3IE4A

B-glucan binding domain of drosophila gnbp3 defines a novel family of pattern recognition receptor
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
101
structure length
101
Chain Sequence
b'YEVPKAKIDVFYPKGFEVSIPDEEGITLFAFHGKLNEEMEGLEAGTWARDIVKAKNGRWTFRDRITALKPGDTLYYWTYVIYNGLGYREDDGSFVVNGYSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gram-Negative Binding Protein 3
molecule tags Immune system
source organism Drosophila melanogaster
publication title The N-terminal domain of drosophila gram-negative binding protein 3 (GNBP3) defines a novel family of fungal pattern recognition receptors
rcsb
total genus 18
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2140 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3ie4A00
3IE4A 3AQZA 3AQXA 2KHAA 2RQEA 3AQYA
chains in the Genus database with same CATH superfamily
2OMZB 1J5IA 4GXVL 1ZTMA 2EO1A 2UXFA 1HL5A 4LL9A 2NY1D 1DR9A 2CM5A 1A64A 4NQCD 3GMMA 4XPBH 1EXHA 3K72B 4HK0B 4KRLB 3KBPA 1WHPA 2X3BA 4QHPA 4NBZB 4XNXL 3ULUE 3E2HB 4PLJC 2X4NA 2C3VB 2GTZB 1TVBA 4LDCA 4OZGE 4E36A 5BRZB 4K3HA 3MU3A 5JYLA 3V4VL 1ZGLA 4U6YB 5GGTA 3STLA 2VDLB 1R9FA 5J06A 3CHSA 2RD0A 5CSZB 1G1KA 3JV0A 3TO2A 1MFAL 4KGJA 1BLNB 4ZX4A 1U33A 1VHPA 3MBEB 4U1MA 5GISL 1X6NA 4LCWA 4R5VA 3D7PA 2WBKA 3I3BA 3O9WD 3Q6FB 5E2TL 5LLIC 1XF1A 5E24E 2E4TA 5HDBB 1PG7L 3G6DL 4QYOA 1U93A 3REWA 3QCUL 3K2UL 3W11C 2ZXGA 4O4YH 1UQSA 2F7OA 1F1GA 1JZEA 3QIBC 4H8UA 4WQOA 5L2KA 3KE0A 2F08A 3CSBA 2E9GA 3MV7D 1WFUA 3DX6B 1PG7H 5EIQA 1WS8A 4HIJB 2VLRE 4RESB 3O8XC 3L7FA 4MCYA 3EJJX 3AS2A 3QEHB 1AKJB 3IJ8A 3ESPA 1F4YH 4HT1L 1MW2A 5CINH 1SUJA 5EZIL 3QJFB 3ARED 5ELIA 4LFHD 1AIFB 2A6DA 3PUUA 4Z95L 2ADJA 1J9RA 1R3KB 1XH3A 2WANA 1FN4A 5FB8A 2Z65C 3SDAC 5IREA 1JERA 4ADGA 4PRHB 1L5GB 3ZR6A 1LO4H 2WN3A 1T5KA 5JZ7C 3LPPA 4HOWA 4JREC 1BGXH 3O6FA 4NRXA 1PPIA 4NC0B 3BH8A 5FGSA 1OD9A 4TNVF 5J3HD 1VFOA 2D7MA 3OWEA 4KBPA 3E9TA 4QRRA 1E28B 4G9DA 3S3DB 1KIRB 3KLAB 2A3TA 5B7EA 3IFLH 3GXMA 3L4UA 4FQ1L 1A1NB 3FUIA 2BY1A 2CR0A 3NJFA 4GBXD 5F0JB 4G42A 2FSDA 3MLSL 4JPKH 4YSEA 1DQJB 1HHKB 1RY7B 1T2XA 2YPKB 3QNYA 4H20L 3VFMA 4D0BB 5FO8A 4UM9D 5IB3B 1MDTA 3LZPA 4CSZA 3BP7B 4F8LA 3NSXA 4L4VD 1N6UA 3D07A 1U3NA 1JG9A 4M1DH 2O5XH 4AVIA 2EH8L 4TSAH 4YHNA 1A9EB 3MJ6A 4K3JL 5FHBL 1BG1A 5I23A 4ALAC 4LLUB 1HH9A 4APXB 5GRXG 4AGQA 2KZBA 5E6ZA 4A7SA 3MZTA 5DF0A 4KK5C 4GBXC 4M1DL 4J12A 5JXAL 2F0CA 2HFEA 5DK2A 1N3NB 5J57B 1I31A 1JNNL 2LFGA 1JIBA 1ZE3C 3ARRA 2P5PA 2VDNH 3MLTB 4KKQA 1VLXA 4P57B 5GZND 2X6VA 4KO6A 2ZONA 3GO1L 3MKGA 3OF6D 3G5ZB 2DYSB 3EHBC 4MLIA 4XCYB 4KNTA 1NGYB 1YYML 2ATKB 2BVTA 1MRCL 2VH5L 4LVNC 4MB1A 4HHAA 3BLPX 2C4FU 4M9PA 3BGFB 1LO2L 3QDJE 2Y7NA 1NCOA 1KELL 4YXKH 1CL7L 2B9BA 2X4QB 3MREA 4UYPA 4AM0A 3BVDB 1BQLH 2L7EA 3KL3A 4R2GD 4G6FB 1I8UA 4QHMB 2WQVA 1NGQL 3RNQB 4DGYH 1OB1B 2G2NA 3FBQA 3FQ2A 2Q86B 2BSTB 3K71B 4ZMAT 3IDNA 4QXTA 1DBJH 2NZIA 3BQVA 3TVMA 5E9DD 1N4XL 4MJIA 3U83A 4POYA 3QZLA 4H0HB 2DWXA 5F9WB 1NOAA 1ROWA 3Q5TA 2GK0B 4XVOA 1OPGH 3NAAH 5IF0A 2H32H 2Y5EA 4XVTL 1T0OA 4M4RB 4DK6A 4X8CA 3U7WL 3VD5A 1DHKA 5T3XL 3V7AE 3FHEA 1UWEH 3HPJB 3VFPB 3UG5A 2F68X 4JHUA 1H6FA 5J12C 2JIXB 4GKSA 5EC2A 3TNNA 5I1CL 4BZ1A 2X4TA 3BAJA 3VXSD 1TJHH 5FM8A 3NABL 4YHPA 2Y07H 1E8XA 2V3EA 1CLYL 2L7UA 1DDHA 5DR5H 4OFDA 4TXVB 4OCSH 1E5ZA 3MGAA 3NJKA 5LBVA 3ECVA 2I5YH 4X5WB 1R3HB 4EF3A 1TJHL 4YBHA 3T0XA 2Y7MA 5DZAA 4PCSA 4F2ME 5J9PA 4E5XA 5MEOA 4I0CC 4KI5D 4XN8A 25C8L 1IBHA 3KAAA 5B22A 4PGJA 3PU7A 1RZIB 5C6WH 5KBLA 1YQVH 5T1LD 4YHLL 4PJAF 4QF1B 1N26A 1DFBL 4QHKJ 4X8GA 2R8SL 3PAUA 4Y5XA 4D0CA 2YA1A 2DMGA 4FXKB 4GQ9L 3HMXA 3LNDA 4NWTL 4QHLA 1K4DB 3CVHH 3MNWB 3SOBL 3FFDA 5C0AB 1NCCL 1VCBC 2A0LC 2IQ9H 1MWAA 5C0FA 3TIEB 1GRWA 1OTSC 4Q9QH 1N59A 3AS3A 2ZSVA 4GAYB 2R8SH 3N1FC 1XB3A 3CNKA 1NIFA 1TOXA 2JB5H 1LGVA 1EO5A 4X83A 3DMMC 1ERNA 2ZUYA 1KGXA 1XF5A 3FB6A 2HX8A 1GOGA 3P0YL 1URZA 4N28A 4PHZA 1OK0A 1TQSA 1YN7B 4IKJA 3X1FA 1C8PA 3BH4A 4DP4X 4ENZA 2NTFB 1S46A 4NQUA 1U8LA 1TXKA 2W5PA 4GB9A 2J57A 4FQXA 4DETA 3ZHNA 4S0HA 3WAJA 3MBXL 1UH2A 3MV8D 1AQKL 3FB8A 2VJ0A 3MRHA 2ADGB 1JNNH 3QQ3A 4JZJA 3AU1B 2J4WH 3P9WB 3T2LA 4H5SA 3FQ4A 3RNKA 2E3VA 3MCG1 2FSEA 5HYSG 2VQ4A 5AW7B 1Z3GL 3H2QA 5C07B 2V33A 4BZ2L 3B83A 1ZV9A 4IRZH 3TOPA 1WBXB 5ISZE 5FHAL 1SLXA 2IPTL 1OM3H 5IGXH 4FLHA 5IMMA 5DFVC 4Y1TA 5EUKB 5EU6B 3ZK0A 2VLJB 2Y7LA 4PY8I 2CKBB 3P4MB 4BFOA 4OD3H 5JMRA 4N0UE 2KI6A 3VMNA 1TZHA 1WDAA 2XBZA 3ATBA 4AQAB 1OGSA 3MUJA 4BKSC 2CUHA 4ZX5A 3CG8A 4MJ2A 1CK0L 4Z7VF 1I1CA 3VCLB 1DVXA 3UO1L 3DX8B 1RIVH 2C3WA 2ZF9A 3RWFB 3S34L 3S97C 3WL9A 1F0LA 1I1AA 1QOKA 4AV0A 7CGTA 4LHQB 4XBEL 4UILL 3HFML 4JANA 3K2KA 4PWGA 4E0RB 2OS7A 1JYVA 4NZTH 2MOQA 4KK5D 4TMPA 2DI9A 1OP3K 5L8LB 3GLAA 3NACL 1QTPA 2XXGA 1L0XA 5DQDL 4L0YA 4U6VL 2HJKB 2X70B 3C6LD 4KDTA 3OAZH 3BEVB 4O58L 4X6BB 5C6PB 3MRQB 4C4UA 5CD5D 2ESVB 4GS7B 4EKXA 3IFNL 1LO4L 2XHNA 4ORZC 4ZDHA 4NFDA 1RZKH 1DCLA 2QZQA 2RIKA 3ZMNA 3QA3B 1JV5B 2IDFA 4JW3A 1CU4H 1E90A 4JX0A 4QHKI 4AQZA 3HZKA 4PW3A 3GBDA 2FT7A 4HKXB 5DJ6B 4N8VA 1ZXQA 5ID0A 2Z7YA 2NXZB 4YHZH 2NYYD 5JW3L 1MJ7L 1AGDB 3EH3B 4LSQL 2ZUSA 