3IDXH

Crystal structure of hiv-gp120 core in complex with cd4-binding site antibody b13, space group c222
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
231
structure length
229
Chain Sequence
QVQLVESGGGVVQPGRSLRLSCAASGFTFRNYAMHWVRQAPGKGLEWVALIKYDGRNKYYADSVKGRFSISRDNSKNTLYLEMNSLRAEDTAVYYCARDIGLKGEHYDILTAYGPDYWGQGALVTVSSASTKGPSVFPLAPSSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 HxBc2 gp120 core
publication title Structural basis of immune evasion at the site of CD4 attachment on HIV-1 gp120.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
total genus 38
structure length 229
sequence length 231
ec nomenclature
pdb deposition date 2009-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3idxH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3idxH01
1ITBB 4NQCA 2E7CA 3FB7A 5IOPA 5CGYD 3W81A 3VXSD 3DOSA 1LGVA 3SKJL 5IHZA 2OJEB 2ZCKH 3WSQL 4ODWA 1GGCL 4K2UL 3B2UD 3MRGA 4MXQD 1QUNA 4MSWB 1HHKB 5ICYB 2YBRA 4LSUH 1CXEA 5C9JA 4XNYL 3O6MH 1Z9LA 1FZKB 4PJXA 1MJ7H 2R69H 5ACLA 2WW8A 4EBQH 3E6HB 4OZFH 4O5LH 4MMZC 3C08H 2Q3AA 1JP5A 3VWKD 4MNQA 2NY3B 4TVSa 4UBDC 1FNSL 2D4FA 2FL5B 3UYPA 5A43C 1T7XA 2DM2A 3O45B 4PP1C 4ZPTA 3NFSL 1MJ8H 5IW3A 2R23A 5B39G 1PYWB 1HHGA 4PJAA 3MGTB 5F9WC 2ITCA 4Y0GA 2HJLA 4HC1H 1HI6B 2GITA 2VERN 3AAZB 1K8IB 4WW1A 3I50L 1D5BA 2PYED 2BRQA 5EO1B 4UQ2A 4GG8B 5BVJA 4OKDA 1FN4B 1D9KD 3GEWB 4JFOB 4XH2B 2GCYB 1DEEB 3GB7B 4LLYA 1I1RA 5FYJD 4NHCL 3QEUA 2B7DT 4HAGA 5I8EB 2W92A 5DJ0A 5EC2B 1RK1A 4DZBA 1CE6B 2H32A 2FEEL 4OF8A 5DRXA 3QXAB 2FECI 3VFGL 4OCNC 1XGTA 3O3DA 3CFEB 1CD9B 4PRDB 4LNRB 3KR3H 2Y06H 3NAAL 5F1IB 3TZVB 2ZWLT 1MLCA 3DV6B 3SGJC 1EAPA 4HG4K 1DVFD 4I4WB 3I6LE 4QNPE 3RWJB 3L7EA 3LKRA 1OM3L 2HRPL 5CINH 5LWYH 3VXME 3O3BA 1PQZA 1S5IH 2G2RA 1N2RA 3K0WA 3UDWA 1S7UB 2R1YB 3NIDE 5CUSL 3WJLA 5F7YC 3DRTA 2BY0A 3L3OB 1Q0YL 2IBBA 2QHRL 4NCDA 4JFFA 3WYRA 5HYJA 4JY5L 4R4NC 2HRPH 4Y5YA 2EYRB 4YHZL 2DKUA 1X44A 3CVIL 5EZIL 2CMRL 1O7SA 1FNEA 4OGZA 4JZNA 2A73A 4NFBA 3FQUA 3BKCH 1QFWI 3VGBA 3GSXA 3KPMB 3P4MB 5C0RL 1PSKL 5IVOA 2A77H 2QHRH 1NSNH 2I27N 4JHWL 3EO0A 5FIEA 3IDXH 4MD5A 4OZ4A 3CAFA 2H2SD 4NRZB 4XHQA 3ARWA 3U36B 3NIFE 3P0GB 1Q9KB 2CMRH 1OD7A 1IC5L 1YEFL 3G08A 4KKCD 4PB9L 3IT8D 3RUGE 1N8ZA 4Y1AA 1KJMB 4OZGF 3MLRL 1PY9A 3CVHH 2VLJE 1UH3A 2XICA 4Y16D 3QB7C 4M48L 5LAXB 3I85A 3ZDYE 4WFFE 2VZUA 3C5ZB 1A3QA 1YYLH 5AAWA 1FCGA 2PXYA 3IYLW 4P59H 1JHLH 3B8YA 2HKHL 3P11H 3A6CL 1HCVA 5DS8B 1IC5H 4JRYD 1EDQA 2N56A 5SWSE 3O4OC 1PDKA 3CU1A 3KPLA 1YPZB 1U8PB 1OP5K 1AGCB 3O6LH 3HB3C 1AR2A 4GKOA 5FYLH 3RWHB 1JTPA 2R56L 3BDYL 5CD5D 4LSDA 5E8NA 5FO7B 1AD0A 2HTLC 3F7RA 1WF5A 3HC3L 1KIQA 3WFCL 5ITBL 1MVUB 5JHDB 3VDBA 5FDYA 1CXIA 4OV5A 1H5BA 5E1HB 3A6CH 2AJ3A 3CZJA 4CDHA 5SWQA 1RIUL 4JGJA 3ZKND 4PRAA 5C0CB 3HNVH 2FZ3B 2Q87A 4S1DD 5JO5B 5BXFB 3AM8C 4S1SH 4NUGL 43C9B 4H1LB 2J8HA 3MCLH 5F1NA 4RSVA 5MENA 1ZHKB 4AIZB 1DSFH 3D2UD 1LK3H 2NXZB 2WANA 3EJZD 2J88H 4K94C 3ELAT 2VISA 3L7FB 1RURH 3WNMA 3WFEL 4E41A 1ZGLM 4C4KO 4UAOC 3L5XH 1F4WH 4PGZA 5FGSA 1KIUA 4O51A 4GRWF 4OSUH 2IGFL 4WY7L 3MCKA 2W9EH 3T4YA 3T0EA 5T1DH 3G5VB 2D7MA 3KDMA 4M8VA 1I9JH 4HS8H 3SJVA 4F9LA 2J2ZA 2NTFA 1A7OL 1T5XA 2O26U 3MODL 5A2LH 5C2BH 4L8CA 1XGQA 5CKGA 1KPRB 4EOWH 2WINB 1BD2B 1IVLA 1BVKB 2ZUQB 2ZP0T 1F3JA 3JBG7 5D7IB 5CP7A 1ZLWH 2XKNB 3K8LA 3V5KB 5I1EH 2XN9A 2NNAB 4TPRL 4QY8A 2E7MA 5JPNA 5KANG 1ZA6A 2BCKB 5C0AB 3FQRA 3HI5H 1YNLL 3LN9A 3WFZA 3ZKXB 3TYGL 3ROOB 4QRUA 3GRWA 5DJDA 2H2SC 4L4VB 4HT1L 1FGVL 1YEEH 3LZFH 5HYQB 4GOSA 3DV4B 2DL2A 4KKCC 4MB4A 3WFBH 5CP3H 5T1KA 4PJDB 2HP4A 1F8TH 2VAJA 3NBNA 1NAMA 5D7JA 4Q9RH 4X9GA 1T6WA 1U58B 4Y16C 4JO4H 4ZAKB 1YNLH 3UJTL 1DBKL 3V7AE 5BOPA 1AHWA 3L5HA 5INCB 4XP4H 3CUPB 1YDPA 1UCBH 4XCFH 3RU8L 2MPAL 3DI3B 2UWEB 2P42B 5E7FA 1IC1A 1B0GA 1ZWIA 1NFIA 1T7ZA 2GJ6A 3RY4A 3MBEA 4YHLH 1BZ9A 1P4IH 1YMMB 5B4MD 5F9DC 4ZUUB 1JGUH 3GKWL 1LE5B 1MHHB 1DBKH 1RIVL 1P4LA 3HAEG 4YHOH 4NO0A 4Z0BL 3VI3F 1FORL 3EOBB 3EO1B 5DT1H 3ZYOA 2OSLB 1RZ7H 4JFYB 4GLRI 4NKQB 5K59F 1NGZA 2JJSA 4IMLA 1N6UA 3B9KD 1G7IA 2IALA 1ORQB 3HE7B 4KZDH 1BWMA 4S1DC 1S9WB 1NBZA 4Y88A 4GH7B 5EOQH 3I6GA 3GKWH 2DYPB 5C3TA 2B39A 3W5MA 3H2WA 4Z0BH 3JUYA 1LO5B 4FQHA 5I75C 3CX2A 3FRPG 3HKFA 4QEGA 3STLB 3P30H 1J0ZA 2EH8L 2AABL 4WRLA 3ZE1E 4DFIA 5H2BA 3RVUC 3FB5B 2W0PA 4MJ4A 2YC1A 1XT5A 2XQBL 5A16A 1AR1D 3HAEH 2H9GB 1B88A 3GJEB 4MAUH 4G8GA 1SM3H 2AABH 5HHQA 4L4JA 4JFDD 4ISVA 2X4OB 4LF3A 3VXUD 3VFOA 3RDTA 4WWID 1OLLA 3QNXA 4PREB 1NEZG 1UQSA 2A6KA 1G0XA 2FGZA 3VJ6B 4CU6A 1U8QA 5FYLD 3RL2A 4L4TD 1PKQB 3NH7L 2HJFB 5CGTA 2VQTA 1DR9A 4JR9L 1FO0B 1NQBA 5EO0B 1M71A 2DLIA 3ARBD 4X8JB 4B7IA 4U49A 1DUYA 3NCMA 4JM2D 3OHXA 4N9GA 5L2KA 2D7PA 1GRWA 2VYRE 1JF1A 2XWJA 4ETYA 1UWEL 2OR9L 3TJHD 2X6MA 1S9VA 2W07A 3X14B 4KUCD 4NNYB 5H35B 1KYOJ 4XAKE 5KJRL 4JZOA 4U1SA 1M4KA 1JNJA 3HZKB 1FYTD 1A9EA 4JR9H 4Q9QL 3FO9A 5T1LD 3QIUC 1JPGB 1X5FA 3QIBA 4HWZB 2BXZA 1IGYB 5IB3B 1NGXB 2VE6A 4JZJA 5DGRA 4L3CB 2CRIA 5FM5M 2BVQA 5F89B 1Q1JH 1UZ6E 1TQBB 4I3GA 4PJEF 5DQDL 1GZPB 3GMMB 1JGVH 3ILPA 1MUJB 2VOTA 4Y4KD 4Q9QH 3R06A 4C56A 1EA9C 3C87A 2HJKB 