  3N97 B;  4KLO A;  2AU0 A;  1PVQ A;  4YG2 A;  5EE0 A;  3C21 A;  4QW9 A;  3VCB A;  3AMZ A;  3MC1 A;  1ARO P;  5IIJ A;  5KT6 A;  5ALX A;  5AM1 A;  3PW7 A;  2LYA A;  3TFR A;  1FIQ A;  1HUZ A;  4KLH A;  2B0C A;  3QNM A;  4RQ8 A;  1X6I A;  4ECR A;  3HT3 A;  3UMC A;  3HJE A;  2HHX A;  2KVS A;  4Q44 A;  4F4K A;  2KJ8 A;  2C22 A;  4UAR A;  1Y88 A;  1ZQN A;  2KZZ A;  2F44 A;  3E2E A;  1L8L A;  3RB6 A;  4Y2U A;  2C2R A;  2HOF A;  4GFJ A;  4OCZ A;  3PV8 A;  3SAG A;  4Y2J A;  5A0L A;  3D2S A;  1KFD A;  1UA0 A;  3EW9 A;  5HMM A;  2PI5 A;  3AL0 B;  5AKZ A;  4KLQ A;  3IHQ B;  3Q8L A;  1U9L A;  1BPX A;  2HVH A;  5ALG A;  1QTM A;  1Z1B A;  4PZN A;  2ZIV A;  4I2I A;  2P66 A;  4I29 A;  2KFN A;  2KOB A;  4DQQ A;  3M9M B;  3D2N A;  5J0S A;  5IIN A;  2OXO A;  4GC6 A;  5D4B A;  2K8A A;  4UBC A;  2KIV A;  4R63 A;  4MEX A;  2YML A;  1ED1 A;  2LBO A;  8ICE A;  2ODG A;  1QQ6 A;  4DL7 A;  5DQI A;  5ALW A;  2WAQ F;  3Q8P B;  3PX0 A;  7ICG A;  1H38 A;  4RQ0 A;  3B9J A;  2HOI A;  4KLM A;  2CPR A;  1UQV A;  2EDU A;  4KIT B;  2I6X A;  1ZD2 P;  2XO7 A;  4KLJ A;  5KG4 A;  4Q8E A;  1A6S A;  2ATL A;  4Z6F A;  1RXW A;  1ZQG A;  5KFB A;  3T5K A;  1Z4N A;  4JWN A;  1X40 A;  8ICX A;  2QAR B;  2GWS A;  1L3T A;  5DDM A;  2R8I A;  4P4M A;  4XUS A;  3B0X A;  3GIK A;  2ZIU B;  4DO9 A;  4RQ5 A;  7ICJ A;  2RRD A;  2DBY A;  1VDV A;  2LYH A;  2A19 A;  2XY5 A;  1NK6 A;  3FDS A;  2NO4 A;  5J8Y C;  2NRV A;  2KIC A;  4O5E A;  5KFQ A;  4ELT A;  5KT3 A;  3CRX A;  4QIW C;  4O3M A;  3BDP A;  4IL6 U;  1JRP A;  4ECW A;  4ED6 A;  4Z6E A;  5ALI A;  4KLG A;  1S5L U;  4QWC A;  2WFA A;  2EQY A;  9ICT A;  2WF9 A;  4YR3 A;  2KZ3 A;  1L7N A;  3WK6 A;  5G5H A;  4EEY A;  9ICC A;  4FZM A;  4FS1 A;  2KEY A;  5CP2 A;  3FM9 A;  4DL2 A;  1D9F A;  2A1A A;  2KD1 A;  3C5F A;  1SKW A;  3HW8 A;  1WUD A;  1BPD A;  4BGD A;  3DEE A;  3QUC A;  3T5J A;  3H8J A;  2R8K A;  9ICU A;  5AI4 A;  2VJ4 A;  1BNP A;  3WK4 A;  1ZQM A;  5AK3 A;  1ZD3 A;  3RJG A;  1GO3 F;  1K1Q A;  5IIK A;  2LPE A;  3C23 A;  4F5N A;  4RQ6 A;  5DG9 A;  4O3S A;  2NO5 A;  3A0B U;  4UAV A;  5J2C A;  2G06 A;  5TZV A;  5B66 U;  3SI8 