3IE4A

B-glucan binding domain of drosophila gnbp3 defines a novel family of pattern recognition receptor
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
101
structure length
101
Chain Sequence
YEVPKAKIDVFYPKGFEVSIPDEEGITLFAFHGKLNEEMEGLEAGTWARDIVKAKNGRWTFRDRITALKPGDTLYYWTYVIYNGLGYREDDGSFVVNGYSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The N-terminal domain of drosophila gram-negative binding protein 3 (GNBP3) defines a novel family of fungal pattern recognition receptors
rcsb
source organism Drosophila melanogaster
molecule tags Immune system
molecule keywords Gram-Negative Binding Protein 3
total genus 18
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2140 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3ie4A00
2KHAA 3AQXA 2RQEA 3IE4A 3AQYA 3AQZA
chains in the Genus database with same CATH superfamily
5DHEA 2PR4H 3HE6D 4ZO6A 1I85A 5EBLA 3FT0A 3SD2A 1MAKA 1EFXA 2AXGA 5T3ZD 1K8DA 1YUHA 2G4EA 5B39G 1CF8H 1A3LH 2YC1B 3EYFA 3REWB 1S7TA 1E40A 1G7HA 2BY0A 3MV9E 4FNSA 3QAZB 5I18L 1LNUB 5IMKB 4OF8A 5DMYA 3Q1SH 2N7SA 4Z5RB 3RRQA 2ZAIA 5I23A 2Z1PA 1NAMB 3ESOA 1I1CA 4GBXC 1S9XB 1SJEB 2ICWB 4MCYA 3D85B 2DQIL 4MA1B 1FLRH 4R8WH 3VRIA 3CDFA 3KS0H 3NJJA 5I26A 2VLMD 4ZO9A 2F2HA 4XO8A 4NGHH 3VD3A 3W0WE 4HWBA 5FGSA 3NACH 3EOYG 3S37X 1ZVYA 2YS4A 5ID1A 1I53A 3VGAB 3H2PA 5E94A 4R0LB 1DQDH 4WWNA 5AL8A 5KSAD 4NO3A 4X6BB 4MAYD 3LIZH 1DJXA 1S78D 1M7DA 2P48B 3LKOA 5IIEA 1PY0A 4WFHE 4Q0XL 4PSPA 4PS4H 4GG6F 2CNYA 2ZXEB 1QTSA 1QFWL 3OKLA 1FGVH 3AADB 3RTQB 5L9DH 1KB9J 1II4E 2AEIT 1E6JL 2C4XA 3TN0D 3WIHH 5IHWA 3G3LA 1M3IA 35C8H 3IRCA 1CDUA 5FYKU 2OW7A 3BLPX 3GHBH 3MGTB 1I7TA 3UC0L 4G1EB 1QFPA 3UJIH 2BSDA 1XCWA 3ISYA 3K8KA 4JZJA 4PP1D 2ZG1A 1HI6B 2R1XB 5DJXB 5C97A 2OI9B 4HGWA 1RJLA 2P8MA 1S7UA 2NZ9D 3FPYA 1KTRL 5DI8B 1QNZL 4YSTA 3OJ2C 2ZF8A 2ZXCA 4BINA 5I8EA 1JWSB 1G5GA 4N1EA 4Z7UF 3CFDB 4JO3L 4J6RH 2NXZD 5E8PA 1EZLA 1TZGH 3NYKA 5BV7H 5ESQB 1KXTA 3S37L 4Y88A 1OAYH 4XBPB 4ONGH 5BVPH 4H1LH 