1J1XL 4OZIA 4XI5C 3M17B 4WFHD 3BAEL 4MGXA 4JFHE 3WIHL 3AY4A 5DD5L 1T7YA 1GGYA 1G9NC 4QRRE 1E28B 2OXHA 2X4NB 3GJFA 4DKDC 3GM0A 5ACZA 1G7QA 4V1DE 3B9KC 5I30L 3SDXF 2LABA 3V4UH 2H41A 4HKBA 3WHXB 3T0WA 4HXAH 3PWPB 4KJPD 4CVXB 1P7QD 2A6JB 2JB5L 5J3HC 1OGTA 1J1XH 3C60C 4JPIA 4M4RA 1KCUL 4LKCB 4BQ9A 1LP9A 2YZ8A 3RTQD 1V7NH 4UIMB 2IJ0C 1YEJH 1BQHG 1A6WL 4Z0XB 2HA1A 4LOUC 3GSNB 5ETUA 4JPWH 5CWSA 4XPGL 5K9QG 3AREC 1VPOL 4P9HH 4XNXL 3DTXA 4ERSL 2DQIL 4E0RA 4KJYB 3L3GB 1N64L 4L5FL 2FJGB 2IPTL 4K55A 1INEL 1ZHBA 4RQQB 4GXVL 4CU8A 3ZHLA 1UJ3C 4JPVL 3RGVC 3U7WL 1FPTH 3IFLL 5D7LA 3RNQB 3IFOA 1FFNB 1HCFX 4YHYC 4PS4L 4AENB 2R2EA 3LQAH 1ZVSA 3K2UL 4D0DA 1ZGLA 1KJVA 3MRPB 3PABB 4RGNB 3U0WL 3HC0A 4OUOA 3UBXI 4NN5C 3ARGB 2AJZB 5DVKA 2LAGB 4ZQKB 2DWDB 2W91A 4OQTL 3CFBA 1H0DB 2V5RA 3ARFD 1ZTXH 1CD1A 3FFCA 3AXLA 3G6DL 5C0BE 2Z0BA 3S5LB 1S9XA 4Y5VA 4PJHB 3TBVB 2FWOA 5SWZD 4XNMA 1BFOA 5D6CB 1ES0B 1KULA 2GSIB 5EH1A 3HNTL 2A2QT 1OGAD 3M1BB 1JFQH 1KENH 5FO8B 1BD2E 4OQTH 1F58L 1A3LH 1KJ2H 2HLFC 5GGRB 4DKFH 3W39A 1OCWL 2VABB 1X6NA 5FKAA 1M05A 4UB0L 5DO2C 3WUZA 1KEGH 5D7IE 4Z7NE 3DURA 4ONHA 3DVFA 4OM1H 4Q9CA 2ADFL 4O00A 4HG4J 4IRSC 1MWAB 3QIWB 4S1QL 3ARUA 1OAUL 3PWLA 3WD5H 3TF7C 4IBLT 3HNTH 5DEGA 5J1TC 4OD3H 3CXDH 4I2XB 1QA9B 2Q7YB 4ZFGL 4W70A 3F62A 1ZANL 3EHBC 4LSTL 2AEWA 3O4LA 4RNRB 2CR3A 3SE3A 3UTTD 3SO3C 1P2CA 1A0QL 1PZ5A 3BQUB 5I71C 1DN0B 1BZ7B 2ED8A 3HR5A 1R0AL 1OP3K 4WI4A 4PJDE 2YSSB 2K1MA 2BY1A 5E70A 1O0VA 3SCMB 4X6DF 3QH3A 3BW9A 1YN6B 4NQVB 3JTTA 3S37X 5DJYA 3MV7A 5D6DA 4XMLL 2J1KA 1D6EA 5DD3L 4C57C 1UA6L 2UWEE 1BP3B 3L3KA 3EJYD 3TEUA 3MZGB 3X3FL 4ZXBA 2NY7L 4BELD 4EI6A 5E00A 1YMME 3T0XA 3FT2B 4YQXH 3DVGA 4KJQC 4X99A 5FAAA 3WN5A 3TBSB 3D39A 1TTUA 1EGJL 4HKXA 4ZSOB 5GS1B 4YHKL 3GMOB 1Q9OA 4OT1H 2A74A 1WWBX 1L7TH 1SJHB 1UA6H 3QFJE 5CEYA 3HZMA 2FX8H 1EHLH 1H3TA 3D3VD 4GMSH 3ZHDA 3BYTA 3LRGA 5GGUB 5JNYA 3EZ8A 1F11A 5I18H 2XRAL 3TYFA 2GY7B 1EGJH 5I66B 4WFGE 3IKCB 4Z5RA 1S7SA 2CLVB 1RUPH 4PJ9A 3Q5OA 2JJWA 4MJ6B 1UXSB 1SMAA 4JRXB 5LVEA 5K9JH 1G0DA 3ARFC 3DUSB 1DDHA 2R2BB 3STZB 2YWZA 3VWJB 3O2WH 4I48B 3N1QC 1UACL 5C7XL 4L8DA 4BKLB 4KI5F 4NPYB 4DGIL 4XNZC 4JGMA 1T4KB 1YJDH 4JM4L 4BZ1L 2BNQE 1V7MH 4N0RA 5EU5A 3MROB 3IJSB 1J05B 3QPQC 2G9HB 3F12A 1UWXK 3VD3A 4XZUB 1S7QB 2Q76A 3FOLA 3WL9A 1KELH 1KGCD 1CGSH 2ZG3A 5AD0B 1UACH 1WWWX 5C7XH 4TNWK 4Z7UA 5MEOB 4DGIH 1PKQE 5D7SL 3LS5H 4TVPE 5KS9F 2OTUA 3EW3B 1FC1A 5D7KD 2X1OA 3QNZA 1IFHL 3SE8L 4P5TB 4NQEB 4NIKB 4PJIB 3T4AB 1LEKB 4F7CA 5J7CC 4UUJB 3P40A 1Y6NR 4XX1G 1FDLL 3U30C 3MRQA 4N8VA 4F7MB 5K9KA 3S96A 3PWJA 2UY7A 1OAQH 1LO4L 4X7DC 2GEEA 3CSGA 3KPRA 2WM0A 1QNZH 3QXDB 1XF4A 2NY2D 4HUUB 5KSBB 4EVNA 3UBXB 5TF0A 3WXWH 4M7JL 4JN1L 4XP5L 1OAYH 4PJ8B 3U79A 2F5BH 4DGVL 4F7TA 4KVNH 1U8LA 1RJZA 3BH8A 1UM5H 2B2XL 5IUSA 4HZAA 3MV8D 1FAIL 5ICXB 4QHNB 4NO2A 5F6HJ 3MRRA 5MHSD 4OZHA 2DWEA 4I0PB 4GG6B 3VW3H 2IADB 3DHJA 4EUPA 1FE8L 2DF3A 1MQKL 3NCCB 4AEEA 2H32H 4KROB 3D87B 5ESQA 4MWFA 4P4KB 4X98A 4FABL 2XNAB 3QQ4A 3TN0B 3BVNB 1NCAL 1EEZB 4LBEB 5D93C 2AK1L 5T1MB 3IDGB 3TO2B 3LQMA 1NFKA 2IQAA 3JVGA 2AERT 3GM8A 4I9WE 1BWWA 3EYVB 4U4BA 1G7HB 1NCBL 4M4PA 3U4BH 1T03H 5C0DB 2K9UA 4HIEB 2D0HA 3TNNA 3B6SA 2FEEI 4FABH 1PG7H 1KIRA 2BK8A 4KY1L 3RI5K 2DI7A 1INQB 4L9DA 4GBXB 1DLHB 1QZ1A 1HH6B 5JOPD 4RWYH 1FLRL 4IHOA 4LVEA 1JWMA 1IGIL 2VC2H 4PJBA 1MCLA 3NFPA 2NX5B 3DX7A 5EU3B 1U91A 3Q3GB 5FCUH 5JUEL 3W0WD 2F53E 1A1OA 3ULSB 2WUCH 4XXDA 5F88B 1NCBH 4ELKB 4OLYL 3TIEA 2MJWA 4MJ5B 5IT2L 3H9HB 3STBA 4PTTA 7FABH 3NPSB 5E5MB 4RGNE 4UTAH 1QSFD 1U8NB 4J3VA 4PJGA 3CX5J 5DD0L 4HQQL 3C09B 5ALBL 2DKSA 1DBJL 1IGIH 5TDNB 5BZDA 4P9HC 4ACPA 2X9XA 1XEDA 3PQYB 2VXSH 3WNNA 4JFEA 5CBAB 2QQQA 1IAIL 3FQXA 4UU9A 2C7UB 3HS0B 1H3WM 5F70A 2OZ4L 3DJ9A 4XPTL 5FUOL 5ALBH 5DMKB 3LQAC 2NY0C 2J3SA 2EDOA 1CBVH 2VQ1A 5ADPL 5KSVA 4UT7H 5A2JH 2W38A 2BVTA 3VXMA 3RFZC 1VB9A 4TTDD 3ESVF 3GGWB 4LRNL 5E8PA 3BOVA 1MREL 3F7VB 2IPKB 3LQZA 2OR8A 3GHEL 1T0MA 4HPYH 4WI3A 1X7QA 1DQQB 3DGCR 1NANI 4P49A 1C5BH 3KYMB 3KPSD 5C08A 2X2YA 4NQCD 2H8PA 2ICWJ 1W2KT 1AD9A 2NY5C 1L9MA 5DRWA 2HFTA 3UZEA 1IZKA 5HY9B 2ED9A 2GK2A 3D85A 3RWGA 3QUYB 1F42A 1YYMH 3V5DB 2GTWA 3PL6B 3TH3T 2NY1B 4C83B 4GSDH 3VI4F 3BMWA 4Y7MA 5F9OL 4XP1L 3VGDA 5CAYB 1QR1B 2IPUK 3BRFA 3BEWB 3PP4L 1C1EH 3BHBB 3VFSA 4YFEA 4X9BA 4OLUL 1UZ8A 3LPFA 2RGSA 4UI2A 5CD3B 1EUTA 4MA3A 4FQQA 4UDUB 2FCBA 3FB6B 1UKQA 3VXRA 5EU6A 1I1AB 1CIDA 2AW2A 1BEYH 1YQ2A 2VDPL 4MNQD 3KPOB 3DXAB 2B1HH 5DFTA 2XI9A 3PP4H 1N5AB 4B0MM 4ZSOE 5CMAB 4ORZC 4NJAL 4LLUA 5KVDH 3GMNA 5EUOB 3KNBA 5E1AB 3V6BR 3MRCA 4O02H 2D31B 2VAAB 4K3JL 2DLHA 4HDIA 4HWBA 4N5UA 2ADIA 3VH8B 3WDJA 1NMBH 3QJHB 1N6QL 1EAJA 1K2DB 3HUJF 4JG1H 3RKPA 1OTSC 4BSJA 4JHZA 1SY6L 3S36H 3SDDA 5DJ2B 4POZC 4OZGA 5EZJB 3X11A 1S5HA 3TNMB 4S11A 5I1DA 4KPHL 1U8HA 4RDQF 3A67L 3QRGL 4K3JH 1KNOA 4GW4B 3BIKA 2R9HC 3GRWH 2O5YH 4HUKB 4Q7DA 3LEXB 2F5AL 5IMLB 3TIDA 2IANB 1VACB 4P5MA 1EIBA 3MRKB 4W6WB 3OKDA 3MOBH 2VDNH 2I9TB 3ZO0A 4D3CL 2YWYA 1EK3A 4GKSA 4JAMA 1YECL 4HUWB 4QHKJ 4LHQB 3FOMB 1QHOA 1JZ2A 4R97C 1EFQA 1NAMH 4YUEL 1SYVB 2FX9L 3H0TB 2VZSA 4PUBH 3UPAA 