A;  1S0V A;  1V97 A;  3HKZ F;  1U4B A;  1L7O A;  3MR3 A;  2FI1 A;  4ICA A;  3HPO A;  8ICZ A;  4M6W B;  4RNM A;  1NOM A;  2GLE A;  1IM4 A;  3KHR A;  1ZD5 A;  4K4I A;  2QLT A;  4JMU A;  3N7S C;  3HWT A;  3GV5 B;  4RQ1 A;  3HP6 A;  1PVP A;  2HOQ A;  4KN7 A;  2E8N A;  3WKC A;  4DSK A;  2EAP A;  1Q3V A;  3V72 A;  3GIM A;  4OJO A;  3ZD8 A;  4NY8 A;  5J2G A;  1F0M A;  2ZIW B;  2W7P A;  1J2N A;  4UAW A;  5KG0 A;  4MFF A;  1C7Y A;  1D8B A;  4ED1 A;  1T3Q A;  2W9B B;  2W9C A;  3JPN A;  4DFM A;  2W8K A;  2DUY A;  8ICQ A;  2DKX A;  4C80 A;  2BQU A;  2E5S A;  2LI6 A;  4FBU A;  4YD1 A;  4I2C A;  3T5L A;  4ED2 A;  1A0P A;  1TV9 A;  4BDP A;  4J9S A;  2JEJ A;  3AM9 A;  4DS4 A;  1UHU A;  2A3V A;  1N56 A;  2R8H A;  2W55 A;  4DL5 A;  1O03 A;  2H3V A;  4J9Q A;  3WK7 A;  3JPP A;  4PH5 A;  4ELU A;  4C8M A;  8ICU A;  4QZH A;  2KHQ A;  1SKS A;  2HI0 A;  2W3R A;  3WK8 A;  4Q8F A;  2GH1 A;  5KG1 A;  1S77 D;  3KFU F;  5KAF U;  1TE2 A;  2E1F A;  5D46 A;  2JZB A;  2HHQ A;  4FZN A;  3NTU A;  2FLP A;  5L1M A;  5KFX A;  4US8 A;  1ZQD A;  2Y9U A;  1JN3 A;  2MRL A;  5JUM A;  2H3F A;  1RYR A;  4NM2 A;  1N60 A;  2YMQ A;  4F92 B;  1B43 A;  1CEZ A;  3QZ7 A;  4MFA A;  1MC8 A;  3EZ5 A;  4DL3 A;  1X9X A;  2ZJ5 A;  3ZD9 A;  3AEV A;  2N1R A;  2E3T A;  2AQ4 A;  4DFK A;  4USA A;  5DBC A;  3CNH A;  3PX6 A;  2MSN A;  4O3N A;  3KD3 A;  1BPB A;  4B9V A;  3CP8 A;  3SV3 A;  3C2K A;  3UPQ A;  1BGX T;  3RB0 A;  4UW9 A;  1N2X A;  9ICR A;  2XGP A;  4IRK A;  5J2J A;  3RAX A;  4CRX A;  4QZI A;  3IV6 A;  1LVH A;  3BS5 B;  5DQH A;  4OD0 A;  1NJW A;  5KG7 A;  1QH9 A;  5KFS A;  4F2S A;  5AI8 A;  9ICP A;  4YXM A;  1KN5 A;  1Z19 A;  3L3F X;  3RJE A;  4GC7 A;  4ECU A;  4RT2 A;  5KFF A;  3LK9 A;  3ZDC A;  2KSO B;  4QZ9 A;  5KT2 A;  1JI7 A;  1OXJ A;  2KVC A;  3EPG A;  9ICV A;  4F3O A;  1SGG A;  3KBB A;  1KFT A;  3QU5 A;  2D6F C;  5DBA A;  3OJS A;  8ICC A;  1PK3 A;  3MGH A;  4DQR A;  4BWJ A;  4DFP A;  2MAX A;  3IP4 B;  4J9R A;  1U47 A;  4FO6 A;  1NK5 A;  1SZP A;  2W8L A;  4DS5 A;  1XNS A;  5KG2 A;  4PJ0 U;  2WAQ C;  4P0P A;  3FYH A;  2G09 A;  4DEZ A;  5DB6 A;  3F2C A;  5KFC A;  