3IE4A

B-glucan binding domain of drosophila gnbp3 defines a novel family of pattern recognition receptor
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
101
structure length
101
Chain Sequence
YEVPKAKIDVFYPKGFEVSIPDEEGITLFAFHGKLNEEMEGLEAGTWARDIVKAKNGRWTFRDRITALKPGDTLYYWTYVIYNGLGYREDDGSFVVNGYSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The N-terminal domain of drosophila gram-negative binding protein 3 (GNBP3) defines a novel family of fungal pattern recognition receptors
rcsb
source organism Drosophila melanogaster
molecule tags Immune system
molecule keywords Gram-Negative Binding Protein 3
total genus 18
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2140 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3ie4A00
3AQZA 2RQEA 3AQYA 3AQXA 3IE4A 2KHAA
chains in the Genus database with same CATH superfamily
3H2PA 4GLRH 4HCRL 1MI5D 1XIWD 3GGWA 4FQ2L 3QIUC 3VQLA 4S0SD 4NWUH 3C8HA 1JNHB 5E2VH 1T2QL 3UBFA 4HWEL 4FQJL 4LEXL 4CN6A 1DQMH 3UBHA 5KYUB 3I9GH 2F54E 2VLJA 3ARFD 3O11B 5KSAC 1E9QA 1E65A 1AY1H 5IROC 9PCYA 1IGCH 1WAAA 1KXHA 3HUJE 4H0IA 3G6JF 5CKAA 3P9WB 4FXKB 1MREL 4DGUA 3NIDE 3DMMA 5DZVA 1DL7H 3QR1A 1IVTA 3G6JA 3R7QA 3VFSB 4WZ9A 5F1OB 4PB9H 3V5HB 3FN3A 3AS0A 3NIGF 5FHBL 3JWOL 1J8HE 3PWPD 2V5RA 3IDGA 4OLEA 1KEGL 1A4JA 5EEXA 2XDHA 2WTRB 2WUCL 1ZTMA 3C2SA 3MCKB 4XBPA 4N5ED 2R69H 5C0AA 4DTGL 1SYSB 3LPPA 2XN9A 3C9NA 3KPSB 3OHXC 3OWEA 2XN9D 3NJFA 2BINA 4JRFA 3VG0L 1HT6A 4YSCA 5ADOL 1X4XA 3KBEA 2DF3A 4XVUC 3P4OA 2PWDA 5F7FA 3T2LA 2XRAH 4Q2ZA 1F5WA 1QEWA 4IKJA 2I85A 4GW1B 2K9FB 2QPDB 3OMAB 4MCYB 2X9WA 1T1YA 1EERB 5JPNC 4G6KL 1YEJL 5HHMD 5HYEA 5GS2H 1WG3A 3KXFD 2ZSWB 3U2IA 5KG9A 2G9HA 1QUPA 3ARGD 1HDMB 1BZ9B 1UD6A 3U79A 1YMHB 1DVFA 3NFPB 4JFEA 5I76B 4NNXA 1N59B 4YFDB 1IM9D 1S5IL 4PJ8B 4EN2A 2JJVA 2WXJA 1L0QA 4WU7B 5CHNB 2P24A 1NCCL 2VDPL 2PTTB 3US9A 4UQ2A 1PZ5B 1WD9A 3D25A 3EGDA 3KH3A 3LDBC 43C9A 3NCWA 1IZJA 1KENH 3O6FA 1QBML 1N5YL 1MCOL 4OF5A 1AD9A 5LDUA 2EYTB 2XZQH 4P23B 4AVHA 4EN3B 1F18A 4Z7UE 1Z7JA 2XX1A 3VD9A 5FEBA 1AR1D 4PM1A 3CSFA 3ASNB 3SQOH 4CN4A 1S8DB 2WBJA 3TBBA 4S1DC 1JF5A 3GB7A 1THCA 2L4OA 4UT9H 4XMPL 3VXRA 5T1DH 1MHEA 3EYVA 1KBVA 3DTXA 4UOW1 3TM6A 3DX4A 2VRQA 3KE0A 3AFLA 3AY4C 4W9HC 1T0MB 4D2NA 4Z7OB 4TN9A 1E2WA 3P4OB 3QYMA 4JO2H 1YG9A 5FOBA 3ROLA 4OVUA 2LU4A 5BUPA 1G7MA 1JTOA 1EZSA 1LHZA 3PWUB 1BPVA 4MVBC 1CICC 2A6JB 1QVOA 5IVXA 1EZVX 1JGEA 1VFMA 3FU9A 4S11A 3NIDB 1E5AA 1A47A 1KB9K 5EUKA 1ACYH 2NYYC 1PEWA 1PSKL 4U1NB 2J6EA 1BG9A 3QORB 5F71A 2CNYA 4AKOA 3DVFA 1ZEAL 1U21A 3QIBB 4DUVA 3RGVA 2JCCA 1TYRA 1MF2L 1SOSA 4HWZA 1OKEA 4L4TD 1TTUA 4KKZA 2V7HA 5I6NA 2RAMA 2CIKB 4DOHB 4OJDH 2Z31D 4KQ4H 3JZYA 1LEIB 1L9SA 2JCCF 3OB8A 3WNLA 3VI3F 3RVVD 2YAOA 5FDYA 2HMID 4UCFA 1NM4A 4H8HA 4EN3D 4MAUL 1SEBB 2J1ZA 4G7RB 3QDJB 2HVJB 4P9HH 3THML 3D4GA 4HS8H 5EIIG 3A67H 3FTXA 3HG5A 4KH2A 3SKOA 5EU6E 5JDSA 3IDNB 4R7LA 2XY2A 5E6IB 2N59A 4ZZFA 1A4AA 2BNRE 2C34A 1QHQA 1JNHA 2AK4E 4L05A 5I0ZA 1DVTA 2BOLA 2GG1A 2J56A 5F0PB 5CIPA 1BBDH 1OCWH 1TZGL 3DXAD 4Z7UB 4QRRE 2DBJA 3J8F7 1ZA3B 2AP2A 4QCIA 1J8SA 1UACL 1T7VA 3VD2A 4TULL 1I3RA 3MOQA 3OAUH 5TE4L 2G5RA 5I1CH 5M7QA 1KY6A 2OSXA 2WYHA 4PJFE 4AH2B 1S7XB 5CLXA 3LX9A 4OLYH 4APQB 3FSAA 1RUAL 1WS8A 4JG1L 3CLFL 3OX8A 1FIGH 1NZRA 3AADB 4H8WL 4XC1L 2YHGA 4H88H 2MEJB 2QQLL 3IRCA 3Q2VA 5BRZE 1U2CA 3WHE1 2JJWA 5T5FL 5JQHC 1LM8V 1UT2A 3GEFA 1AMYA 3GLAA 3G5XB 3CHOA 3U9PL 5IHUL 4ZSOB 1WHOA 3NFNB 3FS9A 3KR3H 1WBYA 4R4FL 4L9DA 1OY3B 3GMOA 5E4EB 1KGUA 3APCA 3V0IA 2B5IC 5DMKB 1WO2A 3T0DA 4ZXBB 2H45A 2OTWB 5T5NF 1I82A 1J1XL 2BC4B 3RHWK 2LLNA 5KBDA 5E99H 4J3WA 3PLYA 3MV9A 4A2LA 1ICTA 2E76C 4DJMA 4WFGE 4XVTL 2DKUA 5FYLE 3BPOB 4NO5A 1HINL 1TF4A 1F4YL 3FTGA 2VXSL 5LN8A 3TWCL 1VGEL 2WKOA 3Q2NA 3FFOA 3CFCL 1A9VA 1I9IH 2JJTC 2WAQA 4O51A 3IFPA 4NKMA 2J8UA 3SGDH 3DNKA 3N40P 3KJ6H 1CMOA 2UY6A 4K3EH 1JZ2A 3NH7L 3MXVL 2EEBA 3JWNC 4NQED 3UPRB 1DR9A 4BXVA 1V5JA 1TYEB 3C6LA 1IQWH 3MRMA 4Y19A 3T9WA 3QARA 4PW4A 3C6LD 2P28B 1MDAA 2VYRE 3NBNA 2KDYA 4NZ8A 3F5WB 2WYIA 2C7UA 4WW1B 4P3DB 4WGWB 3FQ1A 3FSVA 3WELA 3QQ3B 1UCBL 2BHYA 5JZ7C 1RK7A 1YYML 3QUZC 4X5WB 4P2OB 4PJHB 3DBSA 4UTAL 5DI8B 1P7QA 2ZCZA 3FCUB 4HBCH 1D3CA 1ECZA 2W8CA 4QHUB 4XX1G 1TQUA 4GQ9L 3I9GL 4MNQE 3GIZL 2O5XH 3MNMA 3DX1A 3QQ4A 3EUDA 3SOTA 1JNJA 5E0FA 3RL2B 4U6XA 1WAAF 2QVTA 2F8XC 2O61B 3HE6D 4PVNA 1E9PA 3BVUA 1EO5A 3QQNA 5GS0L 5HHOA 5B1KA 3VWJD 1I3RB 5I1HL 5EZJA 3DYMA 4P46A 2P5WB 1OOWA 3HAEG 3QBTB 3V4VL 5IUSA 4LPWA 4M5SA 3FB6A 5GGVH 5EA0H 1CU4H 5I1AB 1RZJH 1K3IA 1B4JL 4GAYB 3DDFA 5IEHB 3KBFA 3OR7A 3KCWA 4WV1C 4NXSA 3WTXA 3QH3A 2PW2A 4MDJB 4KZCA 5FYLL 4D94A 5L7XL 4JFDA 4HT1H 2QTVA 2NY3D 3DX8A 4Z7VF 1SUJA 3T65B 4LGPB 5C70A 2HX9A 3KLAB 3B5HA 3V4PL 1TVBB 4WU5A 4AY0A 1INQA 4BA8A 1ORQA 3A4FA 1PG7L 2DQUH 4NQTA 3MLSH 3MLVH 3IFLL 1ZHLA 3CIQA 5KSBE 3D39B 3L13A 2BJML 35C8H 5TF0A 2IH1A 4FD0A 4Z77B 4I77H 2QT6A 4UNUA 2OV0A 2Z7WA 5KSAA 3W38A 2B20A 1EBPA 5F1NB 4NQVB 4LXFA 3BH8B 4ZOAA 3MHZA 1B90A 4POUB 2ZPKL 3O0RL 3CPLA 1YQ2A 4OZGE 5ACMA 2P47B 1I1CA 3HBPA 2Y2WA 3ZHFA 4L1DA 5CU9A 4W9JC 2R7EB 1IAIH 2I07A 