4AWJC 3DTDA 3U1SL 5MENE 1M71A 2I25N 1OTTC 2WP3T 1QO3A 4I18A 2B14A 5KYUA 1EBPA 1UM4L 4GRWH 1F41A 4TLKA 1SDDB 5FYJH 1N68A 5CS7A 4PVMA 1LWJA 4IM8A 5CXPA 2FD6H 2R0KH 2OMTA 3IK2A 3R06A 1BYOA 2F5AH 3LNEA 1ADQL 4GXVL 2FWLB 3HS0B 3MV7B 3ARRA 1SM3H 5D71L 4ZMQA 1MIEL 5C2BH 4AZUA 2WO2B 1YUKB 3KYKL 2C7UB 2D0FA 3B1UA 1BVNP 3EJRA 4FGMA 3AT8A 2CLZA 1MNUL 5GZOD 3UTSE 2IH3A 3H56A 1LL1A 4KKRA 4O2EB 4JM2A 4UTBH 5K9JH 2V5YA 4ZW7A 3J7HA 3FCSB 4LBEB 1LO2L 1MRCH 3GSOA 4Y7OC 3BGMA 1HL8A 1GHFL 1KZYA 1OIOA 1AR2A 3MLTA 4RWYH 2K9UA 2CKBH 1G9EA 1L9SA 4LCIL 1W0VA 3K6OA 4M6ML 1U2YA 3MRNB 3TIEB 3ULSB 3QYMA 3VWJC 4ZS7L 1DBJH 2CO1A 2AVGA 5I5RA 2YD0A 4XI5D 2YMOA 3B2MA 2EDEA 4JR9L 4GO6B 3WXWL 4HKZA 3EOTH 2B39A 4LIQE 3WSQL 4G7YL 4GP5B 2C4FT 1AMXA 1JG9A 4OCYH 5EBMA 2JELH 3QHZH 1G4MA 3EF4A 4IBLT 3O4LA 4GXFA 2J5LB 1T3FA 3KYMA 1JIBA 4ZTOL 4Z8FL 4L0PB 5DT1H 3SQBB 4UT9L 1G9ML 1BPVA 2VZ3A 3MOAH 3BVWA 1LWHA 1HCFX 1E5BA 2OMZB 1R3KB 2DYPA 2QPDB 4AE0A 5CMAB 5ESQA 1GJWA 2VUYA 4LDLB 4BKSC 1FG2A 5E5MB 5FCUH 3D69A 3J07A 3ZHNA 5GGRY 4YS4A 1UT1A 4JUTA 1H8NA 5KSUB 3AQZA 2BCKB 2WNWA 4B50A 1D6VH 1Y1DA 3HUJE 2E59A 4LBAA 4PY8J 1I1YA 2BJML 4HC1A 2D7OA 5JA9A 3IDGB 2L4OA 2HUEA 5FECB 1JJUA 4JPSA 3IDXL 3NGBC 4LCWE 5GS1C 4A1RA 5ITBL 2R0ZH 3HVDA 1R3JB 1T6VN 5IROA 3U30B 2QQNL 2KYIA 3IN2A 4YIQB 1JZEA 1AZUA 1UB6A 1FAIL 3MRRA 3PQYE 1A3RH 3RI5K 2XETA 1VJSA 5GS2H 1U3ZA 2XVBA 1UXMA 4P5KA 3SDCD 2V0AA 3WAKA 1F45A 2NZIA 2DQHH 2OLDA 2IDCA 1KTDB 2PO6C 2NY1C 3MCG1 5F7DA 2UUDH 3FRUA 4WENB 3OAYK 5EZIH 1J9RA 4AIZB 1X5MA 4BZ2L 2PN5A 4FCAA 4N6RA 5A2FA 5JIKA 1ODUA 4J8RA 1MVUA 2NY7L 4M4PA 4ZMXA 1CTMA 1CDJA 1IRAY 3EH3B 3D0LA 3DXAB 4HJSA 1DJZA 1KC5H 3SQOH 3ZE2F 1HHGB 3KXFA 4N0UE 2VXQL 2IALA 1CQKA 4F2MB 1KWKA 1C5CH 3NOIA 1VEMA 3CWGA 5B1AB 4YHKH 4NUMA 4GEIA 4UB0L 1FC1A 4P5RA 2MH4A 1ZK9A 4BQ8A 1TLKA 4HKZB 1PZ5A 1FL3B 1WS7A 5DDHB 1NCDH 3MUHL 2WLHA 3L9YA 5I6PA 2OP4L 4EI5A 1AZZC 4KHXL 3PQYD 4KJWD 3FO1A 4WFGD 3PABA 2ZQKA 4O00A 5KWYC 3Q2WA 4K23L 5D2NE 1A25A 4O5LL 2IFFL 1CMOA 