2W0LA 2GUOA 5CEXB 3IJYA 5BV7H 1VGKB 2YPLE 2E6QA 4U7MA 3F7PC 2O5ZL 1BMGA 5JORB 1BFSA 3TV3L 2RIKA 3PWVA 3MUGA 1DBML 1EJ6A 4HHAA 2R0WL 3T1WA 1L6ZA 1I1CA 1I4FA 4XCYB 3ZYIA 5IIEA 4RZCA 4M3KB 2R2CA 3RHWK 2P5EB 1P1ZA 3EDJA 1IJ9A 3LKSB 4PJIE 4RFEA 3TC9A 1A5FL 3G5ZA 1IBGL 3BKMH 3RP1A 2OI9B 5HYJD 4U2YA 1YY9D 3KPPB 5E6IC 3Q6FB 5FYKU 1LE9B 1I1YA 2O5ZH 1FG2B 2IAMC 2QBWA 1KCRH 1CFNB 1ZS8A 4AEHH 1D6VH 1A1MB 2Y9RT 2OTWA 2BXYA 5IG7A 2I07B 3GMQA 4HUMB 1DP0A 1JWSB 1HXMA 4P3DA 5DHXB 3FT3B 4BH7B 2O61B 1T66D 3DX6A 3IETA 3T2QA 5JR1L 2FEDC 2ZUWA 4YC2B 4LIQL 1A5FH 1J18A 1IBGH 1CS6A 5I8OL 1H8OA 3QDGD 1G7MA 4NT6B 3CZFA 1X3DA 1QVOA 2IWGA 3RY5A 1SYSB 1HIML 2DMCA 2XTJB 4QF1A 4XMKH 1NUGA 1DZBA 4Y4FA 2F54B 4L9LA 4Y1AD 4NSKB 1DLFH 2IFFL 3CMOL 3F58H 4NKIL 5JR1H 4LIQH 5IEHB 3LRHA 4ZFOB 3EFDL 3I6KB 4NWUL 4Z7VF 1HHHA 3K2MC 5IQ7H 3P4OB 4M3JA 5DDHB 2ZNWA 3X3GL 3RVWC 4YK4B 4M5YH 5A40E 4KRMB 2OJEA 3OKEB 1FFOB 4OM0H 1HILB 1KC5H 2BFVL 4O58L 4H20L 2IMMA 5TE6H 4MSWA 4N68A 1HHKA 3CMOH 4OIAA 3OR6B 5ICYA 2X4SB 2ZUYA 1IAKB 3OJMB 4I3RL 1TETH 2HKFH 1FZKA 5KBNC 3L6FB 2DQUL 4B53A 1T80A 5E99L 3EYUH 1H8NA 3HA0A 2VXTH 2NY6C 1XGRB 3A6OA 4AEIL 2C3VB 5CGMA 1MRCH 1P53A 3G6JF 5LGHH 4WGWB 4URTB 2R1WB 1F4HA 3O45A 4I3RH 5MEND 3CDYA 3SGDH 2OBGA 3SQOH 5J56B 5E2TH 1FNAA 1D5IL 4YX2H 3IJHB 3MGTA 3S7GA 2DQUH 4E41D 3PP3K 1Z0NA 1JV5B 2R4SL 4ZOBA 2ZOLB 1K8IA 5E2WL 2FRGP 1IKFL 1BZQK 4XTRD 1S7VB 4Z9KB 3S88H 2VXUH 1UFUA 5EO1A 2PO6B 3T0ED 4OCMC 1RD6A 1MFAL 4GKNB 3SJVD 1FN4A 1P6FA 4JFOA 4OJFL 1B4JL 4O9HH 1LDSA 3DIFB 4OTXH 2GCYA 1DEEA 1EEYB 3GB7A 3MJ8B 1CK0H 2MKLC 4AG4L 5IW6B 3HHRB 3TZVC 1MJUL 4ZFFB 1U8IB 3ZDZF 4YBQC 4AYFA 2ADGB 3H3KA 3UX9B 4MAYA 4OI9A 1YY9C 2NY4C 3QXAA 3EYSL 2ZCLL 1AI1H 1NGPL 3GJFH 2FATL 3CFEA 4K3HA 1Y18B 1Q72L 1HK6A 4PRDA 2ESVA 2VUYA 2XN9D 3O6FB 5F1IA 5TQ2H 1UEYA 4TOYH 1MH5B 1X4YA 4AG4H 1ZEAH 3QHZH 5KVEL 1MJUH 4KC3B 4WJ5B 1TVBA 5HYSA 1F4XL 4I4WA 1Q0XH 1N4XL 3LHPL 2AKRB 3RWJA 2RJMA 3THMH 3P0YL 2MTPA 4WU5B 5CCKL 1KFAH 1S7UA 4ALAH 3VFVB 4WFEE 1UH2A 5D1ZD 1IT9H 4PJ5B 1Q72H 3OR7B 4BFIB 5T1KD 5C07E 3BGFC 3L3OA 3CSYB 3ULVH 5E2UL 2HAZA 2Z92B 5E08L 3RPKA 3RIFK 4X7EC 2EYRA 5B38B 1FNFA 1QFUH 2H2PD 1OSPH 2DQFA 4MDIB 1IQWL 4DKEH 4I8DA 1MFNA 2DTMH 5A3ID 1N5YH 2GJ6D 3UJIL 4G9DB 3KPMA 3P4MA 2E6JA 4CKVX 1WAAA 1OAXH 4WI6A 3T2OA 1IARB 3TCXA 2W65B 4Z6AT 2P8MA 3GDBA 5ITFA 2J4WL 3CLFL 3UYOD 2JJVA 1GCFA 5HVFB 3C5ZC 4NO0D 3U36A 3TBYA 5HGBB 3IDNB 5T3XH 3LEVH 1Q9KA 4NQDB 4NGHH 3RBSA 1R6VA 1N26A 2P5WA 3SKMB 5DJ6B 1AFVL 2LE9A 1KJMA 1MFDH 4PRPB 1WTLA 4XMPL 2XZQL 2IH1B 1WEJH 2OTPA 3SBWA 1JNHB 3NCYS 2AQ2A 4KXZH 3SE4A 4LCWA 3ARDC 5EUOE 2BSTB 5LAXA 4HF5L 4LCYB 3H42L 4QKXB 1A9BB 4FXGB 3NA4A 4LHUB 3DHMA 1IGCL 3IXAB 4XVUD 3P0VL 4P2YA 5DS8A 1A7QL 2BNRE 1U0QA 1X4XA 2OLDA 1PLGL 1YPZA 1U8PA 1AGCA 4S1RL 3LH2L 1QLRB 3F6LA 3RWHA 3RZCB 3QI9B 1VFAB 2KUTA 5FO7A 2Q20A 3SDXA 4KKBC 4LARL 2VXVL 2NXZC 4LU5H 1MVUA 5JHDA 5FOBB 4G8GD 5GRJH 3VD5A 3P0VH 2J5LC 1TJHL 5F7NC 2QADD 4QHLA 2IANE 4HXBL 5C0CA 2FZ3A 5BXFA 5JO5A 1CGWA 1DQLH 2IC2A 4H1LA 5HGAB 3RDTD 3C6LC 2UZIH 3VFMB 5EPMB 4AIZA 4KQ3H 3JV6B 4WO4B 5JA9A 4ODHL 3L7FA 1N7ML 3RAJH 2BC4A 3P77B 4G6KH 1WUNT 4XBEL 1VKXB 3RX5A 4MQ7A 2DD8L 1JI1A 3G5VA 2FB4L 4GRWE 2B5IC 2YPVL 3BUTA 5D1ZC 4R4FL 1C5DB 1KPRA 3OQ3B 4O2CB 1X5GA 2WINA 1NC2B 4YPGA 1BVKA 4PRIB 2R0ZH 4XCNB 3V4VL 2PKDA 3CGTA 3EIFA 5D7IA 3ZKXC 4E5XB 3JWDH 1YEIL 3QIBD 4U1IB 3RL1A 4Z7OF 4M62H 2XKNA 1EVTC 4CADB 3PHOB 5DUMH 2VZVA 3C5JB 5A3IC 2QR0A 1RFDL 3MLWH 5T3ZL 2P43B 5C0AA 3MV11 1FL6B 2XZAH 1MNUH 1C08B 5TE7H 4P3CH 4C56D 3NN8B 2EEAA 2VDML 3LPWA 3CK0L 3ULUH 3OXSB 4TSAH 4L4VA 2XTJE 3TVMB 4P2OB 4R2GD 1CXFA 5FDWB 5EORL 2NYYC 2K3TA 3WLBB 4PJDA 5F96L 4HKJB 5DJ8B 4XRCB 4WHTB 4N8VG 4WEMB 5C0FB 1F45A 3FO1B 2UZXB 4EI5C 4ZAKA 4ZUTA 4G6FB 3GBMH 2VDMH 2HTKC 4U3XA 5INCA 1MCCA 3CUPA 2HG5B 3CK0H 1FZJB 1QRNE 2FBOJ 3WKMH 4ZD3L 1UGNA 2OCFD 3ALXA 3AS3A 3UJJL 1VGEH 3CIQA 4JM2F 4XWGH 3HE7C 5MI0C 2AP2A 4JKLA 4ZUUA 2FJHB 3BIAX 4KUCF 3TT3L 5B21A 1ZK9A 1LE5A 1GZQB 1MHHA 1GGBH 4JPKL 3OKYA 3GK8L 1A02N 1U8OB 3E6FB 3ULVD 2P24B 4H88L 2HFEB 3EO1A 3EOBA 4R7DB 3MV9E 2OSLA 4U6HB 3MRJB 4AT6B 4EUPG 5E2JA 3O6KL 2G60H 1ORQA 1DTUA 3MO1A 1SBSH 1MFBH 3NCEB 3TWCL 5K59E 4G6JL 5D7LD 1TENA 5ACMA 3DRQA 3TT3H 4I3SH 5JXAH 3G5YB 1PX3A 2DYPA 2CDEB 1H3PH 1WJ3A 2D7TH 1LO5A 3QWRA 4GAFB 3STLA 2KBGA 1I85A 3IDYB 4PGCB 3FFCD 4JVWA 3DSNA 2XIDA 2E7LC 5T3XD 4FQLL 3QP3A 3FB5A 4DN3H 2DQCL 2V2XB 1HINL 4QRQB 4NO3B 1JL8A 4CRPA 4W81A 3K80A 5I6XC 2BSED 5TGBB 5LCVL 2H9GA 3D9AH 5J11C 1WCBB 3GJEA 4LPYA 4NZTL 1FP5A 3PWNA 4XPFH 4KHXL 3K74B 1K4DB 5IBTH 3BP5B 1YQVH 2R2HB 3OKKB 4WUUE 5DC0A 4PJFF 4EUPH 3MXWL 1WLHA 4BUGA 4OCSH 3K1DA 4Q97A 4PREA 5E8OB 1BQSA 3VJ6A 1PKQA 5LCVH 1LDPL 2HJFA 1C12A 2MCG1 4JJ5B 3MLVL 1CLOL 4P5KB 3MQIA 5EO0A 3QPXH 2JELH 1B6DA 4DEPB 4X8JA 3O4LD 5TFSH 2RFXB 4PLJD 2NW2B 1W72A 2E9WA 4P3WA 2ARWA 3WO4B 2XTLA 1NGQL 5DHYB 1X5HA 4PY8J 3X14A 5HD8C 4NNYA 2PETA 5H35A 5TPWH 2HWZH 4XPHH 4IJ3B 2D9CA 2E7BA 3CFJA 4HWEL 1TQBC 3HZKA 5ANMB 2HVJA 4ZMAT 1MF2H 4OCRH 1JPGA 1CZ8L 4XNUH 2DQHH 2RCSL 3BKJH 3L5WB 3MV7D 4MNGB 3QXWA 3NCFB 5HI5C 1BF8A 