2F7QA 4KX9A 2ZYHA 4QOKE 4ZXBB 4GBXB 4R26H 3MXWL 4UZSA 5GJSL 5DUBA 1G7LA 2CHZA 1O6SA 2PUQT 3IFPB 4TUKL 3VRJB 1WG3A 1QMUA 4ORGA 5C0AE 1ITCA 4ZBJA 4PJ7B 4L37B 1H3XA 1E3ZA 1XGPB 5I1AB 3PWUA 3UTZA 2HX7A 4PVMA 3FUKA 3GJFA 1IJ9A 2OMWB 4M5ZL 3PGFH 1E4KC 5E9DE 2I24N 35C8L 4F7CB 3RWHA 3FL7A 2OL3A 3MXVL 4MJJA 2JJWA 4P2QE 5GS2D 1V3KA 3W9EB 3FKUS 3LNGA 3W2DL 1ID5I 1GGBL 5F9OL 1EZVX 2DLHA 1EJOH 2G4GA 3ARDA 3MNZA 4JG9A 4MMXC 4Y7OC 1G6RL 1Q1JL 3QUZB 2F7RA 4K9EC 2YC1A 1HKLH 3IGAB 4HUCA 4I18B 3IE4A 3QCTH 1RUKH 3ARFB 1Y6KR 3PHOB 3R8BB 3RKDD 2YSSB 3O4LB 2A74B 4LBEB 2P28B 3KWVA 1FLRL 4X4KA 4BINA 3RDJA 4NRZB 2FWOB 3EJRA 1VJSA 1BJMA 4UI2A 5C08E 4AQ1A 1HZHH 1K8IA 4DVBB 1OP9A 5GGVH 1SJHA 4OUUA 3BZ4A 3RVTD 3UJJH 5JW4N 5DO2C 1RXLA 4IEFA 5DO2D 3VGAC 3UTPD 2HSIA 4ALAL 3DYPA 1GYVA 1G7HB 4UTAA 1S3RA 2OAAA 5CD3B 2YAMA 3SGEH 1FV1A 3UBHA 5ANMB 2ZWLT 4ZPTA 5LCVL 1JWUB 4I48B 2YFOA 4QRRD 3PQYE 3I9AA 1ZA6A 4C58B 1FVDB 3UEZA 3ZHKA 4TULH 1CGVA 1QR1B 2P5WE 3ULVC 1RUQH 3O8XA 4EI6B 3KLQA 1UWFA 1FO0A 3VX1A 1RPUA 2XV3A 1DBAL 2XUWA 2O1AA 3QDGE 3RE0A 1SM3H 4FS0A 4OGZA 43CAB 5CR8A 4WW1A 1KXHA 1NCBH 2E56A 3X14B 4F58H 1HTYA 5I8CB 1KB3A 1NAMH 4M8VA 4OLVL 2AQ1A 1NMCC 4HOZA 1NC4D 1EHXA 1AMYA 2WN2A 4YQXH 4Z7OF 3QG6B 1DSFL 3WEBA 4CVXB 5HVWA 1ANUA 4LCCA 4N6QA 3M88A 4Z9KB 5GS3A 4F5CE 2WY3B 1AGCA 3CMOH 4BFEA 5I6OA 3BO8B 1A66A 2WWNA 3MCLL 4KKCC 1UENA 3F7VB 4TSBH 4BFIA 4ODVH 1LK3L 1NKGA 4WHDA 3PDGA 5T33H 4JREB 4BBWA 3EJSA 2Y5QA 3A6CL 4RMRA 4R90H 5IVNA 3BZEA 2I9TB 3DA0A 4IOFD 3IKCA 4YDVA 4IHOA 4EI5C 3K4AA 2RB8A 2XPGA 3EHBD 2HH0H 3JTBA 4D94A 4PJ5E 5AG9A 3MJ8A 2V7NB 4KVNL 1NTDA 4WFEE 5K33A 2DMHA 1AR1C 4Z76A 1T0NA 3JTSB 4EIBA 1Z32X 2DLIA 1KYOJ 1DSWA 5C0BD 4DZ8B 1G1OA 3N0PB 3VXRB 1MY5A 3NP4A 4ANKA 4ELMA 7PAZA 1JZGA 1INEL 1C08A 3C60D 2OXHA 3FUNA 4FDWA 4HKJA 3VWJB 5E8NA 1BWMA 3O3AB 5DRZA 2YD6A 5A2JH 1CICD 2ZT9C 4JFQB 1BV8A 4W9LC 4KWUA 4KZDH 1I7RB 4FQJH 4JQIL 4KK9D 1G9MH 4L29A 1BOGB 4NKIL 3VG9B 2QV4A 3NZSA 3QWRD 3RZCD 3VFOB 1BVZA 1HL4A 4KPHH 3S5LG 3L6FA 1GVIA 3K0WA 1ZIAA 3ATFA 2FZ3B 2IAND 4KZEH 4N0FB 2O4EA 4PR5A 3OMZA 2WXOA 2NY3C 1D7CA 5KBMA 3U9PL 3DTDA 3LY6A 4HH9A 1C5BL 1SJEB 1KJ2A 2NY6C 1OZTG 3UGUA 4NZRL 4OFPA 4U49A 1OVZA 3FRUB 3TFBA 4OI7A 1J0IA 3NIFE 1EZLA 5ALCH 4XPGL 4Y2NA 3CDYA 3UTTB 1F4WL 1I3RB 2AI0H 5MEPB 4EZLA 3EOAB 1I9IH 2ARJQ 5CP3H 2WKOA 4KKRA 2DQMA 3V5KB 1GW0A 2APWA 2RFXB 3AY4C 4MXWL 5J7CC 3B34A 2YMOA 3CPUA 1REIA 1EFXB 2QQLH 5EU5A 5BZZA 3MLWH 1DUYB 2F54A 4N2EA 4G72B 4Z3FA 3MKKA 4NQEB 1A7PH 5IV2A 4Y9GA 1HHHB 1P7QD 3JYCA 1G7QB 1JXGA 1TCRA 4AC2A 2CO3A 1OTSD 5KSUB 3EKCA 4A2GA 2VUYA 1ZVSA 4ODUB 3EUDA 2XG4A 1MUJB 3SHSA 1OAZL 1DE4A 2E7BA 5A7BA 2O30A 2OQJA 4NXSA 1SJMA 1EHLL 5L7XL 1WWCA 1MCPL 1GC1H 1IMHC 5IFAL 1IT9H 1I9EA 3OKNB 4WGKA 4P5RA 3V79C 5KVEL 1TCMA 4OZHF 3V0DA 3MV9D 2Z3FA 5IMKA 5K69A 3RVTC 2BP0B 2YPVL 4FF9A 1QBBA 5I1IH 1MCIA 1NEZB 1ACZA 4FERA 1E5YA 2FX9H 4O5LH 1JHLL 2VN4A 1HOEA 4MCMA 3TASA 5I26A 1PLAA 1DVFD 1IM9D 1Q9LB 2NTSP 3EDFA 3VA2C 5FYJL 2Z8RA 3ZMRA 3MACH 1MFUA 3FT1A 2VISB 3BRGC 2FJFA 4P5TA 3QZBA 4S1QL 3C8KA 4NKDA 4E9RA 1IGYA 1FFPA 2J5LC 2OSLB 3V52L 3WTXA 5D9SA 3SQOH 1HXMB 2XJKA 1PBYA 4GQRA 2HG0A 2XIBA 4P9HH 1UWXH 4YSUA 1VFUA 3WS3A 1DN2A 1X5IA 2M26A 3QXWA 3VE0A 4XWOD 2PW2B 3OXRA 3O3DB 3ZDZE 5I1HL 1R75A 1B9KA 5LQBL 5I15L 2XSKA 4FTVB 4G7YH 1HKLL 4U1JB 4N2KA 1LYQA 1MH5A 4HZAA 2R4RH 5C92A 3A6BL 5SWZE 4M8UA 3VXSA 1JYXA 3HI1A 1ZEAH 1JFHA 2FCBA 1LO0H 5E2WH 4ELDA 4Q6IA 2G4EA 4E41D 2QL1A 5CHNA 5AOMA 4LHUB 2HT4D 6FABL 2BSDA 1SFDA 2PXYB 3B8SA 3O11B 1NOLA 1QSVA 1WPCA 2ZSWA 2WLYA 1WS7A 3T0AA 2JCCB 2XWCA 4MZ3A 1TIUA 2HTLC 3CC5B 1R4XA 2EXTA 3BAXA 4HEME 5E6YA 2UYLB 1L7TL 5J13B 2R56H 3WJMB 1AOHA 1MFAH 4X5RA 2V5TA 4L3EB 4XX5A 2IPKA 3F04A 3V9CA 4BWUA 1LEIA 5BOZG 2Q2LA 3F7QA 4KKLC 2VE6A 4ODHL 5D1ZD 4PVLA 5IJBC 4JO1L 1F6FB 1FGVL 1I8AA 1QR4A 3L4CA 3PFUA 5JO5A 3HBQA 4U1IB 3SDCD 2GUOA 2V5MA 4N8PA 5ETUB 2HT4C 5SWZA 3HR6A 4XVJL 3DX9B 3RWDB 4GRLC 4HWNA 4UT9H 4N8CH 4NUQA 5D2NA 3HZVB 2FL5B 5F7WC 2R69A 5D2LB 4G6KL 1AZRA 1NMAH 2E6PA 5EBLB 3MUGB 1MJ8H 1YDPB 4MKMA 3G6JF 5D7SL 1TJGH 3QQ4A 2XZAH 5EA0H 3GSWA 2YOAA 4HS6A 5FKAA 5GGUB 1S9KC 4YPJA 4W9JC 2AKRB 5K5YA 3DIVA 2IALA 4CC1A 2GJPA 5B39A 4YO0B 1DBBH 1PSKH 4OFQA 4KU1A 4X9GA 3D33A 4GXFA 2V7HA 1WISA 2NNCA 1NEPA 2WNWA 3THMH 4C47A 1VKXA 1E4JA 3D3VE 5ENWB 3Q13A 2MOVA 1G7IA 5AYQA 2LU3A 3V7MA 3QYNA 5F7YC 2YBRA 4X6DB 2AEOA 3VH8A 1J1XL 1FIGH 2HRPH 3AS1A 4F2MB 2WNXA 3VTMA 5BJTA 1PF3A 1TJXA 3H2PA 3FU7B 3N3EA 4GIOA 4P4RB 4X5QA 1CFBA 1RU9H 1WD9A 2K70A 2Q2EB 1DUZB 2AV7B 5ECGA 2JMRA 2IG2L 4KHTL 5TDOB 4WEUD 35C8H 4I88A 3C9NB 5FC9A 2IXQA 3PWJA 5A7EA 3MNDA 2AP2A 3OX8B 4JBSA 3SDXF 1U2CA 1JD9A 3IGKA 1TQBB 2WJ7A 4Q9QL 2ZWZA 3R06A 3K6SB 3K4DA 4N2GA 5HGHB 1TQCB 3C8DA 5FYLL 1VEMA 5BUPA 1OXYA 3DGDA 3DI2B 3G5XA 1V3LA 5DZ9A 2Z9TA 5EZOH 1UD3A 3EDDA 3KBEA 3UCRA 1N70A 3CCHB 3L4WA 4PS8A 3J7HA 2VAAA 4HUWB 4L1BA 4HD9A 3PPSA 2BERA 1FQ9C 3BKCL 1CDHA 2Q20A 4TVPD 1XTMA 2EEFA 2DZEA 1A4AA 2JCCF 2X2HA 3UPCA 2Z34A 1C7SA 3E6FB 2Z92A 4C4BA 5DC0A 5DJYA 2EIDA 3FQRA 2YMXH 3D18A 1VRSA 5AB1A 2VNCA 4ODTH 2J6EA 3WE6B 1G7PA 1KB5B 4B6ZA 4KH9A 