3HI1B 3DMMB 4NRYA 2GY5A 3B6SB 4K9EH 3SPVB 4KDTA 1TYJA 3D51A 3TWYA 4K3JH 1SBBA 4Q56A 4ZJ9A 4WW1A 4MA3A 1AD0A 1MWAA 4Y89A 1I1YB 2PYEB 5IGXH 2EO9A 4BM7A 3UZVA 3V9FA 1GMIA 2HT3C 1H3PH 1V7NL 4WEMB 3HLAB 5DVOA 1DJWA 1JDDA 5DJ8A 4M6NH 4Y2LA 4LQFH 1U8PA 5EU7C 2GITB 1J8HD 3QNYA 5IFHL 3SPGA 4UTBA 1GRWA 3V6OE 4L1BA 3OF6A 1YJDL 3RP1A 2OSXA 1MCFA 3E80A 5AZUA 4LPVA 2PWHA 2EIDA 2EYTB 4Q52A 5CP7B 5C07A 3C08L 4DT2A 1IMHC 4C59B 4ZFGH 4JKNA 4RGOH 5EA0H 5AAWC 1KTDA 2HH0H 2XNAB 3D6GA 3M1BB 4ETQA 3IDMA 1ZANL 1OSYA 3MLXH 2WXLA 2YJQA 4ORGA 3FU7B 4KGJA 3FCGA 3FF7A 4UV7H 2XG5B 3IU3A 1I7ZA 3F85A 3QWNA 1A7RH 3IDIA 2G9KA 3T0BA 1RUPH 2JJSA 5CUSL 4GRWE 2WQXA 3QHTC 4Y5XA 3ZU8A 3MLWL 3PNWB 3MBXH 4XCEB 3QUHA 3NAAL 3KM1A 5DMKB 1JF5A 3CC5A 4OCLC 4X6CE 5L4MA 1P0SE 4JHWL 4IBWA 1CK0L 3CBRA 5KJRH 1ZE3H 4G80A 3P2DA 1ORQA 4GKSA 4ZD3H 4ERSL 1HC1A 1I7UB 3VI3B 4P2RE 1KB5L 3BPNB 3C09C 1KCVL 4H5SA 4M1GH 4OQTL 1CLZH 2XTJE 3IFLH 3CH1A 2JB5L 1Z66A 2DM4A 4FG6D 3RZCD 5GS0H 3O3DB 4YWGH 1KIUB 2PYFB 5D1QA 3ETSA 2JXMA 4H8VA 3D39D 5A16A 1IM3A 1AXSA 1IT9L 3HHSA 4S10A 3RDTA 5KUMA 3L4ZA 5FUCE 1AY1L 3Q6FB 3T5WA 1RU9L 3QA3B 4AGMA 5JW3H 2Z31B 4O2FB 1F42A 3NH7L 3DYPA 4LT7A 3S4SG 1ZHKB 1ZT1B 3MDJA 2J1YA 1L7IL 4U1MB 4UQ3B 5FV1L 3LH8A 1S2EA 1X5IA 4JM4L 4X9GA 1JI1A 1RUQH 4OT1L 2D7TL 4AQ1B 1DR9A 1E4KC 1YPZA 2P8LA 4PWJA 3WTTA 2VQTA 3VXSD 2VC2H 5C0AB 4XE5B 1MIML 1OL0A 2JI2A 3JXAA 2XZQH 2XT1B 1YQVH 1WFTA 4W70A 4OW6A 5FM8A 4FG2A 4UQEA 1HZHH 5E2UL 4DKFL 1DDHA 1NIEA 1DQJB 1GGIL 4N2CA 4HBCL 2FSDA 1CG9B 1ZWIB 4XPHL 3SE9H 3B2VL 2ENSA 3GSVB 4HWBL 1MCRA 2VLLB 4GBXD 1Z0MA 3GJFH 2E6QA 3FN9A 2WTRA 4Y1SA 5DYFA 5GRJL 4BFIB 2ADFH 1MCSA 2VN6A 1ROWA 1GGYA 5LXVA 3GRGA 2XDHA 4OD3H 2WIIA 4PMFA 4RAUB 4LU5L 2WN3A 3WUWG 3UZEC 1NJ9A 1PS3A 2W60B 3I9GL 1I8IB 2Z4QB 1ORQB 4GKSB 2PR4L 4QHUB 2NNAA 5FIEA 1E27B 2BDNL 1WLHA 1J1XL 4ZTPH 3WL9B 3ULUD 4GH7B 1A3LL 2AANA 4M61A 1UWXK 3DX6A 2FSEB 5DO2D 4MA8L 3D08A 3X14A 4FTVB 4MX7B 5I19H 1VFOA 4NQCE 2K0RA 3RWJA 4BFKA 2JXMB 5A16B 5IB4A 3P73B 2N3JA 