1QWNA 4AYDC 2X12A 3X11B 2I7SA 3LPFA 3ULUL 1MY7A 2I69A 3HR6A 3FAXA 3MJ7A 1R19A 4W70A 3ILPA 2UY6B 5IT2H 1E27B 1T1ZB 5A2FA 2G5BB 2EO7A 2KI6A 2NXYD 4XCYB 2AV1A 5CP3H 2YPLE 2Z92A 5D55A 4DZBB 2LHAA 3HNVH 4P2RD 1AAJA 4JPSA 5D4QA 4CVZB 4MB1A 2EVHA 2VB5A 1JTPA 3QIBD 4AWJC 1T0NB 3MRFB 4XPGH 4XO5A 1KNOB 4XWOC 4U3XA 1TLMA 4QRRB 5FA4B 3LKOB 1ITBB 3HUJF 4GQQA 5BRPA 4BRJA 5ISZA 4CADA 5EZLA 4GW1A 4PH8A 3CVHA 5E56A 4M5YL 1NCIA 2AMGA 3VGBA 1AS7A 5MP6H 5JPNA 1NAML 2HB0A 4EDWL 2GJ6E 1A1OA 2ZWNA 4P9ML 1KPRB 1OTUC 4HPOH 4YBHA 4XX5A 1T1ZA 3UIYA 1WWBX 2VZOA 3SZ6A 3FPYA 4IOIB 3UYPA 1FSKC 4KC3B 4GKLA 4PBWD 3EG9A 1DJYA 1RP8A 1D6VL 3K6SB 1SYSA 4EOWH 3QUML 3L95B 4RFEA 5TQ0L 5HDBF 4KK6D 4ESKA 5AVVB 3DMMC 1F8TL 2CBTA 1T5WA 4K5PA 4OI7A 2ZUSA 1NCTA 2X6CA 2PW2B 2CK0L 1A9EA 1UA7A 5L8KB 3V52H 3STLA 1U8LB 3MLXL 2VN3A 3PXLA 1JGVL 4JUTA 3L5XL 3AUVA 1HILA 4ZRGA 2HSIA 3QPXL 3OKDB 2GT9A 5FO9B 1KXQE 5HHOB 4TPRH 3VFVA 2XJLA 1DJZA 1EUTA 2DRUA 4FG6D 3W39B 2YC1A 2I26N 5FW6A 3QJFA 3EOYG 3RY6C 1TJHL 4P5SA 3UBXA 1G7LB 2CGRH 2FSEA 2W07A 4BH7B 3CG8A 3QRBA 3HFMH 5DI8A 3ZY7A 1T5KA 4AEHL 1MFVA 5JDJA 3K91A 4U6YB 4NRXB 5C0GA 3F01A 2NZ1A 2VUOA 1JGUL 1NMAH 3IJHA 3TA3D 3SPJA 5I1AA 4JFUA 4NN5B 1B2YA 1CQKA 4ZUUB 3JV5A 4IBWA 2O93L 4PWGA 4FLSA 5HD8D 2WZPA 3MZTA 4WUUB 4L3EE 1FYTA 2Z3FA 3TT1L 4IGBA 3REWA 3FN0H 1QBLH 2BNRD 3TZVD 4IIZA 1X6LA 3ESPA 4BRVA 1S6NA 5IGXH 1HSBA 4HKXA 3HZKB 3CX5J 1F2XK 5E6RB 1TNNA 3GSWA 3LB6D 1MFEL 2WBXA 4G3YH 4RFOH 1HS6A 1O0VA 3GGWB 4NUJA 4KQ3L 4R96B 2V0AA 3RIKA 1BQHG 1ZWIB 1JPFA 2BSRA 3EDEA 4NP9A 4TVPD 3EHBD 1FGNL 3UH8A 4G8GA 1SEQL 2JQZA 2YXWA 3WLWD 3L4YA 3F3HA 2EDQA 2IFGA 1RZKL 3LCYA 4O58H 3HC4H 4R83A 3SDXA 3Q6FA 2ZSWA 3CMOL 1VFAA 2MPAL 1KBKA 1QYGH 5DD3H 4FL4B 5FECA 3QFDB 1NLDH 5IBUG 3O4LE 4Y19E 2ED8A 3ARTA 3U4EB 2ADGA 2F7PA 4M1DL 4Y0GA 5H4ZA 1BCIA 3HMWL 3FRUA 4X99A 3RTQA 3ZIMA 3QXDA 1KCRH 4X98A 4Y4FA 4GUCA 5CILL 4WFHD 5TDPA 3VWJB 4HS3A 4LSDA 2X4OA 1FYTE 3BE1H 5HDRA 4KXZH 1NA8A 2X4RB 2Y1AA 1JPGA 4PJ8A 3PQYA 1NBCA 1RV6X 5F9WC 2F74A 5E6SB 1J8KA 3B2UC 3VTAA 4ES9A 2VERN 1KEGH 2ENYA 5HHPB 4AIEA 4TNEA 3LRLA 2BRRL 2C26A 2ALAA 5FO8A 3LXAA 1LYQA 3GI9L 4XAWH 5KG9B 3BI9X 3KW7A 4HEPA 3A4EA 4CAGA 2W9LA 1H3XA 3QISA 3K72A 1AANA 4N9GA 3S5LG 4XR8C 1MLBB 4FQPA 2WQRA 5L6YL 1BZ7B 1BJ1J 2X4UB 1XZWA 1OB1A 1FH5L 5E2WH 3DX7A 3OX8B 4HFWA 5I18H 2F58H 2HLFD 1NQBA 4OZHE 1W72H 3NCYS 1ES0A 2NY4B 2Q6WA 4NKDB 2MMXA 4IBQA 2FD6L 5LCVA 4YXKH 4C56A 4AQ8C 1IC7H 4QHNB 2DTSA 3SJVD 2WLHA 4RMTA 5CGBA 1AC6A 4KY1H 2W5PA 5BNXD 2Y06L 4WSGA 4DKFH 2CAKA 4W93A 3WD5H 3M1CA 3WS6A 4ANXA 3FU8A 5BZWB 4ZTPL 4OZGA 1CFMA 4DVRH 1IC0A 2AAAA 3C5SB 4KY2A 3BLKA 2BVYA 4HJEA 3EGSA 1DBJH 2APFA 3AS1A 1IEAA 5F7AA 5I66B 3HG0A 4XMLH 1MAMH 3DX7B 1KN4L 2CALA 2J72A 5AAPA 1F0LA 1XSJA 3MQIA 2D31B 3ULUF 1H6EA 4TS6A 1YNTA 2IV9A 1YO4A 1NMBH 2GSGA 3G6AB 3MRDA 4LSQH 3MX0B 1U8LA 3OKNA 1Q1PA 5ISZE 5DJAB 4APXB 4BIKA 4QUOA 1UWXK 4N8CL 1Q4NX 3T0AA 4I3RL 4I7ZC 3GB7B 3QDME 1AGDA 3RTLA 5E6UB 3BLPX 5ESVB 4B9JA 4CJ1A 3L4TA 3OAYH 4TMPA 4U1MB 3UAEA 1J11A 4Z76A 1XR8B 3FOLA 3T2NL 1YVLA 3GSNH 4GXFA 1F00I 4E41D 1K4DB 2G75A 2HTKD 4O2CA 4G43A 4E41A 2N0KA 5HYJA 2EIEA 2NUTA 3BSGA 4HXAH 3ULUH 4NNYA 4A2DA 4HOMA 1D5BB 2AV7B 2X4NA 4K7PH 4P5MB 2XICA 3IMWA 4Q6KA 5C0JB 4KX9A 3L3JB 1KJ3H 4EQ2A 5BRZA 3SKNA 1ZOXA 5GZOA 4IDLA 2IPKA 1AQ8A 3DV6B 3AU0A 3MV01 5EU3B 3GUTA 5FB8B 3KAAA 3D33A 4WW2A 5DFVC 2IWEA 3UMTA 2EDBA 4E9LA 1DQQB 4J3OF 4UMGA 4CMHB 5A16A 1Y18B 3H3PL 3RFZB 1TKWA 4HJ0D 3QFDA 5DRXB 5EZOL 1C5CH 3ZTEA 2OMVB 3FCSA 4HCRA 3K8MA 4UV4L 1AQDB 1HQRA 4NQUA 3P30L 2ICCA 4JFFA 2CRYA 4HLZG 5GSVB 4JFFD 3IAGC 3JTTA 5A3IC 3L1OH 1TIUA 4P46D 4FG4A 1UXMA 4PCSA 5EUOA 4F8QA 2VW7A 1REIA 2GJZB 2CO7B 1OAUL 1U91B 1H0DB 4LBEB 4X7CC 3BSZL 5K9JL 5BRZB 4PJ7F 4JM0A 4MZIA 1JVLA 1UYWL 5CHNA 3RVWC 3CFTA 3BVTA 3QAQA 1RUPH 4Z1PA 2ZOTA 1TFHA 2EC9T 4WO4B 3VH8A 1EVUA 2VDOH 5FFOA 1CTNA 5I8KH 1MRCL 5GGVL 4MB5A 3U6XS 5C0AB 1KULA 2GK0A 4KZDH 4KKLC 5EIIA 4OM1L 2DPKA 4XZUA 5EN3A 4MYWB 2E9GA 5D96C 3CFMA 3FUHA 2NOYA 3QUKB 1PZBA 2COQA 3UYRL 3GFUA 4LFHD 4XTRC 4AMKL 2B0SL 2HCZX 4Y1AA 1N5AB 3FT2A 2E0PA 2DMGA 4KK6C 5F6HJ 1IMHC 3L3JA 4QXVA 3T09A 3WIIL 2AJXL 4YHNA 2HRLA 1U8CB 5HHVH 1HE7A 1QFWH 5I5MA 3QP3A 2R1XA 5FWQA 1AR1B 2ESVB 3US0A 1SLVA 3BEVB 4YIQA 2H6UA 1KC5L 4NCC2 4GXVL 5I8EB 2QLVB 1L5GB 4FN0A 3VI4B 3MFFA 2XBZA 4HLEA 3VXSE 5BZWA 2CWRA 1DVUA 1A4JB 5FYKD 2CDGA 2AF2A 4P05A 3V7AE 4AG4H 1JERA 1NWOA 4GSQA 4H8UA 2FJGA 2PYFB 4A7VA 1R3KA 3P3RA 4HC1L 5D6CA 3H6AA 1U42A 1L7TL 4V2BA 2MSPA 5IQ7L 4G1EB 4UTBA 1MOEA 1PGRB 3T77A 4AMWA 1ES0B 2KUTA 1MCSA 4DUXA 1O5DT 2CDFB 2H9GA 3N55A 3O2VH 4JO1L 4U1HA 4Y4FC 3T3PB 2YAMA 4F8PA 3CLEH 1ZPUA 4O00A 3UCRA 3QG6B 3RPKA 1CFQA 2VRAA 5IBLC 5I8EA 1M6UA 5T33L 2YGNA 5GPRA 1JMXA 3TVMA 2D3VA 3V4PA 2YD7A 4MJIB 4YDNA 4PGBA 3M1OA 5T5FH 3CVIL 2Z31C 2Y23A 1NEPA 1W0YT 1CT8A 3PXHA 1T0MA 3DRQB 5J1AB 1KV3A 4A38A 3ALXA 1JI1A 2AQNA 2WOBA 1OCZB 2V3DA 3ZYJA 4AGQA 4F8LA 3DTXB 4G5ZL 1YEHH 2A5UA 2NX5B 4XCNB 2X2HA 2BNUA 4MNGE 4PY7A 1CD1A 3WU1A 5CEZE 3L6FA 3GXMA 1G9NH 1ZXKA 2Y7QB 3PWLB 4PVMA 5AOZA 3RDTA 1ZVYA 4HQQL 1SXSA 5IR1B 2BMKA 3BKJL 3OBAA 