1VIWA 2GY5A 4I3SL 1U93B 4LCYA 1CYXA 3KYAA 3V5HA 5EBMB 4BZ1L 3QUHA 3KJ4B 1F1AA 3U2JA 3WTWA 5DUMH 2AV1B 3W9DA 1UQSB 4DCQB 5L2KB 2QVIA 1XIWB 1CDUA 3B6SA 3T8XA 3DX6A 1BOYA 4UUJB 2W38A 2O61A 2V2TB 4HIJA 2IBZX 4B9KC 4NEHB 4NNPH 1WBZB 3I6KA 2DB8A 4UOZA 1E6JL 4MS6A 2N01B 3IBOA 3EYQD 3DX3A 4R96B 1M1XA 2YEZA 4PJHE 3L4YA 3LD8B 3NVQA 3G04A 1QHOA 3A67H 1IILE 5JHDE 4ZFZA 4CVUA 3WIIH 3ZIYA 2E7LC 5HD8C 5HJDA 3VFGL 1IGCH 2J73A 1I1YA 1WUNT 1MCOL 1QG3A 4JO2H 4LRNL 4ONOA 3NG5A 2NY7H 2ZOUA 3ZTJH 3AT9A 4U0RB 3QUYC 4DESA 3A23A 5SX5K 2MTPA 3ETTA 1FRGL 5E56A 2DM4A 2Y5TB 1E42A 4KROD 1KTJA 1Y6NR 1KIQB 3HKZA 4MMXB 2DKUA 5F96L 1DVFC 1XR9B 4ES8A 4F5CA 2VGLM 2P5EA 5JHLA 1JUFB 4OU3A 3BWUC 4N1CA 4PS4L 2NY7L 1ZS8A 4R0LB 4S1RH 5AKSA 5AB2A 1B4RA 5BVPH 1HHGB 2FJSA 4PRDB 3OGCA 5CIPB 2XKSA 2DLEA 3LN5A 4Q89A 4GUQA 1OAJA 4AJ0A 2D73A 2GTWB 3W39A 3CE1A 4S11A 5F21B 4TVPH 1Q94B 3PNWB 5BS0E 1EJ8A 1NFAA 4UAHA 5FR3A 2VJXA 4Z0XB 1USZA 4PJ5A 1P5VB 3QARA 4PB9H 4AVKA 3LX9A 1KPUB 1M6OA 1WFMA 4PJIE 4B7IA 3WY4A 4X4MA 4P9HC 2J12B 3UERA 4ZUSB 5F1NA 2DM3A 4UT6H 3GUFA 3LRSA 4OV5B 1CLCA 3L3GA 5E00B 2Z1PA 5I19H 5JNYB 5EBWB 5C7ZA 4YHNB 2X2JA 1CE1L 4ZFFA 4TF4A 1QTSA 4H4NA 3QK0A 3RVWD 5L4IA 4XOAA 4YPGB 1OW0A 4U1SA 5IBTL 5JOPD 4FYSA 2FYYA 3KPSE 4EN3D 4Z6AT 3IVKA 3P4NB 4Y4KD 5DJDB 3S3CB 3ULUH 3QHZL 4JFDE 4UDTB 1BVNT 2NY3B 4KTGA 4O02L 4OKVB 2F5AL 3OQ3B 4U0RC 4EVNA 3DUUA 3PV6B 2NXYC 3KGRA 5GZNA 3RGBA 1KB5L 3V0HA 2P8LB 1TQWA 1NUGA 4NZRH 1D6EB 1QEWB 2YD3A 2D7TL 1U95A 1SDAB 2CRIA 3H9SD 4KRPB 5MP6H 4DZBA 1WA1X 1GYCA 1YYLL 1JHKH 3FTGB 1ACYH 1BMWA 4HHAB 3BQUC 3FC8A 1KTDB 3WMPA 4PSPA 4NQVB 2X4QA 4FG6C 3WFHB 1EZUA 4XWGL 1BAFH 2ZCHH 5C3IA 3NCBB 3N9GL 2IPUK 1DQKA 1CFVL 1XCQA 3HMWH 1UVQA 4GIPD 1AJ7L 2VLLA 4Y4HC 1INQA 3LKSA 2EXWD 2EVGA 1NEZG 2WXFA 1BD2D 3ESMA 2TSBA 2DQFB 4ZMOA 2OMUB 2G5BB 3MV01 5I0DA 1E43A 5IJKC 4J2XA 4FJ6A 1I1RA 5JQIB 4Y19A 4YDNA 4U1GC 4QRTB 1KGCD 4NM8L 1ESOA 4POZD 5F8QC 1HEZB 1CL7I 5KVGL 4G1EB 4E9LA 5L7XH 4I1RA 4I77L 3KYMA 4IBYA 2X4TB 3SDYH 4HAGA 3JV6B 5HVFB 3TBVB 2AXHA 4R2GB 2R1WB 2VW7A 3WXWH 2GAZA 3GSRA 5HHPB 3V95A 2A5UA 3S8WA 1DBMH 1MHHA 1XEUA 3DPDA 2BSRB 2LFEA 4QUOA 5EEVA 3W3BA 2F18A 4N8VG 1H3TA 3PHQA 5A2KH 5I75C 1HXYA 4OZIA 1H8LA 4G7VL 4QRUB 1JZ4A 3NN8A 1YMMD 4JZNB 4H88H 5HDQH 4Y8DC 3WY1A 1UT1A 2YAFA 3CMOL 3LYRA 4NC1E 4PJAE 1EIBA 3MLZL 2FEEI 4R84A 5C3TA 3V4VB 4JFDB 1TTUA 3QZWG 2VN6A 3ZRFC 1IGMH 1FJ1B 1XGUB 2XVGA 4J3WA 3NCJH 3NCEB 3L4TA 2MOGA 3MOAL 4HLZH 4AH2B 4FXKA 4NUJA 5HHOD 3HB3B 2J2ZA 2UV3A 4A68A 1LE9A 1YQVL 2DOCA 4C4KO 3MBEC 3NJLA 2RH0A 3D85B 4XCNB 12E8L 2GPZA 4FKEA 5CJBA 2Y9RT 5TE7H 2AK4A 5DXWA 1AKJD 3SYQA 4WF7A 1A6ZA 3BDYL 2WINA 4L1HA 4UT6L 3WHE1 4OCMC 5I2IB 3FB6B 2VDRL 2QPDB 1LEKA 2Y2WA 3ZBMA 1R0AL 4JY6A 3QEUA 5ACMA 2DIJA 5EDXA 3ARSA 4P99A 4APQC 1CQYA 2P9RA 4I1NB 3DDGA 2ED7A 1GZQB 4J8RA 3X13A 2HJFA 2BS9A 3HNTH 3L3KA 1R0AH 2R1XA 4FZ8H 1P1ZB 4G5ZH 4GG8A 1YY9C 4B9IA 3V0EA 5HYJA 1D5IH 2O6PA 5AEAA 3N40P 5INDA 4ZI8A 1P2CA 3HJ0A 4QRSA 1NBYA 3ULSB 1H3UA 2WYIA 1Y6MR 2X88A 1KLUA 2R4SH 1Y18A 4AEIL 5CJXA 1GXEA 1V7MH 3HHSA 1XIWD 4GRWH 3IB4A 5DRNA 5ERWA 3FT4B 4ODHH 5A16B 2A4CA 4HD5A 3SKUD 5CILL 3SDDC 3VACA 3DHJA 3LRLA 4J3SA 4NPYA 5DK0B 1KTRL 3QZOA 3M6DA 4K8RD 1BZDA 4N2FA 1JF1B 2HVKB 2PPDA 3SYAA 2EYSB 3IF1A 4UQ3A 5EEYA 2P48B 5GGSB 1J1PH 3L13A 2A74C 3L3OA 3LD8C 4X4ME 3CVHB 3NEXA 3RX7A 4TULL 1AGBA 1BXVA 1WICA 2XWZA 3U9WA 3BIAX 5AD0A 5KJRH 2WQAA 2V17L 3QI9C 4H25B 3QUMA 2C5DC 5TGBB 2MQ3A 4L8CB 3FQYA 3BDXA 3UBFA 4NKMA 4O4YL 2QQKH 3DMMD 3FUHA 5T1DL 4MA8L 3QJRB 5IBLC 1DDTA 4FQHB 3S35X 1YRKA 3HB3D 3I75A 4OIIL 1ZLVK 4M7JL 4WEMB 3VD2A 2C3XA 4B50A 5I0WA 1S7UB 3G9VA 1RIHH 4F7TA 1DQQA 2WCPA 5I8EB 3FTZA 1IT9L 3DRQB 4LCWD 2GK2A 1F2QA 3TEZA 3VJ6A 1X5YA 2VXQA 4A38A 1SJVA 2FHBA 1TG8A 4S0SD 2FJHA 4JFFB 4ZXBA 1NUDA 5T3ZL 5IK3A 2DBLH 4BXVA 2K8MA 2C9SA 2PTVA 3OR7A 4YHKH 3MLSH 2WXRA 4FG0A 5DUBB 2I60H 1JGEB 3APMA 4IOIB 2UZYA 1PY9A 4G7QB 3VRJA 4WI0A 4TNWK 1MAJA 2E9WA 2VDKB 1I9JH 2WCSA 2ZCLH 4WUKH 2HRGA 2X41A 1PGRB 1SVBA 3QEQD 3BSGA 4X99A 5GJSH 2HMID 4P4KA 5IKCA 3N85H 2I7OA 2DJ4A 1T6WA 3SOBH 1T83A 4V1DD 2J6EL 1YY8B 3BJ91 3O41B 1JS4A 2Q9OA 3EDEA 2ETWA 2VSMB 3AROA 3IAPA 1KXQE 1TQBC 1G4MA 4CNIB 4H26B 4PMFA 3PY9A 3FRPB 3PWPD 5I30L 1EDQA 3GJEB 3I2CL 3DKHA 1FF5A 5F7KC 1KC5H 1XB6A 5SWQB 2A0LD 5CO1A 4K9JA 1JXDA 1JCKA 1ZT1A 5IB1B 2A9BA 3CVCA 4LLYB 4MD4B 4OIBA 4A7VA 4F92B 2HG5A 2YAEA 3HRPA 1OF2B 1G6RH 1YC8A 4BGDA 1MVYA 2VR7A 3RFZC 2P80D 3KPSB 3LJ3A 4KRMB 4HGWA 1Q1PA 4TLUA 4WFFE 5GS0C 1XVSA 1ZHNB 5L9DH 1HXKA 4FQIL 4PLJD 2J21A 1G7JB 4OJFH 5AZEL 3FQ1A 4F37F 1PZ2A 4M3HA 1Q4NX 4YEFA 1OALA 4XRCB 3QPXH 3JUZA 4KK8D 1CFSB 4JRYA 4E41E 1FZOB 5J8OA 5EZPA 4JM2B 3VRLE 1HILA 4ZNEE 1CGWA 2BVPA 3BVTA 3T4AC 1MFNA 1M2VB 1MHEA 1LDSA 5AW3B 1X44A 5AAWC 3BZFA 3TN0C 3KL0A 1U8JB 3LHPH 4NX0A 4UMGA 5JXED 4HJ0D 1LO2H 3IJSB 4PJDE 5C71A 3DVIA 4OGAC 3RTQB 3WD5H 1L7IH 1CD1A 4OT1H 4ERSH 2OK0H 4NDMA 1PLBA 3H55A 5B1AB 3QDJA 3OF6A 5CLWA 2EDMA 3SDYL 1NDGB 3UC0L 5IVZB 2YGNA 3LV3B 3ARQA 1TPXB 4Z7NE 3OG4B 1YY9D 4HQQL 2CJUL 1RP8A 4FNTA 4WV1B 5C0RL 5KS9B 3HR5A 1FPTL 3H8NA 5H4YA 5JIPA 4HUUA 4OZ4B 