1V9P A;  5AKI A;  4TUP A;  5EOZ A;  3IRU A;  5CHG A;  5J2A A;  3E58 A;  3PVX A;  2W11 A;  1Z3E B;  5CJ7 A;  1TK0 A;  4RQM A;  3H8M A;  3WU2 U;  2OYY A;  4DWI A;  5EE1 A;  2LYB A;  2UVR A;  4PHP A;  4I28 A;  1OW5 A;  1SWW A;  2A1J B;  9ICK A;  1X9S A;  8ICK A;  1TFR A;  2ESE A;  4NLK A;  4EZ9 A;  1DGS A;  4J9N A;  4JWM A;  5ALY A;  3G6Y A;  2ASJ A;  4BJQ A;  4NL9 A;  4QZC A;  5KFO A;  2JHD A;  4GXJ A;  3LVW A;  4UB2 A;  2EAN A;  1ZQE A;  2IA6 A;  4PHA A;  5AKL A;  2J6U A;  4RPY A;  2IHN A;  5BOL A;  3AU2 A;  3BQT A;  1HJP A;  3TAP A;  3D2Q A;  4LJX A;  1ZQR A;  2ZUD A;  1JRO A;  5JTI A;  4J9K A;  4RQ2 A;  1N5W A;  3MR6 A;  4UB1 A;  4RQ3 A;  1SV0 A;  2JRZ A;  3HIL A;  4IR9 A;  2QB0 B;  3UXP A;  5J0X A;  4GIB A;  1WYG A;  4EX6 A;  4NWI A;  4ECY A;  4ZOH C;  3L5K A;  1VLB A;  3MFH A;  5KT4 A;  5L9X A;  1NNL A;  3RB3 A;  4F72 A;  8ICB A;  8ICG A;  1MN8 A;  1ZQZ A;  5EE3 A;  2KK0 A;  1RZT A;  2PI4 A;  4I2A A;  4G9B A;  2WHE A;  9ICE A;  5IIL A;  7ICF A;  3I28 A;  4P4P A;  2K8C B;  4Z6D A;  8ICN A;  3ETL A;  5ALP A;  4ED8 A;  2W54 A;  5J0T A;  3GFK B;  4M9H A;  1NZB A;  1PZN A;  3MAB A;  5ALM A;  4B6J A;  2BCS A;  4KLI A;  5KT5 A;  4M9G A;  4IS7 A;  4DSL A;  2FJ6 A;  2BDU A;  4J9O A;  4Y2P A;  4YQW A;  1L5U A;  2HSZ A;  2VAN A;  3TKA A;  5F9L A;  1NJZ A;  3HKZ C;  2JH1 A;  3SMV A;  3PW5 A;  3C2M A;  2UVV A;  2F3N A;  2VA3 A;  4C7Y A;  1J2M A;  3CYM A;  1ZQI A;  5IIM A;  2ZTC A;  5ALK A;  2G08 A;  1S0M A;  1ZQC A;  4NJ8 A;  4M9N A;  8ICS A;  3RAQ A;  4MEY A;  4F91 B;  1KLN A;  2KJ9 A;  4FS2 A;  1ZQA A;  5CR0 A;  4C4S A;  5IIO A;  3K4G A;  4M47 A;  1MSW D;  4QWE A;  4WJ3 B;  4KMO B;  2Y1J A;  3ALR A;  4QWA A;  2FPM A;  2MUT A;  4DF4 A;  2V9W A;  1UA1 A;  4R8U B;  1JAL A;  3OSN A;  4R66 A;  5FP0 A;  1L3U A;  3UMG A;  3MFI A;  3RJK A;  1M6Y A;  3PST A;  4IQT A;  5KFV A;  1YZ7 A;  5KFH A;  2BZF A;  3BQ2 A;  2FPK A;  4ECQ A;  2ASL A;  3J81 j;  3H0M B;  1PK1 A;  5EWE A;  2YTU A;  4CGZ A;  3GDX A;  5J0O A;  4ECT A;  4I2J A;  3SEI A;  8ICP A;  2XCP A;  2WF5 A;  5K4L A;  1COO A;  5ALZ A;  1WCN A;  1X2I A;  3L4P A;  3RTV A;  7ICM A;  