2OQJA 5CJXA 1JWSA 3SGKA 5C07D 4DF9A 3GKWL 3TA3A 3NCEB 4C4KO 2IPKB 3K6DA 4ZX3A 3FT4A 4H25B 1K85A 3PF2A 2BFGA 3B9VA 4HWNA 2B15A 4PJAB 4GAGH 1G9NC 4Y4HA 4EDXA 2VR7A 2VLJE 3W57A 4JN1L 1VEOA 3BWUF 1SMOA 4QRRA 5JNYA 1R1CA 3LZOA 2NY3C 1AKJD 3Q0HA 5D2LF 5C7XH 2PKDA 1JPFB 2EIZA 4A55A 2SEBB 3SDAB 3DX9A 1U6AL 4PTTA 5TJWK 3HVDA 5ERWA 5DMGD 1WP6A 1ZA6A 3CVHL 2J6WA 2E6PA 2G5BA 4CILA 4LVOC 1IAII 1G7PB 3Q6FB 4GW4B 3EJCA 4PI2A 3S88L 4EIUA 3DYPA 1CGXA 1GIGL 2A6KA 1ZCRA 3QZPA 2X42A 5FYJE 3VWKA 5ITFA 2OSLB 3MTXA 1NTDA 2EIKB 1NBYB 1YPZA 2DQEL 2Z6FA 3ISRA 3NFNA 4JN2A 2FD6H 3T6ZA 3D2UD 1BVZA 4NBZB 3TVMD 5GJSH 2Q86B 4AGMA 4MJ5B 3OPUA 4XN9A 4OLYL 3N06B 4NRXA 2ZKXA 5KVDL 2J21A 4CSSA 3HUJB 3QUYD 4QPEA 2WINB 4NZUH 3S35L 4WK2B 2RIKA 4K8RD 4S2SB 4JDVB 5I6LA 4Y5VA 3MYJA 3VFSA 1WT5C 2XU9A 1MFDL 3CDFA 4CA4A 3GRWA 2RFXB 4MXVF 4QRPB 3SDDD 5BUGA 5F7HA 5I19H 4JVWA 1JF1A 3FFCA 3QR2A 3FW6A 4WRLA 3MLUL 4OI9A 5IB3B 3UYOD 1YJDL 4JREC 1S5HA 5GRYA 1XO8A 2K6ZA 5D1QC 5JXED 5F7DA 1HHHB 1YYLH 5DMJB 2OJEB 1FORL 1OP9A 3L2LA 2A83B 3EOBA 3STLB 5LUMA 3QNXA 4KHTH 5E51A 5FYKL 1IV8A 2NY6D 1D5IL 4LMQE 2Y36L 4JFHD 2BX5A 1PL3A 4Z95L 1PJ9A 4ZUSA 1Z0NA 1L9PA 2B8OT 3HMWH 4YDJA 1QKZL 1BM7A 1EFXA 1F4YH 4LESA 5MEOA 3UYPB 3IGFA 3TBWA 2H8PA 1LP9F 1OSZA 4ACPA 8CGTA 5IV2A 4H20L 5DQ9B 4U1IB 4C56E 4NKMB 5GRVK 1IAMA 4MQ7A 4O2EB 3V0DA 2R4RH 4JDZA 3KVPA 5KVMC 3OMIB 1XQ4A 2E7HA 5JYLA 3NGBB 4GSXA 4PW9A 1MLBA 1Z5LB 3APMA 3T1FB 3JT2A 4JDEB 5BQ7A 2E6QA 2EDJA 2J43A 3LTVA 3UG3A 4K94C 4E41E 4DP6X 3K1DA 4N2OA 5JO5A 3QIWB 4DW2H 4KTEH 3MV8B 3B7RL 3B6SA 5MEQB 2EKSB 2CJUH 4UINH 4IBTA 2DQDL 1HSAA 1DQJB 5AAWC 1KGCD 3FAWA 1CLZL 1P2CA 3FU3A 4BKSC 5D7IF 5EFIA 4HJ0C 4DERA 4PJ7A 2VZUA 1A14L 1F8TH 3T5WA 4DKEH 3A67L 5T1LD 3B37A 3GXFA 1K6QL 1J18A 3UABA 4ECNA 3A23A 1JHLL 2XTJD 4DH2A 1L6XA 2BP8A 3FRUB 4G2AA 3FF7A 4X99B 5I0VA 4F8TA 4E42A 3C6SA 2BWDA 2H3NA 4GKOA 2H0JA 3X3FH 4ANUA 2DQTL 3S36L 5FW7A 3OXSA 1QBAA 3L5XH 4K5NA 3ZPDA 1IVLA 2DI8A 3LD8C 2IQAB 4LVNB 4YE4L 3ERXA 2PR4H 2OCJA 3DV6A 4Y16C 3T0XA 4N0UA 1CC3A 3I74A 4G83A 2VOTA 1YUHB 4BSVB 3TEXA 2B14A 4G6FB 4LRIC 5FDWB 1AJ7H 5ESAB 3ZE2B 1ORQB 4BHUA 1BBJB 4R96A 1KCSL 1ZHNB 4L0YA 4DGWC 3FT3A 1WFUA 4U1MA 2J12B 1MCPL 2J71A 2VKXA 2ICES 3CFKB 1ECYA 2FEEL 2FJHA 3F12B 3CPLB 1TCRA 1B9ZA 5A6IA 4MDIA 3Q5OA 4FZEL 3JVGC 3CBRA 4RIRB 4YX2H 1GZQA 4ZYKB 4PJFA 3W3BA 2MPAH 2D7TL 4HWBL 1UFGA 5L2KD 4XN7A 1Z0MA 3K4ZA 3HMXA 3MV9D 1PLBA 3RL2A 1U8MB 4UQDA 2OXHA 3NRPA 2RFXA 2WWNA 3BAEL 4QRPA 3L1GA 3OKLB 2WVTA 1UD4A 5F1IA 4WTXA 1G9EA 2VH5H 4L18A 1TOXA 2YD9A 4G6AC 1HCVA 5D7IB 3ZIYA 2NT1A 3ABKB 4JQIA 5SWSD 1ETJA 4UV4H 1ILUA 2Y6TE 3ESMA 4TQIA 5IEHA 2YXMA 4GUPB 1TJMA 3CXDH 3CXHJ 5EBLA 1WGVA 4BM7A 3BDYL 1IT9L 3TLRA 1C7TA 1BF8A 5AW1B 1HK6A 5T1KA 4CADB 4IHBA 1SOKA 2NY6B 3DIVA 4Y16B 1J5OL 3KJ4C 1T1WA 5JIKA 4E5XB 2B9AA 4IQHA 4TRPL 5DD0H 4RGNC 3G5VB 4KV5F 5AVZB 2YRPA 3SO5A 3T8XA 3RNKA 4F2MB 1BAGA 3SBPA 1RUPL 4MS8D 2H3NB 1HI6B 4KPHH 1G7MB 5DU7A 5HDBB 3LKSA 2OJZL 3P0YH 5L2KE 3TJEL 5E1IA 4XXDB 1Q90A 2FJSA 3FT2B 3ZKND 3D4CA 4WU7A 3NJNA 1KCRL 4N26A 4PV9B 3MRPB 4ADGA 5DZ9A 4M61A 2IPTL 4LVEA 5I16A 2Q8BH 4CVXA 3PQYD 1MELA 4OFDA 1W8NA 5C3LD 2X4SA 2HAZA 2XG5B 5SX4H 3WNKA 2OW6A 4AM0Q 5GHWL 3HS0A 5IVZB 4MQXD 4MZRA 4WI4A 3KYNB 1WAEA 3PPSA 3WIIH 3RVUD 1M05A 5KVGH 5JXAH 4QRBA 1KTCA 3OR6A 1ORSB 2CLRB 2ZCHL 4JHVA 2KS0A 1V27A 4MMXB 2Y25A 4AYBA 3V4VB 2VWEC 3EHBC 3MROB 2BY2A 2X70B 4XPBL 3F64A 1XR9A 3CVHH 2BW4A 1F4HA 4GMSL 4D9LL 4J1UA 2CJTA 4ZAKB 1AZZC 4NYLB 5EPMB 1G94A 3QJQB 2GTZA 4G43B 5BVPL 1JCKA 3QW9A 1S7XA 3INOA 3FT1A 4L4VD 4PJBE 4R7DB 4C59B 1TVBA 1PYWB 2EXWC 1GSMA 4N0UE 3T0EC 2VSKB 1KYUA 1HXKA 2AQ1A 5LGYA 3PAUA 1AGDB 1WFMA 4KHXL 1LEGB 1R47A 2R39A 4G8FA 3BWZA 4PGBB 4Q8BA 5KAQF 2BLFA 2WOYA 3PWJB 4JFPB 3LKQB 1DQQA 1DFBL 4IHOB 4NRYB 1KIQA 4TOYH 1T2JA 5CF3A 5ICXB 1EH9A 1BFSA 1PY0A 1T66C 3F84A 3HE7D 3JQOB 3LV3B 1G7QB 2LT9A 3HE7A 5FHAH 1I8UA 1QW8A 1II4E 4QTIL 5D6DA 5I74C 2OFQA 3L6FB 3ULVE 3SQOL 5D2NA 4YO0A 4LSPH 1TLKA 4XRCB 2ITEA 1RJZB 3BO8B 3HNVL 4L9LB 4X9HA 2FIKA 4JVUA 4C83A 1BIHA 5L8LB 3FUNA 2ADIA 4OIIH 3FUMA 2NY3B 5IB4B 3TS8A 2VAJA 1RZ8B 2WC7A 3GK8L 2O4EA 4PREB 3MBWA 3IDMB 4HUVA 4FQXB 2CIIA 4AI7A 2CDGB 1CFSB 3NPSB 4MJIA 2YBRA 5DK2B 4AK2A 3BZEA 1VKXB 1OAZL 3QO1B 1L5GA 5EOCH 5HJ3A 2E9WA 4I4WB 3QUMB 4PJ9B 2IH3A 2X09A 4KMQA 5K33A 3LN5B 4XE5B 2VXTH 3P73B 3P0GB 4Q6YA 5DHVA 2AXGA 3F04A 3HHMA 3L7FA 4DQOH 3UG5A 3D52A 1QI4A 5E4AA 1V3KA 4WO0A 3E38A 3O8XC 3FMGL 5C07B 4EBQH 4AENA 5IY5B 2DIJA 1KJ3L 2DQCL 3BD3A 4Y5VB 5JZ7D 1SYVB 2MCPH 2XFXA 3TFBA 5LGKA 2W9DL 3FTGB 2BCMA 4KKAD 4IKNA 5IHLB 3QQ9D 4NM4L 5TE4H 1O7DC 4HX1A 4HFUL 3WFDH 4RGNE 3ZE0F 5K1NA 2B0SH 1O6SB 4KDVA 3VGAC 5EZOH 4OCMC 1WA2X 4O9HH 3PYCA 1Z5YD 3MRRB 3BXNA 4PWFA 4LEEA 3MXWH 2FBJH 5D7LE 3ZDXE 1NCWH 3QUXC 1D9KD 2VQ1B 1DJIA 4MA8L 2Z1PA 3VXUD 4YC2C 1Y0LB 2RTTA 3DO3A 2R69A 3C60D 1UZ6E 3O2DL 3PFUA 1ZLUK 5I6XC 3EJTA 3HN3A 1MFCH 5EZLB 3ZE2F 5B3SB 1F3JB 4KZDL 1PLGL 3RBSA 1X5HA 3VWKC 3M88A 4OB5H 3U83A 1BQHA 3BPLC 4NLHA 2XVLA 1NC2A 4WHTB 4WY7L 2FX8H 3Q48A 1Q0YH 4ALAC 3OAZH 2RD0A 4NO0D 2XG5A 2VUKA 2X4SB 1J8HB 5HYQA 4NO0A 2X9YA 2OTPA 