3PJLA 1DEEB 4MTMA 4YGVB 4ONFL 4MMZB 4PJCB 2PKDA 4O58H 5HHQB 1RZ8B 5B8CB 4OLZL 1H15A 3P73A 1OGPA 2GY7B 4MS8C 3ZTJG 2H32A 1SXAA 2UWEF 5EZJA 3BESR 5HJ3A 3SBQA 3UTSA 3CVIH 1GKOA 2V6HA 3NCJL 3PF2A 4XNYH 1S7TA 1XF4B 3MA9L 3BZEB 4EOWL 4YXHL 2I9TA 5BZXA 3QHTC 3HN3A 4ZMNA 3U6XA 4U4IA 1FGNL 4TYUA 4G3YH 4N9GA 4OFYD 3THML 2F19H 4KXZI 5DJCA 3WG7B 4MX7B 2WP3T 2IWEA 4HPOL 4MZRA 2E8YA 4RAVB 3RDTB 3ZN6A 2J25A 1CXKA 1OCWL 1IEBA 4LEEA 1NDTA 2XWJB 4IJ3B 3T04D 3EYUH 3MRNB 2EYRB 2DY2A 5IROA 4BSWA 3F00A 4ZAKD 3OMNB 3BD4A 5E8NB 1BGXL 2VDMH 3ESVF 5KZCB 4IRJD 4ABQA 3MBXH 3V0VB 4Y2OA 4Y1SA 4HSAC 4L29B 1BOGA 2A9CA 5D7LD 5GGTL 2GITB 5I76A 5KVFH 1ETZA 3IU3A 4EI5B 3T2PA 3T1FA 4UQEA 2H1LM 3V0FA 4G1MB 1A02N 1Q1JH 1XGYH 2CPUA 2EEXA 3E1F1 1TETH 1IM3B 2Q1EA 1BZ8A 4XN9A 3QCTL 5AOZA 4BHUI 3MI6A 4RMSA 5FCSH 1PKQA 2R29A 3U4BL 5KVFL 3RWEB 1E9PA 3VFVB 2VYRE 1LE5A 4X4YA 3CFBB 3FHAA 3TPKA 1TEGA 2D7TH 1OY3B 2Q76B 5JPMB 1AANA 3VFSB 2JKJA 1E9OA 3CWGA 3GMOA 5D96B 2W9LA 3VXUD 5JXEA 2FB4H 1UA6H 2B0SH 4OV6F 1KWGA 4U2YA 4WWKD 5E4IA 4UQAA 1NGXB 3ZHLA 4ECNA 1MCDA 4NO3B 1OTTD 1MI5B 1VACA 4ZODA 4K3EH 4KKNA 5DJ8B 3Q8AA 3IJEB 1TLMA 1PS3A 1T4KA 3GI8L 4LLDA 4P2RE 4BFKA 2RFXA 4D8PB 4QOKB 1JXKA 2X4NB 3ZKSD 1T3FA 1IRAY 5I75B 3MJ9L 4D7BA 4DPRA 4R2GC 4WKXA 5FW8A 1N5YH 2GJJA 3O6FC 1M9WA 1MVUB 1TCRB 4B27A 3TZVB 4JM4L 1THAA 1A21A 5FYJE 1QWHA 1YEHL 5IB4B 4HEPG 4WWKC 1MDAA 1U8HA 1PYWB 1S9YB 4DAGL 4P3CL 1TR7A 3BAEH 4OCWL 5HYEA 2BP3A 5KS9A 4W9FC 4CVZB 1HWHB 2VXQH 1QLFA 3GI9H 4JMNA 3NEOA 2A6JB 2B59A 2A9AA 1UB5B 4I13B 4O2FA 2X4UB 4Y5XC 1N4XH 2F74B 2IDSA 2YJLA 5HDLA 1HYSD 1ORSB 5ITBL 1HJBC 3GB7A 1DBBL 4DGIL 3FOMB 3AABA 3EFDL 1A9BB 3E3QE 4Y1AE 5JDSB 2FECL 2ZPKH 3KCWA 3NTCL 3SZ6A 3UIZA 5GS1B 1ONQA 5C8JA 5IEKA 2X12A 5JXEC 3CFQA 3FQWB 4IS6B 1NQBA 2OSLA 2AITA 3MNVB 2X2UA 2DQDL 1MW1A 4H8WH 4CMHB 5LGHH 1Z9SA 4P46A 3SE6A 1DJIA 4MGXA 4NYLB 4XPAH 3F05A 3W1ZA 4DH2A 5CLZA 4FEIA 5C0JA 3ZTCC 1DO5A 3DSFL 3SCMB 3T77B 1UZGA 4FHJA 4GXUN 1RZJL 3OAYH 1U8OA 5I8KL 3BISA 1MSPA 3ULUC 5ECJE 3QULA 1JK9B 4QCIB 4JO5A 4N0YH 2DMBA 1CIUA 5I5RA 4YBQD 2PO6D 4MDJB 4WDIA 5E1HB 3ZPDA 1E4XH 2YRPA 4FKHA 1JZ6A 4G7YL 3I50H 1JZHA 1CFQB 4JRYE 4R4FH 4Z78B 4X6DF 3A6BH 4UNUA 5MEND 3UZVB 4FQPA 1CXFA 4LP5A 1K3IA 4QXUH 1EJOL 1RVFH 4BFBD 4D0BA 3TURA 3UX9B 4WGWB 4DSYA 4IGBA 3EO9H 1TTGA 4FQXD 1HX0A 4J8QA 5LGJB 4I9XA 5GZOD 4KJPD 4PY7A 4RMVA 2BZCA 1HWGB 2Y0SA 2CA4A 2R7EB 4O02H 4RSYA 4WNJA 5IHWA 2KZ1B 5DD6A 3DC0A 3E9UA 5MHSD 3R19A 1NCGA 2D31A 2D7NA 3CD4A 3CIQA 5I1LB 1ADWA 3CHXA 4X6CB 4QI3A 4UAOB 4XPGH 2IBZY 1FNEB 5J1AA 4PRPD 1FL6A 2Y6SD 4Y5VC 4J7RA 3D2TA 3FCUB 3ELAT 5LJYH 3H3PL 4XCCL 3QH3A 4NT6B 4BH8B 5AW9B 3KYOB 4U3XA 4IIQA 2NX5E 4JZJC 4LOUD 5I5MA 1IARB 3HMWL 3T6WA 4P2RB 3U0TA 2DQ6A 5C0RH 3ZXAC 2Z91B 1SRDA 5CGTA 3SYOA 2MQGA 2ZNWA 3L4ZA 1M6UA 1SGKA 2YAQA 3M8OH 1G43A 5F6IC 3T2NH 5DS1A 1Z5LB 3GSNL 5ANME 5HHOB 2XN9E 4JY4A 4F9LA 2IWKA 5F7BA 2N56A 2CXGA 3M7FB 2XVLA 2P24A 1N0LA 4LLWA 4YSPA 4K3DL 4ZD3L 2OJZL 3MRPA 2E47A 1B3JA 3HUJA 1L4IA 2DEYX 2ZD0A 3KH4A 2ZUWA 4Q52A 3D6GA 2Y1ZA 5HHMB 3WJLA 5FYLD 2CLZA 5TPWL 2FT6A 4ONHB 2V7HB 4G8IA 4KVNH 3BKMH 4X4ZA 1FO0H 2XA8L 3OJMB 3PS6A 5T1LA 5DQDH 3O4LE 1RUPH 4TPRH 5SV3A 1ZD6A 1JZ5A 5EOTB 3BP4A 3TO4B 1VGKA 4WI8A 3RX5A 5BJTB 1MLCB 4XMLL 1DN0A 5I1EL 4JPVL 3BAKA 1WZKA 3KXFD 3FS9A 5EEXA 3J27A 3L9RA 4DN4H 4ELMF 1MCLA 4LOEA 5J1SC 4X0KB 4LNRB 2JH2A 3LCYA 4KO5A 4AXWA 1G9ML 1A3QA 1XL6A 3X11A 5L88H 5E6UB 3B9AA 5KOMC 5IM7B 1A4JA 2GIXA 1QEXA 4OFYA 4WFFD 4YDZA 2Y3NA 3E1ZA 3TJEL 4PWEA 1EK3A 4K23H 5H2BA 4EUPG 2BNQE 3CFKA 2WXPA 1P9MC 3H3KA 2LLLA 2H47C 4AT6B 4QF1A 4PBDA 5ACZB 4JPSA 5GZNC 1F4HA 3AUVA 4NRYB 2WYHA 4Y5XB 3VD3A 1LJMA 4MCZA 2J5WA 1PNCA 3DBSA 3W0WE 3QRBA 4XNMA 2FB4L 1I1AC 5DRXA 1EO8H 2JCCE 3FFCD 1VGEL 3C6SA 3DJRA 4AITA 4TNGA 4D9RE 2NNXA 3W57A 4HIIA 2WWMC 4ODXB 3I6LE 3G6AB 3GBNL 1DQLL 2X7LB 3NRQA 3K91A 3SGKA 2Q8AH 3BP6B 4Z7NB 2R56L 4EBQL 2CR3A 3BE1H 3GRWH 3FU9A 4HWBL 4QNPE 2UY7A 3MJ9H 3V0IA 3V5DB 3MMEB 1OGAD 3EOBB 4DVRL 3FQNB 1XGQB 2W0KA 4LKXA 3A24A 4KXAA 4DGVH 5CGMA 3TP4A 2H0FA 4UV4H 3H4FA 4IHBA 4BWTA 5I16B 5K59E 3AAZB 4NCDA 5C0ND 1MF2L 3WFBH 1EHLH 4MAYB 3QI9B 1OAQL 1PZ5A 4ZSOA 3N50A 4FAAB 5KVEH 2OYPA 4DGVL 4E41B 1T5XA 3FO0L 3QRGL 4ZO6A 4PJBA 3W0WA 2EIJB 4K8RH 2EH7H 2I25N 3G5VA 4A7QA 1M1XB 3EG9B 4L4VA 5F9JA 5GSRA 2WMPA 3ISYA 3L3OC 3FT3A 1GGCL 4OGYH 4ABWA 5IQ7H 2MPAH 3EJYD 2BVEA 1LNUA 1ZKAA 2A9NL 2PYED 5MHSE 2VLRB 5IJVB 2ZX5A 1AQMA 3KEHA 4FA6A 3LPOA 3CDZA 3SODB 4W9IC 3UTQB 3EBHA 1JL8A 3F5WB 5D1ZB 3QAZC 1INDL 5T5FA 1G0DA 4EEEA 1Q9WA 1NBZB 2Y6TE 4G9FA 1T04A 4TQ8A 3WY2A 1ZS8B 2PMZA 3DETD 1KBBA 2NX5D 4R0LA 5F3HB 3SO3C 2FX9L 2VZOA 5F89A 2NMSA 3VI4B 2VZ3A 1R3JA 3CVHL 4YC2B 3D39D 3GS7A 4TSCH 5CGBA 3NPSB 4LCUB 4FCHA 2QSCL 3IAQA 3QA3A 3F8UB 4ACPA 2LU7A 1HIML 3RVUD 1KPUA 2R0KL 1ASOA 5TE4H 3BUYA 1DQDL 4LDOB 4NQDD 1KYOK 1AHWC 5E00A 4LIQE 4OI8A 2J7LA 2AJVL 3RPIA 2NY0D 3RWIA 1RVFL 1CT8B 4TUJB 3QIUD 2LVCA 5SX5H 1MCJA 5HSFA 1WBYA 3MV7A 3VQMA 1CLOL 2IH9A 2FGWL 2WB7A 1SY6L 4GSXA 4L1TA 3TBTB 5DMIL 5KSAB 3GTVA 3OAWA 3RFZB 3CAFA 3VSQA 3MLYH 5C0GA 3OSKA 5IUSA 3TF4A 2X4OA 3S4SB 4EZMA 3AU0A 