3IDXH

Crystal structure of hiv-gp120 core in complex with cd4-binding site antibody b13, space group c222
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
231
structure length
229
Chain Sequence
b'QVQLVESGGGVVQPGRSLRLSCAASGFTFRNYAMHWVRQAPGKGLEWVALIKYDGRNKYYADSVKGRFSISRDNSKNTLYLEMNSLRAEDTAVYYCARDIGLKGEHYDILTAYGPDYWGQGALVTVSSASTKGPSVFPLAPSSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 HxBc2 gp120 core
publication title Structural basis of immune evasion at the site of CD4 attachment on HIV-1 gp120.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
total genus 38
structure length 229
sequence length 231
ec nomenclature
pdb deposition date 2009-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3idxH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3idxH01
3U7YH 4OLXL 2DLTA 4ONFH 5FDWA 4KPHL 1I1YB 3IAPA 3KPSB 3SDXE 5KVFH 5D2LA 4JFPA 5IMOB 3DVFA 2WANA 5ITBH 2FB4L 1TCRA 3ULSA 2NR6D 3MBXL 1GIGH 3L3JA 5B21A 2CQVA 3DWTA 3MRMB 5HYQA 4NFDA 3BFOA 3OV6A 2EYTB 4X6BA 1RZFH 4RFNC 3BAEL 1ZLSL 3BXNB 4XMKL 5CMAB 4JFEB 4PBWD 4W68A 3RZCB 2WZPD 4YUEL 5EOCL 1OWRM 1S7VB 2ATKB 3C08L 1RUQH 3PV6B 2CGRL 4OCWL 1SJHA 4NNYA 1BFTA 1I85C 5J6GA 3H7LA 3QI9A 1N0LA 5E99H 1C16A 3FAXA 3L5XL 5HHMB 2BP3A 3C5ZD 2EDBA 4P2QA 3GMNB 3LRSA 3G5XB 1S3KH 4LGPB 4Z7OE 3RI5K 1K4DA 4DK6A 5I66A 2EE6A 4L4VA 4RISH 1EHNA 3RIFK 3UXFA 3WIHL 3VXME 4MAYB 1EEZA 4GAJH 4XZUB 3NA9H 2AJ3B 4RDQG 2LTQC 4LLYB 1INDL 4PGBB 4X6CA 3WE6A 4L8CA 4KZDL 3S36X 3WHE0 2ENSA 1U8HA 5DK0B 1F58H 2QQLL 1QLEL 3GM0A 3CH8A 1X5XA 4OI7A 4XAWH 3B9KD 1CLOL 3RWJB 4MZ2A 1JNJA 5GISL 4P4KA 5IFAL 2FIRT 3CSGA 1YQVH 3QDJD 3ZKNC 4GFTB 3O3EA 4P3CH 4I9WE 4LLAA 3EO9L 4XNUH 1G6RH 2VN4A 3VFUA 5IF0B 1H5BA 3O8XB 3VGDA 1GAFH 3STLA 3BEVA 4G6MH 4CVUA 5DUPL 3H9SB 3BRFA 4X5XA 1FCCA 3OG6B 4XBGA 2F74B 5KOVC 4MNQE 1NC2A 1HSAB 1MQ8A 4RMRA 1U92A 5J9PB 4BSWA 3OXRA 3D0LA 4PRIA 2ZUUA 1F4YH 4FTVE 4WHTB 5JXEC 1UH2A 2CXGA 4NKIH 4NQEA 1NUFA 1XIWD 4S1DD 3DX9A 1H3VA 5DFWH 4KI5E 3D18B 3G5VB 2YC1B 1S7SA 4YE4H 1HZHH 3WXWL 2MCPH 3RWDA 4EBQL 3TBTB 3S96A 5ISZA 3MSPA 3QQ4A 3QG7H 5IB5A 3HI6L 4P2YA 1TVDA 1INEL 4MD5B 4Y4FC 1RZJL 1EJ6A 3MGTB 1UG9A 3E6HB 4OCXL 3ZYIA 3X3FL 4EI5C 2ZCKH 1FFRA 5ILTL 3H9YA 1NBVH 1QFWM 5CP7A 2F5BL 4G42B 1I7TB 2X09A 1A4KA 4PV8B 2FJHA 1T4KA 1T5WB 2W9DL 4P5TC 1P4IL 2D7NA 3IDUA 4YO0B 5DI8B 4ZTOH 3D3VE 5J1AB 5EWIL 4O02L 1MJ7L 3FB7B 1GZQB 1U3ZA 3KYNB 1ZK9A 5JMRA 1BJ1H 2VXVH 2OTPA 1YMME 2BVPB 1LEKB 2J7LA 5DD1L 4Z8FH 4U6HA 3T08A 3V0VA 5L2JB 1AKJA 1CN4A 1XT5A 5DMIH 4R7DB 1BLNA 2WBKA 4JM2C 4WI7A 3V5KA 3RIFF 1H15B 3KPRE 2CLVB 4TYUA 4X80H 5D1XB 4UINL 4JO1L 4M62L 2VXTH 4OFPA 4EN3A 3B9AA 3LCYA 1AGFB 2HTKC 4A6YH 1YYML 2ESVA 1W0YT 4JHBA 4RFEB 4GBXB 3WHE1 3F7VA 3QNYA 4WI2A 1Z9LA 3CDCA 5MERA 1S7WB 4HEME 3OJVC 1A0QH 4X9GA 1IC4L 1T21B 3MV9A 3UBXA 3C5SB 4J8RA 3WS3B 2VLKE 3C8DA 1OW0A 4NKDB 3SGDI 5J13B 3GUTB 4WU7B 1R0AL 1JPST 1RIHL 3TNNB 3QHTC 3FFCE 4KRPC 4QCIB 2OSLA 1L9NA 3FAWA 3LEXA 3ARGC 5E5UB 2R1YB 4Z6AT 2EDEA 3VXOB 1NLDH 4V1DB 5EU5B 3VXUD 1JWSA 1WUNT 3U6RA 3HPLB 4UMGA 2OXGA 1T1YA 4UQ3A 3RVXC 1U8PB 1T2XA 1Q0XL 4XNYL 3RL1A 5GRJL 1ZT1B 3UDWA 5F97E 1F6LL 1GGUA 4NRZB 1FFQA 4P5KA 1AIFA 4DKFL 3LMJH 4I8DA 2VQUA 3PDDA 2HTLD 4JG0H 2OJZH 3NAAL 1H8SA 4UDTB 1T6WA 2EKSA 4BH7B 1YY9D 3BKCH 4TVPD 3V0AC 3QNXB 4PJBA 3S8WA 4NO0B 1YEEL 5E8EA 5GGRB 3O9WD 1MCBA 3TBVA 1K8IA 1X5KA 4WI5A 4WW2A 2P8MB 1BM3H 1Q38A 4O58L 5BS0E 4U1HA 4Y1AA 1GRWA 3EKCA 4N0YL 4RQQB 3GMMA 2OL3L 1G1YA 3QUYB 3SPVB 3L3DB 3PDOA 3BE1L 4RBPK 2WQ8A 2APFA 4JY6A 3WLBB 5DRZB 4GUPB 3T0XA 5HHQA 4LLDB 4MWFB 5DC9B 2L7UA 1KCRH 2MKLC 4PLKD 5TJWK 5D72L 1WSST 3QXAB 5HGHA 3C8KB 1JHTA 4G7VH 5B38G 1CK0H 4HPYL 4G43B 3PJSA 3ARWA 1PVHA 4JGUA 4AIXA 5C6TH 1P2CA 4FQXB 3VXSD 3G04B 3BZDA 3U46B 1UB5B 4XVTL 5FO8A 3QIUD 3L5HA 4HV8B 5ISZD 4P2OB 5MENA 5AZ2L 3KPLA 3EGSB 4R96A 2W1NA 1JFQL 3RUGA 4OZGE 2XZQH 1YNLH 3TIDB 3I9GH 1MPAL 1RU9L 3FKUS 4K7PH 1A6WL 3PNWA 5CEZH 2C3HA 3GSOB 4LARL 5IMKB 2I60H 2GK2A 2WNGA 1J5OL 2KDGA 3GM8A 1X5YA 2J6EH 3E1F1 5EIQA 1EFQA 5GSVB 1LK3H 2WLZA 1S9XB 3HNTL 5ANME 4HIEA 4C58B 1BP3B 3O6FC 4UNTA 2WM0A 5KVDH 1UM6H 3HS0B 4I13B 1QNZH 4X99B 3C9NB 1MAML 1G9NL 2BNRB 2RFXB 3TA3B 1QRNA 4OTXH 4M7KL 2NW2A 2OMNA 2MKWA 2QSCL 3K1DA 4N0RA 4CADB 1S5IH 5DYOA 4MXVE 2BFVH 3E8UL 4OIAA 3A6OA 1QEWB 3B5TA 3OG4B 4XB7A 4IRSC 4Z7WF 4OLYH 5F8QC 4KXZI 4LLVA 2IAND 5JDSA 4K55A 1AO7D 3U36B 1N2RA 1A1MB 5EUOB 3S7GA 4QKXB 4YHLL 5KANI 2CDEA 4MQ7B 5I30L 1U3HD 2EDKA 4PJ7B 2A74A 2ESVD 2W9EL 1JF1A 3QQNA 3QDME 1YEDA 1T89C 4DKAA 2VDPL 1XGQA 3GBNL 4IOFD 3WIIH 3MV9D 5HGBA 2IPTL 3QPQD 5DSCB 5EULV 3GIZL 4QXUL 5E9DE 2IBGA 2OS7A 2YBRA 2VE6B 4QOKE 4ETQB 5HDQH 1A6VL 1OL0A 3FZUD 3MLVH 2D0GA 4OKVA 4RGMC 3D0VA 3ARRA 3CVHA 1YY8B 4CW1B 3FFDA 4D9LL 1MAJA 3KPQA 1CGSL 1ND0A 3KPMB 4HWNA 4FP8H 2XZCL 3U9UB 3MNZB 3U7WH 2DYPD 3RY5A 2AEWA 2ZUSA 3HZVB 4FFWD 2CDFA 1E4WL 5CUSH 1A7NH 2VDML 2NY6D 1PKQA 3MLUL 3TLRA 1CWVA 4CBPA 2GJ6A 2P5WB 3GRWA 1X4XA 1ITCA 4GT7A 2Z8WC 4KH2A 3MGOB 1WF5A 3MZTA 1L7IL 2H1PL 4PGJA 2YR3A 3RHWK 3TFKC 3JTTA 3N06B 3WNLA 4XVSH 1K5NB 1BQLH 1NCCL 3P11L 1HQRB 2R23A 3IJHA 