3IM1 A;  2BCU A;  3RH4 A;  4X5V A;  4UAS A;  4IR1 A;  4DSF A;  1QQ5 A;  4F71 A;  1ZQF A;  3TAN A;  1JMS A;  3QU2 A;  5J2B A;  2YX8 A;  3TFS A;  2E8O A;  4NLN A;  2BKE A;  4IRC A;  3PSP A;  5EWG A;  2XGQ A;  2AH5 A;  1DGJ A;  2K8B B;  2V4R A;  4MFC A;  2ZG6 A;  4Y2R A;  1S76 D;  5HML A;  5HHI A;  4BUG A;  4IQU A;  4ECX A;  2AJQ A;  2KMD A;  1Q3U A;  5BPC A;  2NRT A;  2BCQ A;  2UVU A;  2R8J A;  2NRW A;  4XRH A;  5EWF A;  3RRG A;  5III A;  1T94 A;  4UQG A;  3V7J A;  2FLN A;  2FE9 A;  1HEK A;  4ECV A;  4F5R A;  3RRH A;  4EBE A;  1DXS A;  2PMZ F;  1SV4 A;  1X9M A;  2BGW A;  4UB3 A;  3RBE A;  1KFS A;  4F5O A;  3G6X A;  4MHV A;  3PO4 A;  5ALL A;  1PUZ A;  2F1H A;  4ED3 A;  5KNI A;  2W7O A;  3TQ1 A;  3TAD A;  3ONN A;  4C8O A;  1RM6 C;  3AN1 A;  2PKE A;  5CWR A;  3H7I A;  1TVA A;  5HR7 A;  4CF5 A;  4B9U A;  4KLS A;  1JXL A;  5KFK A;  3NVW A;  5J2D A;  2ZIV B;  3EWA A;  4U6P A;  1L7P A;  4NXZ A;  2JEI A;  2HHT A;  3JPR A;  9ICX A;  3ISB A;  4US9 A;  4QZB A;  4NL9 C;  9ICF A;  4C0Z A;  2FMP A;  4F2R A;  4C8N A;  4M9J A;  4PL2 A;  5B5E U;  2FDR A;  2VIX A;  4KLU A;  3QUB A;  3GZF A;  1ZQT A;  7ICV A;  2W43 A;  2W04 A;  1EXN A;  1N48 A;  3PR4 A;  2KIW A;  5AM2 A;  1BVS A;  2WF8 A;  1X66 A;  3IG5 A;  4UB5 A;  2XY6 A;  1X6J A;  3C5G A;  3OHA A;  1L3V A;  5DDY A;  3RR8 A;  4DFJ A;  2M0N A;  4PHE A;  5KFD A;  1L7M A;  5EE9 A;  1D8Y A;  4I2E A;  4ZH4 A;  5JU5 A;  4JV1 A;  1UCV A;  2C2D A;  4F4W A;  4YXJ A;  2PFN A;  4OJ5 A;  3SV4 A;  5KAI U;  3LWM A;  2WF7 A;  3QU4 A;  1ZQV A;  1KSP A;  5DBB A;  1Z4O A;  3Q8M A;  3QUT A;  3PNC A;  3V6K A;  4EEL A;  5AI9 A;  2G5H B;  3WKD A;  4DQS A;  3RF9 A;  2ZIX A;  1U45 A;  3H4B A;  4J9M A;  3QUQ A;  2HBK A;  2OEH A;  2W9M A;  3K1Z A;  2HBL A;  4QZG A;  4ED0 A;  4PPX A;  2HHU A;  5AKH A;  2IBK A;  4Y2X A;  3M8S A;  1XC9 A;  4BXO A;  2R18 A;  5G5G A;  1B22 A;  2G07 A;  2NYV A;  4TUR A;  1T3N A;  3RJI A;  3PSI A;  2H5X A;  2MU2 A;  9ICS A;  4PL1 A;  4KLD A;  3Q8S B;  5KL1 B;  7ICE A;  7ICN A;  9ICN A;  2HBM A;  7ICQ A;  4UB8 U;  4PGY A;  3WKB A;  3LDA A;  4P0Q A;  8ICA A;  4RUA A;  3O0F A;  1ZQY