3VA6A 1IGYA 1FFPB 1KB5A 4YO0B 5HI4C 1A4JB 5IB3A 4KTYA 1NGXA 1JZ5A 4L3CA 2AV7A 4IM8A 5DHVH 4J8RB 4ZXBD 1U8KB 1LNUB 5F89A 4TRPL 4KK9D 3AMKA 4G5ZL 1GZPA 3GMMA 4ZO8A 3D39D 2W1NA 4FNLH 5AWNH 2Z91B 3PV7A 5B22A 4UNUA 4PJEE 4RAVB 2HJKA 2A38A 1NLBL 1P4BL 3M17A 5B8CB 3SY0B 4H5SB 4NQDE 2HT4C 4K23H 2R29H 4WV1C 1N0XL 5BZWA 2D3VA 3LD8B 4PRPE 3T0BA 3NZHH 1E28A 2X4NA 4HIIA 3UTPE 2DM3A 1JMXA 2W60B 4XVTL 3FONB 4C4KT 5CEZH 3WHXA 1PG7X 4Q6IA 3PWPA 1EO8H 1T2JA 3EOTH 4CVXA 2A6JA 4PJ9D 3MNZB 4MS8D 1U9KA 3OXRA 5HDQH 4UIMA 1FNGB 4P4RB 4YXKL 4M02A 3ULUD 5F7DA 1R5WA 1NUNB 2APVA 3QQ9D 4ODSL 3GSNA 4Y4HC 3HFML 3ECBB 3QCUH 1JK8B 2EE3A 4JDZA 5EBMB 4K3DL 2NY5L 1GGUA 3L3GA 4HLJA 1CDUA 3LKQA 4RQQA 3PG2A 4IIQC 3D18B 4ELMF 1C5CL 1FYHB 1ZA3B 4G3YH 3HNSL 1B2WL 4AENA 4B50A 3WS6C 1LQSR 1IRAY 3MRPA 3PABA 1MFEL 3ARGA 2AJZA 4ZQKA 2DWDA 1HQRA 5I1GH 4FQ1H 2X4TA 2AGJH 4XNQB 5JXEC 1WICA 1H0DA 1IQDA 1YUHB 2VDOH 4F80A 5DMIH 4P99A 4YDJB 3UPRB 1XR9B 2LTQC 1R3IH 3S5LA 4D9RE 4XHJC 4PJHA 5GIRA 5DUPL 1C5CH 2NCMA 3TBVA 5T33L 1KLUB 1B2WH 2JJTA 5D6CA 3BP7B 4NP4L 1ES0A 5IB5B 3QO0B 4JKMA 4JHBA 1KTLB 1MHCA 4NZDA 3M1BA 2LU4A 3DYMA 5FO8A 5GGRA 5AEAA 4LHJB 1T0NB 2Z31C 4PRIE 3QUZC 2XACC 3KPRD 4PRBB 4MXVF 2Y07H 1KJ3L 4HWBH 4Q0XL 5I15L 2GI7A 4B41A 1E6OL 1ONQA 5JIIA 5T33H 2OL3B 2OP4H 1Z5LB 3QIWA 5FF6B 4LSVL 2AQ1A 12E8L 3I02B 2H1PH 3VMPA 3MLXH 4I2XA 3H9SB 4K3GA 2Q7YA 2Y25A 3HI1B 4U1LB 5F7EL 3L1OH 1AXSB 2XQYG 1RSFA 1HWGB 1ACYL 4X5WB 4RNRA 3VFPB 4Q0XH 3BQUA 1OT2A 2FR4B 1DN0A 1BZ7A 5IF0B 5FK9A 4M03A 1B4RA 4FFWC 5H8DA 1RZKH 3AUVA 3NA9L 5IMOB 2ICES 5JLZB 1DBAL 3SCMA 4F2MB 2YS4A 3IS0X 3WIIL 4NQVA 4N8CH 3BE1L 4W6YB 3WV0A 5D4QA 2DIBA 4Z77B 3MLUH 5GRYA 1F2QA 4P2QB 4JREB 2CRMA 1FGNH 2WWMD 1Q8MA 5DGQA 5JOFB 5D1QA 3ULUC 4YR6B 5E9DA 5I1IL 2DDQL 4HJ0C 4ZYKB 1T7VA 3TBSA 4K8RC 3QDJB 3S36X 3UC0H 1X4ZA 4M7LL 3WIIH 2F8XC 5GS1A 3GMOA 4FTVE 4TUKL 4DN4L 1AXIB 1ROWA 4WI2A 4XVSL 5J0BA 1QSEB 4Y8AA 1AY1L 1I7TB 3HR6A 4X4XB 5JW4R 1JRHH 4KKLD 1AO7E 5J6HB 4GRWH 5DRNA 1J1OH 5CIPH 1VEMA 2ZG1A 5I66A 3IKCA 2CLVA 1TLKA 3MLZH 4BQBA 3C8KB 3BYYA 1PJ9A 1O5DT 1RZ8B 3DROB 3VA2C 5IVXB 1BM3H 2YXFA 1UXSA 4JRXA 3MRHB 2A1WH 1Q9LB 3DUSA 3MACL 2ICWI 5LBSH 2R2BA 1I3RB 2VLRE 4JFED 3VWJA 4OF0A 3W9DB 1BFVL 4I48A 4Z7WF 4GKZB 4BKLA 3M45A 4P23A 5DJXB 3ARVA 5CEZD 2FJFB 1MI5E 4L1DA 4KI5E 4LEOB 3MROA 1CLZH 3IJSA 1J05A 1M1SA 1XR8B 2G9HA 4XZUA 1S7QA 3MACH 4ZPVA 3BD3A 3QDMD 3KG5A 4BUHA 1DFBL 1S8DB 3S34L 5AD0A 1D5MB 1F4AA 3VXMD 1AC0A 3KAAA 5DYOB 4PIRF 5MEOA 4PP2B 3IFPB 4K3EL 1QO3B 5D5MF 4LAQH 3AMLA 2BX5A 4IRJC 3TGXA 5L0QB 4L3AA 4YBLC 5DWUL 4PJ7F 1RU9L 2EIEA 4P5TA 2ERJB 5D96C 2OYPA 5KS9E 4NQEA 2VZTA 2V5YA 5C08D 3T4AA 1OAZL 1LEKA 4UUJA 4PRHA 4M6OL 1DFBH 4R7NA 3D85D 3FN0L 2PTTB 4RBPK 3EGSB 4F7MA 3B83A 4JG0L 3TLRA 1WZ1L 3O4OB 5ANME 1QEWB 4APQA 3QDHA 2VITB 3OKOB 3QXDA 5KSBA 3BH9B 4HUUA 3UBXA 4MNGE 5AYUL 1OAZH 4CVZB 4U05A 4PJ8A 2V2WB 1KBGL 5HYSG 2EDNA 5FFLA 3GNMH 4QGYA 2AXJA 4P2RE 4DTGH 2N7BA 4KTEL 4OCWL 3VXRD 5L7XL 3BPNB 5EU6D 4M6NH 4W4NA 3EKCA 5ICXA 4FA8A 1WZ1H 1YEGH 4DVRH 4P4KC 1U2CA 1CR9L 3SGEI 3TN0C 5EZOH 3CXHK 4QHKI 4Q9BA 4I0PA 4GG6A 2GT9A 3RJDA 1BVLA 2Q6WA 2IADA 5JIPA 5BW7A 1HYSD 1KBGH 1C7SA 1LO3L 2EZ0D 3BN9C 5EB9A 1OSZB 3T09A 5F7LB 2V2TB 4WDIB 5FM4A 3IU3B 4KTEH 4OCWH 4UAOB 4LK4A 5EOCH 2BERA 3MUHL 4W4OC 4CJ0A 4KK6C 5CSBA 2XNAA 3BVNA 5BRZB 3MNWB 4WCYH 1CLYL 3SDDD 4Z95L 5GGQH 2DOCA 1EEZA 4LAJH 4N1HB 3REWB 4LBEA 2WAHA 1A7NL 4GBXC 3MLSH 5T1MA 1UWGH 4AIXA 2QSCL 3TO2A 1QBLH 2XA8L 4M6ML 2DQJL 2C3HA 4X9FA 3TPKA 5C0DA 3D48R 4OFKA 4PGDB 4ZFZB 4HIEA 4M6AA 2E8ZA 4N90D 3VFRB 1T6VN 3QR2A 4M7ZC 3NPSC 3KYKL 5KW9L 2X89A 1INQA 5DK0A 3MLYL 1DLHA 3G6JB 1NL0L 1A7NH 5FXCH 4IMKC 4UINL 2NX5A 5EU3A 1RJCA 5EBWB 3ULSA 4FP8H 5L9DL 5F88A 5DD1L 4ELKA 4PJXF 4R3SB 4XC3L 2ZCHH 1RAMA 2WBKA 4MJ5A 4QOKB 3RWDA 1MVFA 3H9HA 3EYQC 5EIVA 5HHNB 1UJTA 3U4EB 3LB6C 3OAUL 5E5MA 1CFSB 4ZDHB 4X6CA 1U8NA 4O4YL 4HH8A 2WBJC 3CPLB 2CQVA 1WZLA 1XFPA 1FRGL 2R1XB 4PRNB 5FKPB 1IZJA 5TDNA 1MY5A 3RIAF 4UINH 2KKQA 2MQCA 1NCDL 3PQYA 1MRDH 3U7AA 4Y16B 2GIYA 4PBVC 4PJAF 5HPOA 3UO1H 3SDAC 3ILQC 4PGBB 2KPNA 3H6JA 2IH3B 3UTSA 3HS0A 4O4YH 3VXNB 3T2NH 4MCYB 1ZLUH 4J2XA 5D1XA 5DMKA 2ID5A 1JPSL 1X5AA 4KVCH 1RZGB 1JHKL 2IQ9L 1G9ML 5LGJB 2E8YA 5F93C 5HHVH 3MRIB 1KXTB 4TNVF 3U6RB 4IDLA 4H26A 3RWEB 2W9DH 1ZT4B 2X4QB 2GQHA 5D70L 2ICWB 2E27L 2J6EA 5GJSL 3GGWA 35C8L 4M1GL 1E4WH 3L3HB 3F7VA 2IPKA 4IDJH 3ZKMD 1DQQA 4HGKC 3KYMA 1QKZH 1JPSH 1H9VA 1VA9A 3QISA 4JDTH 4HBCL 1NKRA 1RVFL 2AJVL 4D9QE 2C4FT 1OB1B 5HY9A 2I9LB 1CG9A 3VFUB 3QUYA 5I75B 3V5DA 3PL6A 5D72L 4C83A 5GISL 5IFAL 4NNXB 5BS0B 1OTUC 5DC4B 5A2FA 3W9EA 1I1AC 3PGFH 1W0WB 3U9PH 3WUWB 2WWKO 3VI4E 1RUQL 3BHBA 3BISA 4OZFB 4LLVB 4KDTA 4UDUA 4P2QE 5E5UB 4A6YH 4XBPB 3FB6A 1A14H 1ODAA 2GFBA 4U1GC 5CJBA 1QG3A 4CNIA 1LO0L 3GSOB 2NY3D 3QDJE 3KPOA 4WHYG 3DXAA 4QO1A 1N5AA 1RZKC 4OLWL 1CL7L 2L0DA 1MRFH 3E8UH 1XGYL 4FQXC 5EUOA 2FYYB 5E1AA 4A2MA 2D31A 2VAAA 3QAZB 1QSEE 2HMID 4FFVD 1MCIA 4X0KB 3VRIA 3VH8A 3Q1SL 1I3GH 3QJHA 4K9EC 4U1JA 1K2DA 3MC0A 3QEHB 1F3DH 4TSCL 1T1YB 4M1DH 1E6JH 3C5SA 4GQ9H 5GRVL 3HUJE 3QG7H 1FV1B 1I8LC 