4BQBA 1CDBA 3RKPA 2NTFA 4HG4K 3UP1A 4M6ML 5T3ZD 2YD6A 1RIVL 3NH7H 4Y1AD 5EC2A 1NLBH 1MFCH 3SDAD 5DS8A 2VZTA 1UJ3B 1DCLA 5BW7C 3L6FA 2X10A 1UCBH 5T5NF 2DJ4A 3FHAA 4KFZC 5INDB 3M1BA 5C0AE 1VEOA 5I1AB 2ZG2A 3O6ML 2GUOB 4UV4L 1JPFB 2W0KA 5BJTB 5ADOL 1GC1C 3FTGB 3RDTC 3OJ2C 3T4AB 1A64A 1IQDB 1S9KC 3LKQB 4OF7A 4PJIA 3PWPD 5CSZA 1SVCP 1P6AB 3AS3A 3TZVA 3ULUL 1FZJA 3HNVH 1MIML 4L8BB 1ACZA 4ZUWB 1N7ML 2X4UA 5GGTA 4HULB 2JIXD 4H1LG 4Z7VA 3LKSA 2NX5E 5BVPH 5C0BA 5MEND 1GJIA 3SCMA 3TN0C 1PYWB 3EYFB 3T4YA 4MLIA 2OI9C 4IDJH 2DIAA 3CZJA 2BOBB 3PUCA 1KBGL 3V7AG 5CCKL 5BV7C 4JO4L 5DA4A 1I9JH 1MCWW 1UM4L 2E8ZA 3F7YA 4DOHE 4NKOB 4ZNEE 1OLLA 1OD7A 1UC6A 2QLVB 1B88A 3DVNA 1TPXC 3B9EA 3ZKXB 2CK0L 5KSAD 1QSFE 3MRJB 1KPVA 4PJGB 4AIOA 1A9BB 1RFDL 2DQIH 1CDGA 2FEDC 1FAIL 3GB7B 5DRNA 4LEOB 3FL7A 2M1KA 4NN7B 3DURA 4J3VA 2SEBB 3S37X 3S3SA 3IU4L 1KXTB 1KTDB 5HYSA 2NYYC 1Z5LB 3HAEG 4P23B 4JPIA 4UUJA 3OF6D 5BCAA 3VFMA 4Q0XH 2ICCA 5IEKB 3MLZH 4H20L 1Y6KR 5F3HB 4WUUB 4PUBH 3IAQA 3QCVL 4OM1H 4YAQA 1IGFH 1BX2B 1G1CA 3ROOB 1HIMH 5DVOA 2H32H 1INQB 2FH6A 3T0DA 3JWOC 3L3GB 5JOPE 1J1XH 3F6LA 4QY8B 4DVRL 1HQ4B 5F96L 2VLMD 5EBWA 5CIPB 1UXSB 4M5ZL 4ODXB 5ERWA 2W0LA 5B8CC 2WBJC 4TUJA 3VXRB 3PDGA 4D9RE 2CKBB 4Z76A 2F19H 1P4BL 1WZ1H 3VXMD 4Q9CA 1D5BB 3BKMH 3MUGA 3W0WA 3TNMA 3BGAA 3PG2A 2VL5B 1J0KA 1NAMH 2NXYB 3ULVC 1U8KA 1PQZB 3SDDB 2JE8A 2YK1L 4FG6D 4I2XE 3RHWF 4LCWA 3T3MF 3PXHA 4F9LC 3CXDL 1TETL 4H1LH 1O5DT 1U41A 3K4DA 4GQ9H 4WI9A 5FOJA 5B3NA 4U3CA 1CG9B 1U8NB 3WD5H 4WW1B 1EUTA 3PGFH 3U30B 4Y4KA 4E42B 1OGAA 1X9QA 4WEBH 4FHBD 3MRRB 2XTJD 4R0LC 5IQ9B 2OYPA 3MMEB 4I9WD 2I07A 1WEJH 4AL8H 1ZT7A 2YPVH 1FYTE 3CLFH 4IIQC 1U8OB 3QIBC 4XNZB 4OZFA 3MRHA 4OUUB 1ZA3A 2F9BT 4ODWB 5C0CD 2C3XA 2WUBL 4DCQA 1OM3H 2A77H 5B39B 1WZKA 1FNAA 3PHOA 2GW5A 1MJUH 1I7RA 4MNQD 1N4XL 1U42A 2DTML 3KDMA 1HHIB 4OD3H 5I18L 3C60B 5DGRA 5D8JL 1Q0YH 4LSQL 1FE8H 2XI9A 3AM8C 3WFBL 5JW4R 1V3MA 3DXAE 3IDGB 5JXEA 2DD8L 3MRKB 5F7DB 1MCIA 1QFPA 2JJUA 1QPPA 4L3EB 5HI5C 5HYJB 5J8OA 1YYLL 4EEEA 3HAEH 2EEBA 5ID0B 3VH8G 5IFJA 2A9NL 1JWUA 1RURL 4JQVC 5IFHH 4TNVK 4OLUL 3FN0L 4PJXE 5C70A 3HG1E 2YUXA 3AS0A 1AD9A 1QVOB 3MQIA 5FO9A 4RAUA 4PRHA 1DBML 5TDOA 3ESUF 3DRTB 3TM6A 2BHYA 4RAVA 5E2UL 3DBXA 5CIPH 3U0WH 4YHIA 1P53A 3GSUA 3RWFA 1DQDH 5D1ZC 4MAUH 4BZ1H 4LP5A 3G08A 1G7MB 3VW3L 1M7IA 1DLFH 4PB9H 3PABA 1CT8A 3QFJB 1IAKA 3ARDB 4QRTA 5EU6E 2AGJH 4KTDH 4KV5E 1F3JA 3MLYL 1CGYA 4KKNA 5LBSH 1S9YA 5KZCD 4ZAKA 3SCMD 3CU1A 4M5YH 4P5TA 1DSFH 4GRLD 5EUOF 4ZFZB 1CGUA 1T7XA 3UJIH 4C56B 2XA3A 5CWSB 3TPUA 4NN5B 3HE6C 3S5LA 1F11B 4PJ7F 5EC1A 2R8SL 2L7JA 2VQTA 1IAIH 1MCEA 3BD5A 4XCFL 5CBAB 3V0WL 5JTWA 1YMMD 4LPTA 4EDWH 3L9RA 2XTLA 4NBYB 2VR9A 4P2QE 4IOIA 1QHOA 3CXHK 1QQDB 4P9MH 2B8OT 1A6UH 4KK8C 4L4VE 4IJ3B 3U0TB 5F8RC 4E9LA 1AXIB 3FB6B 3CFDB 4HK0B 1F13A 1AXTH 3GSXB 4G9DB 4X6CE 3HFMH 2P8LB 4LKXA 5FYKE 3OR7A 5F9OH 4LHQB 3ESVF 3FQXA 4I3SH 4S1QH 3OXSA 1MCCA 4MSWA 3FOLA 3QIWA 4F80A 2R9HC 3VGAB 3DSNA 2IFFH 5SWSD 2HVJA 1OTTC 3T0EC 1NC4B 3OGOE 1DANU 3CLEH 3ARGA 4RX4A 3O0RH 3U82B 1BD2D 4QRSA 1NDMB 4N8CH 5T5FL 1RZGB 3PWUB 3BDXA 4WFGD 1OAXH 4O5LH 4NZUH 2D7OA 4BFGA 2CRMA 4F7TA 5I1EL 4H5SA 1FIGH 3SGEH 1BBJB 5LAXA 2R2EA 4NQSB 1MFEH 4IMKC 2B5IC 3DJ9A 5CFHA 4QXGL 3VFTB 1FO0A 5C0FA 3VRJA 1FH5L 3QUMA 3SKNA 2Y72A 3TO4A 5D7LB 1MUJB 4GO6B 2MJWA 4ZPTA 3CUPB 1EJOL 4PRIE 1BGXL 4OFIA 5FKPB 2DS4A 1V05A 3L7EA 2NZ9C 3IKCB 4ETYA 1KJVA 3ZKND 5I8OH 5C7XL 4WFED 1BPVA 1ACYL 4PJ5A 5DVMA 1WC7B 5E56A 4TNVF 4LNRA 3VXQB 4GG8B 2XG5A 4QTHA 4FQJH 4YDIL 4WNQA 3EYSH 1ETZB 3SDCA 1UWXK 2HH0L 4S1RL 5BXFA 1WICA 4M8QB 3ILPA 2DKSA 1IQWH 1KCKA 4UIMB 2Y6SC 2CIIA 4L5FH 2A1WH 1CI5A 1U6AH 5E2WL 3DO7B 1YNKH 2IFGA 1CE1L 3C8HA 3ZT6A 2QSTA 5SWZD 2DWEA 2BNQA 4G5ZH 1W72A 4YX2L 2O5YL 3OKLA 1AGCA 2VUYA 3KG5A 1GGYA 4C55A 1IC1A 1XR9A 4N68A 4OLZL 1R5WB 1XF5A 3ZYOA 4RWYL 2EC8A 1KXQE 4B7IA 5L2KA 4L4JA 2XWTA 3TO2B 2GY7B 4FXKA 4UDUB 1Y6MR 3GSNA 1F6AA 1UVQA 3HI5H 4D9QD 4Y4FD 4BH8B 2V2XB 2MOVA 1IEAA 5F7EL 2YRZA 1BOYA 3OR6A 4Z0BH 2XFXA 4UZGA 4JQIH 2HWZL 1VGKB 2QKIB 3O4LE 2HT2C 1BEYL 4EI5D 2BSED 5IHUH 1WWAX 3INUH 3OKEA 3C5ZB 3R0MA 5EU7E 4X5LA 3BH8B 4LCYA 3S35H 3BPOC 4PGDB 1HEZB 1GXEA 3SY0B 1V3KA 3WUZA 1T6VN 2FX7H 2VXQH 2YEZB 4HUUB 2NZIA 4YQXH 5IEHA 3SE9H 3HPJA 4OFDA 2QV2A 4P5TD 5C0GB 5KS9B 1BVZA 5J56B 3P9LB 2A6DA 3MLTA 1JF5A 2VLJD 4U31A 3TVMC 4NZTL 1IM9D 4GG6B 3IXTB 4P2RB 3MBXH 1J8HA 3DRQA 3B9KB 4GXUM 5E00B 1H8NA 4QHNB 4JM2D 2XNAA 2F53A 4OV6F 1MJJB 2IADB 3TBSB 3QDJB 3T0BA 1U8IB 5E6ID 4GW5A 3KPPA 2Q6WA 1EUUA 2HTKD 3B2UC 4L29A 3ARBA 4WHCA 1XR8B 3C08H 5J57B 2CGRH 1TZIA 4G6AC 4OCWH 5IB4A 5DMYA 3QDMD 5IKCB 3HTLX 4H88L 4PD4K 4YPGA 1EHLH 4JZNA 5IB2B 1I8LA 2HJKA 5JPMB 4ZMAT 5FV1L 3ARXA 5CZKA 4PR5A 1CICA 2ZUTA 3PHQB 5GRXG 1XF4B 1MCPL 3SBWC 1P9MA 3QZWA 4U1MB 1KV3A 1M7DA 5IJVA 4PJHB 4POUB 4KRPD 3SJVB 3ES6B 2VWEC 3QFDB 4MJ4A 1INDH 3IS1X 1KJ2L 5D4QA 4KZDH 1OAYL 4X4MA 2MFNA 1ZHBB 4X6DA 5I1DB 1XIWB 1W0WA 2DBJA 1B0GA 3PWLB 5C0JB 4U2YA 5CGTA 2QQLH 1QLEH 4JR9H 3RVXD 3VMNA 1J0IA 3P4MB 2BVOB 1OAQH 5D7KE 5FKAB 4XP4L 4HBQA 3Q2CA 2CMRL 1FL3B 4YNYB 5IBUG 3UTTD 