A;  4QZD A;  3SYZ A;  5KFP A;  1Z00 A;  3M8R A;  2ZUC A;  3GU3 A;  3AU6 A;  3BJY A;  3MR2 A;  2OHF A;  3BQ1 A;  4JUZ A;  3VC8 A;  1MQ3 A;  3PR5 B;  3FC4 A;  2VA2 A;  5AM3 A;  3KKA A;  4K4H A;  1MQ2 A;  1YZ6 A;  4B9L A;  3QE9 Y;  4O0I A;  1QLN A;  7ICR A;  1TAU A;  2UVW A;  2W9A A;  4PHD A;  4LZD A;  3H40 A;  1IV8 A;  4CCH A;  3PZP A;  4CNQ A;  5KFG A;  2K4E A;  5E79 U;  3UXO A;  2EH9 A;  2E8M A;  4UAZ A;  2K60 A;  1JUD A;  3M7D A;  4RNO A;  1QCK A;  7ICS A;  4B9T A;  1WWV A;  1ZRN A;  4C4R A;  2IHM A;  5DB7 A;  2F8K A;  4F4X A;  3R9K A;  4B9N A;  9ICL A;  2JEG A;  2JEF A;  1F5S A;  2W9C B;  1ZOL A;  7ICU A;  5L1L A;  5AHX A;  3ZDD A;  1KW4 A;  5KG5 A;  5ALU A;  1U48 A;  3ZDA A;  4TUQ A;  1SXD A;  4F93 B;  4DQI A;  5J0W A;  5AM4 A;  1ZQB A;  1NJY A;  3M6K A;  4JV0 A;  4LZG A;  1ZQQ A;  2QKQ A;  4UB6 U;  3UM9 A;  3C1Y A;  8ICL A;  2G0A A;  2KG5 A;  4F4Z A;  3PW4 A;  4JK1 A;  2IOH A;  2JGA A;  4YFK A;  3OGU A;  2DGZ A;  1NK0 A;  2DPJ A;  3BQ7 A;  1BPE A;  1TAQ A;  5DB8 A;  2RLT A;  4O3P A;  1DRG A;  2JZB B;  1ZD4 A;  2FMS A;  4P2H A;  5KFW A;  4P4O A;  2HHV A;  1NKB A;  4QWB A;  4NLC A;  4O9M A;  2YN4 A;  4RU9 A;  5J2F A;  5AIB A;  1SWV A;  2PFO A;  4NLB A;  5ALO A;  3GV7 B;  3TAD C;  1S0N A;  3DDH A;  3SQI A;  3WKE A;  3EYZ A;  4FE3 A;  1NKC A;  2D3D A;  5J2K A;  2MA1 A;  2E1E A;  3H8W A;  2GOL A;  4HYK A;  2BPF A;  4QZA A;  1LKY A;  2IOF K;  5KL8 B;  3UXN A;  4Y2Q A;  2KNJ A;  1FO4 A;  1B4F A;  2V4Q A;  1OUQ A;  4KLL A;  1V85 A;  3TAQ A;  4EX7 A;  3GV8 B;  5J8Y A;  9ICI A;  1KDH A;  3T79 A;  8ICH A;  4M0A A;  3AQF A;  5J2E A;  2KP7 A;  2PMZ C;  3PW0 A;  1S9F A;  3NVV A;  2JR5 A;  1N62 A;  3PMN A;  1RQL A;  4YD2 A;  1T7P A;  2PFQ A;  2KFZ A;  3NRW A;  3JPO A;  8ICW A;  4NLZ A;  4R65 A;  4IC9 A;  4DSI A;  3KZX A;  1RPL A;  2AGQ A;  2FMQ A;  7ICO A;  3M6Z A;  1AQ6 A;  3KOO A;  3JPT A;  1KTQ A;  1D9D A;  1SZH A;  2P35 A;  1L6N A;  4KX5 A;  1COK A;  4ELV A;  4IQW A;  1SIJ A;  2NV3 A;  2J6T A;  4DLE A;  5ALR A;  2EAO A;  2W03 A;  3BZK A;  1SKR A;  4CDG A;  3N7R C;  2F76 X;  1LB2 B;  4FFD A;  4CE6 A;  4P0P B;  5JRT A;  1QSS