5DJ2A 5JA8B 5EZJA 1BREA 2FECL 2QQLL 4HULB 2PF6A 1WBYB 3G9AB 3OGOE 2OS7A 1U95B 1U8JA 4G80B 4GW4A 1NBYB 5SX5H 2QKIB 3LN4A 4F58H 5IMLA 3LEXA 1BJ8A 2IANA 4MAYD 3TO4C 4RMSA 4TSCH 4NYLB 3VXSE 4LSRH 1DL7L 4M61B 4HUWA 3FOMA 3QHTC 3TH4T 1J5OH 2VDRH 2B1AL 4CMMA 4PR5B 2J8UA 1SYVA 1OPGL 5EA0L 2ESVD 3RKDC 2CGRL 2Z93B 2IG2H 3MZTA 1KIPA 3BXNA 3O11B 4UT6L 4MX7A 1X9QA 1MCJA 1NFDA 3BN3B 2EEBA 2V7HA 1I8KB 5IQ9B 5KSAC 4MD0B 1DE4B 5KVFL 5JORA 1HNGA 4X6EB 2J8OA 1RPQA 2DIJA 5TDPB 1AE6H 4XB7A 3VGAC 3OG4B 1QFWL 3B9KB 2P5EA 3LKSA 4YFLI 4WUKL 1NC4B 1EEQA 4YC2C 4JB9H 3SOBL 3KPPA 4ETQB 3BRDA 3HTLX 3Q6FA 1FG2A 1F3RB 1ULVA 1ZE3C 5KVFH 1CFNA 4P2CG 2XTJC 4UV4L 4F9PA 1A2YA 2I07A 1K3IA 2V17L 1JWSA 3LPGA 5FGCB 2V9TA 3FT3A 2PYEE 5A2IH 4EDWL 3M8OL 4WUKH 5JHLL 2R0LH 3ZZ1A 3LOWA 2F19L 3D0VA 4NT6A 3CVHB 1SYSA 3VXOA 5FYJE 2VXQH 2P5WD 2F54A 2JIXA 4NSKA 3KLHD 3RGVB 2IBZX 1QSVA 2DRUA 2R8SL 5IHUH 4YHYB 1IAMA 1MCFA 1TJIH 3M8OH 4LCWD 5IEHA 4ZFOA 3I6KA 2F19H 3OGCB 2Z4QB 3P4OA 3DO3A 2FIRT 4YXHL 1FO0L 4NN5B 5DLML 2EC8A 4WI7A 4Z7VE 4L4TB 1H8SA 3OKEA 2Q8BH 1AJ7L 1IKNC 4NNPL 2VSDA 2VZOA 3B9EA 2HMIC 1HILA 4G6AC 3CH8A 1RK0B 3QUXC 1EUUA 4KKAC 3VRLE 4OI8A 1EZVY 3QBTB 5GS0L 2X4SA 1IAKA 1HEZB 2HFGL 2XZCL 3W11D 1YEDB 1YZZA 5I1AB 2KH2B 2YRLA 3N1GC 1OAKL 3L6FA 2PTUA 4LVNC 5JHDD 2HT3D 1E4XL 1URLA 3LKPA 5AUMB 1KG0A 4KMTL 1W72H 3F65A 1XGRA 5C0CD 4GS7C 2C3VA 3GIZL 1C16B 1J8HD 3B5GA 4I18C 2R1WA 1MAMH 2CLRA 3D0LB 4IRSB 2YKLH 3G6JE 4QXTB 5BMFL 4XPBH 2X4RB 1JE6A 4PLKD 4LQFH 1U3HA 1JV5A 3EZJB 2ZOLA 3MPCA 5K93A 3OPZL 3ROLB 1KB5H 4I77L 4QOKE 1S7VA 3GIZH 1KN4L 1S78C 3SO3B 4OLXL 4QT5B 2PO6A 4RFNC 2DQTL 5EIIB 5I71B 1EERB 4ZNCD 5GGVH 4GKNA 4QLRA 1BQLL 5CZKA 3DIFA 4PB0L 3V6OC 2Y36L 1EEYA 2CK0H 3AC0A 3MJ8A 4HAFA 5CJQL 2B4CL 5IW6A 2N7AA 3O6FC 4K7PH 1TZGL 3CDGA 3JTSB 4ZFFA 5IJKA 2DLFL 2ADGA 1GPOH 1X5IA 5INDB 1GIGH 4NQXB 2N4IA 4E9LA 5FUCE 3ZDZE 3L9RA 4KZEH 2KDGA 25C8L 1GGIH 1Y18A 2GY5A 3IAPA 2MWCA 4CW1A 3GSNL 1A1NA 2DL9A 4PB0H 1MJJB 2Y36H 4JRYE 5E8DL 1GAFH 3WNLA 4OCXL 5E95B 1MH5A 3MRDB 2ITDA 5TDOB 1DANT 2ARJB 4WJ5A 5C0AD 3FN9A 4UILH 3DYPA 2DLFH 4NRXB 2AKRA 9CGTA 1F2XK 3OKLB 4YEFA 2XFXB 4WU5A 4YGVB 2K7PA 2QQKH 4IOFC 4L4VD 3S5LG 1J7VR 3VGHA 1BAFH 3VFVA 4PJ5A 1WFOA 4QYOB 2H6PB 3OR7A 4BFIA 3H3BC 4HLZH 3ALPA 4Y5XC 3KLHC 3CSYA 4Z7QF 4MQXC 1T2QL 2B0SH 4ZAKD 2R15A 1IM3B 2EKJA 1L0XA 3KPQA 5D2LB 5B38A 3S9DB 4HK0B 3GMPB 2NXYC 2OQJB 2OJZH 3MBXL 4AMKL 5IESH 1X5XA 3JWOL 2PN5A 5KVGH 5D2NA 3ARFB 4PY7B 5FECB 3VRJB 4G9DA 1LO2L 4NFCA 5C0NC 3ZL4L 2NZIA 2FH6A 2W65A 1LVEA 4X6FB 1FIEA 4OCYH 5IMMB 5JDSA 1G6RH 4MQTB 5HGBA 2CJUH 4H8WC 4NQDA 1NCCH 1EFXB 3JV0A 4QXGH 3S97C 3LEYL 3SKMA 3T65B 5DJ6A 3EOAB 1MWAL 5IB1B 4GLRH 4HK3J 4LSQH 3NVQA 1RJLB 1JNHA 3RVXC 4GRLA 3HC4H 2BSTA 3LVEA 2DYPD 4LCYA 5GGRY 5IKCA 1CE1L 1XGUA 3A6BH 3MOQA 4LFHG 3V7MA 1A9BA 3INUH 4NZRL 3QWRD 4X8XA 4LHUA 5FGRA 5I16A 3H3PL 2GW5A 4QRPB 3IXAA 1ZVHA 3HI6L 4MJID 4ODVH 4ZOCA 1HDMA 3FMGL 4RGMC 4UIKL 4OZIF 3HAEB 4BJLA 5DEFB 1R5VB 2SEBB 4LQ1A 1FZMB 1QLEH 3RZCA 3UTTB 3QI9A 5MERA 4RISH 3MUZ1 3PGDA 3VXQB 3KPNB 3U30B 5C0EB 3C2SA 3KXFA 5J6GA 5GGSB 1GYAA 4WO4C 5HBBA 4OGYH 4NZRH 4XP6L 5EO9B 1ETZB 3NTCH 4DGYL 3N9GL 3UAJC 3OAZK 5DK2B 1EXUA 1LP9F 1VESA 1QLFB 2Z8RA 4RMTA 5DA0B 4XCEB 3VFMA 1CFTA 1X5KA 3MLTA 1E4KA 1K6QL 1A6VH 3JV6A 2WUBL 1TVHA 3O3UN 2V9QA 3U0TA 2X7LA 4FQ2L 4G43A 2DQGL 4L3EA 1RQ5A 3N0PB 5I9QC 3ULVF 1PZUB 1GH7A 5ICZA 2ZKHL 1VKXA 3O2VL 1CT8B 4LP4A 4K8RL 5DR5L 1EMTH 5IROA 5IJVB 1FNLA 1K6QH 3MGOB 3SDCC 3O9WA 3TFKC 3VGGA 1HKLH 2PW2B 2WUBH 5GHWH 3D3VB 4ZNEA 4MB3A 1C5DA 3RVTC 4O2CA 4NWTL 5IB2A 4DFHA 1NC2A 4PRIA 3GFUA 4XCNA 4WWKC 2ZKHH 4FQIL 1NPUA 4X7SH 5TE4L 1RZJH 4E5XA 3O2VH 15C8H 1JPTH 5D93B 4OGXH 1PBYA 1MPAL 4P2OC 1A3RH 5JOEA 4CADA 3PHOA 2YD1A 5FGCE 4Z7OE 2ENSA 4NKOB 3PHQA 3Q6GL 5IM7B 4OB5L 3FKUS 1WITA 5D8JH 1JGLH 4MD4A 4G6ML 4R4BB 3NCJL 3OZ9L 4OFVA 3V4PL 4NWTH 5L88L 1FL6A 1NDMB 2FX7L 3FB8B 1C08A 3ZMRA 1EJOL 3FRUB 3N85L 5I8KH 1FSKC 4FQJL 2FD6H 2AQ3A 3OXSA 3TVMA 5FDWA 2YZ1A 4DWHA 3DMMA 3QNYB 1I7UA 4N9OB 1T1ZA 3F5WB 5C09A 2GYSA 3Q6GH 3WLBA 6FABH 4OB5H 4HKJA 5I73C 4XRCA 4WHTA 4JFDE 3D1MC 3NCJH 2EO9A 3OTTA 4Y19A 3PNWA 3L95B 5GGTA 5M95B 3VXUE 1YEKH 5L88H 5C0FA 4Z78A 4D94A 1XF5B 3PWPD 2NZ9D 4FQJH 2C1PB 3OMZA 1IC7L 4ONGL 1FZJA 5FYLE 4L4TE 3UBXG 2YD9A 5FEBA 1S7XA 3IF1A 1MFCL 2A83B 3REVB 5C9KA 4D9LH 3RPIA 2COQA 4Y2DA 1T7WA 2P46B 1XZ0B 3QQ3B 3DUUB 4WW2A 1OQXA 3U82B 4NCC2 1KOAA 3T1FB 1EBPA 1GZQA 2ILLA 1GC1L 3A0OA 4YDVB 3E6FA 4U33A 4R7DA 2HFEA 1HN1A 4RRPA 3C2AL 3WIFB 3B9VA 1FYTE 3ZDXF 4E42B 3MOAH 2NY0B 5J89A 2AJSL 3PDOB 1AQDB 1XH3B 1TJGH 4LLQB 4XXCA 5ADOL 1BQHB 5DI8B 4LMQE 3QCVH 2CDEA 3VG0L 1T89C 1H3GA 3WLWC 4CL7A 2Y4SA 3HMXL 5FHBL 2DQDH 3OKMA 4KI5C 4PGCA 1XCQB 5I1KL 1CVSC 1T83C 1K4CB 2V2XA 3WXVH 1DBBH 4WFHE 4NO3A 3S4SB 3VXPB 4JFZL 3GI8H 5TGBA 4NKMB 3HMWH 1WCBA 4Z7WB 5FHBH 3RUGB 1S7WA 2PYFB 4FFZL 3BP5A 3OKKA 5FGBA 3CNKA 4M93B 2X10A 3U7YL 3MREB 2V7NB 4KQ4L 5E24E 4OD2A 4GW5A 4UTBH 3PV6B 5HJ3B 5E8OA 1NCUA 4ODTH 4XCCL 4K7FB 1FVEB 5IGXH 4FFYL 5E2VL 1I8IB 1UVQB 5DSCA 5BVPH 2AS5M 3V2AR 4FZ8H 4ONFL 2XWTB 3QUMH 5ALCL 2BOBB 