4IRZH 1N59B 2BOCB 3JTSA 1O7SA 4NM4L 5JQ6L 4BSVA 4YK4C 1E27B 2IQAB 1NH6A 1LILA 2FLBT 3F7QA 4LIQH 2RHEA 1IGTA 4MJIA 5I76B 4R6UA 4DW2H 2AK4A 2DB8A 5L6YH 4M7LL 3TYFB 5IV2B 1IGML 4YEFA 5I1JL 1N26A 1MFDH 3OPZL 4QHUA 5LXGH 3RY4A 2OM5A 3STZB 4DVBB 5DZNA 5T1DL 5K33A 5INCA 3BH9A 2D7PA 1SBSH 4TTDC 2W07A 4AJ0A 3R0NA 5DR5L 2ZJSH 2C7UA 4DEPC 5DF0A 3KPOB 4NRXA 3OKNA 2J88H 2R29L 4Y16A 1S7TA 5C0AD 1U58A 3SHSA 3CD4A 3ME0A 1CXHA 5IESL 2HN7A 3FO9B 3E3QE 1P1ZA 4DKDC 1J9CT 3QH3B 4OCYH 4NO3B 1BZ9B 4K07A 4FZ8H 3P4NB 4N8PA 4PGEB 3HI6H 3NFSL 4YZFF 2LU4A 5KSBB 2ZUVA 3VG9C 1INEH 2ERJB 4DUVA 1QRNE 2H9GA 1RZJH 5FUOL 5IR1B 5CBEA 2CRZA 5D71L 1BF2A 5CAYB 3TN0A 3KWWA 4WIQA 5C9JA 1MVFA 2BJMH 4HWBL 1ZHNB 1HOCB 2GY5A 3WN5A 1J12A 1S7QA 5C92A 3GI9H 3AROA 1I8IB 5M95B 4TSAL 1C7TA 5L8LB 3MYJA 4FMKA 3GKWL 4HZLA 5EN2B 5IHLB 1D9KA 1P4IH 5HDOA 5I1LB 1AD0B 3O6FD 1S7UB 4O02H 1MQKL 3GBLA 3NA4A 5EIVA 1SYSA 3E2HB 5CILL 3MRDB 4WY7L 5M94B 1QSFD 4QT5B 1JWMB 3MODL 2R0WL 1WZLA 3HMWL 5H35B 5DD1H 1LMKA 2OL3B 1NBZB 1UWGH 4JPKL 3QO1A 5D2NE 2JJVA 5BOZG 2UVEA 2HRPH 1G0YR 1OTSC 3A67L 5JUEL 2BVTA 1GYAA 1B2WL 4WWKA 3MOAH 4IRSD 4UINH 5IW6A 3I6LE 2NY7L 5EBLA 5GHWL 4QRPB 3QXVA 2IH1A 3I85A 3HR5A 4OD2B 4OGZA 3RZCC 2GKIA 5J7CC 3O6LH 3WDHA 1AE6L 5FYJE 1CD1B 4ELMB 1IAII 5FGCB 3RTQA 2X70A 4NQCB 3EDEA 5EO0A 3T1FB 1KG0A 5I17A 5JOPD 1XF2B 2R2BB 1T0MA 4NQDA 5DJAB 5GRZA 2WBJA 5B8CA 1G7LA 1RV6X 4GKSA 3FRPA 4O51A 4J4PC 1R0AH 4MB5A 2QADC 5JW4Q 1PKQE 2Z8VC 4Y4HA 2D31B 1A2YB 3LV3B 2ZSVB 4L9LC 3ZE0E 5M7QA 3EFFB 3PE9A 2B39A 5FO7B 5HHXH 5C07A 2PXYA 5I8CB 4ZYKB 4K8RL 3OKKA 2DQJH 1Q0XH 5E1AA 5GRJH 5EA0H 4KDWA 1MF2L 4ZD3H 4CU8A 4NC1C 1SQ2N 2ITCA 1L9MA 4DKFH 2HG5A 3IJYB 1LO4L 3IFOB 3X12B 3HMXA 1RULH 1J0HA 2I9LA 3QIUB 5ENWB 3CMOH 4LBEA 4MNGE 1LD9B 1KPRB 4XPHL 3O8XC 3FB8A 1MI5A 1QSZA 2IC2A 1YEEH 3JUZA 4Z95H 3MJ9A 3DSFL 2YD9A 1S8DB 3DROA 3BSZH 4O58H 3TFKD 1HI6A 5JHDD 5L9DH 4N0YH 5DTFB 4OT1H 1T1WB 5GGQL 1NAKH 5FB8A 3TF7C 3FQTA 5E03A 5C08A 3SQOL 4PJ8B 5DJ2B 1IAOB 1ORSA 4OF6A 4L9DA 3CSYB 4LCIH 3DXAD 2AI0H 4PRAA 2C26A 2DQEH 5CJOL 4JQVA 2AK1L 1SEBB 4Z7VE 1FFPA 2BVEA 4PP2A 5C0BE 3VMOA 5D72H 1F90L 2GTWB 4YHML 4XPAL 5JMOC 2P5EA 4HC1A 1JCKA 3LS5H 1GGTA 4TVPH 1FZKB 1AR1C 4HPYH 5F7NC 3BESR 3HG1D 1AQKL 4LCCC 3O3AA 2O61A 4ZXBA 2OX5A 4LGRB 4LHJB 4LEXL 2IANB 4OCLC 3RDTD 1VSCA 1DUYB 5TF0A 3O6KL 1AO7B 1CFSA 1YECH 5D1ZA 4Q2ZB 3C09C 1R6VA 4MJ2A 5T1LD 5HHOD 5AZ2H 3TBWA 5FOBB 2R4RL 3TIEB 1U3HB 3O4OC 1JFQH 4DN4L 4K71C 4XPTL 4OM0L 1G9MC 4GW1A 4S2SA 1MPAH 5A16A 4U1JA 4JG1L 4AG4L 4O2CB 3TN0D 4RNRA 1QUNA 2JB6B 5GJTL 1RVFH 2YRPA 4YC2B 4I0KA 1U8QB 2D2OA 3IDJB 3ARPA 2VC2H 1IKNC 3HNTH 4PS4L 4IEFB 2W60A 5CGYC 4XX1G 3EYQC 4Y5XC 4J3SA 1GC1L 3V2AR 3TYGH 1G9NH 4PGCA 1OGTA 2VR5A 2X42A 4KGJA 1QA9A 2QSCH 1AGBA 2AJSH 3NABL 4N8VA 1EIBA 5FYLD 4NJAH 1K4CB 1ONQB 2XY1A 4G6JL 2FEDD 3E8UH 4YXHH 1BIHA 2DYPB 1HHGB 5IHZA 1FORH 5ESQB 1U91B 5D1XC 3V4UH 3LD8B 4FXLA 2FD6L 4DGIH 1H3UA 3W0WE 3IRZA 5DO2C 2NYYD 3QUXC 4C4KO 1MLCA 1DQLH 2J8UE 5EUKA 5DJXA 5FYKD 3RNQA 3OB0H 4NHCH 4G3YL 3GGWA 4LCWE 4N0CC 3H3PH 1N8ZA 4LU5H 1FJ1B 3FQWA 2Q7YA 5J6HB 3GBNH 4JKPL 1P4LA 4UAOB 2A2QT 2VKWA 2X4OA 4I1NB 1Z2KA 5FYLL 3RWHA 1IM3B 4ACPA 3QQ3A 4APQA 4Q9QL 2BXYA 5I0ZA 2WBJD 4Z7WE 1MCDA 1OGAE 2VLRB 4DFHA 1A6VH 3V6FB 2X89D 3TP4A 3LAFA 3VFNB 1WIUA 3P9MB 3DUHA 3QRGL 3ULVD 1UACH 4YHYB 4D9LH 3PP4L 4I18C 32C2A 3SKOB 5D7JA 5C07D 5FYKL 4OF5A 2NQCA 4L3CA 1A1NB 4MQXC 2RJMA 4Y8DC 4HXBH 4AYFA 3GJFA 3MLUH 2J5LB 1FZOA 3I50H 3T1WA 2EO9A 1PSKL 4U6XA 3O41B 5EFIB 1C8PA 1FC1A 2E7HA 7FABL 2XN9D 4QRQA 4Y5VB 1WAAF 3QIBD 3WUWB 4OZHF 5KTEH 2W65A 5FM8A 3P11H 4N0FA 4PRHE 1MI5D 3B6SB 4HQQH 4X7CC 2BSRA 3X3GL 1T1XA 2ORBH 4HIHA 1DN0A 4M6MH 3QUYC 2PW1B 1KB9K 4M6NH 4JRYE 2X05A 3QJHB 2HA1A 4MZ3A 5JO5A 1GOHA 2JK5A 5IK3A 3IDNB 3OB0K 1IEBA 4XH2B 5C08D 3F58L 1DL7H 4J1UA 5GRUH 1N6VA 5KSAB 1OQXA 4HUVB 3FCTA 3GSVB 4JLRA 2A6JA 3UTSA 1GZPA 2BC4A 1G7HA 3LIZL 4UV4H 5K9KB 2DI9A 3FT3A 4M3JA 3UEZA 5F9JA 5BZDA 5ADOH 4W4OC 4HFUH 2P46B 4FQXC 3HI1A 1BQHB 4KHTL 1T20A 3NIDF 4JPWL 5I1IH 2IQ9L 3FOMA 1MCHA 1ZS8B 2IPKA 5EZOL 1MIMH 4IRJA 1A6AB 5T3ZH 4P2OC 2P44B 3UTOA 3UZEA 1N7MH 4XWOC 3BJ91 3MJ7A 5AYUH 5H2BA 1B0RB 1ZE3C 4JFYA 3O4LD 3BD3A 3CX2A 3ABZA 1Y6NR 3GMOA 5DVNA 2Z35B 3MROB 4KKCD 2C3VA 5CCKH 2YD4A 3MR9A 4G8GA 4JO4H 5ICXA 5LCVH 4D3CL 2AVGA 1TZGL 2X2YA 2LABA 3VXMB 5JLZB 4KQ4H 1H8OA 2GTZB 1EBPA 3HE6D 1HCVA 3SGKC 1JV5B 3MGAA 1ZHKB 2FX8L 2JB5L 3QEQA 2CJUL 1IBGH 3TA3C 3W39B 3L5WA 1CFBA 4KWUA 3QSKB 2NW3A 4LRIA 1RI8A 5DHXB 1RFDH 4HKJB 5I16B 1D5MA 1T04A 4DFIA 1WGOA 2A0LC 1FAIH 2H8PA 1ADQA 4NZRH 1B6UA 2F8OA 2IALB 3T77B 4XGZB 1FVDB 3FRUB 4DZ8B 3MXWL 2P8PB 3REWB 4JDVA 3MACL 1S7RA 3REVB 4OFKA 2XTJB 3ELAT 3EOAA 3JWNC 4UT6L 5F93C 1GGCH 1XEDA 5I1KH 3QCVH 1A6TA 1CS6A 1FNSL 5A1AA 2J3SA 4RFOL 4LFHD 1HSBA 2R9HD 2F5AL 1CZ8H 3WL9A 1D5XA 4M5ZH 4MNQB 4H26A 4DUWA 3BX7C 2EC9T 3T0ED 3BJLA 4R7NA 3RGVA 3SDYL 1P4BH 3TWCL 3P73B 2EDTA 1WV7T 2BZDA 4FTVB 4CMMA 4MA8L 1MY5A 4I0PC 4G80A 3N1PC 3MA7A 1VESA 4U7MA 1RJYB 4R3SA 1I1FB 1QLRB 2Y9RT 1WWBX 5JDJA 1R3KA 5D7KD 1IFHL 4JY4B 3MV8A 4M02A 5DWUH 4WU5B 4MJ6A 4LMQE 1H9VA 