3PP4H 3VXTB 1DEEB 3SPCA 4ONHB 2CBPA 2FHBA 4BQ9A 3BEWB 3IM1A 4L4JA 4NO2B 1G5AA 5I1KL 1H0DA 4NHUA 2IALA 5CEYB 1MNNA 1D5BA 4OCYL 5TDNA 1M1XA 3B1TA 2DD8L 3RI5K 3V4PB 3BFOA 4F15B 1BVLA 3HCVB 1IX2A 3CFQA 2IF7A 3INUH 3C8KA 2VITB 1XF3A 4JEGB 2HLEB 5CUSH 4ZMTA 3REWB 1UXWA 2GB2A 3VUAA 1SXCA 4NSKA 5D7LA 3FQRB 1A6UH 4Q6IA 1Z66A 5F1NA 1IKFH 3DK0A 3SGJC 2X3BA 3UACA 3W81A 4CMHC 1NCHA 2PR9A 3IBEA 2ADFL 3BGMA 3CE1A 3VXOA 3W0WD 4IOSA 3UDWC 3V5HA 4NQSA 1OEZW 2Y6SC 3B34A 4HVBA 4GUQA 4Q9QL 3MRCA 3N6YA 4Y4KC 5DHMC 3A4AA 5I1JL 5C0GB 2MQ0A 1IBYA 5JOPE 5D7IA 1K4CB 2H2PC 1CJYA 2ZWKA 3OKOB 5DJCA 1JZIA 2DWTA 3LHAA 3IE9A 5CZKA 4RQQB 4JFDB 5IBTL 1CBVH 2VLRA 4FKKA 4JZOB 5JDSB 2X9XA 5GGUA 2VSCA 4XBPB 5DK2A 4HDIA 1MIEL 3BW9B 3BZEB 1P1ZB 5C1MB 1BD2E 4H2AA 1RZGB 4KGJA 1YSOA 4ZW5A 1F42A 1UJ3C 1YN7B 3I02B 5BZXA 4G7YL 4CW1B 3DUSA 2GC7C 2QGCA 1FO0H 4M43H 5EU5B 5C97A 4HZLA 4OCSL 4TUKL 1DDHB 3O3DB 3FCGA 2AABL 2DJ4A 1T6BX 4PJIE 3MUGB 4QXUL 3KPPA 4OGXL 3NDZE 1JNNL 2CHDA 3QUKA 5E5LA 4AQAB 3UO8B 1E6JH 3JBG7 3AG4B 4YXKL 2EH7H 3AB0B 1JHLH 3I84A 3MLVL 4PJHA 2V2WA 4M7LL 1N64H 3V6ZA 1Z3GH 3A24A 2PP7A 4R4ND 4FEIA 3IKCB 4XPAH 5C0CB 3CHSA 1B6DA 1HNGA 3MJ9A 3ZMNA 1HOCA 1U33A 2IQ9H 2EYRB 3ZKXC 1QFHA 1HILB 4KVCH 1R75A 4FFZA 4WWKB 1NIAA 2J6EH 3UFIA 5C0BA 3L2MA 4Y19B 5DHYA 1QSED 3JTTB 5AAMA 1I8LC 1FNSH 1E40A 1IGJB 3L45A 5JOFA 4OF7A 4N0FA 1QPPA 1ZLUH 3GM0A 1EFQA 4UUJB 3L5WA 4OZHA 1LO0L 3EH4B 4F7EA 3LN9A 1EAQA 3HOGA 4QLRA 5EOQH 5JA8B 5B8CC 1BOGA 2D9CA 5AVRB 5DJ0A 3TZVC 1MCPH 4CKQA 4M62H 3WEMA 4YK4B 2CD0A 1G7HA 4DPBX 2WXRA 5HHNB 1NCNA 4OGAD 2QQKH 4AEIH 1URZA 2DMBA 3MBXH 1BIIB 4N2KA 3QDMA 1SGKA 5T1MB 1MW2A 3POHA 1NGPH 2IDCA 3S88H 3E2HB 2B08A 3KL0A 2R1WA 3DTUB 4EZLA 1D5IH 1D5ZB 3BP5B 5FYKU 3UZQA 1A4BA 5DEGB 4EIBA 2FUTA 5AW2B 3VA2C 5IT2L 2Y72A 1F6LL 1OTSC 2Q3XA 3GPSA 3LZQA 5IHZA 2YGQA 3MOBL 4KOCA 2XN1A 5E5MB 1ZSDB 3A6BL 3O8XA 4N0YH 5C9JB 2I5YL 2AK4B 1LILA 4N2IA 2YPVH 1D7BA 2WXHA 3L7EB 4U1IA 3TTSA 5CEZL 1EK3A 1AP2A 3TBSB 3HS0C 1OSZB 5IV2B 1BBDL 1OCWL 1WBXA 4LKXA 2IXQA 3OAYK 3QUMH 5J11C 3WLWC 4HIJA 1TTFA 2BS8A 4HIPA 3CSYA 4F80A 1MRFH 1NOFA 3SGEI 4QMEA 4ZUWA 5I1EL 2WKLA 2ZWYA 3QI9D 2QJDA 3KWWB 5HYJD 1BFOB 4AT6B 1GHFH 2YD6A 2CM6A 3VFPA 2OMWB 1KCKA 4CGTA 3FT9A 3HVNA 1OE3A 3H9SA 3ILQD 3KYMB 4QTFA 4NUJB 3TO4B 2CO2A 2YGOA 4IOSD 2ZOKB 3MGOB 1OAZH 1A3RH 3MX0A 5CFHA 4QTHB 4BH8A 4LSSL 4KBPA 4EOWL 4ES8A 1AKPA 3ZDWA 5CMAB 5F7BA 4HWBA 4PRAB 2PYEA 4P48A 1CLVA 3IN0A 2R1YB 3PCYA 5FGBC 1BXVA 4H4NA 3VX1A 4J23A 2ROXA 2OI9B 2BSBA 1XL4A 1RZIB 1U3YA 3UGEA 1ZVSB 1OM9A 1RURH 4WI8A 2WO4A 4A6YA 4MD4B 1M6OB 4MNGB 3W2DL 1BGXH 1BPLB 2G3MA 3PNWA 4JY4A 1ZLWK 5DS8B 1JRHL 4UQ3A 3U1SH 2AJYL 4N24A 2YEQA 2MOVA 1C5BL 1UM5H 2UV3A 4RRPA 3GMLB 5JYMA 3NN8B 3BUIA 4I5BB 3RGVD 3I6LE 3ZJAA 4KO6A 3RWJA 4M9PA 5B7EA 2F53B 3MN8A 4OZFA 4NWTH 3E3QC 3NCMA 4DPCX 3L3GB 4DPAX 4OJFH 4MAZA 5D1QD 1EAPA 1ZVHA 1QFUL 2GT9B 2FR4B 2DQTH 3COOA 4YHIB 1QO3B 3BH9A 3IDJB 1MHHA 3O45A 2W38A 5C08A 5TDPB 3N1FC 3QIUA 3ZK0A 3FB5A 5BVPH 3WLBB 3VXRB 1SMAA 5ANME 3VFWA 2YD0A 1SFHA 2G0LA 2DQEH 5MHSE 1EX0A 2OSWA 2GFBA 3TV8A 4Z7AA 2IJ0C 2XUWA 5E6ID 4V1DE 1LE5B 3MOAH 1EJ8A 2P8LB 4NWUL 4OD2A 3SO3B 3QFJE 1CIDA 3S98A 5KWYC 3GRWL 3PJLA 1U8OA 2WQXA 4C8XA 4GP4B 4PRIA 3VRIA 3CVIH 1KEML 2NRDA 1AKJA 2DBLL 3OJDB 4UU9A 1UA6L 4W9IC 4XOAA 4L4VE 1A1OB 3TA3B 1OO2A 5TK2A 5HP5A 4YZWA 3WYRA 1TVHA 4J3UA 1UJTA 2N01B 5FW8A 3TN0B 1AO7B 1WCQA 2R23A 2VLKD 5T33H 2PCPA 4K71B 4IBVA 2K1MA 1KBGH 1E42A 3RUGB 1BZ9A 1WIUA 3TESA 4D0CA 1HQ4A 5IB5B 1XF4B 3UP6A 4D9RD 1B0GA 4DP7X 4CU7A 1CFBA 4UILL 5IVOA 1TPXC 4J7RA 1NDMA 2Y0SA 3JWDH 4A2EA 4M3KB 3GSXB 2A73A 2G3NA 2N7AA 3HR5B 1JZ4A 1IFGA 4NQCA 3KDPB 4X4KA 1L0YA 4Z95H 4HULB 4MQ7B 2Y9RT 4O2EA 3WTSA 2XWJB 3Q5TA 1IC5L 3KD4A 3IU3A 5C07E 2OL3B 3LZFL 5B1JA 4QOKD 5DFVD 3U7WH 1U8NB 3S4SA 2DQHH 3LKSB 3P3YA 3DX6B 3ATEA 5IHHA 2UWEB 2WSKA 4PJIB 4M03A 2ITDA 2AEQH 3QJFB 4KK5D 3L3DB 5FXCH 4YSEA 1G1CA 1JRHI 3F83A 1PNDA 4HJUA 2W9DH 4U1HB 5B3NA 4Y16D 2YXVA 5DQDH 3QR0A 2C5DC 2WLIA 3MNVB 1AHMA 1IAIL 3SPVB 3Q3GB 4P23D 3DMMB 3RWGA 5A7BA 4DVBB 4F7KA 4JN1H 3HA0A 4F7CB 1XGUA 2GUOB 5IUCA 1QD0A 2I9LB 1H6FA 3HLKA 1IM9A 3F65A 1BFTA 4N8VB 4WJKB 3QORA 1PPIA 3SBRA 4F1SA 4FADA 3L81A 1DANU 2KPNA 1FF5A 3NRQA 3OHXB 4P3WA 5CJQL 3KWUA 1OZUA 2P5PA 1ADWA 1JWUA 4WU5B 4DP8X 2VDKB 3ESOA 3QUHA 1AZUA 1KN4H 3EXJA 2IANB 2ITDB 4JPIA 4WI6A 1WV7T 4J12A 5HVHB 1SVZA 5TD4A 3RKDC 5BMFH 5ACLA 4FXKC 2DN7A 2XN2A 4X5XB 3L4XA 3LVTA 1KJ2B 3QO0B 1YUHA 4HCFA 4BSVA 1QLFB 2FNWA 4FXGB 3H42L 5KVFE 5JPNB 1Q1JH 4A7GA 3RZCD 2VZVA 4HKJB 4N0UB 1T03H 3NFSL 1DUZB 3B9KB 1BQSA 5H2BA 2G60L 2DTMH 1CFNA 4YLQT 3BD4A 3QDGB 3QQ4B 1QHOA 4JJOA 5B4MD 4YFEA 5IB1B 5IMLA 2P5ED 2P7TB 2VR5A 1S9XA 3DHMA 3F7YB 4BUHA 3MREA 4FLQA 4MXQC 2XC8A 5JIDA 4XB7A 2FO4B 1QQDB 1FDLL 3MA9L 1KJMA 2ZKYA 1Q9OA 2XYBA 4YDZA 3IDUA 1ACYL 4OZIF 4LBEA 2WQSA 1RJLA 4YHKH 5IOPA 4NNPL 1XB8A 1HU8A 4NPJA 2VXQH 1TJGL 5D9SA 1MWAL 1CL7H 2DM2A 1G7JB 2JMRA 3QNZB 3ATAA 3EYSH 5DZAA 1R5WA 1DVXA 2ITCA 3NSJA 2G9HB 3TO4D 1YEDB 2RCSL 3OGCA 3D69A 2KERA 3AG1B 3AXHA 1SF3A 1I75A 4GW5A 1JZDC 3QE5A 4TM9A 5D1ZA 4F7MA 1TG8A 4M4PA 