4LRIC 3QZWB 4JJ5A 1CCZA 4IJ3C 4LNVA 5DJCB 4MA7H 5D5MB 4P5KA 2VJXA 1OARH 4KH2A 2RFXA 1OTTC 5F3BA 1XMWA 5ESVB 5H37G 4PJ7B 3TJEH 3BQUD 2BOCA 3OAYK 3NACH 3O8XC 3TBWB 4YHNA 5DHYA 4O2FA 2JCCA 3BJLA 3MRBA 5F7UA 4J4PA 1YMHB 2EH7L 3W0WB 2A0LD 5ALCH 3SCMD 4Z7UF 1YEHL 1U3ZA 1UYWL 1ZSDB 3FQTA 5CJOL 1INDL 4MNGA 1QSFB 1QOKA 2I5YH 2CDGB 4YO0A 1A4JA 1V8HA 3JUZA 2QV2A 3HPJB 1KCKA 3WNKA 5D1QD 1KXQE 1QYGH 3I9GH 4J8RA 3NIGF 4JLRA 5E9DD 4FG6C 4M5ZL 4RAHA 1OP9A 1UYWH 5F6IC 5TF1H 5SWZE 1U3YA 1I3VA 4U1KB 4BH8B 4WEBH 1I9IL 4R97B 5B8CA 1OGAE 3SY0A 4PTUB 4H5SA 4ZS6C 3RI5F 3QUKA 1A6ZB 1A6UH 4YDLB 4OKVB 1MCOL 4HMCA 2J6EL 1JIBA 1AC6A 2W60A 3FONA 1OWRM 2VKXA 3S35L 1MAJA 5E4EC 2A9NH 1KYOK 3RX7A 3RY6A 3HE6A 3MNZA 4X7TB 5CILH 4EDXB 1FNGA 5JDJA 4P4RA 4JRXD 1CICD 1LK2B 4OZHF 2J7LA 5C6TL 1VDGA 2BVUA 4JKWA 4N0YL 3KPSB 5D9SB 3V8OA 3UTTE 3DETD 3VWJD 2J6EH 1ZXQA 1NMAL 5L6YH 3ECBA 1CDCA 4PG2C 5E6IB 4U0QB 4PV8B 1JK8A 2IAMB 3IRZA 4JHAH 5JZ7D 3ARXA 4P23D 3ZTNH 5EBMA 3L3IB 2PNDA 1NGYB 3B4NA 1FH5L 3GIVB 3BT2H 1UCTA 1L7IL 3IS1X 4GUPB 5C8JB 3T08A 2MCPL 4ZS7L 1DJSA 1ZA3A 3VH8G 4UV7L 4MVBC 3ARSA 2FGWL 4IEFB 3MRMB 3KJ6L 4PJCB 1EPFA 4XB8A 1YUHA 1FH5H 4P5TD 4NQED 1XR9A 4L8SC 4MXWH 2HN7B 4PRHD 4PJBF 1KLUA 2HT2D 3PIQB 4J6RL 1P5UA 3BP7A 2EDRA 3QO0A 3JV4B 3SKJH 1L9NA 4QTIL 1KTLA 3D3VE 2A6IB 2XKSA 3WSQH 3RVVD 4APQD 1MIEL 4GAYB 1T0NA 1GGCH 4K2UH 3IB4A 4PJGF 5DURB 1B0WA 3QG6A 3IKKA 4PJ8D 4XNYH 2OL3A 4MXVE 1HSAB 1RUML 1Z5LA 1I7RB 1AGEA 2DS4A 4HPOL 3I02A 2NY6B 2PW1A 5CZVL 3H9SA 1MIEH 3V5HB 4TQEL 4U1LA 1AXSA 1FNSH 1CL7I 2H32B 4TUOB 3VFPA 4LPXA 3NFSH 2FR4A 2OK0L 5IF0A 5L8KB 4ZOEA 1V3KA 3IGAB 5F72S 4JREC 5DFVC 1IM9A 4M7KL 4KROD 5IMOA 4QNPF 1RZJC 1KTKE 3VDAA 5JLZA 1HE7A 3I50H 5EOCJ 2E7HA 1KGCE 1MEXL 5E0QA 3NIDF 3U1SL 4HH9B 2GK0B 1PQZB 4Z77A 4Z76A 1N2RB 4KJWD 3BJ91 4YFDB 4LP5A 2VIRB 4MCZB 1CDBA 5D7KE 4LASL 2FNBA 4DOHE 1CICC 2BVYA 4NHCH 1BJMA 4JANB 4YR6A 4LKXA 4ZYKA 3LDBB 3MNVA 2NY4B 4MHHI 2X89D 3DO7B 5ELIA 3VFGH 5HGDB 3TA3C 4POUB 4JZNB 1CIUA 1OW0C 4HV8B 1QSEA 3EO9L 1I7TA 2NX5D 3FQUB 3NAAH 3SGJA 2ATPB 5J6HA 1S3KL 3Q5TA 3EO0B 3LMJL 2JK5B 3EYFA 4MD5B 1OM3H 5CGYC 3QDGB 1YC8A 3SDYL 4CBPA 3C8KA 5CUSH 5EC1B 1RZ8A 3DROA 4J3TA 2ZJSL 3G08B 5IVXA 4ZFOL 1I9RL 1N8ZB 3BGFB 3MRHA 4Y1AB 5I8CB 3VFNB 5MHSE 3B2UC 3PQYD 1Q0YH 4MXQC 3W9DA 4GKZA 4JY5H 4QRSB 3LMJH 2HH0L 3UTSD 4YHZH 4UZGA 5DJXA 3CVIH 3LKNB 4Z7WE 5EZIH 3AU1B 4TULL 5L0QC 5D1XD 1XR8A 3KPLB 3RWIB 4QRRB 3T3MF 5DMJB 2ERJC 3O3AB 4P46D 4V1DB 3VWKC 4FXKB 4TYUA 5CZXD 5C0RH 1KN2L 1PSKH 2FH8A 3Q2CA 1OVZA 4U1HB 4JHWH 1S8DA 1D5MA 4OF6A 5HVWA 2VDKL 5GJTL 5DYOA 4PP2A 3D25B 4J3OC 1PVHA 3T77B 3WEXB 4OV6F 5EOTB 4OV5B 5CKAA 4PB9H 1YEFH 2IFGA 5SWQB 5D5ME 3I84A 3VFWB 1QBML 3QXUA 3MLRH 3MA9L 4KTDL 1NANH 3QFDB 4U6XB 1NBVL 3ARDB 4PJ7E 4M48H 3SGDI 2OZ4A 5F1NB 2X09A 4OBRA 5JOPE 1AGBA 1D9KC 3BSZL 3EGSA 4WHCA 4L8BA 2NY1D 3QDAA 3LS4L 2HKHH 1ORSB 3AB0B 3W0WE 5J57B 1MCSA 2UZYB 4Q2ZA 3BPNC 1QEWA 2EDFA 2VITA 5TQ0L 2VWEE 3HG1D 4KTDH 2C3GA 4G8FB 5IB4B 1QSFE 4CVZA 2R56H 3BDYH 1VADA 5EWIL 2V2WA 3KDMB 1NGWB 5IBLD 4NKDA 4U7KA 5C0JB 1I8MB 3HC3H 5SX4I 3WFCH 5ITBH 1E4XI 2ORBL 2AAVA 2Z8VC 2J5LB 1MCEA 4HZLB 4TUJB 3NABL 4N5ED 1RIUH 1ZLSL 3AM8A 1BGXL 2AJUL 1DVFC 3DXAD 5TQ0H 5C0BB 4S0TD 4NUGH 4XGZA 3C6LB 5FUZL 1RIHL 3FT4A 5CP7B 3ZT6A 5FV1L 5IVNA 3VU2A 4YHIB 1OSZA 3MYJA 1IL1B 3CFCL 2V2TA 4WDIA 2XN9B 5B38G 4XVJL 3WFEH 4QY8B 5EULV 4M9PA 1NBQA 1ZA6B 3T0AA 4AJ0A 4X80L 4DQOL 4F37F 5BRZA 3MNWA 2IGFH 2EXWD 4WY7H 1EV2E 3REWA 2B5IB 2MSPA 1A7OH 5D1ZB 2OX5A 3QEQA 1CFQA 3PDDA 1Z9SA 1PEZA 3MODH 2VDLL 4HSQA 1FLTX 3KPSE 1I1FB 4F7EB 2CKBL 4NHUB 3V52L 1NAMB 1SVZA 4PGDA 4ZFZA 4JDVA 2BVPA 4BK4A 1F02I 3ARRA 4H0HB 3CFKA 4NQSB 3P9MB 3BP6B 4GW1B 1HHIA 1H3XA 5DD6A 5I19L 1SY6A 4FHBD 4K7PX 5EBWA 1B0GB 4TPRH 1G1CA 2VDLH 1N6VA 1XIWD 4FS0A 1ZLVH 4LHUG 4R3SA 4P46C 5ID0B 5CZXC 4QOKA 1QD0A 5HHNA 1CFSA 3TYGH 1JWUA 4ZDHA 1EHAA 1FBIL 4NN7B 5FUCC 1J12A 4HT1H 3CPLA 4PJCE 1FGVH 1IC4L 4CU7A 2EXYD 3K8MA 4YHPB 4NC2B 4PRNA 5FKPA 4YIQB 2P5ED 4MNQE 1FL5B 2LAAA 4H8WL 4Y16A 3SQBA 4EI5B 1A6AB 2AK4A 3UJTH 5CD5C 1IEAB 2ED7A 5GZND 2VRAA 2R0KL 4AL8L 4PJAE 3V0WL 4LLMA 3GHBL 3BX7C 3ZE1F 4FQHB 4JCMA 5CS7A 3VXNA 3RU8H 4MCYA 1JMZA 2MPAH 2YA2A 1IC4H 3QFJB 1G0YR 5MI0B 4U3HA 1MELA 1RZGA 3ZKNC 2BSSB 5KSUB 3FL7A 3MRIA 3U6RA 2EDTA 3U9UB 3RWEA 1OT1A 1ZT4A 2X4QA 5A16B 1RIVH 4J3SA 4R6UA 2H26B 4N0CD 1FORH 2ICWA 4MNHB 3I2CL 3EJZC 4WTZG 4MDJB 1RMFL 1VERA 3KWWB 5CFHA 2F54D 2JIXD 4G8GB 1MCPL 5F3HA 1T04A 4XX1E 1C8PA 4N5EC 5HHQB 5HVHC 3CX5K 1OB1A 3H7BA 1UQSB 2I9LA 2A6KB 5DC9B 1AP2B 1TZHB 3VFUA 2P8PB 5F7FA 3I2CH 4NNXA 5F7WC 3X13B 2BNQB 5BS0A 5JIKA 1JJUA 1W0WA 4LLDB 2EH8H 1JZ7A 3WUWA 1PG7W 2P8LB 1DUZA 1M71B 4KMQA 3MRNA 2GTZA 1DUYB 4LLVA 1WV7T 3FFDB 2XQBH 1NCNA 1JF1B 4U2ZA 2O93L 4XBPA 5I6XB 4C59B 1CFBA 3QAZC 5J11B 5KN5B 1HQ4A 1ZHNB 3G6AA 2N1KA 3NZ8B 2DICA 5HYJE 3FO9B 3WBDA 2XT1B 1S7TB 1A6TB 3ZTJG 2AJYL 3UZQA 1X5LA 5GS2D 4ODUB 2VE6B 4OIIL 1WAAF 3CDFA 5E8EB 4HJGA 1U3HD 4X0KA 1FIGL 3MJGX 2X1XR 3NH7H 5GRZA 4U6VL 2EYSA 4RFOL 3QEHA 3TESA 3OB0H 3O3EB 5B3NA 1FL3B 1XIWC 2JLLA 1JYXA 1T1YA 1KCLA 3QDGE 1ZHLB 2OMNA 