A;  3WK9 A;  2DL0 A;  2DFL A;  4OJL A;  4EBC A;  1XO0 A;  4DOA A;  3QU9 A;  4UAU A;  4ED7 A;  1J97 A;  1RYU A;  5ALH A;  3M9N B;  3THV A;  1TK8 A;  1ZXI A;  5HP4 A;  3HX0 A;  3SAF A;  1UT5 A;  2O6K A;  4F5P A;  3ISC A;  3QXG A;  5HR6 A;  3LVV A;  1ZET A;  3N7P D;  3D6J A;  5AKJ A;  4YN4 A;  3DV9 A;  1T4G A;  3ZDE A;  2B6G A;  1JXE A;  4OJ6 A;  2ZXH A;  3KTQ A;  9ICO A;  4MF2 A;  1ZJN A;  2KTQ A;  4DSJ A;  4O5K A;  5H2F U;  4I2F A;  1IIP A;  5KFE A;  4RPZ A;  3LWL A;  4GXK A;  8ICJ A;  4RZR A;  2ZJA A;  4B9S A;  2FPL A;  1ZQW A;  4KLE A;  3KKA C;  4GLX A;  3MDA A;  4Y2S A;  2EZX A;  5DG7 A;  3QEA Z;  2JXJ A;  1S97 A;  5KFL A;  4R64 A;  5AKX A;  1ECW A;  5AK6 A;  4KLF A;  1RG6 A;  2LM1 A;  2C2E A;  1JX4 A;  2IMW P;  4LVS A;  2K4H A;  1SL0 A;  1IG6 A;  1ZYQ A;  5CEH A;  2ISO A;  7ICT A;  5ALQ A;  3NVY A;  4ECS A;  1HUO A;  2AGO A;  4NV0 A;  3V7L A;  3MBY A;  1KRP A;  4C4T A;  1TAM A;  1NI3 A;  4F50 A;  4I2B A;  2QAR A;  5AK4 A;  5AK5 A;  4CF4 A;  1UPH A;  4IRD A;  5KFU A;  2PFP A;  5KT7 A;  3UQ0 A;  1KQQ A;  4YR2 A;  3H0L B;  5ALT A;  5DGB A;  1ZQO A;  2ZIU A;  3RJF A;  2OM6 A;  1N5X A;  1A76 A;  1BNO A;  2RDJ A;  2OWO A;  4RQ4 A;  1RQN A;  3NUQ A;  4BX9 C;  5AKY A;  4M04 A;  4F5Q A;  4M2Y A;  4DSE A;  2WTF A;  3I76 A;  1L3S A;  9ICA A;  2D8C A;  2RQ5 A;  2XIC A;  9ICH A;  1URJ A;  3RFA A;  1L8O A;  4J9L A;  1XO1 A;  8ICM A;  3C29 A;  1YT3 A;  4Z6C A;  2KE7 A;  8ICO A;  3GIJ A;  4YP3 A;  1K5O A;  3C1Z A;  3JPQ A;  3CW2 C;  5AIA A;  3WK5 A;  1LV5 A;  1HIW A;  5F3X B;  2MUT B;  4YR0 A;  1BPZ A;  5L1J A;  2J6S A;  2NRX A;  3H0R B;  5AI5 A;  2RP5 A;  2LM4 A;  1XS9 D;  2WB1 C;  3B0Y A;  3K1R B;  3NVZ A;  3E0F A;  1S0O A;  4M9L A;  3T3F A;  2YMP A;  2AXT U;  4DQP A;  2KV2 A;  2ASD A;  1O08 A;  1F44 A;  1PK1 B;  4EYH B;  1RXV A;  3F53 A;  1UT8 A;  2HMX A;  2BQ3 A;  1S10 A;  1DOQ A;  2FLL A;  3MR5 A;  4KTQ A;  3EPI A;  2Y9T A;  3KHG A;  3M9O B;  1FFV A;  4Q45 A;  3ETR A;  3AUO A;  2EZZ A;  9ICW A;  4M6W A;  1XWL A;  3ZDB A;  2KN7 A;  4RQN A;  3SR6 A;  2KJ5 A;  2F77 X;  4PGQ A;  4Q43 A;  2DKZ A;  5D49 A;  2PXI A;  3EUB 2;  