1XEDA 4M7ZC 4OVVA 3V7AG 3W11D 2OMVB 2R1WB 3DETD 3L5XL 4I85A 3PWNB 3TA3B 3RA7H 2IBZX 3CH8A 4YDJB 3H2WA 3LTVA 1G7PB 1IC4L 4XCCL 4XH2B 3BT0A 5K1NA 4JZJC 4U2ZA 3PHQA 2VAAA 1AR1C 2A0LD 2NPLX 2AEWA 3G08A 4JZOB 3VGAC 1FL5A 1IFHH 1T6BX 1JWUA 1T5WA 2WM0A 2GSMB 4MAYA 4NN6B 2VR7A 1HHKB 3ZZ1A 3JTTB 1E2ZA 3NCYS 5F88A 2WWMD 1MJUL 4KJPC 3VRIB 4OM0H 2ZX5A 3RX8A 4F9PC 3DOSB 1KULA 3QVAA 4XB8A 4S1RH 4QYOB 1P7BA 1DJSA 3DECA 4GBXB 3KCWA 4GAFB 1S7TB 4M8RA 2PXYB 4OLVL 4WHYG 1FCGA 4HHAA 4I9WD 5T1LB 2WYZA 2X2YA 5FOBA 1N2RB 3HE7C 5JHLH 3ZKMC 2PTVA 1E6JH 2DLFL 3LRGA 1FORL 5CR8A 4CSSA 2FLBT 5FB8B 3ZHKA 3KPSE 1XDTT 2MKLC 2YGOA 2B15A 3CPLA 2WKGA 3QXTA 4CC0A 2O30A 4L8SB 5GGSY 1MREL 1PL3A 4XVTL 3BLBA 4Y4FC 4Q89A 4F7MA 1H6FA 2E7BA 1QNZH 4Y2DB 3ZIYA 5JPMB 5IFJA 1I8LA 3WNJA 3VUAA 2NNFA 2GUOA 3FFCE 4YL9A 4LPUA 1ODAA 4OAWA 5EC2B 3W82A 3IJYB 1U4EA 3MJ8B 1I1FA 1A9BA 5FXCH 5BZWB 1BLNA 3CFCL 5DI8A 3Q8BA 1T1WB 3SGKC 1DLFH 4FMKA 3G04A 4K9JA 4MXWL 4OD1L 1WVZA 4E5XG 4F7KA 1JYXA 3T8XB 3UGXA 2EABA 3VRLF 3B9KA 1Q9WA 3RWIB 3P4MA 4G8GE 4RA0C 3EOBA 3QDMA 4GQPH 4P5TB 3FSZA 1B4JL 4YDJA 5AW4B 5KYUB 3JTBA 2O61B 5G5DA 5KVGE 1PYWB 1OT4A 3P30H 1CL7I 5EO1A 3B8YA 1N9PA 1JV5A 5F71A 2Y36H 3SJVE 5IV2B 1OAJA 2DIJA 1D5XA 3ES6A 1IAOB 1T4KB 1THAA 1NGXB 4Y4KA 4AH2B 4ALAL 2DH3A 5TDNB 5A2KH 1F4AA 2CJ3A 3WCYA 5DJYB 2BNRA 2NDGA 2J43A 2E27L 4IQHA 2EIKB 4HXAH 4XNZC 1LP9A 5F1SA 5T3ZE 1CQYA 3I9IA 3WEAA 3DO7B 3L5HA 4B5ZA 5E8PB 3AAZA 5DEGA 3LNIA 4U1SA 3BEWB 1J8HA 2PPFA 3EJPA 2ZE0A 3QUYD 2CKBL 4N25A 1ZA6B 1M57B 4EZLA 4QT5B 4YR6B 1IBGL 3QIWC 4FULA 4GUCA 4I2XB 4Y2DD 1DBJL 3IU4L 5HSFA 4GSUA 1I85C 1N67A 2AMGA 1XF5A 1COBA 1FQ9C 1O9WA 4PJCA 3ZZSA 5JPNA 3VXNA 2KZBA 4K8RC 5AW0B 2ZOTA 3KGSA 5T1MA 3BEVB 2JTYA 4HZ1A 4GW1B 4IDJH 1H3VA 2EYRB 4K8RD 4HIXL 2W8CA 4LL9A 1U6AL 5E56A 3QIUB 1QRND 2A6JA 1OF0A 1XB6A 5B3SB 1OCWL 4HJ0D 2C3WA 3MUZ1 4OM1L 5D6CB 1RIHH 5FA3A 4A55A 1HSBB 1CLYL 5DUJA 4ZW8A 3ELAT 1UCBH 4LKXA 5T1LD 4JFTA 4NP4L 5AB1A 5L0QB 3QR1A 5C0AD 2YD6A 4H1LA 4I3SL 1YY8A 