4Y4HD 5HVFB 4LSTH 3L1EA 3DROB 2DQGH 2E27H 5E9DD 1ND0A 4TSAH 4U6HA 4UZUA 3VG9C 2W65B 4HP5A 2UXVA 1PTZA 3MACH 3O45B 4ENEC 3SY0B 2H6OA 4GYBA 4FQLL 4JQIL 5DJ2B 2NTFB 4X9IA 1LO5A 4NNYB 2AJSH 2AHIA 5KSUA 1TO5A 1GA2A 4IEFA 4LRNL 4F58L 3VFRA 1BD2B 2A7BA 3U7AA 2GJ6D 2MNUA 2YN5A 2OI9C 1ZLVH 1JNNH 1IT9H 4ACTA 1DE4B 2C1OA 1GHFL 4LEBA 1GGBL 2ATAA 1OV8A 4DP2X 2VXTL 2XWDA 4AGLA 3BUQA 1NSNL 4NKQB 1TTRA 2YQBA 3K0WA 1I7ZA 1OWRM 3RG1C 1MCLA 3QUXD 5FR3A 2BCKA 4H40A 5D7KD 4Y5XB 5F7DB 3VH8G 1QLEH 4O2FB 5I71C 3SE6A 3BRFA 3IXAB 3MV11 5TPWH 1HL5A 4X4YA 4ZX6A 5DF0A 4GG6E 3MRLB 5HHME 3AAZB 2YR3A 1H19A 2YBGA 4QJ5B 4IIQC 1VF5C 5GRXG 5CD3A 1FL5A 1NEZB 3QCUH 4G11A 1GGCH 5TF1H 3TNMA 4X9FA 3BFWA 3Q6GL 4LASL 4BFEA 3ZDXF 1X44A 4YUEH 1R0AH 2AXFB 5DFTA 3NJMA 1NCUA 3VX0A 4YHZH 1DTUA 4APQC 1DBAL 3WJJC 3BYYA 2IG2L 4FQQA 3QAZC 4X4MA 4ZUWB 3B5TA 2FYVA 3I50L 5EIQA 3T0BA 2MKWA 3QDJA 3AM8C 2VLLA 4MMXC 3ULVL 4PJHE 3G6DH 2J2ZA 5EBMB 3K6FA 1AJ7L 2J1YA 2FLBT 2ZXDA 3E9TA 2VLJB 5GS1C 5KVFL 3HPLB 4I3GA 2MNJB 1HH6B 3ZKQD 5JXEC 3P3TA 3PV7A 1F1GA 3RWEB 5AQ0A 2F7OA 4XAWL 3EFOA 4E0RA 4OI8A 4LPUA 4ELME 2I9TB 4CRPA 5BW7A 4HD5A 1GJUA 2Y1ZA 3GRGA 1RZ7L 4A1RA 2XXCB 1HHKB 2YPLD 1UH2A 1A7OL 3NZHL 4DPRA 2GEEA 1UT9A 2LAGB 4AQAA 1NOLA 4WIQA 3S8GB 4X7SL 1HYSC 2IH9A 5AB0A 1TQCC 5ITFB 1PF3A 3GDCA 4U49A 4GI9A 1WT5A 2AJZB 1GVIA 2ADYA 4G80A 1A6ZB 5DUPH 1DUYB 1WC7B 4PRNB 4WTZA 4Z7NF 4YNYA 3IFNH 4Q9RL 1MXDA 1P1ZA 4EI6A 2AK1H 4UMSA 5HI3D 4Z7QE 3LNEA 1F45A 3DURA 3NT0A 3ZKXB 4B97A 1B2WH 3RX8A 2R51A 3NJGA 3QFJD 2X7LA 5HPMB 2NUPB 4OZHF 3X1BA 2M26A 4PWHA 1NGXB 1T7YA 3CPUA 2FWUA 4FX5A 2J7LA 4MXWL 1NCJA 2YZ8A 3JWDL 4X4ME 4ZW8A 3SY6A 4JHAH 4P57B 4Z7WB 1CLOL 5FKAB 2DQIL 1FN4A 4L4TB 3BP7A 2AANA 5EOCL 3WO4C 4XMLL 1KBWA 1M7DB 4ZFZA 2VMFA 3GM8A 3GDBA 2HN7B 4OUUB 2EYRA 5CSZA 1JPTH 5EU6A 5C0RH 4G42A 1TZAA 2YO3A 1QTPA 3ES6B 2XBTA 3P9LB 2CHZA 3FQWB 3SE3A 2QFPA 4ERSH 3FUEA 2EC8A 1KGYE 5ESVA 3NEXA 3ULUE 1JRHH 3U1SL 4BV1A 5G4MA 2NY7H 4XWGL 1PY9A 4ICWA 4HIIB 1I9RH 3OKNB 2P49B 3EYFA 1YDPA 4YBLB 4EXPX 1SXNA 2EXYC 1KTLB 1PKOA 2EIBA 4RFNB 4D9LH 3ARBA 3L48A 2BWIA 2X3AA 4AM0A 4JPKH 3VI3E 2UX6A 1SBSH 4BFIA 1QUNA 2WN2A 2OR7A 1OGSA 1U4EA 2N56A 5IW1A 4K3HA 1NC2B 1JWMA 4G9FA 2AJVH 4LU5H 1S9YB 4KTYA 3A21A 4DO6A 4E0RB 2FSDA 2A6JA 2AXHA 2CHNA 5LGHH 3JV4A 3CZEA 1F3JA 4Y2DC 4PJXE 1M7UA 3RHWF 3IDGB 3NTCH 2D3NA 4UV7H 1A3LL 5AD0B 5KVDH 5F7UA 3LQZB 2ZKHL 1MIMH 3SQBA 3V79C 5IVNA 4J4PD 4U3SA 3L08A 1JNLH 2PPFA 5E8PA 3F6JA 4NT6B 4J3BA 1F02I 4Y5YA 5FS5A 2V7NB 1DSYA 3PRZA 4AQ8A 2DQFB 4I88A 5I8CB 2EVFA 3VVVA 1Z5HA 1J87A 1CXFA 1P0SE 2JKRM 1KJ2L 1HWWA 2ORBH 4OCRH 2W0PA 3I3DA 2FX7H 5KYUA 1HNFA 3FTVA 2WZ5A 3D08A 3OD3A 3AXIA 5IVXB 2E3VA 5D5MF 3HCVA 4MCZA 2WJ5A 3M7OA 1KCVL 2A0LD 3PDOA 2XWXA 2EE3A 3U30B 3K46A 5DGQA 5T1JA 1NBVL 3IN2A 2H0PA 3C60A 4RRPM 1BWWA 3RPIB 1KT2B 2VCOA 1U3HD 3KCPB 4RWHA 3TF4A 5IM7B 1ZGLM 1ZT4A 4MJIE 1XH3A 4U1SA 1DEEA 4PJ9D 5GGRA 1KMGA 4PIRF 1E28B 2X4PA 1E4WL 1T89A 1RLWA 4IKIA 2UX7A 4MBRA 4N6QA 1QNZH 3DXAA 3WNMA 1OT4A 4ABQA 2AQRA 4OFIA 2PWFA 1EEYA 3IJSB 1KG0A 3LJ3A 4YBQD 4RGMB 3KJ6L 4YGVB 3WL9A 3QEHA 5DJZA 3WAKA 1CF8L 1ZDSA 3MXVH 2GKIA 2BP0B 4PREA 1OGAB 2EYTA 2IAMA 3H9HA 1FVDA 2B39A 4U7KA 3CDGB 3MLZH 5AVXB 3UZEC 4XCYA 3ZT5A 4AEFA 4ANWA 4KK9C 1ADQH 1VGEH 2BERA 1AS6A 2V9RA 2ZUVA 2G4EA 3LRGA 4AG4L 2QQNL 1I9IL 5DQDL 3RL1A 3MCLL 3FONB 4AEEA 3W2DH 1W16A 3UJJL 4H8VA 4DOHE 2ZNWA 2AJYH 4HUCA 3ML8A 3CSTA 4QRTB 3QQXA 2OP4H 3JZ7A 4PJDE 1OGTA 3BIAX 5DD5L 5AZUA 3FQNA 5LAXB 3FRPB 1PNCA 4KO7A 1MXGA 5D1XB 2PP8A 4OBRA 4TL4A 1LP9E 2R29L 3G9AB 3HB3B 5FM5O 4JG0L 5E2TH 5IFAL 4G8GE 4ZJ9A 3PPEA 5IFHH 1I8MA 1KTBA 1OHQA 2C3XA 3W9DB 3KVDD 1J5DA 1RKRA 2GVYA 5EU3A 5J11B 4ZMNA 5K69A 2R2CA 1FH2A 1NAMA 3O3BA 1A3RL 1J05A 4HALA 1S9WB 3DPBA 3PXJA 3RDTD 1U92B 4PJCA 3GIZH 4H5SA 4G59C 4X5RA 3LRSA 1W80A 2LW3A 5HPMA 2UZPA 1U8IB 5HVWA 3P77A 3AITA 1W0WA 1QQDA 4DUWA 5I1HH 4PLOB 4HH9B 4TLUA 3FNKA 3UCQA 3MREB 3MBED 2X9ZA 1FNSL 2BOCB 1D5XA 5DGRA 2A9ML 3WL9B 3VD4A 1FG2A 5KANI 3GXPA 3WY1A 3B2VL 3VD7A 3P4LA 4ZNCD 1QFUH 2ITCB 4JO3L 2IG2H 1J5IA 1FFOB 1KACB 3K4AA 5EOQL 2A1WL 4A04A 5DD1L 3TF7C 1P6AB 3MNWB 4QNPF 4BK5C 3SDCD 2L8AA 1XAUA 5I2IB 1VHPA 3MJWA 2WQVA 4KH9A 3D2UB 3R1GH 2HLAA 4XNDA 3W0WE 5CM1A 1C8QA 3TOPA 2QQKL 4AEIL 1YY9D 1RUMH 4GRLB 1CFTB 4PRPA 4D3CH 3KPRA 1EHNA 3IU4L 3FULA 1NPUA 4NRYA 5CBAB 3V4UL 5JQIB 4KKBC 3IJYB 4M6ML 4K9JA 4BZ2L 1MFBL 2UXFA 4RAVB 4U1LA 4WDIB 5CP3A 5KVGE 2PO6C 2QELA 4IOFC 4LNRA 3ZDYB 1Q9OB 1UZ8B 4GFXA 1VEMA 3ATBA 3B2DC 5I8CA 4QJ4B 1ZV9A 2OXGA 3GBML 4PWJA 4TRPH 3QEUA 4B3VA 3V2AR 5F3BB 2BNQA 1KCLA 3IFOA 4XBEL 1CE6B 5CGYD 4ZOCA 1DBML 3SDAD 3EJZC 4L4VB 3RWGB 4ZNEE 1RFDL 5IMKA 4MVBD 3T3PF 1EXGA 5E1GA 2DQCH 3EFFA 4FFYA 3O4OB 5IIEA 1VGKA 3K71A 4NZTL 2KZWA 1BMGA 4L8SA 5D71L 2FYYA 3MRJA 3OB0H 2EDEA 3TIEA 2BPBA 3S5LB 3WKMH 3MV9B 4BFBD 4PVLA 1FLRL 4F57L 3K0YA 5F7MC 2VDRH 2EKJA 1OGAE 1ZGLA 1WFTA 4XNBA 4XCFH 1U95A 1VERA 5AOIA 1RHHB 3EOAB 4F7CA 1Z3GL 4LLMB 4WNSA 4JFDD 3MRBB 1OSPH 2DJSA 5CNHA 1D6VH 5JORB 3FZUD 4JZJB 1DSFH 3G5XA 4XTRD 2E74C 4P5TB 4B3EA 5D93C 2PETA 3FC8A 3KZ8A 2NNCA 3CUPB 1HOEA 4G5AA 3JV0A 