5J2I A;  4AYB F;  1FEZ A;  4XA5 A;  1Z1V A;  8ICF A;  3PW2 A;  3GIL A;  5ALJ A;  2ZUB A;  4EZ6 A;  2JV3 A;  4KX3 A;  5F9N A;  3M1Y A;  2ZIW A;  4YMN A;  3V6H A;  3OPX A;  4F4Y A;  2B21 A;  1DK2 A;  5T14 A;  5KFR A;  2LKY A;  2HCF A;  8ICR A;  5J0Q A;  2W9B A;  4ECZ A;  1TKD A;  5DLF A;  3MGI A;  1SV0 C;  3QEB Z;  2K4I A;  2XCA A;  4UB4 A;  2KHV A;  2K4P A;  4U7C A;  2Z7J A;  3KZI U;  1VJ5 A;  3H4D A;  2DQN B;  3ICX A;  3ORY A;  2BR0 A;  4JV2 A;  2CN1 A;  1TK5 A;  4QWD A;  3BS7 A;  2K89 A;  4I2D A;  1ZQ1 C;  4QNL A;  4QZE A;  3PO5 A;  3F5E A;  1ZJM A;  4J9P A;  2HHS A;  4I2H A;  3QX7 A;  5AIC A;  3QYP A;  5AKK A;  2R8G A;  2HDO A;  5KG6 A;  5KFZ A;  1T8E A;  2Y0S F;  2VA8 A;  3QZ8 A;  3V6J A;  4OO1 J;  4NM1 A;  5KFY A;  4UAT A;  1QSL A;  5CB1 A;  5J0R A;  3RJH A;  4NLG A;  1D8L A;  4EYI B;  1S8O A;  1NJX A;  3MGV A;  8ICT A;  2RDI A;  4B9M A;  2OCE A;  3SZ2 A;  5KFT A;  4KLT A;  3A0H U;  4F8R A;  5DB9 A;  4BWM A;  5ALV A;  2I5H A;  3K75 D;  1V38 A;  2P6R A;  2XVT A;  2VJ5 A;  5KFJ A; 
#chains in the Genus database with same CATH homology
 2ESE A;  2EAP A;  4NJ8 A;  5JU5 A;  2D3D A;  1UCV A;  1F0M A;  1SXE A;  2F44 A;  2KMD A;  4NL9 A;  1LKY A;  2D8C A;  2E8M A;  5J8Y C;  3BS5 A;  2EAN A;  2K60 A;  2L5Y A;  1LKY B;  1SV0 C;  1WWV A;  2B6G A;  2KE7 A;  1B4F A;  3BS5 B;  2F8K A;  2FE9 A;  1V85 A;  2K4P A;  3TAC B;  5JTI A;  2DKX A;  1DXS A;  2QB0 A;  1SV4 A;  5J8Y A;  2KSO A;  1B0X A;  5F3X B;  1KW4 A;  3IDW A;  1SV0 A;  2E8P A;  2LMR A;  3HIL A;  2QB0 B;  4MHV A;  2KSO B;  5KNI A;  3TAD A;  1JI7 A;  3BS7 A;  1SXD A;  1OXJ A;  4PZN A;  3KKA C;  1WWU A;  2QB1 A;  3K1R B;  1SGG A;  1PK1 A;  2YTU A;  2QKQ A;  3SEI A;  1PK1 B;  1PK3 A;  2ES6 A;  2KIV A;  3SEN A;  1RG6 A;  2KG5 A;  2LPE A;  2Y9T A;  2EAM A;  4NL9 C;  1UQV A;  1COK A;  4PZO A;  4IS7 A;  3BQ7 A;  2EAO A;  5L1M A;  4RQN A;  2Y9U A;  2DKZ A;  2QAR A;  5JRT A;  1X40 A;  2GLE A;  3KKA A;  1X66 A;  1Z1V A;  2DL0 A;  3H8M A;  4RQM A;  2QAR B;  2F3N A;  2E8O A;  1X9X A;  1OW5 A;  1V38 A;  2JV3 A;  2E8N A;  3TAD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...