3H4HA 3B2PA 2OYMA 4FFWD 3B9EA 3FZUC 4YXLH 1T2JA 3R19A 3PWJA 2XXFA 3CZEA 4KK6C 3ORJA 1NAKH 3FTUA 3OMZA 3P0YH 3B5HA 4V33A 4W9EC 3OR6A 3APCA 1FNGB 1IFGA 2YZ8A 4FLSA 2X70A 4TTDD 5DUBB 1MJJA 2XWZA 3HRZC 3CPUA 4L1SA 3UEZA 4UNTA 3MBWA 5E5MA 2NY3D 2X1OA 3HZVA 1DQVA 5FYJD 1JGUH 3MYJB 5GRYA 5I6MA 2APFA 4XP6H 5H37H 2YRLA 1DFXA 1QLFA 2UZXB 1N3NA 1UYWH 2Y5EA 4JZNA 1ZPLA 2DD8H 1AG0A 3SOBH 1N6QL 1RURL 3O4LB 2H45A 3RWDB 4LO9A 3WNKA 4MAYC 1U93B 2AMUA 5BZZA 4WJ5A 3VA6A 1Z9SA 3BN3B 3RYMA 4BZ2H 3P4NA 2Z9TA 4MFHA 4XHQA 4U1NB 4XC3L 3PV7A 1C1EH 2H6PA 4JPWL 3PU7A 4EDXA 5F7LB 1EDQA 4FNUA 4HG4J 4LFHG 4NQDD 5B21A 3JT0A 4P2CG 4YLBA 4XRCA 4K3DL 5CM1A 4JO2H 4JFOA 3IS0X 3V0FA 3PDOB 5I5MA 4J8RB 4FZEH 4J3OF 3KJ6H 3FU0A 5HVHC 4X99B 2ZJSH 3FCTB 1N10A 2J8OA 3L7EA 1AGFA 3KXFB 2R0WL 4DP4X 4KTEL 4NZRL 3QO0B 1S9WB 3TO2B 1SXCA 1NGYA 1KENL 3BWZA 5KVDL 3CJJA 3ZT6A 4W9KC 1WISA 2WJ5A 4ODSL 4X7FC 2DWEB 4OJCA 2BSRA 2P5EB 1AZBA 3FDWA 1AO7B 2BVOA 1FRGH 4KVCH 4TUUA 4XPTH 5ANHA 3BVTA 3V0WL 2ZKYA 1R3LB 1VFMA 5IBTL 5EO9B 2F8OA 5A2IH 4Z3TA 5JW4N 1T0MA 3ARZA 3RJQB 4HIEB 5J3HC 2X4QA 2NTSP 1I9EA 4J6IA 4C4KO 1BD2D 5ERWB 4YHNA 5T5NG 6CGTA 3CZSA 1XIWA 3QWOB 3ZVVA 4Z7OB 4I77H 1J05B 3TTYA 3D06A 1C5DB 4LGPB 5D1ZC 2OYLA 3VI4F 4N2FA 3F58L 3ZIMA 1KJ3H 1U8QA 1MCOL 2H47C 2F6AA 2J1KA 1FL6A 3QIUD 1OB1B 3PF2A 4B41A 5IW6B 2PTUA 2VXVL 3UFIA 4WW2B 4XNMB 2ZKMX 3MYJA 1I9JH 4Y5VA 4DAGH 3I9AA 5AVSB 1UXWA 1JUFB 3GINA 3JUZA 4MD5B 4X5XB 4DN3L 1WT5A 4CVWA 5I73B 1VCAA 2EDFA 4GQQA 4Y9EA 2P8PA 1CN4A 4HAKA 4OV5A 4H26A 2PP9A 5DURD 3OQ3B 2D9QB 2GIMA 4OGXL 5DVKA 5AG8A 3IETA 5CEYB 1BV8A 1MJ7L 1TQCB 2A3TA 4G43B 2WXJA 1SHSA 4AEHH 2V3FA 5D2NA 5KG9B 3IMBA 1HYSD 4NBXB 2IXQB 2BP8B 2F61A 5GRUL 3ZK0A 4ZW5A 2E0PA 2UX6A 4DP5X 2BOBB 4PRIA 5D7KE 3BP5B 2VLKD 5IFAL 2A1WH 3OSVA 1KJMB 1KJVB 1JXDA 4LLWA 5J6SA 4EBQL 2HJKB 2R2EB 2XVKA 3T4YA 3T0AA 3BE1L 4MRCA 1MRDL 3NMEA 3UZVB 1QLEH 1XCQB 5FM4A 5KBLA 5EIIB 4DP0X 4HH9A 5J1AB 1PMYA 1NWPA 3CZUB 4B96A 4FNLH 3WTVA 1RZJH 4RVBA 5GSVA 4OCWH 2MTPA 