1W0VB 3U83A 5T5FL 1P9MC 3WJJC 5GGTL 1UWEH 4G42A 2OR9H 1U95A 2ZPKL 4Y1AE 4G80A 2EECA 3IDIB 2YUWA 3NMEA 2VLMD 1NBYA 4CJ1A 3GJFB 2UUDH 5HI3D 5KJRH 4RRPG 3ZLQC 1MHPL 1MLBB 3QIUA 5B4MC 5IV2B 2EKSA 4M61A 2BJML 5FHAL 3DLQR 4PFEA 4JPIB 1YPZF 1RUAL 4JE4B 3ZTJH 4N0UA 5T5FH 5J13B 1LP9B 4M00A 4YXLL 2BDNL 2Z93A 5HHXL 3AROA 2DIAA 4NZUL 3O11A 1NCWL 1LEGA 5DQDH 2FDBP 1KTDB 3GI9L 1I8KA 5IQ9A 1PW3A 5CWSB 1K85A 1R3LA 2YD2A 3FCTA 3EUUA 4HWUA 3BAEH 4WV1B 4PJ5D 4E0RB 3WIHH 3T2PA 5DD5H 5TDPA 8CGTA 3WHE1 1KCVL 4HX1B 2F15A 3HRZA 3B9KA 5I30H 3MXVL 1NCWH 1NC4A 1V3LA 5D7LB 3IFOB 3GI9H 4OBSA 4ETQA 1L6XA 4PBXA 3MA7A 4D0DB 1JBJA 3C60A 2Q86B 1AR1C 2WV3A 2JB5H 1WBXA 4MA1C 4JQVC 2X9WA 1KCUH 4E41E 2UVFA 1I7ZA 1U8MB 1A6WH 2GHWB 3AXLB 2F53B 1U93A 4GAJL 4ESKA 4Y4HB 4P9ML 4RIRB 3T0EE 3AREA 2FWOB 3CLEL 4XPGH 4ZUWB 3SJVE 2PUQT 1VPOH 4OD1L 5JW4N 4HKZA 4DW2L 2DN7A 4XNXH 1WISA 4ERSH 3DPBA 1CF8L 1N59B 2DQIH 2GAZA 4LL9A 5JW4Q 1N64H 4HCRL 4IIQB 2IPTH 4L5FH 4OFIA 5D7IF 5TH2B 1INEH 3WFDL 3W39B 4GXVH 1UJ3A 3RGVA 1M05B 4JPVH 4GQPH 3U7WH 3GMLB 4GRLD 3ARBC 3HLAB 3BP4B 3IFLH 4EXPX 1JZ3A 3V79C 4PS4H 4JM2C 5HHOA 4LCCC 3RA7L 3K2UH 3K7UA 3TJHC 4OD1H 3PWLB 3U0WH 1RHHB 4LHUD 2XN9E 4L4TA 1JTOA 4HGMA 2JTDA 2LTQB 1J0HA 4WEUD 3G6DH 3O4LB 1G7LB 2C3WA 4UOW1 3RZCD 3QI9D 4OQ1A 3E1F1 2B8OT 2JB6A 4PJDF 5I1AA 2A9ML 3EOYG 3KXFD 3HR5B 4EKXA 5IMKB 3BKYL 4UMGA 5AUMA 4M43L 1J1PL 2Z31B 2EE2A 3QUZB 1F58H 4LLWB 4DUVA 2DJUA 4R0LC 1OCWH 3LY6A 3HRPA 4Y4KC 2VH5L 4UB0H 3WFHB 5DJYB 2F9BT 5I1JL 1TCRB 4IRSA 4YE4L 2VLKA 4QXTA 2ADFH 2BHUA 1D6EB 1WSST 4S1QH 3BPCB 2X4RA 3L3KB 1OAUH 4L3ED 4HGWB 5CJXC 5E00B 2YK1L 1BIHA 3ROLA 3DX8B 4ZFGH 3D39B 1ZANH 3K46A 4LSTH 4KRLB 4QT5A 5EIIA 4KJPC 1A0QH 1J0YA 1BBJB 2GKIA 2Y5EA 3O9WD 1R0AH 3RTQC 2K7QA 1G1YA 4HK3N 3U48A 1JI2A 2X4UB 3JTSA 3OX8B 5T5NG 1NC2D 2ZOKB 1YNTB 3T8XB 4NQXA 4YHML 3TYFB 5ISZA 2WWKT 1G9EA 5KG9B 5MEQB 4Q74A 5CJ5A 4XMLH 3VD7A 2V6HA 2E9JA 2YHGA 5DD3H 3X3FH 2NY7H 3TT1L 5IWLC 1DDHB 2F58L 2ARJA 5IFJA 5IBUG 3MSPA 4TSBL 4NRXA 5DTFB 2F8VA 3OKLA 4YH6A 2XFXA 3ARPA 3O2DA 4YGVA 2Q8AL 3WE6B 4YHKH 5LG1A 3TVMD 4LIQE 1OY3B 4OLZL 3DMMD 4G8GE 4P57B 4QYOA 5EU5B 1BIIA 4CGTA 5C09D 3KHQA 1TITA 2WIMA 4Y19D 1WT5C 3JZ7A 4NUJB 2X1PA 5C1MB 2XRAH 3ZE0E 4Z7QE 2DQEL 2JE8A 3SGKC 5D2LA 4MJ2A 4G7VL 1D5ZA 3GMPA 3OJDB 2KZWA 1JTTA 4K71B 2Y6SD 2OTUB 2PR4L 1RV6X 4Y2DD 1FVCB 3ARFA 4PY7A 1JPFB 3VRJA 1ZLWK 4AM0B 5FECA 1AKJB 1IGML 1QFHA 1U92B 2YPLB 4X6FA 4QHUB 5LXGL 4XAWL 4G9FD 5IMMA 5IK3B 2X05A 5KTEL 2O5XL 2EIBA 3MRQB 4YJZL 4KAQL 4JM4H 3EBAA 4BZ1H 4ENED 1MHEB 3S96B 1EFXA 3T65A 1NLDL 2OL3L 2VDQL 5JW3L 3EOAA 3KLAB 5IB1A 3EDEA 3S98A 3OF6D 4FZEL 1LD9B 4JO3L 3CC5B 1CFVL 3K4ZA 3G04B 1U8LB 2VR4A 4NBXB 2O5XH 4IRJB 2WQRA 4QRPA 5D7SH 4YBLB 2WK2A 3FQNA 5JW3H 5D96B 4CVWA 1IFHH 3SE8H 3MRRB 4HBQA 4C56E 5JW5B 5DEFA 1FZMA 1WBZB 5IEKA 4OZIE 3GSQB 1VSCA 3VXQA 3C6SB 4HS3A 4EN3D 3KPNA 3U0PA 5C0EA 1S9KC 1JNNL 1FDLH 4ZTOL 4NM4L 5GGSA 1TPXC 3EJYC 1PEWA 5EO9A 1LO4H 3ARQA 1W8NA 3I3EA 5BQ7B 1EVUA 2D2OA 4M7JH 4JN1H 4R9HA 4XCEA 3MR9B 1W8OA 4WI8A 4XP5H 4ZO9A 1LP9E 3U2SB 4DGVH 3B2VL 4M8QB 3AGVA 2BVOA 2B2XH 3G5XA 4IOIA 4DZ8B 1FAIH 1WFNA 2DB8A 5DZOA 3B6SB 4LDEB 4HIHB 2AEPL 1KIRB 3ULVE 1CT8A 3UYRL 1T5WB 1D7FA 4IHOB 1FE8H 3MGOA 1MQKH 4J4PD 1JWMB 2QTEA 1B0RB 1FZOB 1CDGA 3BPLB 4G8IA 3QSKB 2VO5A 1T3FB 5D7LE 2VLLB 2Y5TA 5A2KH 5DHVB 4BQ8A 1NCAH 3ARYA 4I0KA 1OP5H 1Q9WA 4PJGB 2D03L 3MFGB 3DECA 2Q7NA 4UT9L 2AK1H 4PJHF 3MMEB 4NKOA 5IM7A 3FFCE 1WK0A 2CUHA 1K3ZA 4R4BA 5T3XE 2EO1A 3HZYB 5HVGB 1NDMA 3FB8A 3FRUA 4M7ZB 5HDOA 3FQXB 4KY1H 1OWWA 2GSGB 4YBHA 1FLRH 4UT9H 1KLGB 3F5WA 4GRMB 1CLCA 5JUEH 4KHTL 1JN6B 3L95A 4OLYH 4POYA 5F44A 5IT2H 3QDMB 1GSMA 2NPLX 5DMGD 2C1PA 2WBJB 3HE6D 5GSVA 3GUTB 3LV3B 3P9LB 2A83A 1RZIA 5DD0H 4NM8L 4HQQH 3GO1L 1DBJH 4HIXL 3IAQA 43CAB 1GGTA 3O4LE 2NY2C 4S2SB 1IGFL 3MFFA 3SDAB 1AD9B 3GMRB 3T1FA 1KCSL 5DRWB 1R24B 1BPVA 3ZE2F 1IAIH 4QCIA 4YDVA 3GSVB 3ZT5A 4EN3C 5ESAB 4BA8A 3WIFA 4JO2L 1CD8A 5IR1B 5I1CL 2OZ4H 4XPTH 5FUOH 5C07B 4RA3A 4ZO6A 4BSVB 1NCTA 3H9ZA 3PDOA 3EDFA 3S37L 1AQDA 3MV7E 3QEGL 1UZ8B 3QWOA 1XH3A 5FYJL 1IGTB 4LLQA 2WP3O 5ADPH 5C92A 5DI8A 3IFNL 3EFFA 4LRNH 1MREH 3GHEH 1XCQA 3D39E 3BWAB 4K94L 4UNTA 4M93C 4L29A 2AV1A 1CDIA 1K4CA 3QEGH 3DVIA 4LGRB 3S4SA 3VXPA 1MIML 3MRCB 1F4YL 4NO5B 1VFUA 5FYKL 3RUGA 5F9OH 2PYFA 4XP1H 4BQ6A 2VLJA 3MREA 2V7NA 4OLUH 2WNGA 1IAIM 2B20A 4OZGB 1JGDB 3X11B 3KJ4B 3PV6A 5HJ3A 1X5ZA 1U8HB 5BJTB 4K7FA 1MIMH 2ZUXA 1U41A 4U1GB 3ULUE 2I24N 2BOBA 3H9SD 2BNRB 3QZWA 5FYKH 4F33A 5SWSA 4UBDD 4FQCL 2EE6A 5DJCA 5DUBB 32C2B 2VDPH 4P5MB 4PPTA 1NAKL 1VHPA 2HRLA 2VWEC 4PP1D 4FQXB 5ESVA 3LIZL 4NJAH 5AYQA 4H0GA 3TBWA 4X83A 2QSVA 4KK5D 1IM9D 1YMHA 1SJEA 4G8EB 1N6QH 2YD7A 3IJYB 1ZSDA 4LSPL 4W68A 2A6DB 5HPMA 1SY6H 3QA3A 1PAMA 1TTGA 2C1OB 4Z7UE 1ZAGA 4GAGL 4F57L 5JQHC 5MEPA 5DMGC 2EDWA 3FHQA 3OB8A 3ZYZA 4KPHH 3MX0A 4JQXC 4HHAB 2P7TB 3A67H 4NOFA 4LDLB 5FYJU 3HPJA 3QRGH 2RBLA 3S6CA 1P1ZB 4YDLC 1R3JA 2X42A 3G5ZB 3TO4B 2F5AH 2YMXL 3VMOA 3NIGE 3VCLB 4JY6B 4U6YB 4U1KA 2ADJB 1I1YB 5LKNA 5DZNA 4D3CH 4GAGH 1YECH 1XF1A 3O0RL 5KSBF 4TTDC 4GRWB 5GQBA 5IG7B 