1D6EA 1QEWA 2AABH 3SDDA 1KFAL 1QW9A 4K5LA 1H6EA 1I53A 3ESOA 5D1QE 5HDOA 5BCAA 3BUQA 4R4BA 4AYDC 5I74C 1CICB 1SLWA 5CJXC 3DX2A 2YMXL 1UYWH 2R2BB 3EYVB 4DVRH 5DJAB 1JVOA 1T4WA 1NANH 2NYZA 1TFHA 1W9XA 3OMIB 4B9CA 1MOEA 1JWSB 4G2AA 4KY1L 2C3GA 2J72A 4XAKD 3GHEL 4N8CL 3C5ZC 1PKOA 1V55B 7PCYA 4AGLA 3PHOA 2K7PA 4HDIB 4W93A 2WBJB 1SJXA 4XAWL 4J3OF 1CGSH 1YEKL 1AR1B 3INUH 3LKQA 1J88A 3ME0B 4KTDH 4N3TA 4RAUB 5B1JA 3U1SH 4P2OC 1O6VA 3B9KA 4I0PA 2AAAA 1HEZA 3DHMA 5GZOC 1A14L 3L3IA 4IEFB 2OJZH 5D7EA 3EYSL 5CJ5A 2BIOA 4OZHB 1WC7B 3QUML 4RQQA 5AW0B 4XPTH 4QKXB 1F97A 5KVMC 2FH8A 3EFFB 4PV8B 4KFMA 3DXAA 4JO4H 1FV1B 4R4ND 2GAZB 1AD0A 3P9LB 1OP5H 5DQ9A 5FDWA 5DWUH 1IUZA 2N59A 1XAKA 4TS6A 5DZOA 2KERA 5DEGA 1JNLL 4BKLB 3SPJA 3VRIB 3CK0H 4P2QA 1VDGA 5EN2B 1L0QA 1ZK9A 5BV7H 3GBLA 5I0XA 4G71B 4AL8H 1EEZB 4YHML 3SOTA 1JZ8A 5LWYH 1TTFA 1WD8A 4JFUA 5HI5C 3FCSA 2VABA 4CBZA 3X3GL 3D52A 4YWGL 4JM2F 5HBBA 4WJ5B 3QDGB 1S2EA 1MKFA 4GLRI 4ICWA 2R2HB 4EDXB 4M5TA 3RL2A 5K9OB 3L8QA 4PJEF 2LV4A 4X7TB 4YDMA 3KBFA 5KJ4A 4R4NC 5CAYB 3ILQC 4JHBA 2FRGP 1RZJH 2AK4B 5FYLH 3KNBA 1YSOA 1IQDB 5KYYA 5ABAA 4B9JA 4PGEA 2XRAH 2MNJB 1R17A 3K80A 1CGUA 1X5ZA 1QPKA 1LEKB 4UDUA 1JFQL 1RU9L 1CXHA 1GMEA 4KUZH 2J1ZA 1PY4A 4Y8AA 1NC4B 4A7UA 5IB5A 2K6ZA 2OJEA 3I2CH 3IKCB 5I24A 4WZ9A 1NA8A 1KCUH 3SQOL 4FJYA 2X05A 4HUNB 3CUPA 3P9MB 4CC4C 2WVVA 2EVFA 1KY7A 3EYOB 4RMBA 3PJSA 5IW6B 3GK8H 2R1XB 4Y9EA 4ZOAA 3RG1C 2PCYA 4LPTA 3INOA 3O8XD 1TZ8A 2BY2A 3TTYA 4KI1A 2JWYA 4O9HL 1A3LL 2E9IA 2VDPB 3X1GA 5CM1A 1YCSA 5GGVY 4UV7H 4OF0A 2FLBT 3DPBB 4RFNC 3DBXB 4ZS6D 4AZ8A 2OXHB 3EHBB 3GPSA 5CU5A 3QDAA 2WQRA 1C1EH 4BUQA 1TMQA 3HHSB 4DT2A 1CD9B 1WE5A 3GZOA 1O6TA 2X1QA 1NOFA 3IAGC 4L4VE 2UZIL 2J1KA 4JHAH 4Z3HA 3X1BA 3JQOB 3GEFA 4HUMB 1GGUA 4XNZC 1IAOB 4L9DA 2L7QA 3MOBL 3VW3H 4LSSH 3TA3B 1BF2A 2B3RA 3BVNB 3A47A 3L5HA 4KV5F 3LHPL 2Z31A 2V8LA 3G6JE 2QDWA 3V6FA 4PJBF 4BEIA 4HH9B 2BW4A 3ARUA 1AGBB 1T6BX 2WYTA 1HKFA 2Y23A 4FYRA 4W9EC 1W91A 3QUMB 1OW0C 2QBWA 5KWYC 3UDWC 1SFHA 2XQYG 1OCZB 1QVOA 2JJTC 3E8UH 1J8HB 4KKAD 2OP4L 3C12A 4QEGA 3UC0H 1CD0A 5BVJB 3S36H 3MOQA 3DGGA 4JO1H 5AL8A 5ESQA 5GGRB 5TD4A 1R46A 4TRPL 3I75B 1NAML 5FA3B 2ZWSA 2P44B 3Q1EA 3D50A 6TAAA 1F5WA 4M48H 1WFOA 3S8FB 1XV8A 4M7LT 1B6UA 2OXGA 1AVAA 5CP7A 1JBJA 4YZFE 4Q6KA 3ZSSA 2EINB 4GUOA 2WO3B 2YEQA 1C5CH 3D4YA 3TJHD 1BVLA 3STBA 2FDBP 4CU7A 2VZVA 2L8AA 4OCSL 4R7DA 4AG4H 4BQ6A 2HFGH 1PZUB 4I4WA 1BZ9A 1HHHA 3IJ9A 4U7MA 2NY4C 4LP4A 3WHE0 5DS2A 4UOW0 4PSRA 3HC0A 1OAXH 4J1UA 3KPNA 2DIAA 1ZVSB 3B2VL 3L95A 1RZ7L 3F7YA 3LSOA 2BS71 1DE4B 4M5YH 1O5DT 3CN3A 4G11A 1G87A 3MRMB 3EFOA 4OF6A 1TYRA 1RZQA 4NN6B 1NSNH 4X99B 4ZZFA 4NWTH 3K5SA 5DHYB 1B4JL 2H2PD 3HAEB 4NERA 4EI5D 1WYJA 1CWVA 2XQYK 3ZZQA 4QGYA 1J0YA 4GUCA 4AQ1C 2CDGA 2AEIT 4FXGC 4HWBA 2XWTA 3E80A 5KSAD 1TSRA 5BW7A 4PUBL 4YX2H 3VXOB 2MMXA 4ANXA 2P5ED 4TQIA 4RGMB 3D5OF 3F7LA 1WSST 2J3SA 4G82A 1WT5A 4XBGA 4OZFG 3UDWA 1YECH 4TN9A 2AABL 2ZYSA 5EN3A 2PWFA 5D7JD 4LAQL 2QFPA 3HS0A 1FNAA 4PJAB 4KJWD 4NAQA 3Q05A 5LB1A 1U58A 2IJ0C 1J0KA 2YWZA 3GSXB 4HGWB 1JDCA 3C6EA 2BSSA 4GUPB 5CMAB 3QCVL 4PWJA 2GEEA 4Y4KB 3KL5A 1Z3GH 4NO5A 1T1XA 2ZXWB 2YLHA 3JWDH 4BQ8A 3QUYD 1D5XB 2A9ML 2ROXA 4PD4K 5ALCL 3AREA 3REVB 3S9DB 3I02B 1H9VA 1ZT4A 1QKZH 1TO5A 3D2UD 3CSTA 5AW8B 1AR1D 3V6OE 3CHPA 3WNPA 3VRLF 4K3EL 3QR0A 3PWPE 1BQHB 1E30A 2P8MA 4X5PA 1ITBB 5K93A 2KDGA 1NCUA 4FMKA 1S78C 3V8OA 1U8JA 5DJ0B 4MVBD 3C5SB 1XR8A 4GW5B 1T2JA 1PKQE 2R39A 4LKCB 5D1XB 1L9OA 3U79A 3WELA 4JHZA 5GISH 1AZVA 4YFLF 4BM7A 2JKRM 3VDAA 1GYUA 3GEWB 4X6EA 5JIIA 5J56B 1CFVH 2X6CA 1NGWB 4WGVB 1KTLA 4UOQA 4DEWA 3P02A 3PGCA 3WFDH 3HZYA 2I26N 3NCCB 4QLRA 3GMQB 1AFVH 1HINL 1JYWA 4PTUB 1JRHI 4GRLA 4QHNB 4KTYA 1HWWA 2KPWA 4YGVA 3HE7A 2WQ8A 5IFJB 3Q48A 4XP9H 2VRQA 2DWTA 3QHFH 1CR9L 1QFUL 1JVKA 4X7EC 3O3EB 3VFRA 4LSTH 1R19A 4LRNH 1BFOA 4CADA 3QIUA 3NJNA 3FT0A 3WFDL 3VB8A 3TJPA 4A2HA 1Q72H 1JI2A 3CFNA 3N2JA 4ONFH 3HBGA 4M1CD 5E8DL 3QZMA 1SMDA 4X4XA 2VB5A 4RMQA 5BMFL 3B2VH 1ZHBA 3ZUCA 2DLGA 4K2UL 2HKHH 5JIHA 2ZOKA 1MHCB 2W0LA 3IXTB 3KCPB 5DMJB 3ARBB 4PJIF 3BUBA 1S7VB 4XNYL 5T3ZE 2RHEA 1RLBA 1SMAA 4YDLC 1KCLA 1ZPUA 3MRFA 4XE0A 5A2CA 3AG4B 3L2NA 3MGTB 4YLBA 3KPOA 2L0DA 2GI7A 3AGWA 4UTCA 1RHHA 1S9XA 4Y4HA 2PR4H 2AJ3B 2VR6A 3FU3A 4QHUA 4X2UA 2DWDB 3EBIA 1CIDA 1K8DA 1UEYA 3HNTL 1XF2A 1XF3B 3NQKA 5CR1A 4JMXA 3SCMC 3WTSA 3SY0B 3KS0J 3TBSB 2XTJE 5D5MA 1JN6B 3UYOD 3T1FB 3RA7L 3GHPA 3QORD 4X6CF 4HJTA 3TJEH 3BIKB 4FLSA 4HKZA 4F2MA 2OCJA 1S7SB 4ZMTA 2IIJA 4LU5L 3ARVA 3MYJB 3FXIC 3WNIA 4PB9L 3M17A 1PKQB 3EW3B 4IDLA 4PJDA 1QSEE 2VDLH 3N6YA 3PNRB 4N0CD 2JKNA 2NNAB 4KAQH 3BHBA 4WWNA 5HYQA 4KUCF 3WUWA 1NBVH 4XNQB 4GI8A 1PIFA 4MNQE 3EBGA 4OJAA 1EO8L 4FA8A 5JA9A 1QUNB 3QG7H 5C0CD 2DS4A 3VFNA 2UVEA 4ZFOA 1V3JA 3GGWA 4PGCB 2CIIB 3Q2VA 5AKVA 2ZXCA 3MV11 1X9RA 3OJDA 1WZLA 5IG7B 5DJXB 1CJYA 2H1XA 3BFQG 3GSOA 4OD1L 3ZMEA 1U3JA 3IS0X 4JCLA 1FNGB 4XAWH 4QTFA 3VX0A 1I8MA 4TKWA 2IF7A 4YK4B 5E2TH 1IAIM 1TMCB 3ZYJA 4Z8FL 5C09A 1IB5A 5L8KB 4PRID 3PL6D 5I71B 3MLWL 4A66A 4F80A 1ZSDA 4AQEA 4UOW1 5M95B 3WJJA 5A6LA 2W9DL 3EZJB 4HLEA 1KB5A 1F1DA 