2EE9A 4TSCH 4U6YA 4AVHA 3QDGA 3WHXB 4MLIA 5B1KA 1LE9A 4Z23A 3VU1A 1JHKL 1P4BH 5C08E 1CE1L 3WFEL 1RIUL 4A6YA 1ASPA 5EEUA 1Y6NR 5E2TL 1JXGA 3CZFA 3CHRA 1OP4A 2UZYA 4WNSA 1FFPB 2IANA 3VRJA 2AGJH 3U4EB 1P5UA 2BHFA 3KWXA 2UWEA 1KIUA 2PYFA 4KUCF 1OCOB 5D1QB 3V0AC 1JPTH 3ASWA 3MU3A 4I0PD 3UAAA 3QDJB 3HCVB 3COOA 4GXUM 3WXVL 1OSZA 3G6JA 4BA8A 4HCRA 4YDIL 1DVSA 1GYVA 5AAPA 2FEEI 3O6LH 3BHBA 4FXKB 3DUSB 3EIFA 2WXGA 3EW3B 3S8FB 1NCCH 3LH9A 4C56D 3D33A 1CVRA 1NFIB 2FO4A 2DN7A 3EZJB 1KGCE 4G80B 4U33A 5I5JA 4OZFA 4R7XA 3RUGE 1KBGH 3TCLB 1BVLB 2XX0A 4HKJB 5EN2B 3MCLL 5GGQH 3TVMD 1QYGH 2CJTA 2AQRA 1GGIH 1HKFA 1W8NA 1QHOA 1XGQB 5DHVH 4BSWA 5DEFA 5DYOB 2FBJH 3WJLC 2CALA 3P2TA 2V2TA 1U8OB 4KK8C 3T0ED 4CGUB 1KGYE 2IPUK 1MNUH 4F8NA 4AMKH 4G8FB 1JZJA 4OIIH 3QQ3B 4H88L 3NRFA 5JOFA 3EYFB 4M7JH 5IMMA 3OHXA 4G1MB 4BWUA 4L18A 1XMWA 4ANWA 1W91A 1D6EA 4JS7A 2HJKA 2YKLH 2LVEA 4OTXH 1DANU 3SKUD 4YSDA 5DJAB 2VLME 2ZUWA 1GGCL 4A7QA 3ATEA 4H20H 1MCQA 1HT6A 4UIKH 5LBSA 4ZO7A 1T2QH 1LDPL 2H1PH 3FN3A 5FO9A 3KJ4C 4JW3A 4KRPC 5JZ7D 1S9VA 1MFAL 4U6YB 1QA9A 2R29L 1M2VB 1O7DC 3KXFE 4N0UA 4DKTA 3FQWB 4AQZA 5FUZH 5CJQL 3ZSSA 1DQJA 4LPYA 3T4AB 1KXQA 1HSAA 2HLAA 4L8CA 1UH4A 3GTNA 3G5YB 3WU1A 4JFEA 5I71C 3L5XH 1SN2A 1ZXKA 2NW3B 4PJAF 1A6ZA 3QEQB 1P5UC 3LZRA 4OQ1A 2V2WB 5KJ7E 3Q2CA 4QRTB 5T5FH 3TEWA 4I18C 2HFFA 2XFXB 4XXCC 1GC1L 3B5TA 4WTXA 4A7GF 4ODHH 3QDJA 1XF1A 4JN1L 2DDQH 4GW4B 1SY6A 2ZG3A 4OJDH 4H1LG 3CZLA 2Y7NA 3IE4A 15C8L 2K4WA 1YEDA 2XQYG 3VD4A 3CFBA 5ANMA 4OUUB 2VMJA 1FYTE 1R3IL 4G6JH 3RDTD 4OCMC 4WJKB 2X4SB 1E27A 2WZ6A 3NJHA 1T5KA 4NOFA 1T1ZB 3B7UX 4PJBB 3FFCB 4JE4B 4MNQB 2QADD 3QPKA 2CLRA 2NYZA 4OLVH 2ZIDA 4P8QA 2R23A 2QQNH 4OI8A 3B4NA 3NA9H 3MBED 4KK9D 3WJMB 4KJYB 3ASNB 2NY5L 1A3RL 3JWDC 5INDB 1ETB1 3E6FA 2DOCA 3ISRA 4NGHL 2VUKA 3HPJB 4LL1A 1IKFL 2Q8AL 4NUPA 2CD0A 1NC4A 3W56A 5ABZA 4NAQA 2NSXA 1FP5A 1DBAH 3IPBA 3GZQA 2YXFA 5HYEA 4N24A 4WNQA 1VGEL 2H4EA 2YQGA 1XF3B 2ADGB 1MLBB 3KLKA 5CO1A 5CF3A 4IHOA 3P69A 2WK2A 5DC9B 