2Y07L 2V17L 3PGCA 3RWIA 4NDMA 5E2JA 2NZ9D 5DD0L 3NFNB 4XC3H 1T2QL 2IAMC 2FR4A 2BNQE 4C59B 2HP4A 3CFEA 3VFWB 5HD8C 5BMFL 5ICYA 1JZ3A 4EZMA 3HC4L 3T2NL 3OGCA 5EZIL 5HPOA 4LPYA 4U1KB 3RWGB 2YA0A 5I8EB 5KZCB 2P47B 1XH3B 5CJ5A 3NBNA 4AMKH 3DTXB 2G9HB 1N4XH 5J06A 2DTMH 3MRPB 4GRLB 2P42B 5I18H 5C09A 3WFBH 2UV3A 1MCFA 1ED3A 3D3VB 1WQVT 2DD8H 4P9HH 4YDKL 2Y6SD 5H94A 3V4PH 4ZUSA 4YHPA 1YYLH 1UJ3C 4NP4H 4UB0L 2YSSA 4D0BA 4HMEA 2A9NH 1RURH 2VH5L 2Q8BL 1YMMB 2AEPH 1KCUL 1JGDA 3FN0H 5AWNL 1HHKB 4BFBD 2XKUA 4LHUA 4NPYB 2AABH 2CR6A 3GRWH 1DBMH 2N7AA 2VDKH 1I1CA 5FA4B 3RA7H 5E2UH 4XP1H 4RFNB 4U3HA 1KC5L 1KGCE 5HJ3B 3VW3H 2ZKHL 1FNGA 4LDOB 1NGYA 1QP1A 2AJUH 2E6QA 3DECA 5T3XD 5HYSG 1YUHB 1Q94B 4Z7UA 3MLYH 3LS4L 3QEUA 2VLKB 3VWKA 2GITA 4HDIB 2NLJB 5ESVB 2HT2D 5SWSB 1FVEA 1EEYB 2F53E 3CSPA 3UC0L 1I7UB 1G6RA 5DXWA 4CU7A 3DX7A 1EO8H 3B3IB 1YA5A 3FFCB 3GO1L 3H7BB 5DD6B 4KHXH 2F58L 2GFBB 1BD2B 3VG0H 2OZ4L 3EYOA 1NDGB 4X5WA 1I1YA 1QSED 4FS0A 1WK0A 4XCFH 2Y5TB 2UVFA 3PWVB 5IMOA 2BY3A 3V0WH 3OKDA 1DEEB 2N4IA 2VIRB 3QEQD 4N5EC 2X1WL 1QFWH 4Z5RA 4MCZA 3TVMD 3ULUF 3MRMA 2EYTA 4HMCA 1VFUA 3ZE2F 5F88B 3BXNA 4JZJB 3MLXL 3RIAK 5CMAA 3RZCA 3KPNA 1ZHLA 2LE9A 1YJDH 4HS6B 1S7VA 2ATKA 5FYJD 4X4ME 1MRCL 3PV6A 4M1CC 3BUYB 3B2UD 4GAYB 1AC0A 1ERNA 2IGFL 4ZO8A 4G6AD 2JCCA 3QWOB 1MFBL 1WT5A 5BS0B 4F7EB 2OP4H 4ELKB 1X3DA 3M8OH 4MAYA 3GJEB 3K4AA 4XZUA 2AJ3A 4HSQA 4R4FL 1J1OL 3QYCA 4R26L 3SE8L 3NIFF 2GK0A 5T5FH 3FQRB 4PGBA 2ADFL 5I75C 1I3GL 4MJIE 2V5MA 2NXYC 3SDDC 5SWZB 4YBQC 5LGJB 1RJZB 2VDNL 4F7CB 3CVHL 1KB5H 4JVWA 5FYJL 5FHAL 4D8PB 4HT1H 1NEZB 3X13B 3RWJA 4UQ2A 5DGQA 4KDVA 4JGJA 3H9HB 5GXBB 5FCUH 4DAGH 1BGXH 3GMPA 3U30C 4K7PX 1A7QL 4QXTA 2X4SB 5IF0A 4LLUB 3U4BH 3SDXF 3OAUL 4OZGB 2EH7L 4JFZH 5BRZA 4XNZC 4BSJA 4QTIL 4EI5B 3QUZA 4JFHD 1JGVL 3HUJE 4FFYH 2Q8AL 2CD0A 2HH0H 5DQ9A 3BIBX 1KJMA 1R3LA 2OR8A 3C60C 5SX5K 1WBZB 4BZ2L 3F12B 4JAMB 4TTDD 1TJIL 4WHTA 4WFFE 4J3OC 4UILL 5E2WH 5E24E 5C09D 1FGVL 4R90H 3AMKA 1FBIL 3CX5J 3U4EB 3GHEL 2VLJB 3PQYD 3WXVL 2O5YH 3S5LG 3D18A 4PJDB 2YC1A 4NBXB 3D39D 1EZVY 4OLVL 4E41D 4BM7A 3THML 1NCNA 3G6JB 5GPRA 2R56H 4M6OH 4OLZH 3TBTA 4RWYH 2PYEE 1JVKA 5E0QA 3BT2L 4CVZA 4MMZC 3T0AA 2FWOA 2H2PC 3MV11 1KJ2B 2WBWB 1X5FA 3KVQA 3CPLB 5DURB 5E6IB 2G60H 4FQQB 5C0NC 3MGTA 3E6HA 2GHWB 4X8XA 4LCUB 2VISB 3BW9A 5DD5L 4XAKE 3LZFL 2HWZH 3QDMB 1WZMA 1F3DJ 1J0JA 4PYGA 1HH6B 4G42A 1I7TA 3LQZB 3QAZB 4PV8A 3BEWA 3FT4B 4PLNC 1G7QB 2C1PA 3WJLA 4GKZB 1V7ML 3QHZH 4YO0A 5DI8A 5J1AA 4NN5C 4ONGL 3FB7A 4UIKL 1GZQA 4KRPB 2FYYB 5DEFB 4QOKB 4TVSa 5EPMB 5KN5A 3KYNA 5AZEL 1I1AC 1QKZL 3P2TA 1MCOL 3L1OL 3DIFB 4BKLA 4R7DA 3KPSD 4NZTH 1AY1L 2EYRB 4P2CG 2UUDK 4F7PB 4PLOB 1LDPL 4NQDE 4JFXA 4EVNB 2CK2A 1H15A 3OKMB 4DGVL 3WFEL 5D1XA 1OTSD 4IJ3C 3UTTB 1AGFA 2K9UA 3DMMA 5EORL 4WTXA 4RFEA 4JFQA 4GBXA 1RIUH 1AP2B 5HHNA 5HVWA 2GT9B 1NGPH 3ZTNL 1JNNH 2VRAA 2Z91B 4JFED 1S7WA 2AXGB 3RZCD 2ED8A 4HD9A 3AVEA 1JPTL 1JNLL 1T21A 4U3XA 5C6PB 4HAGA 4GAGH 3WS3A 4KI5F 1M05B 1ZSDB 1URLA 4NKDA 1TVHB 2AEQH 3VGAC 4ODHH 1YNTB 3GUTA 5HHMD 2AW2A 2XICA 5D7IB 2D7MA 2UZIL 5DVLA 3TNNA 5CZVH 1F02I 1MY7A 2H3NB 4QCIA 3U1SL 4J4PD 4GRWH 1G7JB 2H6PB 2R1YA 2XA8L 2QADD 5IB1A 1CCZA 1NCWL 2AXHA 2FDBP 4B7LA 4FQ1H 3VXOA 4FQ2L 2HFTA 3LEYH 5E94B 3HPLA 1DBJL 3AXLA 2J6EA 3IF1B 1GH7A 2CIKB 4EQ3A 3MO1B 2EE3A 5IIEA 3DX6B 2RAMA 4HWUA 1U8PA 3ZZ1A 5C0AB 3CFKB 4JFDE 4YXKL 1KLFA 1ZT1A 4HCRA 1JHKL 5F89B 3BDYL 4X98B 3MTRA 4NRZA 4JFFE 2CMRH 3UJJH 1H3PH 2EH8H 2DWDA 3UPAA 1ZVYA 2BDNH 2CO7B 4NM4H 3EO1B 1NMAL 5F3BB 4UDTA 4BH7A 4ERSL 3LN9A 1P7KA 2PCPA 1ZOXA 4JKMA 4WVRA 4NO0A 4OGXL 1P7QA 1C5DB 2P5EE 2NX5B 5GGRA 1IGMH 4U4BA 2Q1EA 3O8XD 5D6CB 4N9GB 5I1JH 2P8MA 5CD3B 5F7UA 3H9SD 3QUYA 3DOSA 2BXZA 3L3DA 5T1DH 4XC1H 5FEBA 3PWNB 1CL7H 2FATH 4JRYD 4IOSD 5DRZA 4LLDA 4MWFA 1AHWC 1WIOA 3QHFL 4MVBC 5DR5H 1I4FB 1HK6A 3QEHB 2R2CA 4JM4L 3SO3B 1QSFB 3QXAA 5B38A 1TQBB 3QUMH 3IU3B 1ODAA 5F1OB 5DJ8B 3KYOB 4G43A 1D5IL 4MJ5B 1UB6B 3EYUH 4P49A 5IESH 4FQXA 1AR1D 5I2IA 3G04A 3QDHA 3HKFA 1UB5A 4Z78A 1DTUA 2ZUYA 2PYFB 4HV8A 5H8DA 3OJDB 4P2OA 5HHVL 1J1PH 3EGSA 1Y0LB 2WIMA 4HKXB 5FUOH 2DBLH 1OCWH 3JV4A 5D71H 1DE4A 4H0HB 5TE7L 4X7EC 3S3PA 1BAFL 4WI8A 5IMKA 1NCDL 5E08H 5EZLB 2XZAL 3D9AL 2XOTA 3BQUA 5JOEA 1C5CL 2XXCB 4Y88A 5BOPA 5GSVA 3NIGE 4EI6B 5C0RH 1S9XA 4TSAH 2DQTL 1CE6A 3GKWH 4OCSL 4L8SA 3WFCH 3HS0A 2R69L 2EDRA 2YZ1A 1Q8MA 4X99A 3C9NA 5DHYB 3S37L 3BIKA 4GKNB 4JB9H 2BNRA 2RFXA 3CC5B 1JRHL 2PUQT 3EYQD 3LQAC 1YEFH 3EOTL 3BP6B 4ZQKB 4QRUB 5EH1A 5I15H 3QWRD 1RZ8B 4FOMA 4I2XB 4CADA 4D0CB 1KUMA 5E7BA 2DQCH 1QLFB 1ZGLA 2ADGA 12E8H 4JO3L 1LE9B 1QEWA 4JZOA 1R5VA 5JUEH 1G9ML 3U36A 1I3RB 1A1MA 1NKOA 4LAJH 1AGDA 1UYWH 2O5XL 4YFLI 3IB4A 1FPTH 4MQ7A 3EOBB 4ODVH 4I5BB 5F7YC 4YHZL 5ADPH 1NGZB 1AE6H 4K2UL 3QUXD 1Y18B 3VGFA 5DMKA 1I9RH 5E8PB 4C83B 1FYTB 2D7TL 2ICWB 4N0CD 5K93A 5MEPB 4F8QA 1QFWI 1RZIA 3VFSB 3NCYP 3Q48A 3KR3L 5EU3B 5JHDB 3VGHA 4XMPH 2D4FA 3TV3L 3GBML 2VE6A 4HWEL 1PBYA 5L7XL 3NVQA 4ETQA 1KIQB 2FHFA 1VFBA 2GJZB 3DXAB 3D87B 1KENH 1SEQH 3DGGB 4OZGF 1MAKA 5JPNB 3IJSB 1B4RA 3HC0B 3QP3A 4TUOB 3VXPB 3UTZA 3QCTH 