1F8TL 2N4IA 1PX8A 1FC1A 1EUUA 1BD2E 1UJ3A 4OLVH 5KS9F 1CFNB 3DJZA 4XPHH 3LIUA 2D3VA 3PWVA 1T03L 3C60A 3L5XH 1DJWA 3WKNA 3AG1B 3FK3A 1QP1A 3NAAL 1XIWA 2EXYD 4UBDC 1UKSA 4OFKA 1MNUH 4ZUUB 4WWKA 4EUPB 4N1HB 1AO7B 2QR0B 2X89D 4I1PA 1A1OB 5IEKB 1I9RL 3U2SA 3BMVA 1BXXA 1J1OL 2YK1L 2XWRA 4RFEA 4L48A 3DARA 2DV6A 3DYOA 2HVBA 3UGXA 4JEGB 1EAJA 1RFDH 3PG2A 1I1YB 4PUBH 4XC3L 3SE8L 4UM9B 3QYMA 3H56A 1RI8A 3D4GA 2ZXEB 1JPFA 1BD2A 3VD1A 1QA9B 3PWNA 3EOYG 1FZMA 4WTZG 3KYNA 4J3OH 5KW9L 1JF5A 4M56A 2QPUA 3K6OA 2ARWA 4K23L 4FQJL 4RGNC 4XC1H 5HXMA 2AEWA 4CRPA 4N3UA 3TV8A 3HMXH 4YR6B 4J28A 3WHXB 1CGTA 4X6DE 4AI7A 3NUKA 3ZUNC 5E1GA 5EU6D 5EC1B 2O72A 4TLTA 1FH5L 1NFDB 2OX5B 2YHGA 5BZWA 3O0LA 3AG3B 4IGBB 5BV7C 3OKLA 2WZPD 3VI3B 3SY6A 2VDRH 4Z5RB 4PY7B 4OJEH 3BRDA 1NPUA 3V6OC 4BA0A 3PV7A 3PCYA 5GHWL 1TVBB 3GBNH 1J05A 1A7OL 1OE2A 1U3ZA 1FL3B 1ZT7B 1ZGLB 1V8HA 1LO5A 3BWAA 3RX8A 4K55A 4KDVA 4M6AA 4RMWA 4TL4A 4JVPA 4KRNA 4WO4C 2BCKA 3TO2B 4CGTA 5GRYA 2DYPA 1G9NC 5KANG 3FTYA 2MSPA 4U05A 2DTMH 4OM0L 3TONA 3OGOE 4GEJA 4X8JA 3T0EC 1GS7A 2EDEA 2OR7A 4EVNB 2ZKXA 2JXMB 5F2FA 3JV4B 1ORQB 2APVA 4P2RA 1OOWA 1FPTH 1ZHKB 3GMNA 2EDLA 2IMMA 3L1FA 3GBMH 3MBWB 2FO8A 3SE9L 1QSED 1J8HE 3HNVH 5D1ZI 2ICWB 1QZ1A 1UWGH 3RGHA 3ZT7A 1CLVA 2V5YA 4IRJA 2MNWA 3RWGB 2DH2A 4DPCX 3FYEB 5C0IB 4ERSL 4WFED 4P3WA 2AQTA 3G6JB 4Y4FC 4A6YL 3HNSH 4H0LC 3BWSA 4HJIA 1UWGL 1Z9LA 4L3EE 5CBEB 3EYSH 4L8SC 4MMYA 3T0WA 3TF7C 1K4CA 1G9MC 4HBCH 4P05A 5CWSA 4ATWA 4YDLB 7FABH 3IN0A 4HXAH 3NIDF 5DUPH 1RJZB 2NT1A 3AFLA 3R18A 4LAJH 1CLZL 1YMHA 1SNRA 4PJIA 4WUUD 5KVDL 1TSHA 2VXVL 4R7VA 1T7YA 2EILB 2D03L 3B5HA 5T1LB 4HPOH 1E5BA 4OJYA 4NKQB 4PRHA 4WI5A 3KM2A 1AD9A 1NGPH 2F53E 3PDOB 2O26U 3WUZA 5T5NF 4Z7WF 1BQSA 4FQLH 4LVOC 2XWBA 5LUMA 1XT5A 3WFCH 3N41F 1IM9A 1X7QA 1K5NA 4XC3H 4P9HL 2J8HA 4URTB 4XNUH 3D0AA 1MCQA 4YMPA 1E28A 1MHHB 1F58L 5F1IB 5DFTA 1DFBH 1WEJL 5LDSA 4HFWB 1XGYL 4XN7A 1U8QA 4JZNA 2OR9H 1FUNA 4H0GA 2ZWNA 3MV9A 4KKBD 4K94L 2H5UA 4AEEA 5FKPA 1M7IA 3EYUL 1ZEAL 4XWOC 3WNNA 1KENH 4FE9A 2MQCA 5CJQL 1C16B 2YQ3A 4YNYB 3A4DA 5I1GH 3LKOB 2ATAA 2I85A 1NBVL 4A04A 1QNZH 1QO3A 1JK8B 4AMXA 2F5AH 5DD3L 1QI5A 3ULUD 4JRFA 3ZTNH 4YSDA 2JJSA 3SO3B 5LNDA 2WUBL 2ED9A 4QXUL 4MA1B 5CCGE 4DOHE 2X4SA 2BSEA 1Z5YD 2VXUH 2YPLE 1G6RB 4NB7A 5FCUL 4UNVA 5IJCC 2X9YA 1SHSA 4JDEB 2O5NA 3RHWF 1XZ0B 3APDA 1E7UA 4B3EA 1EVUA 2VC2H 5JLZA 2J6WA 2PR9A 4MNGB 2YD2A 1U8NB 5HDBF 3C5ZA 4PLKD 2UY6A 4HIXH 2OMYB 1WO2A 1RZFH 1QRNA 2J88L 4I8DA 1ODUA 2J43A 4OGQC 5G4NA 1H3GA 5KVGE 4WUUB 4IRSC 1MI5D 3H3PH 4FQIH 4NCC2 5D1XC 3FFCB 4LDLB 3FQUA 3M46A 5C0BA 4EJ1C 4OCWH 1C7TA 4QRSB 1BJ1J 4QHMA 2B1AL 4LLVA 2VH5H 1TZOA 2FYVA 3ALXA 3RGVB 3TYFA 4R3SA 5GSRB 1BQKA 2DIEA 5HYJD 4QWWC 5F7MC 2VR4A 2QGEA 2WP3O 2JKIS 5FYKL 3S4SG 3HNSL 5IFHL 1P7KA 3VVWA 1N5YL 2V3DA 3MRBB 2Y07L 1NLDL 1NGQH 2XYBA 5DK0A 4DGYL 3U6XS 3VYPA 1IAKA 2G9HB 2OW7A 1NLBL 4TRPH 3R7QA 2IADA 1GIGL 3QIWC 5EF1A 4DGWC 4FL4C 3UAEA 4NKOB 5AUMB 4HW6A 3EO1A 2Y4SA 3FO2B 1XXDC 3IWVA 3EH5B 2FLMA 1JGVL 1SHXA 2AVFA 3HG4A 3V4UH 1ZLEA 4G43B 1USQA 4Y5VA 1WFJA 1AZBA 1NBZA 4WWOA 4H1LB 1LO3L 4Y5YA 4J6RH 1G9EA 3AXLB 5A40E 3ZU8A 1IGML 9CGTA 4OIAA 1FRGH 3DV6B 2H8PB 3GXNA 3U0WH 3Q8FA 5A6MA 3WLBB 5ILTH 1QAWA 3CSGA 1INDH 3QAQA 2DF3A 4UWQB 5GSVB 1OTTC 1F6AA 4ZW3A 1OLLA 1FFOB 1SBBA 1SEBB 5ICXA 1RZIA 2DH3A 4N25A 2W07B 4NQQA 3KXFE 4LO9A 3GUTA 4Y16A 4OB5H 3WNMA 2B14A 4KY2A 4RX4A 2XVKA 4KHTH 3LVEA 1FYTD 3GIVA 3BDYH 1MCRA 5ADOL 2DQDH 1H3VA 3RTQC 4YUEL 1AOZA 3U1QA 2VKWA 3H42H 2N7SA 5GRVK 4XMTA 2C1OB 4WO4A 1AY1L 1ZWIB 3DVGA 5K9KA 4RGND 5CJQH 1WIUA 1T21B 5ESVA 3OXSB 1NL0L 2KZKA 2B5IB 4WI0B 5AAWA 1J5OH 4ODWB 2EDNA 3NH7L 1JZDC 3GDCA 3BMWA 3BPNB 3CIAA 2IQ9L 1RQ5A 5CUSL 4AZ8B 3F83A 4F3FB 1UA3A 2LT9A 3WTTA 1G4RA 1U41A 2ZG1A 3APCA 1BECA 3F12A 3UJTH 1N6VA 3UPRA 4Z0BH 2VXUL 5LCVA 4JG5A 4NENB 1SY6H 1ZLUK 3BD5A 3MRHB 1QBML 5GGSY 3FW6A 5SX4H 3LDBB 4NQED 3EOTH 1P5UA 2ZX8A 4H5SB 5B38A 1QBAA 1T1ZA 3H4HA 4AEFA 2XX1A 4Z7AA 1P7QB 1GGTA 2X6AA 2BWDA 2A9MH 1YYLH 2EDWA 3S2AA 2CCWA 4M4PA 2GBAA 4I3GA 4EIZC 2B1OA 4YFDB 3VD7A 4Y5YC 3H3BC 2GC7C 4JGJA 1PD1A 3AW5A 3CBJB 3RYMA 4JJ5A 3E6HB 2ISDA 4N20A 2B1AH 6PAZA 1JTOA 1RK1B 1UG9A 2FQEA 2E7CA 4E5XG 4AGOA 2ENYA 4O2EB 4RAHA 2EYTA 4LLQA 4U6HA 3L9BA 2VLJE 2AXFA 4LASL 5K1JA 3K0YA 3IDMA 2YAHA 4Z77B 5DYFA 5BS0B 2XQBL 3VCLA 1AC6A 1PFOA 4PJ8B 1WC7A 2PP7A 1GC1C 2YD5A 4WHTA 4HBCL 7FABL 4A7GF 1KXVA 4LEXL 2LLNA 4YBQC 3DRTA 3B5TA 2KDYA 2PW1B 1YZZA 3P9LA 3UP1A 4PJFF 3VXNB 1LWHA 2DQCH 3MHZA 3QUKB 3PDDA 4LCCC 3WS6A 4Z23A 2EDQA 2PP9A 3NT0A 3HTLX 5C08B 2AQSA 1U8IA 3BEVA 4H40A 1YNTA 4BKLA 3ROOA 4ADIA 4HSQA 3LXUX 4LEXH 4ZYKA 5I17B 1H5BB 4JZOA 4APQA 4WAFA 2A7BA 3JWNC 3QORB 2EUZA 1JV5A 4XZUA 5EU4B 5JQ6L 4NJ9H 3CZFB 1PG7W 3CGTA 3LV3A 4N8VB 3AQZA 1XSJA 3U6RB 3U25A 2X4PB 1HU8A 3BEWA 3GI9L 4DP1X 5DVOA 4KHXL 5I0VA 4LLMB 4JRXA 1IEAB 5A2BA 2OZ4L 2YKKA 1O7DE 2JJSC 3S36X 2JFCA 2QKIC 5DHVH 3P73B 5KYYB 4MDIB 2JSFA 32C2A 4JPVH 4WRLA 4ZUWB 3TBYA 2FX7L 3HE6D 4JRYD 2HMIC 1S8DA 4FFZH 5E6SB 4AVHA 1J0ZA 4FNPA 1C12B 5DA4A 3GSNB 5DJ2B 5L8JB 4LIQH 4PJ5D 1JJUA 4OQ1A 2UX7A 4H2AA 3T09A 1F86A 