2NX5D 3ZO0A 2GTWA 3H6JA 1WBZB 1P5UB 2UZYA 3FH8A 5I17B 2AEOA 2ZKWA 5HYSA 2XIIA 1EEZA 1H15B 3W0WB 1DQDH 4LE8A 1JIBA 2IOIA 4X7TB 4YMPA 4L8CA 2W94A 4Y1TA 3SCMD 5KSUB 2FRGP 3KPLB 1W0VA 3CFDA 5GGTL 3MGAA 1C5BH 1VADA 2Z34A 4PAZA 2GQHA 4JM2D 3SY0A 5CCGE 1JZHA 4P5RA 4HXBH 1XH2A 4M8UA 4NQXA 2EZ0D 4KXDA 1GGTA 4ZFFB 4MAYB 3NA9H 5K1JA 3NZ8B 5C3IA 1G5GA 1XBDA 4WTQA 1AGEB 2CQVA 1XDTT 1T21B 3F58H 1IUZA 5JLZB 1NGXA 1ET7A 2GCYB 3QHZL 2VJ8A 2C9PA 3VM7A 3OKLA 1WBZA 4YDIL 4NNPH 2HJKA 3P11H 3FB5B 3TT3H 1UACH 2WXFA 1AD0A 1S7SA 2CGRL 2Q1EA 5E4OA 4MXQD 3A6BH 4N0YL 5DEZA 2R8SL 1HZHH 1MIML 4JG1H 3MMEA 4Y8AA 4AQ1C 1OOAA 5DJ8B 2GIMA 4H8WH 5SWZA 3SBWC 1GGUA 2ZOLB 2BXZA 3MR9A 3MV8D 2Y07H 4OD2B 2O61A 2WO3B 4PTUB 3US1A 5K9JH 1Q9LB 2VSMB 3NFSH 4WFHE 4OZIE 5E9DA 2EE6A 3DOHA 2C3GA 2NXYC 1IGCL 1AHWC 2W0FA 2B1HH 4L8SB 4R0LB 4POZD 3VFWB 2A2QT 2UWEF 2Z8RA 4JRWA 1OLZA 4L48A 3RURA 4NP4H 4X5WA 2J3SA 1L9NA 2UUDK 2JLPA 3CX2A 4PJBF 1GS7A 3OM3B 3LKPA 4WUKL 3MUJA 1L9QA 3QDHA 5BS0B 3FL7A 5LQBH 3ASOB 4XNZB 3H53A 4BWWA 2N7SA 4MJJA 4HFUH 2J2ZB 3B2MA 1URIA 3NIFB 4ZQKB 4I2XE 3SIKA 3WKQA 1IGYA 1ID2A 4HJGB 4JL2A 4UAOB 3TWCH 2YMXL 2GSIA 4FNLH 5BRZD 5IEKB 2VDLL 1A6TA 3HZVB 5FM8A 3SE4C 5EN2B 4Z8FH 3ILEA 3QZMA 2ZXCA 4E42B 3MRHA 1E4XL 1NKGA 2HPOA 4L3EB 2XQYA 4X9BA 4QO1A 4HG4J 5JHDD 2OAAA 3HG3A 2ZKMX 3PGFL 4P5KA 3OL2A 2Q8AH 5HGBB 3U0TB 4NZJA 1PLGH 1INEH 3MODL 2NY4C 2NY7L 3B7UX 5A40E 2VDKH 4OKVA 1CUOA 4KRPB 3NSFA 4OD1H 4P4RA 1HXYB 4DEWA 1O7SA 2ZCKL 1F90H 5AWNL 1XF5B 2GJ6A 4V2CB 3WDJA 1D6EA 1Q0XL 2VL5A 4KK9D 2IWFA 1WS7A 4Z3TA 3TVMC 4AE0A 4B9KC 5EWIH 5SX4I 1DJHA 4DFHA 3GJFB 3N44F 4MWFA 3MA7B 1KTJA 1G87A 3PP3H 4HUMB 4LAJH 4LCYA 4ORGB 4LPVA 3QQDB 4TVPE 4A7SA 4XNQB 2QVKA 2VABA 4CC0A 3EDFA 3LIUA 3LQAL 4NN6B 2B5IB 2MWCA 4UANA 3EZ8A 4AVKA 3HZMB 5F9AC 1OP5H 1BXAA 1BF5A 3BDYH 1GKOA 1TU2A 3D05A 3II1A 5AYTA 3N3EA 3OJ2C 2D8KA 5DLLA 5B21A 2FATH 1S5IH 3P2BA 4Q56A 2OMXA 5ERWB 3EO1A 4G8GD 1N70A 2WUBH 4UT7L 4PJBB 5E70A 2Y7MA 5D2LA 1A1MB 4NCC1 4OLVH 4UIMA 4KKRA 2H1XA 4XHQA 3J07A 4BCYA 1HHJB 4XP1L 4F7MB 2MIZA 1KBBA 4ZT1A 1YHPA 4XMWA 4AKPA 5EUOF 3T0EE 2FJUB 4BA0A 1UA6H 3OXRA 1LTXA 3ZYOA 4DKDC 1PKQB 4WSJA 3KGTA 2Y5EA 5C0FA 1HYSD 5BS0A 2QADC 3L3OA 3V0HA 3WY4A 4A6YH 1CYGA 3N04A 4HMDA 1GC1C 2Y1YA 4GQRA 2YOAA 3QUZA 2VN4A 5E1QA 2V2WB 4CSTA 3EO9L 1TJIH 2JSFA 4YHIA 4GPVA 4I48B 4YBQC 4NJ9L 4U31A 4DK5A 4P3DA 2XV0A 4TQHA 4WFEE 3EF4A 4I0CC 3TBYA 3VSUA 5J3HD 2YRBA 4Y5YB 4M3JA 2HFEA 2FWOB 5CR8A 4XNZC 1GYVA 1JF6A 3DKHA 4M5ZH 4PS3A 2V17L 2GJRA 4KRNA 4IBLT 5LNGA 2L7EA 4TVSa 3TCLB 3BPCA 4YHYC 4KXAA 4B9GA 5ITBL 2LQRA 1J0JA 2KH2B 2DI7A 3T2QA 3JV4B 3T1WA 3QCVH 5TDOA 5DQJB 3V0GA 1P7QB 1E7UA 1YCSA 4V33A 1UWGH 2J4WL 1YA5A 4JPWH 2X40A 2BP5M 4B53A 4E9XA 4H1LG 3FQUB 1GZPA 4FJYA 2FWSA 3MLWH 3GIVB 4KVNL 2L04A 1BZEA 3MV7E 4PTUA 5IFHL 4ONOA 5D70H 5EZPA 2CHWA 3E1ZA 3MUGA 4L2YA 3RRQA 1PX4A 1YN6A 3L16A 5JHDB 3VI3B 3CFEB 2PTUA 3GMMA 1PCSA 3O6FD 2CCLA 4P59H 1IILE 1AQKL 1YJDH 3DETC 3T6QC 1FHGA 1FO0B 1DSWA 1ZHKB 4TVPH 3TV3H 3X3GH 2P8PA 3BVXA 3KL5A 1OGAD 3GHBL 3MBXL 1UC6A 1CLYH 3CSPA 1M1SA 5T5FA 5E03A 3CZFA 4M6NL 5ESQB 5ICZA 1F1DA 4RMVA 4U3CA 1T21A 1TSHA 2GJJA 4U6VL 5FK9B 4YUEL 3RAJH 4KI5F 3LYRA 4HGMA 1K72A 4UT6A 4MFHA 5I9QB 4BK4A 2EH8H 3MOBH 1J1PH 5J1SC 1FZKB 4XC3H 3PGDA 2XXFA 3HNTH 2OYKA 2LU3A 4FDWA 4F27A 1DO5A 5E8OA 5FGCE 1FGNH 3MA7A 4LCYB 2GAZA 1EAOA 1E4XI 3SB3A 2XQYG 4OD3H 3HLAB 3ZUNC 3MRGA 3APNA 2HH0L 3UGXA 4GKSB 3GTNA 2EVIA 2P8PB 2J5LB 3NRFA 4ZI8A 5FHBH 1P7KA 5IESH 3NABH 2E9JA 2DYSB 4WO4A 3NACL 3VH8B 3VU1A 5IP4A 5PCYA 4WEUD 4P4RB 1NGWB 4AZ8B 2Z8SA 1R3HB 3MV7A 4JFYA 4FTVB 5B1CA 4A2MA 4X4XA 5JMRA 5JHMA 3VFMA 1UFUA 1P4BH 2F8OA 2YAHA 3A47A 4UM9D 3BLBA 3ZRSA 1N6QL 4XPTH 5I1DB 4S1DD 3TP4A 2ERJC 3IRPX 4FMFA 4MA8H 3B2XA 5SV3A 3L4CA 4RAUB 1CL7I 5CGYC 1OE1A 5SWSE 4K0OA 4AUJA 5L2JB 5F0MB 3PHSA 3MC0A 1O7VA 3VI4A 1V8HA 4B41A 1BX2A 2F1AA 5FCUH 1FO0A 1MZYA 2NPLX 4JFZH 4E9VA 2XFXB 2VW6A 4MX7B 4B60A 2YWZA 4PG2C 1KSRA 1OM3L 3KPQB 4DTGH 5KS9E 3I3BA 43CAA 1CU4L 4NDMA 4LVHB 3ARED 5I15H 3MV8E 1A66A 1FFQA 2FE0A 2NR6D 5IMKB 15C8H 5L4FA 4TTDD 3NYKA 4LLWA 1B4TA 4JQXA 2DQJL 3QXAA 4Z7WF 3OVUB 2ED6A 3C5ZB 4V1DB 2IH3B 1G0YR 4Z0XB 2ICWI 1PG7W 1W72L 4MSWA 5L88L 1XGRA 3CAFA 3MUHL 2JJSC 2KQNA 4LQFH 4XOCA 4DQAA 2ZUTA 5BPPA 4LCUB 2X89D 5DJAA 3FFDB 1ZVNA 4W6YB 4QHPA 12E8H 3BMWA 4PP1D 5GSRA 3S48A 3ROLB 1A6UL 2AXJA 2QBWA 4ATWA 4CGUB 4A37A 4JKMA 1MCJA 5J57B 2E59A 2X3CA 1XH0A 3B3IB 4QDGA 2E56A 2M2DA 2FO8A 1JSYA 1R24A 3IXAA 4G6MH 2IDUA 5AG9A 3W5NA 3R8QA 1MHEB 3V6OA 1P69B 5T8IA 1SDYA 1QSEA 5JA9A 3LV3A 3RPBA 5D7JD 1JWMB 4G9FB 1H3TA 4G6AD 1UVQB 3CJJA 3MLSL 1EO7A 3RB7A 5IHBA 3K1KC 4KNQA 2WCSA 1UXSA 1GZHA 2OZNA 1TITA 4WSKA 5L9DH 4MMYB 3T4YA 3GRBA 3PHQB 3L3OC 5A16B 4PGJA 3ARXA 3L54A 5I30H 1RPQA 3WJJA 1RULL 4HK3J 4U3HA 4P2CG 5EU6D 3O0RH 1BYNA 3GSOB 3TNNA 1E7VA 2NDFA 2DI9A 1P5VA 5DD6B 3LXUX 1MJ8L 4JG5A 2NUTB 4LGRB 3FONA 3IU4H 1JK8B 1BEYH 2I25N 5F1KC 4O2FA 2X70A 3EDKA 2AZAA 3WUWB 4Z3FA 2PPCA 4OM0L 3RTQD 4NIYE 1MHPL 4HGWB 4IU3A 2X1OA 1TZIB 2IANE 1FYHB 4FLRA 1I85A 4O02H 3AREA 1M53A 3T4YB 2F54B 1LWRA 1Q0EA 3GBMH 1ZSDA 2YARA 