4V1DD 3KPMA 1WCQA 4P46B 5IQ7H 4JANA 1IT9L 2YZ8A 4PJXB 3MNZA 3OBAA 3HG1B 3AREB 1MF2H 3BHBA 1HKFA 1A4JB 2DJSA 2EIZA 1HXYA 3Q1SL 3UTPE 4MQXD 1OP5H 5LKNA 2BNUB 1A8JH 3T8XB 3BKJL 2P5WA 1NGQL 3WS6C 5T1LB 1KPUB 2BVQA 3BZFB 5EU6B 1A3LL 1BQSA 4POYA 4X0KA 5KVGL 2VLLB 1VFOA 1K5NA 4GXUN 4MXVF 1HQRA 4XPBH 4QRRD 3IFNL 4G8FA 4JCMA 1FP5A 3A6BL 2COQA 4TSCL 5TE4L 3VD3A 3QUYD 3CZFB 4XMLL 2H32A 1RPQA 1UJ3A 3LN4A 1OB1B 4S11A 5DJZB 1F8TL 3RBSA 3MV01 2AK1H 1TPXB 1SJHB 5INDA 3J8F7 4XPAH 4NNYB 5I1AA 5J6GB 1JPFA 4MA3B 1C16B 3FTGA 2MHAB 1W72L 3T4AA 2APVA 1IQDA 1UM5L 3LKQA 1K4DB 5HVHB 4G8GE 4LEXH 4O2FB 5I66B 1NAMA 1QFOA 4L4VB 3P4OB 1MVUA 4FQXD 2JELL 4FFVC 2KL6A 1EBAA 2CUHA 1P84K 5C8JB 4ZTPL 4ZUWA 3IKKA 4WI3A 5F1NB 1FIEA 2DQHH 4L8CB 1ZWIB 5TPWL 4DN4H 4P2OD 4OM0H 4ZFOL 2D03L 4PTUB 1OPGH 4JG1H 3S34L 2RCSL 4XWOD 4FQLH 5GJTH 1YEKL 2BOBA 3O45B 3H0TB 5IVOA 1OP5K 2VXUH 2R4SH 5AAWA 1M71B 4P4KB 4RA3A 1WTGT 5TH2B 1JYVA 4PY8J 4NKOA 1JHLH 4ZS7H 1KFAL 2FHBA 5DQJA 4K3JL 4AH2A 1GC1H 3FRPG 2VZ3A 3V4VL 4RSVA 4ZUVB 4M8VA 3MRJA 2VZUA 3E2HC 4PJGA 1H5BB 4EIZC 4ZFGL 1A9BA 4XBEL 2BNRD 3TA3D 2CUMA 3GB7A 4LEOA 1IC5L 4KKLC 4G6JH 5KG9B 4XBGB 3ARUA 4GSDL 1NC2B 2SEBA 5K59F 1I9EA 5CHNA 1D5ZB 3HAEA 1U92B 4JN2B 4P23A 3DHJA 2GJJA 4XNQB 2FD6H 4PRIB 5GS3A 4BSWB 3LHPL 3MFFB 5CKGA 5GS1A 4UNVA 1X44A 3K4ZA 3UCRA 4QNPE 5F3HA 3NN8B 5BV7H 2Z4QA 1BFSA 4R0LB 1BX2A 3ROOA 1INQA 3G5ZA 4LSRH 3DX9B 1HQ4A 1RUKH 4H8WC 3OZ9L 4TUKL 5CIPA 1UXSA 4ODXA 1E6JH 3RWDB 1NFDB 2OQJB 4Z0XA 3MV8E 3VXRA 4HUKB 4XCCH 4AEIL 2W0PA 4Y2DB 1XCTA 2CKBA 5FYLH 2YUVA 1MEXH 2NY2B 1CIUA 3S96B 1I75A 4Q9QH 1KLUA 1D5BA 2HKFL 2OR9L 3MRNA 5MP6L 3K46A 3ZYZA 2UWEA 4WUKL 4LPCA 2VL5A 3CGTA 3MBEA 4JO2H 1PQZA 4J3UA 1ULVA 3V6OC 4PIRF 2VDQH 4PTTB 4R2GB 1IGCH 4RAHA 4I0PD 1OP3K 4LSTL 2WWKT 1FQ9C 2B4CC 4NNXB 5FYKH 5CP7B 3CK0L 1RY7B 4URTB 4RMUA 1CG9A 1A4KB 4ONHA 1T4KB 4RGOL 1OTUD 3KXFD 4EDXB 3JWOH 1U8JB 2YD2A 4E42A 3MRRA 4O9HH 4MHHG 3QIUC 1PSKH 1T5XA 4YGVA 4NGHL 1J0YA 3S35X 1WISA 4OUUA 7FABH 2IAMD 3KNBB 4ODWA 4U6HB 4PG2A 1HE7A 3NCJH 1BLNB 5B39A 3O4LB 3V5KB 3ULVH 3WNPA 4HBCL 4M1DL 4EN3B 4L4TA 4Z18A 2W0FA 3IDGA 4PJ8C 2QQNL 1RAMA 3NCCB 3Q5YA 3MRKA 1IKFL 5F7DA 1QFHA 2X4NB 3O2DL 1U8LB 3HE6B 3W81A 1UKSA 1KF9B 3F58H 3QO0B 1A14L 3V6ZB 4Z7UE 5C86A 2DN7A 2I25N 3UBXB 4XVJL 1QVOA 3LIZH 1ORQA 4WHYG 5FXCH 1EFXA 3D25B 4QLRA 3MRIA 2PYED 1XGYL 4HJGA 4OZHE 4N8VG 4OCMC 1CL7I 2IH3B 4KHTH 4JPWH 2IQ9H 3GNML 4PJCB 3AMLA 3JZ7A 5F7LB 3DYMA 2X4RA 4M6AA 3MOQA 1RUPH 4WO4A 3ARDA 1JWSB 1C08B 1DQJB 4MD4B 3RPIA 3FQNA 4Y19E 1A9EB 1KN4L 4XHQA 4K3DL 4XNXL 5E8NB 4LFHG 4YC2C 1DR9A 3BGMB 5D5MF 3V52H 4ZFZA 1OAUL 4U1LA 4P5KB 2E6PA 4OCRL 1OWWA 1CLZL 4CN6A 3C2AH 3KLHC 4NM8L 4RMWA 2EKSB 4F33B 4M7LT 3W9DB 5FA3B 3NIDE 4YXLL 3U2SB 5ACZB 3F62A 3EDJA 4Q6IC 2JCCE 1BBDL 4QGTA 1TZHB 4N5ED 1QQDA 5D9SB 4LRNL 4U1HB 5F9AC 3WIFB 1L7TL 3U0TA 3EAKA 2ARJQ 5EOQL 1G84A 3F8UB 4JRXA 3FB6A 5CLTA 3CFDA 4H25A 4OGYL 4U1GB 4F58L 4OQTH 4JY6B 1NBQA 1MSPA 1JYXA 5EO9B 3HCVB 4FQIL 5DHVH 2DLHA 2Z8SA 3P4LA 2E3VA 1KT2A 5DFVC 4WUUD 3S4SB 4JDZA 4BFIB 3S4SG 3MX0A 3PJSB 2ZP0T 2HJLB 1AFVL 1P2CB 1AXSA 1VEPA 1BOGB 1NC4A 1UZ6E 3ULUC 4WHYH 3MNWA 3B2VH 3GK8H 3F65A 4CDHA 1J18A 3SDYH 3LY6A 3SN6N 4OBSA 1NDMA 4CVXA 3PWUA 1SY6L 3WBDA 4U7KA 3VE0B 3RU8L 3DI3B 5D2LF 4HF5L 5EOTB 1HWGB 5FV2A 1BBJA 5BRZE 2NXYD 4OQ1A 2YS4A 3SDDD 3MJ6A 4NQSA 4YHYC 1CQYA 4M7JL 2KQMA 4YBQD 5IMMB 5B22A 4JFDD 3VFTA 2MSPA 3VXNA 2HMIC 3LEVL 1IFHH 2V5YA 5D7LA 3PXJA 1OT2A 1BFVL 2G2RA 3CUPA 4PRPA 5FKPA 4TSBL 3IKCA 2Y07H 4CJ1A 4UI2A 5D6DC 4KK5C 5ESAB 2J5LC 3MRFB 4EUPG 3GEWB 1WC7A 5DD0H 3LPGA 2ITDB 1JPSH 4TQEL 2EDXA 3NACH 1SJEA 5DRXB 5BMFH 4HLJA 4JY5L 4JJHA 3PL6B 4P3DB 4XCNB 5FGSA 5D7SH 3DUUB 3T2NH 2ZCHL 1ETZA 4LP4A 3H2WA 3U9PL 1KIPB 2NPLX 4HKBB 4LLVB 3B9DA 1XF3B 2ARJB 2HFGL 1KXVC 4M8QA 1OAKL 3BPOB 4FXGB 5JR1L 4UIMA 3JV6B 5E8OB 3IDIA 1NBYB 3I6GB 4XXCC 4F8TA 3C60D 15C8H 3DO7A 4YDKH 4MD0B 1CF8L 4X6CF 1AJ7L 3RAJL 1TJHH 2CRIA 4UB0H 1QSEB 5HYJD 4L3ED 1TTGA 3Q5TA 2NY5C 5T33L 3P30H 2VH5H 2Q8BH 4X7SH 1YEDB 1NGXB 1NCUA 3GJFH 3I2CL 5EBMB 3W2DH 3TVMB 1YN7B 5D2NB 3U48A 1JK8B 3JXAA 2X1QA 5HDBF 5KW9L 5BQ7A 5MEQB 1RHFA 3TO2A 2H2PD 3RQ3A 5DZLA 4OZIA 4F7MA 2APBA 4UDUA 4XPFH 4HS8H 4Q9RH 4OKVB 1KN2L 3CVHB 3N9GL 4BH8A 2V2XA 5E5MB 5C0ND 3H8NA 4KMLB 4PB0L 3N85L 1B4JL 3QFJD 1CR9H 1VGKA 3KPQB 1DLHB 2QKIA 4OB5L 5HVFB 1MWAL 1CDHA 3C5ZA 4X9HA 4NC2B 4PGDA 3UO1H 1HEZA 4TPRH 3ARFB 5CZXC 2YEZA 4DGYL 3UC0H 2PR4L 4HUUA 5GIRB 5C0GA 3GO1H 1JN6B 1PKQB 5TQ0L 5KS9A 3P9WB 1CU4H 2ENYA 2F58H 4C56D 4F9PC 1RUAH 5JORB 1E6OH 2FJGB 3P9LA 2OZ4H 5E1HB 1DBBH 5DEZA 1I1AD 4EUPH 4AIZB 35C8H 2JJTA 1KJ3L 4GG6A 4G9FD 1ZAGA 2DTSA 2DMBA 4P2RA 3EO0A 4O4YH 4P3WA 3B9KA 1Z3GH 2F54D 5E00A 5T3XH 3DX8B 25C8H 3GMQA 1MJJA 3Q5OA 3KGRA 2IADA 4P57A 2HLAA 3QDJA 5EC2B 1U8IA 3C87A 1EGJL 3SE3C 3GMLB 4MXWL 5DS8B 4X8JA 4YK4B 1A7PH 4JEGB 3TT1L 1MRCH 1II4E 2OTUB 3ILQC 4MNGB 3A6CL 3L6FB 1N6QL 5IKCA 4GOSA 2X41A 2IGFH 3SKJL 5IB2A 5JPMA 4YDLB 1Z9SA 4W6YB 5ITFB 1C1EL 3QA3A 1MFBH 4U0QB 2EIDA 6FABL 4PJEE 1VHPA 4U1MA 2YPLE 4HG4J 4PJHA 2A38A 3IGAB 3TZVB 3ROLA 3ES6A 5D93B 4LLMA 3T3PE 3QFDA 