2Z92B 2X1PA 5KBMA 3TPKA 3MACL 1DJHA 3LD8C 1KC5L 3C2SA 3WFDH 4R5XA 5ADPH 1EHKB 5L9DL 4MDJB 1T7WA 1C5CL 4QXTA 5BZDB 4FG6C 3RZCC 3UPRB 2EZ0D 4E42B 1PAZA 4N1CA 2XBZA 1RIVL 4LP8A 4AQAB 3WS6C 3QJQB 2KQMA 3O3EA 4XO5A 1D5MB 4YZFE 3FUNA 2X4UA 3VWJA 1NCDL 3TNMB 1CR9L 5K93A 3WS3A 4DCQB 5IJDC 4U0RC 2LW3A 4Y8AA 4LL4A 3VFUB 4WSGA 3D7PA 3RNKB 5KYXA 5EC1B 4ILDA 5DD6B 2CIIA 3ARBD 1SMOA 3KPPB 3O6MH 4A2HA 4P2YA 3LZNA 4AVKA 5KSVB 4KROB 1GZQB 1T0PB 2FL5B 3BKJH 5DCCA 3RWIA 1INEH 3WBDA 1ITBB 5D7IA 4PG9B 3HN5A 1KCUL 2OMNA 2YO3A 1A02N 2AABH 3ARGB 4JFHD 4JB9H 1KELL 2ITFA 3GS7A 4Z3JA 5I15L 4U3CA 5AYUL 4QRUA 3NFPB 3CX2A 4X4MA 2UWEE 3N55A 1W6WA 1L3WA 3ILPB 5JORA 1P6AB 4Z7NF 4OAWB 5EC2A 2HG5A 1UEYA 2MJWA 3H53A 4FL4C 1OGAB 2ODIA 3AITA 3T1FB 5FM5O 5JQIB 4MB1A 5L8LB 4Z7UE 1XH2A 5C9JA 1UADC 3QDGE 3EO0B 1WBYB 2Q87A 1L0PA 2I9LB 2X42A 3A6BL 3GXPA 5EA0L 5J0BA 4FXGC 5B3NA 2YUZA 3S9DB 3FO2B 2UY7B 1PTZA 1LNUA 1VESA 1S7RB 2BRRL 3MLXL 3EUUA 3SDXB 1YN6A 2YR3A 5F2FA 2NY1B 4QJ4B 4KVPA 3BX7C 1P1VA 2DY2A 4OM1H 2OQJA 4CU8A 5JPMC 2BSED 1I8MB 4NDMA 1D7CA 4LEBA 3MBEB 5J9PA 3GPEA 3UJIL 4OCXH 4ECNA 2VDKH 3OJMB 2JFCA 2Z35A 1HKLL 2V8LA 3K46A 3P0GB 1J0KA 4JANB 4JO1H 4QMEA 5KJRL 4GAAA 3GJFB 4ISVB 2VL4A 1A0QH 4WEBH 1LILA 1BEYL 3HG1D 1KB5B 1JS4A 3NZHL 4JFDA 2ZX7A 2G5BA 5DT1L 4M6OL 4K71B 2H9GB 2MQ3A 3EDFA 3FOLB 4P57B 1CFQA 2C9AA 2IBZY 3ATAA 3LKOB 4LRNL 4XCYB 4ZMWA 2AEQH 3HKFA 1KIPB 3PGDA 4U1IA 4DNLA 2WVSA 3SZ6A 4TTGA 1VFUA 1Z7JA 3B2XA 2WBXA 4K5NA 3W9DA 2FD6L 2YA0A 3BZ5A 4UT6L 4O2CB 4NQSA 4S0TD 4G5AA 1E4XI 3OAWA 4RNRA 1IGFH 4D0DB 4J5VA 5L8JB 1TU2B 2H3KA 1PG7X 3WLBB 1WWWX 4G5ZH 3S35H 3INOA 3QJHA 1FZOA 4I0CC 4RMSA 4QYAA 1NOLA 5J7CC 2OKMA 1QLFB 4IKKA 4JM4H 5DDHA 4MASA 4OT1H 5F97E 2CLVB 1FE8L 2I5YH 3C6LB 4GIPD 4UT6A 5E6SB 3ULUF 5J13B 2MOVA 4P9HL 3I50L 1JNHB 4B6ZA 4E9XA 4U1JB 4JO2L 4JRXD 3ZOAA 4Z0XA 3UTZB 3CHOA 1FNGA 4DTGH 1D9KD 2X87A 3TVMA 1B0IA 1G7JB 1YEEH 4XBPA 5ILTL 1AANA 2DQJL 4IEFB 2F8IA 2ESVE 3TBTA 1SXBA 3GPSA 4HD5A 3ZDYF 3LVTA 5DUPL 2DICA 