4JMXA 3T6VA 4LIQL 3QXUA 4N0RA 3U1QA 2ESVE 2JE8A 4YEFA 5T1LA 1U58A 3WXVL 3IMUA 3B9AA 1BYOA 2XPZA 2WVVA 2N3JA 4OVVA 3ABLB 3FQXA 5DLMH 4B95C 5BUAA 5GGRB 2FB4H 4CMMB 4ELMA 4P9HC 4D3CL 4DWHA 2VZ3A 1SN2A 3O4LA 4PI0A 3OAUL 5DD6A 5I1CL 2VDNH 4N8VG 5HGHB 3N9GL 2DZEA 4B0MM 3FUFA 1R6VA 5AKTA 3D34A 2ZJSL 4MS6A 4ORGA 4X8CA 1KWKA 2ZQKA 5SWQB 4JCLA 3S97C 1MVYA 3CDYA 1MFAH 2QSVA 1MPAL 2B77A 3GLZA 3HPLA 5K9QG 2FEDD 1KF9B 2BP3A 4AGNA 5JW5B 2H47C 4HXAL 4PN6A 2WSDA 2FWLB 4YSSA 3QNFA 3VB9A 5JW3H 1QFWM 4NAQA 2YD5A 3QPKA 4G9DB 4FF9A 4Z3EA 3U9PH 3V0VB 4E68A 1H5BB 1BW8A 3KCPA 2DWYA 3TH2T 1X5AA 2VT0A 1J1XH 3HZYB 4GNKB 4JZNA 2FGWH 3EIFA 4OD1L 3REVA 3MRHB 4L3EA 2C1PA 4YDMA 3QCVL 3WDHA 1X7TA 4E36A 2CKBH 2WWKT 2ZIDA 4GRLA 4PRPB 5AOLA 3AGWA 1S3KL 3HN5A 3QJHB 2BHUA 3BIBX 5HTSA 5DUBA 3ZHDA 5C0FB 3KYOA 3G5ZA 4LHUB 3BPNB 3DTDA 3JTSA 4KDWA 1SOXA 4KFMA 2QVMA 4OF0A 2C9AA 4Z0XA 3NJXA 4X4YB 2XV2A 5IGXL 3QNYB 3WN5B 2AQPA 2DWSA 2EVGA 4FNRA 5L2KB 5CN1A 4FL4C 4ZMXA 5EC1A 1SDAB 1UD5A 1R9FA 1T6WA 1BYPA 2BVOB 2WMPB 3MJ8B 3WJMA 1ZE3H 1XGPA 1OSPL 2K7PA 1KB5L 2YBRB 4HJTA 1QRKA 4JKNA 4QHKI 5HVHC 1OAQL 4P4KA 1NCDL 1YEFH 1YN7A 3I02A 5T1DL 5HYFA 1AMXA 1SLXA 4RZCB 3TNMB 4CJ0A 1D5XB 4EI5D 4HU8A 1F6AA 2W07B 4WJ5A 3O2VL 3UTSD 4DT2A 5EBWB 3U4EA 2FX9H 4HGWA 4JPIB 3RVXD 2VXQL 2XQYK 3FH7A 4TSCL 4PJGE 3ARYA 3QXWA 4TQPA 5E9DB 3ZZLA 2VO5A 1W0WB 4U0QB 3UYRH 3CFCH 2Y1VA 4MB3A 3V5KB 1LO4L 4ZW6A 1G43A 2BVQA 1GMEA 1TSRA 1Q72L 2F9BT 3F7KA 3E80A 4NGHH 2EINB 2VXUH 2NXZB 4KQ3H 1J1PL 5FF6B 1I8LA 1FI8C 1OE2A 3D3VE 3UPAA 3EJYC 2NCEA 3SCMB 4R97C 4LHUG 4M56A 3TIDA 2WVUA 1NLBH 2JIXB 1XV8A 3OQ3B 1UCBH 4JQXC 2KZBA 1UJ3A 3W9EB 2UWEA 1S78C 4CBZA 2GTWB 2R8SH 2O5YH 3WEXA 1WD8A 2GUYA 4PJ5B 3S37L 3CN1A 2ATPA 5HGAB 1HEZA 3KPMA 2P45B 1AHKA 3AJ7A 4DK6A 5CU5A 2AKRB 3HPJA 1RJLB 4NHUB 4X5LA 4P5TD 4J1UB 2H32B 4JO1H 3WDIA 4M1DH 5E7BA 5GGSY 3U0TA 4G80B 3SBQA 1OTUD 3OTTA 4QYOB 3EDDA 4D8PA 1U95B 4TLSA 4IK6A 1GJWA 1FNLA 4HUXA 1MCCA 4M93C 5T3ZH 2J5LC 5CJXC 3UJJH 3GIVA 3LXBA 5CCJA 3FBKA 4NQCE 1XZ0A 3O3AB 1XF5A 1Y6MR 2BOBA 4RSVA 4EI5A 3IMTA 2X7LB 3BESR 1A7RH 4QKXB 3CDCA 4KVPA 4N28A 2VE6A 4YXLH 3UTSA 3VFNA 3CXDL 4N2EA 2X0VA 1JXJA 1ZTXH 1DJXA 5CP7A 1AVAA 1J9RA 4AYEC 2EDOA 3D1MC 2VDKL 1OANA 1XGQB 2VDPH 2BWQA 1R4XA 2Z92B 3X14A 1L6ZA 1RK0A 3EO0A 4PJGB 3SDXF 3WKML 4BFRA 4JZJA 4WEBL 2OX5A 4X8XA 3QJVB 1ZT7B 2A4ZA 1A6ZA 1U2YA 1DN2A 2OMZA 1IARB 4QRUA 5F88B 1V10A 1FNEA 3X11A 5E2WL 1K5NB 3UTZA 1AOHA 3ZGHA 4FA6A 1VDGA 2E9BA 4I48A 1PZ2A 3X13B 4J3OC 2BK8A 3BJLA 1J0YA 1HKLL 2WP3T 1NCOA 1QSEE 4DN4H 1BWMA 4ZPTB 4FOMA 3V6OE 3GWJA 4LARH 4K5LA 4UI2A 4X42A 5E6YA 1MJJB 4IMKC 5I1DA 5CSGA 5EBLB 1RU9L 2OL3H 2VISA 5E4IA 2RR3A 3EO0B 3GMNB 2A9NL 4PJGA 5AOJA 4ZUVB 5MEPA 2EDTA 1OPOA 4LO9A 3V0VA 5E1AA 5E8DL 1XFPA 2QHRL 3A0OA 1DJGA 3OXRB 4Y2LA 2CMRL 5DVOA 5AYQA 2CGYA 5HDOA 5ISZB 2ZCHH 2F19L 3PDDA 4RDQG 3Q06A 1Z6JT 3DX8B 1FG9C 4QY8B 1PBYA 5DZJA 2ZAGA 5ICYB 1KY7A 2G3XA 5JQ6L 3Q1SL 3G9VA 1AGEA 3APDA 5GJTH 1QX1A 3QWRD 2E4TA 3V6BR 4ALAL 5D5ME 2HKFL 2H7WA 3ABMB 5EHFA 4DEUA 4A6YB 2Y7LA 4UNVA 1F4WL 1P4IL 4BZ2H 1KFAL 2C8NA 3PAVA 3ARDA 3SN6N 1S9KC 2FL5B 5D1QA 2X2YA 4GMSH 5E94B 2V2TB 1FZOB 2HWZH 2NY1C 2MQCA 3NSCA 3NJHA 4BEIA 1RUML 3QIUD 4CC1A 3MPCA 4A7UA 2OMBA 2QPUA 4PGZA 1TMCB 3P4NB 3GF8A 5AW0B 4ZD3H 4B9CA 4PBXA 3HRPA 4X8JA 4X83A 3CH1B 4OIFA 1SZNA 3GBNH 3LKRB 2EE2A 2PW1B 4X6CA 2HVBA 1J8RA 3CWGA 4ZNEA 3SE8H 1BZDA 4M48L 5D1XD 3FO9A 1UYWH 2UZXB 3EH1A 1FWXA 3MUY1 4UT6L 1YQVL 1JL8A 3PGDB 5EO9A 2Q20A 3BSHA 4WV1B 4XP1H 4KTEL 5ABZA 2AKRA 3HPJB 4L3AA 3KL3A 5GRUL 1MEXL 4R7DA 5FV2A 1CE1L 1P6WA 3CD4A 4PYHA 2QQLH 5D8JH 4LLDB 4I0PB 1NMCC 5HDQH 2A74A 2HUEA 2Y22A 3Q13A 5D1QB 3OHMB 3ZE1B 4OLUH 5JHLH 1W2KT 4RGND 1T03L 5HJGA 1P9MA 3U82B 2HFFA 3WEBA 2EEFA 2OQJB 2ED7A 3KNBA 3F7PC 2MHAA 2X4TA 5TQ2H 3LN4A 1JPEA 4KKCC 3VB8A 4AMKH 3LVEA 3IETB 3EFFB 3H9SD 4LSUL 2CCVA 4S1SH 4XVUD 1FFRA 1UCTA 3RX5A 2BSTA 2ZG1A 3BX7C 3ECBB 1YN6B 1NANI 3FUKA 4KXCA 4P4KC 5L4MA 5A2CA 2C9QA 2L0DA 1ZT4B 3RDTC 4IJ3B 1I7TA 4H0HB 2MCPL 4PY8I 2D4DA 5D9SB 4ZBJA 4TNFA 1YC8A 4YLBA 1XSOA 1N4XL 3SSGA 1DQLH 2XKNB 3PDOB 1RZKH 3Q9QA 3SE9L 2X2JA 3V0FA 1HJCA 3O8XD 4LCWB 5D1XE 5F9OL 5GRJH 3RUGF 2G9KA 5F3HB 1MCQA 2FGWL 4DW2L 1KLFB 4P04A 3GZQA 3WMSA 4ZO7A 2ED9A 3U6RB 3WI9A 2V2XB 3FK3A 4JFHE 5DO2C 1A6TB 2VQTA 2BVOA 3IVKB 3QULB 1Q9LA 4IBSA 3UZVB 1DVQA 1K5NA 4MD0B 4Z7QF 2DLTA 1A14H 4U1SB 4GBXA 4F9PA 1OIOA 5IB2A 1DDHA 1L4IA 3BKMH 4XAKE 4QXTA 1B4RA 1JN6B 2R2HB 3IJ8A 4ZTOH 4C47A 4F93B 4F58H 1K2DA 1XIWC 4ZXBC 5EEWA 5GZOD 3HC4L 5E00B 2FECI 3STBA 2PWGA 5J9PA 1K5WA 2UUDH 2DM4A 5CSBA 3SKOB 4NO5B 3HB3C 2WGXA 4IRJC 2LLGA 2V5TA 1U3ZA 3VRLE 4FC3E 3C5ZC 5F3FA 5C09A 2PXYD 4FYQA 3IMBA 3ZE1F 4YWGH 5C8JA 3UTZB 4I18A 4EXKA 3E6FA 1PKQA 1BQLL 5E8PB 5B1JC 3WNOA 1UWXH 3WEAA 3N41F 1EDQA 3FOMB 1V54B 4KI1A 4WV1A 3GPEA 1OP3H 4ODUA 1IC1A 3PJSA 4LDCA 1EFXD 3ETBJ 1CIUA 4X6FA 3JWOH 3QXTA 1YY9C 3UJIL 1RUKL 4IBUA 1ASPA 3EFDH 3TBVA 3OKMB 3N9GH 2OMUA 3KGRA 1JPST 4K5MA 3MU3A 2FBRA 4RQQA 5EU7E 3TPKA 3GSVA 3K80A 2VJ0A 2NYZA 3O6KH 3QEQD 4ETQB 3ZT6A 1XCWA 1BD2A 1QNZL 3FQ2A 3S9DB 1LP9B 1RPUA 4F8NA 3LH9A 4CMMA 4ELMB 