4R4FH 1J1OH 1FZJB 2NY4D 3CFCL 3R1GL 3SE8H 3T09A 1H3TA 4K7FB 5IGXL 4OAWA 1ZHBA 5E2VL 1TTUA 2EDLA 5I1DA 1L4IA 3P3YA 1XIWA 4Z7VB 2VDOH 2C1OB 2FIKA 4JPVL 2JKXA 5C0BB 4DEPB 5C0JA 3PQYB 2HFEB 3T4YB 5FHAH 1UEYA 4ZSOE 2X4PA 3P4MA 4KI5C 1WCBB 2BVOA 1N5YH 2FSEB 5I0DA 1FL3A 4YNYA 2A83B 5CP3H 1N59A 2BOCA 2C3WA 1E27A 2IQAA 5HI4C 3BOVA 5D7LD 3EDKA 4BUGA 5DUML 1YDPB 3DVNB 3VA6A 4YWGH 1EAJA 5B3JE 1RZ7H 2ZUQC 5I76A 2DJUA 2X9YA 4B53A 3OAUH 5J1SC 3O2VL 3TYFA 2EH7H 1J05B 5IV2A 5FM5O 1GHFL 3FQUA 4MB3A 2WAHA 3MREA 4AM0A 3OAYK 4MMXC 1UWEL 5DA0B 9CGTA 4DVBA 3G9AB 3BVNB 3QULA 1E4KA 1UCTA 4ZODA 1MCWM 5ABDE 3B8SA 5DZOA 1RK0B 4LASL 5GRWA 1JPGA 3NZHL 1SM3L 1TJIH 4LLQB 4CN4A 3SQBA 3B5GA 4MVBD 3KPOA 5DMGC 4XP5L 1YEJL 1V5JA 3RY6A 1HH9A 3ISWA 1NANH 3THMH 4W6XB 5EBWB 2P49B 5TE6H 3BT2H 4NO3A 1BZ9A 1YEIL 3P4NA 4PGEA 2X44D 5KSBA 5A2KH 5TF1L 3W0WB 4OIIL 3C6LC 1X7QB 5IR1A 1K6QL 4PJBF 2J8UB 1ZMYA 4X7TA 2ADIB 2PW2A 4LCWB 1XGTB 5DD5H 3P0VH 3JBG7 1ZHNA 1HOCA 4HXAL 4PLJC 4WW2F 5I71B 1EAPA 2QTEA 2VERN 5EN2A 2HVKA 1S7UA 4Z7WB 3O2WL 1OGAB 2QADB 5E95B 1LVEA 4KMQA 3L5IA 3W9EA 3MRDA 5AZEH 1DDHB 3VXUA 2X9XA 1EA9C 1QKZH 4QT5A 4L9LB 2X40A 2XKNA 2FL5B 3GSWA 4NHUB 2AJXL 1UXWB 4OZFB 3WFDH 1NBZA 2EDFA 1AY1H 3UZVB 3I84A 5IB3B 1D6VL 4DGVH 1I7RB 4UU9A 4P2RD 5IJKC 3KDMB 4KKAC 1ADQL 1FDLL 5IBTL 4JZJC 5EORH 4OD2A 2NNAA 3ZTNH 1CD1A 4ELMA 5MHSD 4NSKB 4P59L 1LP9A 1LO0L 4TRPL 4MHHI 4NQCA 1F5WA 1JPTH 4PRDB 3K8MA 4HJ0C 4PJ9B 1PLGL 3O9WA 1EMTL 3BPLB 3T65B 4C57C 2R2BA 3LRGA 1CFQB 5DJAA 1K2DA 3LQAL 1AGEA 5FGBC 3QNZA 4PRHB 1MNUL 3OWEA 2UZIH 3U1SH 3JVGA 5I8KH 5DK3A 2JJSA 3MPCA 4JRYB 2P5WE 1A2YA 2XA8H 3GSUB 4WV1C 1NCWH 2WK2A 3G08B 3VDBA 2BRRL 3EFFA 3OKOB 4M1GL 4OJFH 3VXTA 1CT8B 1DBJH 3SJVD 2QQKL 5I8CA 4ZYKA 1MHPL 1EDQA 3QUKB 3U7AA 3LKRB 1F2XK 1F3JB 2DMCA 5D70L 2M26A 3F6IA 1FSKB 2XKSA 1S9YB 1JUFB 5A2LH 4ODTL 1XGUB 2K7PA 3BDYH 5FFLA 1F2QA 4KTEL 3VXSA 4LCCB 3OTTA 1MOEA 4HPOL 4XI5C 4ZFFB 4X4XB 4GXVL 3X12A 3QIUA 3U7YL 5ENWA 3FT2A 5EC1B 3C09B 4J12A 3WSQH 2AQ2A 3P0GB 3N0PB 3O4OB 1NCBH 4K71B 4YHOL 5GSRA 4G8EB 5DTFA 1RJCA 1T1WA 4PJFA 5T5NG 1RZFL 3W11C 2M8XA 5DJ2A 1IAOA 3FB5A 5F9WC 3CSYA 5AG9A 1T03L 1H0DA 1UADC 3EDDA 4LKXB 4Y5XB 3OR7B 1SEBA 2WUCL 3R8BB 4Q97A 3VI3E 4UTAL 2GTWA 1IZKA 4FABL 4JKWA 1T2JA 3V7AE 1D5IH 2Y25A 1S3KL 4Z7QE 2Y06H 3BKYH 2IBBA 2IANA 4RISL 1MHEB 1DUYA 5T1MB 4KRLB 1AO7A 1HHJB 1E28B 2AV7B 1C12B 4GAJL 4Q2ZA 3NA9L 3DV6B 4NYLB 4FFVD 5E6IC 5HHVH 2DAVA 3ZE0F 4WCYL 1U3HA 2YD5A 4LKCB 4PJGE 2EDNA 3QUXB 2Q76A 4RBPH 5TE7H 3WNOA 4ALAH 2FX9H 4O2CA 4OFVA 5LAXB 3QISA 1X5LA 1EV2E 2JB6A 1KLGA 3D9AH 4XAWL 4AY0A 3NTCH 1C5CH 3MCG1 1U8QA 3IDJA 3QAZC 2K7QA 4B0MM 1K8DB 3Q6GH 4IS6B 5ECJE 3GSRA 3K1KC 4OCSH 2IF7A 5I73B 4P3CL 2R69H 1KJVB 5AG8A 4XNUL 1G6RL 1Q9KA 2IBZY 5DVKA 4FQHB 4HIIA 4LPXA 3EOTH 1GAFL 1BF8A 3ZKQD 5DMJB 4G6ML 4X9IA 3G5YB 4UBDC 2CUIA 1K4CA 1BHGA 3MV7E 4WNQB 4OFYD 4ENEC 1YEHL 3IFLL 4I18B 1SJXA 2DYPA 1HHGA 4KKLD 3SDCB 5FCSH 3QRFM 4YHNB 4HLZG 5ESQA 4PJIF 4E5XA 5BXFB 1G9MH 4A2LA 1X5IA 3QDGD 2BERA 4CMHC 5F1IB 1MCNA 3DVGA 2O5XH 2K3TA 1F4YL 2CIIB 2UWEE 4YHZH 5IVXE 4QRPD 2VTFA 4XTRC 2R0ZH 4YGAB 4K2UH 2IWGA 4NKIL 4Z7VF 2DWEB 2BNQB 2D7TH 1W72B 1FJ1A 1QHPA 2I5YH 5C0EB 1AGCB 2ZPKH 5J6HA 1OAZH 4YE4L 4KJWC 1HZHL 2OR7A 4ZS6C 4KMTH 2DDQL 4NQCD 2MCPL 4QRRB 3KR3H 2B0SH 3QG7L 1PJ9A 1WBYA 3U0PA 4N1HB 3SDAA 4FXKB 5L7XH 2VB5A 1DZBA 2AP2A 2E7LC 4ZFOB 2ZZUT 2J12B 4ZUUB 2X1XR 1NCTA 3RVWC 3BYYA 3VFNA 3P9MA 4ZO7A 1MCKA 2ZCKL 2OTWB 3OR6B 3SE4C 1NBVL 3OKEB 4KK6C 5EIIB 4YDJA 1A3QA 5MEOB 4PV9B 3PWPA 5FUCE 4L4TE 2WIIB 1X6LA 4H8WL 3FO1B 3BKJH 4KDTA 3SKUD 3CH1A 4HZAA 1RD6A 1CDJA 4KROB 2AJZB 1NUNB 2JIXA 4OLWL 2A6DB 1F4WH 2RIKA 4Y5VA 2F8VA 5DMIL 2Q86B 3WUWA 1CDIA 1I7ZA 2APXA 1XGPB 5GRVL 3IFNH 1JNHB 3B6SA 3P0YH 3DHMA 3DRQB 3S88H 4X80L 1GGBH 1UT9A 1FNEA 2XNAB 2VXTL 2DQUH 2EZ0C 3WDJA 3HLAB 3FONA 2ATPA 4HLZH 4A6YL 2WINB 1PY4A 2B4CL 4GW5B 4XH2A 1KEMH 1YEGH 2VAAB 4XMLH 2Q6WB 5I1CL 5T1KB 4PJ8D 4HCRH 2J8UF 5KSAA 3ARBB 1A0QL 2EXWC 4PY8I 4RWHA 1F8TH 1LGVA 2VKXA 2ZNXA 2FBOJ 3MXVH 3GSVA 3RL2B 2FBJL 1TZIB 3SO3C 1Q9WA 2YMXL 1TQBC 1R24B 1BJMA 5IVNA 1S78C 4N0UE 5DT1H 4MGXA 1CICB 3HE7D 1NJ9B 1IGJB 1CGVA 3WNMA 2JELH 1M7DB 1Z6JT 2Z92A 1ZS8A 3OF6A 1MCSA 1NLDL 3O3UN 4ZTPH 4M43H 3TH4T 1AC6A 2ZOLA 4K8RC 4CNIB 2GSGB 2EXYC 4NQVB 5TPWH 2D03H 4S0SD 1B0RA 1W0WB 3JUYA 3S34H 1TCMA 1B0GB 2ID5A 3DGCR 5IMLA 1NANI 4UT9L 2FJFB 1YEKH 2Z35A 4NUGH 4PD4J 3MROA 1XZ0B 3VGGA 4ONOA 5BZWA 3ZL4H 3KJ6H 4JRXE 3LMJL 1OQOA 1MIEL 3VXMA 1O7VA 2OJZL 2VQ1A 4JN1H 2YUWA 1JV5A 3BKCL 3KLHD 3V4VH 1ZHKA 2CLZB 4NN6B 1I8MB 1AR2A 2HLFC 2A9MH 4MJIB 3IYLW 4NT6B 2VITA 4HKJA 4I0PB 1BM3L 3T77A 5EDXA 4QHUB 4S1SH 4XGZA 1LE5B 3FRUA 2C4FT 3GHBL 5DC4B 4MDJB 2P8PA 5IG7B 3REWA 3BH9B 3BO8B 3V8OA 4HX1B 4JGMA 5HGGS 1JTTA 2N56A 3KXFB 3REVA 3SE3A 3CFBB 1GGIL 4NO2A 1DQQB 2Z31C 4MS8C 1KCRL 4LSUH 4HIJB 5JW3L 1NUDA 3HRZB 3OKNB 5EB9A 3QJFB 2IAMB 5C0CA 1CK0L 5DFVD 4Y16B 1MFAL 1U58B 3OZ9H 5C6TL 1PKOA 4N1EA 4MNQA 3HUJB 3K2UH 3S6CA 3KYMB 2P24B 2E9BA 4PRPE 5EZJA 3ULUD 1E4XH 5K59E 3P73A 4N90D 3MRLA 1NGWA 3NGBB 5EOCJ 4XXDB 3MYZA 4WUKH 2D0FA 3P40A 2H9GB 1YNLL 