2COQA 3PXJA 4OBRA 4B0MM 4JK0D 2RR3A 1XGTB 2VSDA 4AVJA 2ITDA 1INEH 2FUTA 4E9XA 2ADIA 1AP2B 3TBWB 4Z7OB 1DQLH 3AACA 3FB7A 4JQIH 5FX3A 5I15H 4XPBL 2XWEA 4L4TA 4M6OH 4M6NL 3MODL 1M05B 3VG0H 1R24A 2R4RL 2EABA 3FQTA 3TN0B 1FC2D 3VI4E 5BS0D 4XVSL 1LO0L 4G59C 8FABA 4JS7A 1WWBX 4LSDA 1KJ2L 2OTWA 4M6NH 4FC3E 3OG6B 3MRGB 1IU1A 2CJSA 3F2LA 3FONB 2AJXL 4FFYL 5HHME 3IFOA 3E0GA 3KDMB 5PCYA 4AQ1B 1RZGB 2IWFA 2WQWA 1ZHLB 5C2BH 4YHYC 4U3SA 4LSUL 4LFHG 1SF5A 1UD5A 3BDBA 4F20A 4UCFA 3UBXA 1IM3A 4M1GH 4DO5A 1XGRA 3ZT5A 3H9HA 5CEXB 4X9IA 3HI6L 4PWFA 4K5MA 1AC0A 4RDQG 5IOPA 4ZPTB 2E7DA 4ZMQA 4G8GD 4ZS6C 4MSWA 3W5NA 1QVOB 1NCJA 3VFSA 1E9OB 3GMOB 2V4LA 5E51A 1X5HA 5GQBA 5KVDE 4OJDH 3MLXH 4U1KB 3B7SA 1IM3D 1NFIA 4ZXBD 4QDGA 1XQ4A 4XN4A 4EI6A 1U8KA 2EIZA 1T83C 3OSVA 2YN3A 4K3DH 4ZD3H 3V4PL 1ZLSH 3TC9A 2ZOLB 3X2QB 4AENB 5F93C 2F5BH 2Z35B 4D9LH 3VXMB 2LTQB 4UANA 4FX5A 4WKZA 3KLDA 3DSNB 3CVIL 2MPAL 5IFAH 4D9RD 2YUVA 3A6CH 5DI8A 3S96B 5FOBB 4GQQA 3I9GL 4YHIB 3BP5A 3QG6A 3Q06A 1ND0A 3IJHA 3Q0HA 3BZDA 3FU6A 2C4XA 1CPUA 4M8QA 4ZS7H 3NA4A 1YPZA 1XMEB 2FQDA 5G4MA 1DP0A 1PYWA 5LWYL 4CBPA 5IMLA 3EGSB 5F7DB 4PTTB 3KPRE 1J7VR 3BKYH 1FNHA 1GOHA 4DQOL 5KYUA 4OZHE 1OP4A 4CA4A 3QRFM 1MRDL 2B1HL 5BQDA 3H42L 3WOVA 4ZOEA 5EIIA 1WK0A 3LQMA 2H6OA 1KT2A 2DQEH 4OAWA 4BK4A 1U3HA 1U21A 3FOMA 2XWTB 2I9LA 4ISVA 4QT5B 2KH2B 5HGAB 5T1MA 3PQYD 1HZLA 3SE8H 4M61B 5JOEA 2AGJH 3FYIB 5CSZA 3JTTB 3OLGA 1EVTC 1ONQB 5C8JB 3VXRA 2XI9A 3IDIB 4IQHA 3M45A 2J71A 2NDFA 4PJCF 3TO4D 5I66A 3O3AA 2NDGA 2YD8A 1KIPB 3ZLQC 2FWLB 2IG2H 5FA4A 1Y0LB 1N7MH 1SYVA 4GIAA 5L2KE 3CSYA 2VITB 3II2A 3HG0A 1HSBB 3CFEB 1TZIB 4ELKA 2WZPA 3OLEA 4YL4A 3DMMA 3GD1C 4UTBH 3QUGA 5D6CB 1U92A 5F9DC 2FZ3A 1D7FA 3OKKB 3HW7A 5IQ9A 1QASA 2YBGA 4NO5B 3UJIL 2NX5A 1UACH 3OZ9H 3X12A 1UB6A 4FD0A 3QO1B 4NHUA 4J4PA 5JUEH 1NAMA 5SWSA 3KBHE 3WGUB 1MNNA 2HAZA 4J5VA 1B0RB 3L7FB 2XQ0A 4OJFL 3ZE2F 3EYFB 1QZNA 1KIUB 4WJG3 1PLGH 4TUUA 3SE4A 1JSYA 3PL6A 2A6IA 1AKJA 1D6VH 5KVFE 3W38A 1JRHH 4CKVX 1O9WA 2HA1A 3R8QA 3OAUH 4JHAL 4F8QA 2EE6A 3RVXC 4LKCA 5D1XA 3V7AG 5D93B 2IO5A 4F8NA 3WJJC 4EN2A 1DVYA 1UZ8A 1FN4B 4CKQA 3GWJA 3T3PB 3AVEA 4JN1L 3U4AA 5IEHA 2FWSA 1RCYA 5E4EB 2J8UB 1BIIA 3CC1A 4JG0L 4HIQA 3O9WA 2FNBA 3O3BA 1U36A 3O2DH 3K81A 2PXYC 4NQEA 5HHVH 1XH0A 5BZDB 5I1DA 5DHEA 3O6FB 4NRXB 3QR2A 1G7QA 1EEUA 3FUDA 3Q6GL 2Q6WA 1FNEA 1IIIA 5J1AB 3JSSA 1LQBC 3QDMD 1HCFX 2HLAA 2NUTA 3VFRB 4LCWB 2WLIA 3H53A 3RY6A 4QJ4B 2R9HC 1AS7A 3KLKA 3NZ8B 4WW2A 2VM9A 2BFVH 4GW1A 4MMZC 2B9AA 4XXWA 3U0TB 3UROR 4X7SL 4N2MA 5HHXL 1RJYA 2E9BA 2UX6A 1CDGA 1R5WA 4N2DA 2MWCA 3FAXA 4ODVL 2VL4A 4IMKA 5E1AB 1D5ZA 2CZNA 2FX8H 2PYFB 1J1OH 1DVZA 6CGTA 3ZKQD 1CUOA 4LBAA 5I28A 2WLZA 1QFHA 4IIZA 4PRAA 4LEOB 3CJJA 2B16A 3P4OA 1F90H 5EV7A 5H35A 2XG5B 4GAGH 4NNXB 3MUZ1 3IDXL 1JGDA 2TAAA 3LEXA 3PGDB 4BV1A 3RU8L 1MXDA 3SE4C 3CZKA 2CLZB 3FAWA 2BY3A 3NCYS 3O2WL 5DK2B 4P9MH 5DRWB 1AH1A 1AIFA 2A6DB 4HMDA 5CD5C 2DQTH 3FJTA 1ETB1 3Q9PA 5D5MB 4XC1L 2ALWA 4IM8A 4BCYA 2N7AA 1R47A 2AJZA 3TO4A 2ATKA 2CDEB 4OQTL 4YDIL 4AYID 5T5NG 4UT7L 5D55A 1MZYA 4DUXA 1ECZA 1DN0B 1UXMA 3QQ9D 4K4KA 1BF5A 1UT9A 4K15A 5CSBA 3ROLB 4GRWF 1A8ZA 2WTRA 2HFFA 5DVNA 4X0KA 4PJDB 1N5AB 4PYHA 4AXWB 1X4XA 2F53B 1BYNA 2GJZA 3SBPA 2QV2A 3N04A 4J2QA 3D30A 4XN2A 4P3DA 3L3JA 4DUWA 4HU8A 4KXCA 2PXYA 3O11A 4QRPD 5B1KA 2EKSB 4FMVA 3ZTDC 3UJJL 3MUUA 4GNKB 2A73A 4X80L 1P4LB 2AK4E 1G94A 5KEZA 2A77H 5B1JC 2H0PA 1ZLWH 4G6AC 1FGVH 2HTLD 5JR1L 5KTEL 1KPVA 5ACZA 4KO9A 2HT2D 4PJGA 5IB3A 4KMQA 3GXUB 2ID5A 5KN5B 4K7PX 5F6IB 4L3CB 4N6RB 3SEPA 2J44A 1ZAGA 5JIQA 1IIKA 1HHJB 3FSOA 2AFNA 1XO8A 3VDBA 1LEIB 4PJHA 1X3DA 4H7VA 5DVMA 4S0TD 2CPCA 2PO6A 3STZB 1NCDH 2R29H 5BOJA 2MHAB 1HH9B 5JORB 2XKUA 3WD5L 3ULVE 2OK0L 3EIFA 3FSVA 1BVKB 3FT2B 2P1YA 3VXRE 3T0DA 4FQ2H 3RJDA 1JP5A 2X6BA 3X1NA 5AVXB 2EIEA 3FTWA 3VD9A 4NN5C 3QORC 1KEMH 3O6KH 2IOOA 3QJUB 2FL5A 4JCWA 2BJMH 2QSQA 4KKBC 4L2YA 4XXDA 1CZ8H 3DIDA 4JQVC 3OC8A 2A83B 3SPGA 3MUGA 4P3CH 1BFSA 4U6VH 3INUL 3JWOC 1JZJA 2CO1A 2QGCA 3QNXB 4L5FE 3RILA 5B3NA 1RZ7H 3MNWA 3NCFB 4RIRB 2R1YB 4LOVA 1S7RA 5DHMC 3KYKL 3PXLA 2VXVH 2AKRA 4Y4FD 4XT1C 3WIIL 2R0WL 2ZSVB 3LRKA 1FL5B 4P49A 3U2SB 5BMFH 4NSKB 2DKMA 3TVMB 4RFEB 4GI9A 5T3ZH 3MACL 3HOGA 3KYKH 3QEQA 1X5XA 2XN9B 4MA7L 3ZT6A 2A4EA 4RNRB 1MW0A 2X0VA 4PJ9A 4WWID 4O02A 4NAJA 4I2XB 2R15A 1MVFA 4YHOH 4UIMA 3O6ML 2JIXA 4LARH 5DD5H 3S3SA 2HLFC 2ZUQC 1L6ZA 4WUKL 4M93C 4YLCA 2P45B 4WCYL 4NHCL 2VDML 5HGBA 3KLSA 2GBTA 3HJEA 5T1KB 5K39A 1HL8A 1OSZA 2CLRA 2PWDA 4WNQA 4XGZB 3UOAB 2DYPD 1QPXA 2ENPA 1FZKB 4NOFA 2JK5B 3GJFH 2H7WA 1N10A 2IAMB 1BBDL 3B4NA 2W88A 1YNLH 4L2LA 5F89B 4CVWA 3B2MA 1U0QA 1JPGA 4KZCA 3K72A 4TQPA 2DM7A 2Q7YA 3FH8A 3LS4H 4JLRB 1W0YT 3OKLB 3MRIA 1SBSL 4Z5RA 3VNYA 1ZS2A 2C3VA 2GTZA 1C1EL 4PS7A 3VXUB 4HYTB 2WHVA 2WVSA 1KLGA 4YE4L 1J05B 4DW2H 4DJMA 3WL9B 4PJBE 4CMMB 5JR1H 5KTEH 5A6IA 3HZMA 4WTWA 2I69A 2MPVA 3LNEA 3E6FA 2BCKB 4MCNA 1ZGLM 3GK8L 1II4E 5E4EC 1KN2H 3FQRB 1RZJC 2Y7SA 3NCWA 5L6YH 3DO7B 4UV4L 3QUYB 3JZYA 5HVHC 1K2DA 5KSAA 2VSCA 3FCBA 5IW1B 1ET7A 3HE6C 1MF2H 5D4HA 3WFBL 2GJ6D 2IQAA 5DVPA 5EBMA 4JR9H 5L4FA 