4PVBA 4Z8FL 3U9WA 3TC9A 1AXIB 4DHLA 3QSKB 3QDMD 1BVNT 1AP2B 2H4EA 1U6AH 4L4TA 1C08B 1NCBH 4E9SA 2TSAA 4GBXD 4L1LA 5IFAH 4W6XB 2DQUL 2F5BH 3WNNA 3BP4B 3DLQR 3EYQC 4JFFB 3AREB 3LIZL 4AQOA 3HG4A 2VKWA 4ZS7L 3HZ3A 4NN5C 5J5EA 1SRDA 2EIZB 3V5KA 3KXFA 5FCSH 4LT7A 1CDUA 1CXEA 3WV0A 3RNQA 4X8JB 2F1EA 1GW0A 3U48A 2FZ3B 3P9LA 3O41A 2C3VB 4GQPH 2X05A 3S6CA 1MJUL 3WEOA 4L5FL 5HD8C 2WB7A 3UBGA 1ZTXL 3B3IA 3C2AH 1PG7X 5GGTH 4ODXB 3UOAB 2HA1A 3SKNB 1QRND 1IGML 3IXTB 1OQXA 2HT3C 1XGPB 2BY3A 3FT4B 2H6PB 2CO7A 3QXVA 4WI9A 1QBMH 2CJSA 1RIVH 2GHZA 4W9EC 2DWEB 3AW5A 1N59A 4JFQA 2D3LA 3HHSA 3LQAH 4G9FE 4UZSA 1UXSB 2EIMB 4MKTA 1P6FA 2YPLB 4I5BA 2B1AL 2DOCA 1JZJA 3PDGA 2I9TA 4PRPE 1NCDH 1YEFL 3ESUF 1OP3K 3MLUH 1FNGB 1P84J 1SEQH 4MCYA 4OAWA 3M1BA 2NXZD 5MP6L 3PU7A 4UT9A 1VZGA 5G5DB 3X3GL 4XMKL 2NZIA 4P8QA 2EXWD 4POYA 4Z7OF 4IKKA 4ONGL 1OAYH 4AIXA 3GI8H 3EGXB 4ZW3A 2XVGA 5J8OA 4J3OG 3QK0A 2ZXBA 3C5XA 4OGYL 3FB8A 4U6VH 3EJSA 3S2AA 4CVWA 3UBXI 2D3JA 3N1PC 3ZL1A 2WXPA 3AWGA 4LSPL 4PLJC 2PO6B 3A4DA 3C5SA 3WIHA 3QUGA 3VXMA 1C8PA 4YVNA 4G6FD 2WLKA 4N6RA 3TJPA 1IZKA 2PWHA 1ZE3C 3P0VH 4OIIL 3HE7C 3BE1L 3A22A 3BZFB 3IPBA 4POZC 2A74C 2WXGA 3MBWB 3NEEA 2A9BA 1DLFH 3T3MB 5IB4A 4F37F 3GLEA 1QWHA 5G2NA 4UQIM 5CLTA 4X6BB 4JAMB 1UQSB 2B3RA 2WVSA 1QTSA 3CMGA 3HS9A 1A7NL 4MMXA 1QNIA 5D71H 4WGKA 1LDPH 2VR9A 3E3QE 2FQDA 3KHQA 1IBDA 3KPQA 3FQRA 4N20A 3CBKB 5DHVB 4HIJB 4GO6B 4YDKH 3GJFK 3QUZD 4X7TA 3ZHLA 4L8CB 2EQDA 4UM8B 4FQQB 2D2CC 4GKNB 1TPXB 1VCAA 2FEDC 4LNVA 3UTSB 5I17A 1MJ7H 4UQEA 4N85A 5GQBA 1DVYA 4XPTL 5JW5A 1U3NA 2VDMB 1W72B 1TZGH 2VDOB 3IMVA 5DLML 5H37H 2XPGB 3PWVA 2GIXA 3U0PB 4KROC 1WISA 3E0GA 2YPKA 4OM1H 5HHPA 2XNAB 3HFML 3M07A 5JIPA 4HKZA 2QZQA 2V17H 4P2OD 4BFJA 5HYQB 3GSXA 4JL1A 4Q6IB 3S5YA 1U92A 3NCBB 4PJCB 1KXVA 1FRGL 5HHNA 3T4AC 2ZYHA 5HDQL 3OKEB 1BJ1H 5DT1H 3IE4A 3ILDA 1SM3L 1RJCA 4GRWF 4P2RA 4QR7A 2KPWA 1SQ2N 1JHKL 4HF5L 5E2JA 1SLUA 3SDXE 3OKMA 2CLRA 3ARDC 3PAZA 1JXGA 2XCMC 5T3ZE 3I9AA 5TDNB 3CFEA 4LAQL 4JDTH 5E8OB 4WK0B 3TCTA 4NHCH 1G4RA 3L5WB 4OZHB 5D1QE 3VFGH 2IBZY 3Q5YA 1NIBA 2IO5A 1PY4A 4FP8H 1Q94B 2WMPA 3E8VA 3WJMB 3BEWA 3GHBH 3S34H 1MCWW 3ULUD 2AJXH 5HHVL 1JV2B 1ZTXE 1JZ3A 2P52A 3NPSC 3IGLA 5F3BA 3TO4C 3CU7A 2WK2A 1RIHH 1FL6B 1GYCA 4NUMA 5C0NC 1KIRA 1IJ9A 4YDIH 3ZYIA 4Y7MA 1NKOA 4K7PX 3JVFC 3GSNB 1HZKA 4V11A 2QSQA 3D4YA 2NY2C 1EJFA 3OSKA 5ECGA 1WTGT 1QFWI 5F9OH 3JSSA 5GRJL 1JI2A 4GXUM 5EN2A 2XZAL 5DMIH 4JY5H 4HKXB 1EXHA 1QRNA 3LMJH 1ETA1 5D4HA 5EIVA 1BVKB 5C0JA 1DVFC 2JTDA 4YDVB 2Y7QA 3PWLA 1A9BB 4YFLF 3V5DB 5L9DL 3S96B 1OLLA 1OAQH 3N5AA 3ESNA 2QQNH 3SDAC 3WFEL 1XH3B 1PZAA 1XF1A 4L9LC 1KLGA 3H3BC 4ZFGL 4WI0A 2Y3AA 4UQAA 2FQFA 4GAJL 4ZAKD 1MVFA 1JG9A 3FTWA 4ZTOL 4FULA 3D9AL 5IM7A 4ZMAT 5I1JH 1KB5H 5FYKE 3BW9A 4Q6IC 4A2FA 3Q7JA 3BD5A 3REVB 3PNWB 2FBOJ 4JY4B 2D7QA 5HXMA 3AXLA 4ATTA 3WTYA 1KTDA 3ARSA 3U46B 2F2HA 4G72B 3EH5B 4PJCF 3HN8A 3B56A 1H3UA 2YA1A 3B9KA 5HHOD 1MIEH 2WCPA 4NZRL 3JUZA 3MMEB 1QTYT 2H2PD 1JFQH 1HHJA 3KWTA 4PJEE 2P42B 3X1GA 4JMNA 1AE6H 3LEYH 4XOBA 3I9IA 5EZIL 2BIMA 2VAAA 5DJ6B 3WXWH 1CFSA 4AITA 5FCUL 5I1IL 4PJBA 1RZJC 1RK1A 3LEVH 2CCWA 1TVDA 3IDMA 4NO3B 4TLKA 1IGTB 3PS6A 3TJHD 4W4NA 3P2DA 1OD7A 3LNHA 1HKFA 2EACA 2YC1B 2CM5A 4XP4H 3STZA 5KOVC 4XX1E 4XN5A 1PU0A 5E9NA 5J4MA 2VMEA 3ARFC 4QRTA 1U8IA 2HKHL 2IBZX 1Z3RA 1HX0A 4P99A 1JTTA 4P07A 4BDVA 2VDLH 32C2B 3O9WA 2EEXA 4YHML 3KPTA 4Y4KB 1S9WA 3DPBB 3Q9PA 4KPHL 4L29A 3FN9A 3EDJA 2D73A 4PJFB 1ET5A 4UAOC 3UGUA 5F0JB 2WKOF 3CDGA 1HXMA 3IS0X 5D2LB 1DJSA 5IREA 1CICB 3KYNA 3II3A 3PABB 4WTZG 1MW3A 5KVEE 4JW3A 4X7EC 2NQDA 2R27A 1B0IA 4PCKA 1UT1A 5HHOE 1SY6L 4KTDH 3S3SA 4XNUH 5LBSH 1OGTB 2DIBA 2YD8A 4OCSH 4TUKH 1I9EA 3QIBC 4Y2NA 1SJVA 3RAJL 4Y4FD 1B88A 4WW2C 4PIBA 4K8RH 1RZFL 1IC4L 1NGQH 3SZKC 5CLYA 4LOUD 5KJRH 2CR0A 4R5XA 2WYTA 1N8ZA 2P5EE 3U36A 4OF3A 1QPXA 3HHRB 4XMXA 3N0PB 2BZDA 2PN5A 3Q1SH 4PYGA 4AK1A 3RVTD 2YQGA 1UWEL 4QI3A 4JR9H 3RWCA 1X5JA 1CDIA 1E2VA 2V3FA 5CZRA 5FGCB 1BEYL 1RU9H 2OL3L 3H2WA 5E6IC 4D9RE 4JDEA 3FTSA 5BO1H 3C6SB 1KPVA 1KFAH 4QXGH 3KBPA 4NQVA 4C58B 4LLUA 2PCPB 3TBTA 3VXRD 2J44A 2XTJE 3U6XA 1EO8L 2ADJA 1HKLH 3E6HB 3OLIA 2DLFL 2J8HA 4BQ8A 5KYYB 3DYOA 5LO7A 3GUTB 3EW3B 5C2BL 4IRJA 4BE5A 4YNYB 5GGQL 4QXTB 1FAKT 3EYOB 1NUFA 1OCCB 4MTMA 2F5AH 1INQB 1NCGA 4ZO6A 2F53A 5FYKH 3UTPE 2ESVD 3VYOA 3GJFH 5MEQA 4DIXA 5JHLA 4XXCC 1H3WM 3L9EA 3WUWG 2CMRH 5SWZE 2Z0UA 5CEXA 4R8WH 1DDTA 5I1EH 3NGBC 2J1KA 4JM2A 1KN2L 2K3HA 3GMQA 4IRSC 2D0HA 3IJEB 5B4MC 5FUOL 4H1LB 5JQ6H 3MCG1 1IBGH 4JFVA 4LP4A 5GJTL 2WLZA 4DGIL 5ILTL 5F7EL 1QLFA 2GPZA 4NN7C 4Z77A 1JHTB 4N68A 4RIRA 4U7MA 4I89A 3VFMB 5DR5L 5L0QB 4FI7A 3U4AA 3SPVA 5F7WC 3IJHB 3S37H 4IRSD 4S1RH 4XRCA 1KGJA 2WP3O 4W4OA 4GS7B 3V55A 3T6WA 1GYAA 3MYJB 2DYRB 4XMUA 1J86A 2QVFB 3R06A 4M6OL 3V0WL 1SJXA 2ISDA 1XXDC 1NC2D 3OZLA 4DESA 3CZLA 5LBSA 4R90H 4RWYL 3QO1A 1CDBA 5I5RA 5I6PA 4JG9A 4ODSL 3LKQA 4IHOA 4HC1H 1JGUH 1NMAL 4LHUD 3AT9A 3W82A 1MW0A 1HAWA 3ARFB 3O2DH 5LN4A 3ETTA 5CSZB 3ZKNC 4I3SL 3ARBB 2I7OA 1NBYA 1YPZB 2EO9A 5DRNB 2J4WH 1CD8A 2HG0A 1ZV5A 3C2AL 2WZPD 1JXKA 1W0VB 2COVD 2Q6WB 2XIDA