2B1HH 1XAUA 3I9GL 1NSNL 2VLRD 3KWWB 4K7PL 1LK2A 5C9JB 2KPNA 1A47A 1RJYA 4LK4A 1X5AA 3T2PA 4P46C 1I1FA 1QLRA 2DRUA 4X6EB 3DUSA 2J6EL 3FO0L 3CK0H 3WN5B 5F7MC 4BQ6A 3AREC 4JY4A 2HMID 1LK3L 2PYEB 4JKKA 1QFUL 5TFSL 2V2TB 4XP9H 1D9KB 5KVDL 1B3JA 1UM6L 3MLWH 1L0XA 3K3QA 1WFNA 4PYHA 3NFNA 4OTXL 1F97A 4KK5D 3UYRH 1CD8A 5CINL 4HAFA 4HW6A 3VFWA 1S5IL 2AJVH 3HZYB 4LVNB 2BY0A 4RGNE 4U1KA 2BFVL 3RWGA 3QO1B 2VZ1A 5I8EA 1XH3A 5KVMC 3DTXA 1OSZA 3GI8H 4OLYL 2BSTB 2G9HA 4HBCH 1QTYT 3MRPA 1ZLVH 3I75B 4GRLA 4PREB 5HYFA 3HZMB 5GZND 2YA2A 5JZ7C 4OZIE 2D7QA 2GCYA 1YQ2A 5F7KC 4AENB 2OJEA 1KTRL 3O2DH 3GKZA 1ZTXH 2N7BA 1HHHB 3RX5A 1CXFA 2DIBA 2MQ3A 5KVEL 3RTQB 3BP5A 1HKLH 3HC3H 1DBKH 1YMMA 1AI1H 4XCEB 1FNFA 1M6OB 3WIIL 1HHKA 1KG0B 2EICA 3BWUC 3BZ4B 3QI9C 5ETUA 2ZUXA 4NPYA 1T0MB 4NQDB 5J11B 3KLAB 4CKVX 4GKSB 1U93B 4NNPL 5HVHC 4LIQE 5FA4A 1LEGB 5F7HA 3BMVA 5KS9E 2YXMA 4Y4HB 1UA6H 3PGDB 4F3FA 5HDQL 3MLRH 1KB5A 5HPMB 5ACLA 1LHZA 1Q94A 2PXYB 4GW4A 4FP8L 2Y23A 3CDGB 5F44A 3OKKB 5I1GL 1I85A 3K74B 2NLJA 5ESVA 3U7WL 4UV7H 3NCEB 5SWSA 5E1AB 4GLRH 1EEYA 2WMPA 4MX7A 3I3DA 3UPCA 1I7UA 5E2TH 4QEGA 2IMNA 4UTBH 2NY5L 3QDJE 1OAUH 2QHRL 1U8MB 3B3IA 3FFCA 5CZXD 5DD6A 4P4KC 2ITCB 2FO4A 4LSDA 2HG5B 2GFBA 5SX4H 1BD2A 1G7PB 1F6FB 4XCYB 4U05A 4Y8AA 4HFWA 3VU2A 4X6FA 5J0BA 2D3VA 2FLRT 4LBEB 5JHLL 3H42H 4QGYA 4ZOEA 2XPGA 5I75B 1H5BC 1R5IA 1U2HA 1BQUA 2VIRA 3QPXH 2KZWA 4JFDB 1ZLVK 4U1SB 2VYRE 2XQYK 1CYGA 5F88A 3W5MA 4JZJA 5EOQH 1F00I 3NH7L 4JFFB 1IL1A 5FB8B 2YD8A 5FUZL 5EO1B 5D5ME 5ALBL 1KTLB 1UKQA 4HS6A 3ZE1E 1OSPH 2GSIB 3BUYA 3LPWA 3HR6A 4XP6L 4QWWD 8CGTA 3LKNB 3ILQD 3QWOA 4AK1A 5FGBA 2FECI 5BS0A 1A7OL 1AFVH 4ZXBB 4ELKA 2X1OA 1YN6B 2FEEI 4Y2DC 3GJEA 2NY2C 5B39G 3R06A 4M61A 4JFOB 4X83A 5C0DB 1FL6A 2AJYH 4BQCA 2B20A 4LSPL 4RMTA 3BISA 3G6AB 1MWAB 5SWZA 2OLDA 1NMBL 4GW1B 4FTVD 4HF5H 5LGJA 3I3BA 5A16B 1RJZA 4R2GC 5CEXA 4D8PA 1EO5A 5HY9A 3TT3H 3QBTB 3X13A 1KCVL 2WLYA 4HUXB 3H9HA 3BGFC 2FGWH 3BPNB 1BIIA 4KI5D 1TFHA 3OX8A 3SOBH 4TSBH 1EX0A 2HYMA 2BRQA 1UQSB 5HI4D 4LLUA 2ADJB 1OGTB 1A7RH 4Y4FA 2FHCA 1TNNA 4TQEH 4MLSA 1AGBB 2CKBH 4EI5A 5D2LE 3L7FA 4R8WH 2ZCHH 3CCHA 1NL0H 2G75B 2I9TA 3U9PH 4A2MA 5EU7C 4KKCC 5C1MB 1Z9OA 2DM4A 1OAKH 1KELH 1WBZA 3F12A 4EN3C 4JAMA 4EJ1C 2JF1A 4Q0XL 3Q0HA 3MLZL 4OI8A 1CF8H 2IPUG 4PUBL 3RAJH 3V95A 2BY2A 5DLMH 3RNQB 1IGFL 3D3VD 3U4EA 3B8YA 5KSUA 1HIML 2VLJA 3GGWB 1I1AB 3PV7A 3DO3A 4NKMB 2BX5A 4PJDA 1J1XL 1IM9A 2X7LB 5DMGD 1JZ2A 4G9FB 5E4IA 3I2CH 3G6JA 1OW0C 2BVYA 2NY0C 2VSCA 5CJQH 3TC9A 2F54B 4DTGH 4Y5YB 4JM2A 2Q3ZA 4LF3A 2F19L 5KW9H 1KJ2A 3QQ3B 3WNNA 1WZ1L 1ZT4B 5FK9B 3CPLA 3BKML 3KPRD 4GMSL 5E6IA 2V5TA 1A7BA 4FQQA 1ZANH 1UWXH 3VXUE 2J4WH 5ICZA 1KN2H 1MRDH 4LCUA 1FZMA 3C6LD 4TULL 1D7FA 2VISA 4IDLA 1HCFX 1T83C 4PB0H 4YIQB 4OGAC 3QDMA 5HSFA 5CKAA 1MWAH 5DRWB 1HH6A 4GQ9L 1EHAA 3LQZA 4PLJD 3UDWC 3FT4A 3LSOB 3WD5L 1MRFH 2VLKD 3DV4B 5IBLC 1Q72L 2GAZB 3BWAA 1L6XA 4WEBL 5TQ0H 5DEFA 2FYYA 5HDBE 1VPOL 1S7XB 4LSVL 2Y36H 2A73B 2NY4B 3FFCD 4TVPE 4XWGL 4ELME 5FGCE 4AL8L 3STBA 1LP9E 1TMCB 2YPVL 3CLFL 5FECA 5IW3A 4MCYB 2HFFB 8FABA 3DIFA 5LQBH 1EVTC 3CVIH 2EYRA 1KJ3H 2CDGB 4F7PA 5CEYA 2A77L 1OM3L 4JRWA 4EVNA 5IOPB 1QOKA 3HUJF 3TH3T 1T7VA 4WTWA 1JZ8A 2G5BB 1YPZA 2BSRB 4HIHB 4OD3L 4AT6B 3UTTA 1WTLA 1DN0B 2UYLA 3AU1B 3DYPA 2DICA 1IC7H 5JO5B 4KKAD 4DWHA 4U1GC 5IK3B 4Z77B 1EGJH 2CLRB 2Z91A 2Q20A 1NKRA 1RSFA 3GMRA 2AXGA 3MRGA 4YH6A 3TT1H 1MH5A 5HGDB 5IFHL 1OF2B 3FCTB 3K8LA 4OZ4A 3ZKMD 1M05A 1ZSDA 2A6JB 4J23A 3MUJA 1GZPB 1TVHA 1TJGH 4NQEE 5GGVY 5IWLC 4HJ0D 2KKQA 1C1EH 5F9JB 3S3JA 5GGVL 3VXSE 5D7IA 3C6SB 3HI1B 5CD5C 6FABH 4EQ2A 5BS0D 3V5HB 2E7LA 2H6PA 1TITA 2FNBA 1DQDL 3O3DA 4MAUL 1KB9J 4BZ1L 5ISZE 3EW3B 1E4JA 3CFCH 4BELD 1QBML 4IRJB 4PB9L 1DLFL 4KI1A 3QT2A 4HWBA 3SEPA 1FL5B 4HIXH 4OI9A 5IGXH 2AGJL 4HS3B 3IF1A 1EXUA 1AHWB 2DQDH 4CL7A 1PD6A 4PP1C 3DX6A 3MJ7B 2DLEA 4JPVH 5H2BB 5ACMA 5C0AA 3CFKA 2E9JA 5SV3A 5F89A 4FN0A 1JI1A 4I77H 4X98A 1RUMH 3GMOB 2MMXA 4PJFE 1CXIA 1BVKB 3UJIL 3E3QC 5ICXB 1OLZA 1E4XI 3QB7C 3EO1A 5F3BA 3Q6FB 4XI5D 2X4QB 2YPKA 5DUMH 4FQCH 3D85D 5D96B 1IAIL 4NRYB 5F7FA 1LO5B 4P5MB 4XNMA 2N1KA 3O2VH 5DDHB 1C5DA 3NMEA 1N5AB 2NX5A 4KVNH 3BZEB 4C54A 1SYVA 4N9GA 1T04B 1P5UA 3PL6C 3VFPB 1OARH 5CD3A 4P9ML 2H41A 2IANE 1A6UL 1UWEH 5DJCA 1VACA 1AO7E 2NMSA 1T1ZA 3PWNA 4KAQH 4LPUA 1IGYB 3W11D 2EDJA 1AXTL 4LASH 1S7RB 3O6FA 3IVKB 4ZNEA 1CFVH 1PG7X 3HFML 5JA9A 2IPUK 5F9OL 2ESVE 2KZ1B 3QEHA 1QSFA 5I19H 5AUMB 4OLXH 4Y0GA 1DBAL 2ARWA 5DJ8A 4MJ5A 4KPHH 1UB6A 1HSBB 5IVZB 3ZDYF 3MV9E 4HUNB 3WL9B 1D5XB 5FAAA 5D2NC 2FB4H 4XX1E 3DI2B 4IRSA 1KNOB 1QZ1A 2YOCA 3O0RL 5J12B 2PYFA 3MCKB 1U36A 1C7SA 5TF1H 4N8CL 1QYGL 3V5DB 1KIRB 3VWJB 3BAEH 4HKXA 4OIIH 1ZLSH 1OAXL 4O5LL 2Y4SA 4XMKH 4NZUL 4CMMB 5DURD 1FIGL 1CDYA 4YUEH 5EOCH 2DLIA 3MUZ1 1CVRA 5GS2D 1MFEL 1HILA 2APTA 4R3SB 1T89A 3EJYC 1MCRA 4EI6A 1BFOB 3L5XH 3P77B 3ARFC 4MJ6B 3WHXB 2ZSWB 4P0DA 5DHYA 2KH2B 4GKNA 3WIHH 2WWKO 3BN9C 5E9DD 2YWZA 4QRUA 2FR4B 1PDKA 4QOKD 1EEUA 1RZ8A 4D0CA 1QLFA 1R3JA 4PJBE 1AH1A 1LE9A 4UBDD 5EU4A 4GLRI 1IGIL 4AQ1B 4ENED 5T3ZE 4GMTL 1I3RA 4Y1AE 1QBBA 1ZA6B 