3LH2L 5D2NE 4AV4A 5DMYA 5CILH 2WV3A 4ABVA 3NFNB 1AE6H 3TVMD 1OSYA 2ADGA 2YMTA 3B6SB 2YKLH 1FNSL 4L9LB 2JLPA 5DWPA 4MLSA 5FFOA 1C8QA 3SGKC 3PP4H 3SJVB 1HI6A 4A39A 1BM3L 2YGPA 2Q87A 3OVUB 2V2TA 2DYRB 3VXTA 5PAZA 5E8DH 3GLEA 3GXIA 4XVTH 1A3RL 4EZJA 4W9KC 5D96C 3EYQC 4LHUD 4F57H 2DQJL 4D9LL 1IC4H 2NLJB 1FNSH 4JKMA 4PH8A 5LKNA 4HZLB 1FCCA 2O5YL 5EU6A 5EUKA 3ZVVA 2P8PA 4O5LL 2C7UA 5ISZA 3PWUB 3UTZB 5D1QC 1OGAA 1S9VB 3GDBA 2XZQL 4F33A 5A3ID 1TZHB 1DJSA 1YEGL 2Z8WC 4OD2B 3T4YA 5I6PA 3IETA 3MA7B 2CBOA 2EDTA 3X3FL 1FZJA 1TTBA 3V4PH 4KX8A 4MQ7A 1CBJA 3P40A 1RUAL 3TIDA 5HPMB 5I6LA 5ICZB 1TO4A 5HDQL 4H8WL 2XOTA 2BC4B 4JKKA 1MCOH 3QUZA 2CBTA 3RGVC 1EZVY 1YEDA 2HKHL 1PQZA 4XMLH 3TN0D 5I1EH 4MJ5B 1HAWA 1HHGA 2WZ6A 2P26A 4NO2A 3BC9A 4JJOA 1IBZA 4UQ2B 2D8KA 3QNYB 5EN2A 2HVJA 4ZDHB 1I4FA 1T89A 4Z0XA 1NCIA 5BVPL 3FQXA 5H94B 2NW3B 1B6DA 1YNLL 5B39G 1XCTB 1SJHB 2PN5A 2IFFH 3C6LB 3KPQB 1OGAE 3B1TA 2PF6A 3NSYA 5F1NB 4AJWA 2FGWH 3DTXB 1BEXA 4F7PB 2ESVD 1VFBA 4WHYG 1M7UA 1A9EA 1I7UB 4PG9B 4RDQF 3EJZC 1P4BH 1BZOA 1KCRL 4WSGA 4Y16D 3WV0A 2XNAA 1YUKB 3L4VA 4UDTA 5GRWA 1JTTA 3EGDB 4HWZB 2DIBA 1XGPA 4OKVA 1UYWL 4FCAA 4KVPA 5IB5B 1KBVA 1UM6L 4PHXA 1MREL 4FXLA 5BOPA 4MNGA 3GHEH 3FBKA 2Y2TA 43CAA 2ZXQA 2APBA 2BZDA 2ICEA 4PGDA 3FTGA 2GABA 3HLAB 3W9EA 5ADPH 3QNZA 1KTDA 1E65A 1UD6A 2MCPH 3B3IA 3V4PA 4RZCB 1T1YB 4WHCA 1IFGA 3MCKB 3FFCA 3NCXA 3TCTA 1AGEA 3GYRA 2HKAA 2YRLA 3CLEL 1HS6A 4OF3A 3RWJA 3EADA 4LLVB 4DP8X 2FIKA 3FRPG 4AG4L 1HH6A 3K2UH 4RGMC 3RGVA 3TYFB 4JKNA 1LP9B 4MNHA 1BSIA 4KJYB 5AYUL 4OZGA 2O5ZH 5FEBA 1AZCA 2OI9C 3LOWA 3N9GH 3QFDA 2CCVA 3VI3E 3ZYIA 2VDMB 3JBG7 1SHMA 3HRZB 4HU2A 4PJ9D 4ZFOL 1KGIA 3MR9B 4JKWA 1PD6A 4GO8A 2K4AA 2DQCL 1Q72L 3O45A 1HESA 4XP5H 2Z31B 3IMUA 5AUMA 4PJ7E 4W4OC 4G7SB 4DNLA 4ZFGH 2IH1A 2VQ1A 2V2WB 5I9QB 1DJYA 3D9AL 4P23B 2RA1A 2YZ8A 2X10A 3ZE1F 3KM1A 3NJJA 1CLZH 2Q0ZX 3ES6B 1FDLH 1Z1WA 2DW5A 5JHLH 1J8HA 4AJVA 2LTQC 2ATPB 3POCA 3DGGB 3UZEA 4OZIB 4NQDB 1MNUL 2WQSA 1HQ4B 4HUKB 4QWWD 1QFUH 3CZGA 5GSVA 4EDWH 1KYUA 3L1GA 4Z7WA 3GIZH 1RJLB 4UZUA 1P6FA 4YHKL 2WZ5A 2UUDK 3N40F 4D0CB 1ZV2A 4U1HA 5MENA 3X14A 1YJDH 4EOWH 1ZIBA 2DM2A 4NC2B 1F58H 2MCMA 3HUJF 1EEYA 2YUXA 5GPRA 5GGQL 3VA6A 1N59B 5I1JH 2AEPH 5FYJU 4D8OA 3MLVH 3NIGE 1WH0A 3FN0H 4NQCE 4AEHH 1A6AB 1L9MA 2OV0A 2WINB 1RH8A 1XF5B 4WU5A 3ULAB 5TQ0L 3WN5C 1IFRA 4JFOA 3F7VA 3EFOB 2BPBA 1Q0XL 3WCYA 5DMKB 1ZLUH 4UQ9A 5FK9B 3NIGB 3QP3A 3RP1A 4PVNA 5C0DA 43C9A 4JFEA 3L54A 2QTEA 4S1SL 5FHBH 3MX0B 3AY4A 2BVQB 4WFGE 3U46A 3VXSE 2WBJC 2WBJD 1RK0A 1URLA 1Z6JT 2PTTB 4CDHA 2EC9U 4QIRA 2XCMC 1KPRB 3S37X 3SDCC 3GTNA 1I7TB 3WIHA 2E86A 1ACYL 1LWJA 3TZVD 5IWLA 4G8GB 2UZIH 3W82A 1SYSA 1X9UA 1KLUB 1F18A 2ODIA 4FTVD 5I74B 1IQWH 5K1VA 2WKOF 5MERA 1YEWA 3CFCH 3RLSA 2EDJA 4H8PA 2LOEA 4PCYA 3QPXL 5C9JB 1U58B 4BZ2H 3ZDYE 2AC0A 3ECQA 4A2EA 1UJ3C 4P48A 3ULVD 1YQ2A 3ERXA 2DQUH 2CGZA 4QAMB 4BJLA 4NPKA 5BRPA 4Z3IA 1JF1A 3BAYA 4FQ2L 2PXYD 4QRPA 4KTDL 2AQQA 2A38A 4UTBA 3D2UA 4JFPA 2DQJH 5TE6L 2EQDA 3LQAC 1Q9OA 4ZMZA 4X9HA 2WXMA 1L7IL 3N1PC 4HKBA 2BSBA 2L7JA 1KCSL 4M29A 4N2BA 4PJFE 4AV5A 3FRUA 5HHVL 4KKAC 2OBGA 6PCYA 3UO1H 3BGFC 3SKOA 5GS0L 1NLBH 3QJFA 2DWEA 1I8LA 2NSQA 4JO4L 4C54A 1H6TA 1WIPA 4IMLA 5CP3A 3T0ED 2E27H 5EEWA 4HVBA 2VDOL 2H2PC 3IDUA 2YEVB 4APQB 1NM9A 1F00I 4EQ2A 3OXRB 4L0ZA 4K8RC 4P59H 1DQQB 3MJGX 2JELL 1EFXA 3U6RA 1JPSL 2WSKA 3M86A 3WEXA 3IFNH 2LW3A 5DTFB 4ETQB 1YN6A 2ERJB 3OKOB 3VH8G 3QVAA 5IVXA 5L2JA 2GC4C 1IEAA 4ZTPH 4AK2A 5C9KA 4LXFA 1I1FB 3WDIA 4HGMA 3BD3A 5JHMA 2FIRT 3HI5L 3TT1L 3ETBJ 5I82A 4E2OA 5GRUL 4B9GA 3WFCL 4HUVA 2OTPA 4PFEA 3IXAB 5DD3H 1RJCA 3VG9C 3HI5H 4AGPA 1UWXK 2JB6B 3V6OA 1UM5L 2EIMB 2IH3A 1XGTA 4B5ZA 4OLYL 4IU3B 4W9HC 2IAMC 1L9NA 1IKNA 4XVUD 4FHBD 3ZE0F 4TQHA 5FCUH 2JTYA 5GGTH 3BW9A 3MXVH 4UQCA 1HHIA 3PIQB 3TBCA 4J23A 2FJFB 2QHLA 4P5TB 1ZT1B 3MRCA 4MD4A 1AR2A 5IVXF 3C2SA 3CDGB 4PRBA 3VI4F 4UM8A 5HP5A 4F7MA 3U30C 5CJOL 4UNTA 2LQRA 4JPIB 3UMTA 4GW4A 2EE2A 1N3NA 1K8DB 1GH7A 3TCXA 3LPWA 1ID2A 3IPFA 3LTVA 1EGJA 3FONA 4U1GB 5D2LA 1V7ML 2GCYB 3DX7A 5HVGB 1CBVL 2HRHA 4KY1H 3DNKA 1KEGL 4XE5B 2DJMA 3BT0A 1A5FL 3QQ4B 3MYJA 1JNJA 1KUMA 3DV4A 3ARGC 2CM6A 2DTSA 2NY6D 5ANMA 5B7MA 1YEIH 1QLEL 3NJXA 2BVPB 2ZNXA 1M2VA 5A43C 3QEQE 2BSTA 1YEFL 2DRUA 3MGOA 3RHWK 5FFLA 4BKTC 3N44B 3QEGH 5AKTA 5CEYA 4JDZB 1NFIB 4V1DE 1MZZA 4NDMB 4NGHH 4YFLI 3FCTB 2VL5A 1RIVL 2UXGA 4JQIA 3QDJD 5INCA 1A4BA 1OPOA 4RWYL 4NI3A 4FQQB 4ZUTA 5GS0H 1EEQA 5KZCD 1KGJA 4GG6F 3SYPA 4Z7WE 2VJ8A 4DAGH 4FULA 3HNVL 5EOCJ 2OR8A 4MMZA 4PJCA 4FFZA 4GSRA 3T2OA 2I27N 4NOBA 5CJ8A 3VYNA 1JNHB 3RBGA 4F2FA 3NIDB 4MA1C 3X3FH 2NSMA 3C5ZD 1G9NH 1XSKA 2VDOB 4HJ0C 4ZG1A 1BCIA 5ITBH 2R69L 4BFIB 1FFNB 2YD1A 3US1A 1FVCB 2Y3AA 1L0PA 1MJ7H 2G30A 3DOHA 4LSQH 2G9KA 2E7HA 4H8QA 4A37A 1UJ3B 4YDVB 3F58H 4WNSA 1H5BC 3SCMD 1FG2A 2Y25A 3B9KD 2BNQA 1HYSC 3UYRL 2IBGA 5I0YA 3TVMC 2AEPL 2YARA 5EEUA 1FNFA 3P77A 1NL0H 2VN7A 4PJEA 5ILTL 1KCWA 4M8RA 1DVFB 3ASWA 4AL8C 3JTSA 1RK7A 1MWAB 3LPGA 4C57C 2MQ0A 2JKWA 2FJGB 1CDIA 1F4XH 2R2CA 1A4KA 4XTRC 4CN1A 4M03A 3ZSTA 2DQEL 2R0KH 4JFYB 4JFQA 1I7RA 2IWGA 1E4WH 1UM4H