3VXTB 4YUEH 1T1WB 4NN6C 5CIPB 5F9JB 5F1OB 2EDHA 1FG9C 2APTA 2FX9H 2I60L 2ZUTA 3KPRE 5HHPA 4OKVA 5DQ9B 2HYMA 1CTOA 1YJDC 5KSAB 4JFFD 2EYTB 2YMXH 3CZFB 3TV3H 1J0KA 2ZCKL 3NGBB 1REIA 4QF1B 1DBMH 3O0RH 1FNHA 2MNUA 2R0WH 3VGAB 1LK2A 4GG6F 1TDQA 4RMWA 5D9SA 4LSUL 4OZHE 5I76A 1KF9B 3O6ML 4R4ND 2ATKB 5E6IA 4PV8A 1HHHB 2IAMA 4QGTA 3F6IA 1MJ7L 3CMGA 2R69L 4K07A 3L3IA 4EBQL 1A22B 1RHFA 4UDTB 4O5LL 2XY2A 1NGYA 3B3IA 3C08L 3GIVA 3CDCA 4J1UB 4OFYA 1ACZA 4GUPA 5C8JA 1DANU 3MLPA 3SHSA 1MJ8L 2C3XA 3ET9F 5I8OH 1Z2KA 4O2EB 2PXYD 5FA3B 4N0FB 2EC9T 4ODXB 3MRMA 1QRNB 1HIMH 4HC1L 4PJCA 6CGTA 3V95A 4OAWB 2EDLA 2IFFH 2EDQA 2HN7A 3QCTL 4HUXB 4NKIH 5KAQG 3PIQA 4UNVA 3EFDH 4NWUH 3BEVB 4NFDA 3JV4A 3X3GH 4PJBE 4CN6A 2A6IA 3MV9B 3E6HA 4KK5C 4GAYA 1X6LA 3UTZB 3QUXB 1WGOA 4X6CF 2BFVH 3HB3D 3K4DA 4O58H 2FL5A 4H20H 3J8F7 3QCTH 4PJGE 1S9YB 1HSAA 2HTLD 1I7RA 1PYWA 4LVNB 4KRPD 3KR3L 2Y06L 3F7YB 1HI6A 5E99H 3AAZA 3PGCB 1W0YT 2ZSVB 4GS7B 3V5HA 4JFEE 4AEIH 4I18B 4MAYB 5CINL 5DJAB 5LWYL 2F74B 1S5IL 4TUOA 4GO6B 3SGEH 4GG8A 5CEZE 3UDWC 4XH2A 1YNKL 3IGAA 1D5IH 3C8DA 3WJLC 2ESVB 4F3FB 1KT2B 3OSKA 5HDLA 2R4SH 3CU7A 1GHFL 5I8EA 1TVBB 5E2WH 5EC2A 5HYSB 1CE6A 1IKFH 3QDME 4WUUB 1G9NL 5HDBF 3LDBC 3L5IA 5BRZD 4HH9A 2GK0A 4RFNB 4Y5YC 5FYKD 2WSKA 3RIAK 4HW6A 1MFAH 3KYOB 4OJFH 3KYAA 2VIRA 4MCZA 1B4JH 1YNKH 4LNRA 3QEQD 1I3UA 3BKCL 5DJZB 3TZVA 3DV6A 4JANA 5C08E 1GHFH 2A77L 1T66C 1NSNL 1UB5B 3N1MC 3IDXL 3WDHA 1G9NH 3FQWB 3UROR 5ID1B 5K9OB 3D69B 3EYSH 3DO7A 2ZCLH 3IVKB 2R1YA 1NGPH 2FATH 2DQFB 5HGDA 3UP1A 1U3JA 1HZHL 4HV8A 4TNVK 1P7HL 5DVOA 2ATPA 4DAGL 3CVHL 1J8KA 5D7JD 5KVEH 1F4XH 1N4XH 3LHPH 4QOKD 2P8MB 4X4ZA 2JK5A 5ITFB 3P0YH 1FCCA 1T20B 1YYLL 3QDGA 2CKBB 3T04D 4HJJL 4P59L 3TBYB 1JHLL 4WGVB 5CCKH 2PXYC 3P11L 4JQIL 1CDJA 3VXRE 5EC1A 4NOBA 4UOJA 5EU6E 1HZHH 5HTSA 2P5WB 1NDGB 2NLJB 3R4DA 4Y5XB 5GPRA 4MLIA 5I8CA 3MBED 5EUOF 1CXHA 3VFNA 3O6LL 4DAGH 1A21A 1OP3H 5FYLL 5E2UH 4LCWB 2AK4D 4QRSA 3VG9C 5E08H 5IHBA 4F15C 4NRZA 4PJEB 3L3JB 4PV9B 1FJ1B 2NXYB 4HJJH 3LKNA 2M2DA 1R3HB 4JQIH 3AU1A 3P73B 3I75B 1H5BC 1IQWH 1IE5A 3HNVL 1HXYB 3RWIA 2VUOA 1SJVA 4QRRA 3UJIH 3O3AA 4S1SL 4V1DA 1GL4B 4FXKA 4OZGE 3MCLL 4U1HA 2FLBT 5EN2B 5F8RC 3T3ME 1DSFL 3C5ZA 3KVQA 2J4WH 3CLFH 1LK3L 4V2CB 3SDXB 2J88L 4KGLA 3D25A 3T77A 4KRPC 1WZKA 1RURL 5EOTA 3WEXA 3AB0C 3L5XL 2XG5A 1AFVH 1F4WL 3VFWA 4QHLB 3UCRA 3S3SA 1WVZA 2GJZB 2YD8A 3B5HA 5DQJB 4XMPH 2XZQH 4N90E 4OSUL 4EQ2A 4XTRC 1J8HB 2J8UF 4NJ9L 3QFDA 4U6XA 5F8QC 3ARDA 2W9EL 5T1DL 2ICEB 3T0EC 1I9JL 4HS8L 4HF5H 3H42H 5HYEA 4F9LC 2F8OA 1NFDF 1CGYA 1E0OB 2LV4A 1ORSA 5C2BL 3LSOB 1IGCH 4EOWL 5BS0D 4RGMB 1A7QH 4A6YB 2BC4B 1PLGH 3RVUD 4IOSD 43C9A 1BBDL 4G8FA 4S1RH 3LH2H 4NJ9H 5IB4A 4MQ7B 1GXEA 3E2HC 3HCVB 1ZHKA 2WLYA 1NGWA 1JZ6A 2G5RA 5C0JA 5I1EL 1I8MA 3LCYA 4LARH 2VXVH 2D4DA 3NFNB 1PGRB 1NKOA 4HZLA 4TUJA 1KACB 3LKOB 1TJHH 3HI5L 4GXUN 4YPGB 3ISWA 4HXBH 1AIFB 5C0BA 2AXFB 2Y7QB 1GOHA 2BSRB 1BBDH 3C6LA 5L2KD 1UWXH 3RL1B 1YEEL 4YHIA 3LZFL 5FA4B 1TNNA 4HS6B 4N8PA 4PGEB 1Z9MA 3WFBL 1IL1A 3BPOC 3O2DL 4ODHH 1F8TL 5I9QB 2QR0B 1N7MH 1BD2A 4Q9RL 5D7JC 4JO4L 1CN4A 1ND0B 4XBEH 3VFTB 2G75B 4XP4L 4QWWD 1AHWC 1UCBL 4XCFL 2DD8H 3BGMB 2FB4H 2H2PC 3SDCB 5BV7C 5D1ZA 3V5KA 1IMHC 2YPVH 2NNAA 2QSQA 5F7HA 4R4FH 4MZ2A 3O2DH 1I1FA 1P4IL 4F7EA 4YHLL 5SV3A 3MBEC 2BCKA 4NHUA 1WIUA 1JGUL 3QIUD 4WWKB 3V4VH 4ZUTB 3BO8B 4YHOL 3ROOA 4NQSA 3P9MA 1YEIH 5EU7E 3BP6A 5DT1L 4GW1A 4CMHB 3CD4A 2BNUB 4NN7C 1G7PB 5HYQA 1RZ7L 3DV4A 4M7LT 4I0CC 2JJSC 2YPKB 4KZDL 1JF5A 1RFDH 3BDXA 3MRLB 5T3ZH 1U58A 5ID0A 5EOQL 1FSKB 4ZG1A 3DVNB 2P44B 4XI5D 3DARA 4X6DB 4KRNA 4BM7A 3O41B 5JW4M 4PLNC 4ONOA 3SKNB 2UWEA 5EORH 4YHPA 3KHOA 3P30L 4XVUC 1LILA 4YIQA 5I73B 3QO1B 1FL5A 5F96H 2XV6B 3MO1B 1P69B 1YMMA 1NC4D 4EI5A 1A6AA 3DRQB 1IEAA 4LPUA 5J3HD 1J11A 3C60D 2ZUUA 2YXMA 4X9HA 4FTVB 4MAUL 5EIQA 2GJJA 1Y0LB 4JFYA 4ZD3H 4KFZC 3QFJA 4MJIB 4AQOA 2E6PA 3VI3E 3UJJH 1SM3L 1A4KB 2AEQL 3HE7A 2QADC 4LOUD 1IAOB 2BSSA 2EEDA 5KSUA 1AO7B 1OLZA 1S9WA 5KZCD 3U9UA 3ARED 5C0IB 1Z3GL 4JPKH 3RDTC 4XPAL 3GK8H 2H26A 4X5LA 4LDOB 4YAQB 4H88H 4MNHA 4MDJA 4RAUB 3KWWA 3HPLB 2BY3A 3PWNB 2CSPA 3QRFM 3RGVD 2C9AA 2AEQH 3O6KH 3U46B 4KUZL 5EBLB 3TWCH 4JFQB 5GGSY 2VLRB 4G6JH 4PBWD 2DMKA 5HHOD 3DI2B 1Z3GH 4KWUA 4XPAH 4OFPA 1AP2A 1TZHA 2ESVE 2P8PA 1MI5B 3X13A 2BNQA 1C12B 4LLDA 2CDFB 2E7LA 2P8LA 5DVNA 2X4OA 5EFIB 2YEZB 4FQLH 4KUZH 2DQCH 1W72B 3FFDA 3QIBC 4QWWC 3V6OE 1HINH 5FO9B 1R3KB 4JZJC 5KN5A 5IW1B 1ZHNA 3ZSSA 1Q1JL 2HLFD 1JUFB 4NZTH 4XWOD 3NZ8A 3MJ9A 1JGVL 3CFJB 4KHXH 1FO0A 4QXWA 2D0GA 5DO2D 5KS9B 2HVJB 3KYNB 3MXWH 1S7RB 1S7TA 2IPUG 4NC1E 4IRSD 1A6TA 2VLKD 1KB5B 1VFMA 4R2GC 4ZODA 2XWBB 4ODUA 3VD4A 3AY4C 5E8EA 2AV7B 4L1HA 1LDPH 2LVEA 3WNOA 3V4UL 3MLVH 1CLOH 1WAAE 3EHBD 3O3EA 1CGXA 5HHMD 1FL3A 4HXAL 1ZHLA 1W0VA 4HWZA 3FJTA 5E7BA 3O8XB 1NGQH 5J13C 1V7NL 2DTSA 4X4YB 2P5WE 1YEJL 3WS3B 5BZWB 5KOMC 4P2RB 4CVUA 3IDIA 4HIIB 5J9PB 1MUJA 4HWEH 1Q94B 1J86A 4LCWE 4JPWL 1MLBA 5IV2A 2DI9A 5ISZD 4P9HL 1CZ8H 4Q6IB 1V5JA 2RCSH 1X5JA 1MCNA 3HN3A 3ULVC 1EH9A 2WIIB 3OXRB 4RMRA 3MJ6A 1YPZE 1MSPA 4D0CB 2YR3A 5F7DB 2L7JA 1FPTL 1R5WB