1P69B 1IQWL 5IBTH 4L5FL 3RBGA 1CLOH 2A1WL 5ELIA 4I5BA 1U6AL 5SX4I 5GISH 5IFAH 1T7YA 2V9QA 2B2XL 1YNKL 1NGZA 3WO4B 4ZUSB 4YHPB 2DI7A 1LO0H 2YSSB 4G5ZL 4XTRD 5E8PA 4C83A 4D0BB 2ICWA 2NXZB 2PTUA 5HI3C 5JIPA 3EO9H 2UY6A 1T66C 5MEPA 2XWJB 1JGDB 4H0IA 2DM3A 3VFSA 1HWHB 4YDLC 4MA1B 5EU3A 4KJWD 2YN3A 5DJDB 3LQAH 4ZS6D 5JHDA 2DKMA 1MNUH 5DUPH 3CAFA 3PWPE 3E6FA 5F72S 1KIQA 3TZVC 2GJZA 3DXAA 5D93C 1S9WA 3NCFB 3NOIA 3DGGA 1CIDA 2BRRH 5TQ2L 3D2UD 2EO1A 2HJFA 5JPNA 4AEFA 3HC0A 4G7YL 3CJJA 4TUOA 3RVWD 3VXPA 5JW4N 4ORZC 5MENE 1MHPH 4JQIL 4P46A 3V8CA 5BW7A 3RUGE 5IHUL 3INUL 1QR1B 3TEUA 4PJXA 3HG1A 3S35L 3LH2L 3PP3K 2OCFD 4QHMB 1A4JA 3NIGF 2FX7L 3O3BB 3IFPA 4KK6D 3RDTA 4KTEH 1G6RB 3WXWH 2Q3AA 4OZHB 3SE9L 2BNUA 4EBQH 4GXVH 3CFJA 1JGLL 5T1LA 1KPUA 5JNYA 5HHOA 1U9KA 2J2ZA 3EYOB 2PNDA 4X5WB 3BZFA 5EU6A 4YBLB 4YJZL 4Y19B 2VLLA 3OKDB 3CMGA 3I02A 4GQPH 3WDIA 4OCXH 4RGND 4YHOH 3X3FH 4Z5RB 4MCZB 2NX5D 1RHHB 5ILTH 3VD4A 2R0KL 1KCLA 1KEGL 2F5BH 4F2MB 5LGKA 2LQRA 2EZ0D 3CZFA 1G7IB 4D2NA 3KPNB 1ZHLB 2W9DH 1OB1A 4Q74A 1T03H 5DJZA 2WUCH 5EWIH 1RZKC 3VRIB 1MJ7H 4UTAH 2EXWD 4FABH 4HWZB 4MA3A 4LSSL 1EHLL 2R0LL 2VLME 2JCCB 4XT1C 3JV5A 2MHAA 1S78D 1EERB 4O2FA 3P4OA 1KACB 4ZG1A 3QDGB 1FLTX 4LVOC 1JYNA 4JHWL 5C8JA 2EC9U 4JO1H 4M62H 5F1NA 4RRPG 2DQGL 1A6ZB 2GK0B 4WCYH 3TH2T 1MHCB 1WWWX 4NOBA 1ZWIA 1YYMH 5GGSB 3QG6B 4PTUA 4K8RD 4L1DA 3MLSL 5K9OB 2EXYD 1MCQA 2NY1D 4JR9L 3L95B 1IC4H 2J8HA 5F6IB 3O45A 1OAQL 3H0TA 2Y5EA 4UQ2B 3DNKA 1D6EB 2PTTA 5I71C 1M71A 4IRZL 4OD1L 5BO1L 3MNVB 5TH2A 2X4TB 4B5EA 4Z7NF 3GMPB 2R1XB 2XTJE 4D9RD 1RIHH 4Y4KC 2X89A 4ZUVA 2AXFB 3VDAA 4QXTB 4LIQL 4DW2L 2GJ6E 5L6YL 1SBBA 4XHJC 2HLFD 1W0VA 5C0CE 5BRZB 4M3KB 1DUZB 1MFDL 3JSSA 4NFCA 4F9LA 5KG9A 3QUZB 4RMSA 4IHOA 5KAQG 1YEHH 5LXGL 3IFLH 1NFIB 4A6YB 4WJ5A 1D5ZA 5DQ9B 3ZHDA 4XNYH 1T7WA 1SBSL 4JN2A 1KJMB 1R3LB 2JJWA 4XNQA 3MFFA 4RCAA 1XFPA 3ARQA 2Q7NA 2ZJSL 3VD7A 1F45A 3NN8A 4PG9B 2Z31D 4R0LA 4MS8D 3NAAH 2J88L 2E7BA 4HGWA 2XN9A 4I48B 4IIQA 3ARTA 2YXFA 1JGEA 2ICEA 3QIBA 4PJ9C 1FYTD 1ZXQA 3BPLC 1A22B 2DDQH 3WKNA 4ZPVA 4ZUTA 1NFDA 3SGEI 2OQJA 4JJ5B 4Y2DA 4YFEA 4OCYL 4CVZB 2FWOB 3BPCB 4FZ8L 2ILLA 1M4KA 2BCKA 4DK3A 4PJIE 2OL3H 2PO6B 3AM8A 4G6FD 2Z0BA 3BE1H 1CVSC 2O26U 4PTTA 4ZDHB 1N64L 3EOYG 1F3RB 3BW9B 3WMSA 2BJML 1JTOA 4NNXA 3GI9L 2E9WA 1FSKC 2C3GA 4P46D 3K7UA 2AKRA 4ZAKC 3BEWB 3HE7B 3QXDB 4LDEB 3ARED 4EDXA 1VENA 5A2IH 2C1PB 1U8JA 5ID1A 5BVJB 1V3JA 4ISVB 4H8WH 2XQBL 1ZLWH 5FF6A 1BZQK 5KN5B 2CPCA 3FJTA 4XVTH 4OLWH 4G6KL 3KNBA 2BSSA 4MYWB 2DMKA 1M7XA 4BKLB 1UWGL 4GJTB 3RI5F 1JBJA 3O4LA 4K9EC 5EU6D 5EG6C 1RU9H 2HRPL 4JFXB 4OQTA 1A6WH 4YR6B 1UZ8B 4LARH 5IROC 3MOAL 4ODSL 1J5OH 5DHVA 1FAKT 4M93C 1PX4A 2Y1VA 3DMMB 4JFQB 2X4NA 2B4CH 5JZ7D 5HHNB 1IEHA 3HE6A 1U8LA 3EFDL 3O6LL 5I1CH 4QNPF 4JDTL 3QO0A 1XF1A 3V6ZA 1FG9C 2P45B 1LNUA 1MAMH 2FBJH 4NCDA 3UPRA 2YMXH 4CGTA 4M7KH 3EYVB 3QIWC 2MTPA 5SWSE 3WLWC 2LVEA 4Q6IB 3D25A 3QEGL 3QI9D 4PJAA 5JOFB 3VJ6A 1RK1B 4P2QD 1YMHA 4FNLL 1I8KA 2HT3C 2V7HB 2IH3A 4PJCA 1BD2E 5FM4A 4RIRB 5IB1B 4L4VD 1P6FA 3LDBB 4WFGE 2DLGA 1T83A 1C08A 3CDYA 1ZVSA 4YHLH 5HHXL 1DQJA 4MD4A 1JZ4A 3AXLB 1A9EA 5I30H 1MJ8L 4QYOB 5IIEB 1A02N 2ZG1A 2F15A 2DQJL 3MRQA 5E8NA 2W9EH 3LKPA 3ORJA 5EA0L 4UT9H 2VABA 4ZD3L 4LVHB 1DVFB 3BGMA 2VDPH 3T0EA 1ZLWK 5DJ6A 3TO4C 2IG2L 1CGTA 1MIEH 4PJEB 2DWDB 2YPLB 2CH8A 4LLWB 2IPTH 5C2UB 1RULL 5I73C 4BQ9A 4P4KD 3FN3A 2O5ZL 4WFEE 1T3FA 4F33A 3W9DA 2FZ3B 5FA3A 3GIZH 4QXUH 3CMOL 1KYOK 4R4NC 3WCYA 3U2SA 4IM8A 1P7KB 2PCPB 2BMKA 5ACZA 5CLWA 5L0QB 1HYSC 3E0GA 3RX8A 1P7QB 5GRVK 4I4WB 1TZHA 4Z95L 4GRMB 4Q7DA 5D9SA 3BSZL 4GS7B 3WIFA 4XPGL 4IMKA 4ZSOB 5E6ZA 1CGSH 5L9DL 1B9ZA 1TXKA 1JP5A 4OT1L 3SDCC 3VFOA 2XZCH 3GHBH 1NAKL 2BHZA 4IMLB 1NC2D 3LKOA 2HKHL 3ALPA 4LCIL 5E70A 2AI0L 1GGIH 3HN3A 5EO9A 1E4WH 3HCVA 4XRCA 3W82A 2DQEL 1I3UA 2VDMH 4PRID 5SWZE 1QR4A 4K94C 5JW3H 4Z7UF 3OHXB 5B38B 3S4SA 1VADB 3LS5L 5IWLA 4TVPL 4BFIA 1MFAH 3OL2A 4NQED 2HJLA 4TOYL 3R8QA 1L7IH 2H1PH 1BOGA 5DC0A 5I2IB 4XBPA 5TDPB 2JLLA 1NCCH 3WUWG 3ECBB 5F6HJ 4QF1B 1YECL 4Z78B 4Y2DD 2V5SA 3V9FA 4WDIA 2NY2D 1WIPA 3B4NA 2BK8A 3NFPB 1RIVH 3ZDZE 3VE0A 4D9QE 4DUXA 4M4RA 3JV4B 5EOTA 1NSNH 2RQ8A 3ZTJG 1DE4B 1EZVX 4KJYB 2AQ1A 4OCNC 5IMMA 2V9RA 1RVFL 1TQCB 4R2GD 4AZ8A 3SDXB 3IDMB 3BQUB 3FO0H 6CGTA 4JHZA 1Q9LB 5AD0A 3O6MH 1LEIA 2VC2L 1QFUH 2OZ4A 5TFSH 4D0DB 1CE6B 4L8SB 5ESAA 4EUPA 3MRFA 3TYGL 3BIKB 3VFVB 2ITDA 1BQHG 2KBGA 3ULUH 5CINH 2VLJE 4BYHA 5DRXA 4KROC 2AJSL 4PJDE 4U1IB 3PL6A 1HDMA 4HHAB 2JCCF 4NJAL 4P3DA 2QR0A 4XCNA 3DUUA 4KJQC 3X17A 1ZGLB 3G6JE 2ADGB 4GRWE 1HINL 4YXHL 1KIPA 1AKJD 4HKBA 1FORL 1R5VB 4JZOB 1XF3A 2ARJA 3AB0B 5JIKA 4QHKJ 4Q6YA 4RDQF 4DZBB 3V4UL 4FXGA 3JV6A 5E8OA 1XCQB 1AGDB 4DGIL 1NBYA 1KBGH 2HRLA 3I6GA 3LN5A 3ZDXE 2NCMA 1MLBA 4MD0A 2YKLL 4EN3D 1CFNA 1DQLL 1UM4H 4NHCL 1QSEA 5DMKB 3ARBC 5KVEH 3H3PL 4LU5L 1NGXA 2V7NA 2CK0H 4P4RB 5EBMA 1RZIB 3TVMA 3O11B 1YN7A 5D2NA 1I8LC 1JK8A 1UZ6F 1PY9A 5MI0B 1CICC 2NY0D 2ZOKB 1AQDB 1CXKA 4NNPH 3WFZA 5JA8B 5MEQA 1P9MC 1CDUA 1VFBB 3IU4H 1Q9OB 5E5MA 3EJZC 43CAB 1UACL 3UTZB 4H20H 1DLHA 2EEAA 1Q1JL 5CP3A 3IDXL 3FO2A 3ZTJH