1EXUA 2WBKA 2D3NA 3GBDA 3PJNA 3SE9L 1NCAL 3M88A 3U0TB 2WYTA 4KQ0A 2X40A 2CCWA 3VA2C 2B0SH 3HJEA 4P23D 3KPMA 5IW1B 4G7VL 3TO4A 1F97A 1OARH 2DJUA 4WI3A 2YAMA 4HW6A 4I0PA 1MCNA 1H0DA 3FUJA 3JZYA 1UA3A 4LEOA 1I3VA 3HS0C 4X4YB 1DFBH 3IJ9A 2EYTA 3EFOB 3KLSA 4GEJA 1NCBL 4DGYL 2YQBA 4L5FL 4N8CL 3ZE0F 2YD9A 1EPFA 3MRHA 3W9EB 4NQDE 5IOKA 4MNGB 3B37A 2NSMA 4D0CB 1CXKA 1QW8A 3O9WA 2DW5A 4B0MB 2HX8A 5E6IB 1UJ3C 3EYSL 4JDTL 1XH1A 4I1NB 1D6VL 4XCYA 4X8CA 3BVXA 4MJJA 5GJSL 4G9FD 4B60A 4DZ8A 2WGNB 5D1XE 5FHBL 4AENB 1IAMA 5TFSL 3LVEA 3VSTA 5HYFA 5I9QC 4LIQH 1MJ8L 1DN2A 2VDPB 1UA6L 1FFQA 3DX8B 3RTLA 4CVZA 3CIAA 4E9QA 1CDIA 1THCA 3IT8D 1D5ZA 5I1EH 1JGLH 1G1OA 1G43A 1OAZL 2ZWNA 4XAWL 3V2AR 5D4HA 1SOKA 4HDIA 4XMZA 4ZNEA 2AQ2A 5E0FA 1NBCA 4LCCA 2X4QB 3GZOA 4PU2A 1MCHA 5HJ3A 2DWDB 4LOVA 1TR7A 5F0MB 1N5YH 2ZUQB 5ETUA 3RVTD 2IADA 2A1WL 1GGUA 1JGDB 4JDZB 5GGTA 3QARA 4QCIA 3UZQA 1O9ZA 1G7JA 2FJGA 5AVVB 1F3RB 1FVDB 2WP3O 2DQCL 3SJVB 2PLTA 5E6ZA 4HFUH 1FDLL 4BKLB 2JJTC 4CVXA 2P24A 2AJZB 1JZ8A 2J3SA 3QISA 3O3BA 4UB0H 5CUSH 4APQB 2GKIA 1TZIA 3GUTB 3PG2A 3EGDA 5E95B 2VLJD 3F12B 3LQAL 4KK6D 1GYCA 1LLAA 2QKIB 1TFPA 5GS3A 3ESNA 3HI6L 2FLMA 5EU6B 3APFA 5GSVB 2KPNA 3K72A 3FB8B 2BS8A 1G87A 4OF6A 2RFXB 4X8GA 1JPEA 3U9UA 4KMQA 4LCWB 4AOFA 5I71B 2IFFH 4FJZA 4CL7A 4Q9QL 1KCLA 1BM3L 3L1EA 1KJVA 3LHPL 2IOIA 2E6JA 4LPCA 3B7RL 1M2OA 1NCCL 4J2XA 1T20A 4HHWA 1UD3A 3K1KC 4GRWF 3O41B 5AZEH 1CLCA 2XYBA 4OFVA 1WWBX 2WQ8A 2R1YB 2OMUA 4L4VA 1UC6A 3NH7H 4M6NL 1EO5A 4X6CF 1NKRA 2J7LA 2DBJA 4Y2DC 4B3EA 4KXZH 2X6VA 3MLUL 1B4JH 1FZMB 5AOLA 1T1XA 3GGWA 4AM0A 4UAOC 3RVUC 5KSAB 4IYKA 3X17A 3S5LG 1EFXD 1I31A 3RL1B 1QI5A 3W11C 3FBQA 1BVLA 5F7YC 1IQDA 3IJSB 3DX1A 3U7AA 1AS7A 2VDMH 2ARWA 5DEZA 2NNXA 3AU1A 3VXPA 4NZFA 3UP6A 3AUVA 1JYVA 1ZGLA 3L13A 2ARJQ 2ZCHL 4PJ5D 5MEPB 1UZ6E 1EJFA 3QZWA 4KPHL 3RL2B 3HFML 4JAMA 1KN2L 3STLA 2F08A 3S2AA 4OZ4B 5GGUA 2BNQA 4WTZG 1MG2C 2AW2A 5F9OL 2JNZA 4JFEE 1T2QL 3PWNA 3TA3A 4ZUVA 5MI0B 3GXUB 4HUCA 2LAGB 4KQ4L 1AACA 1P4LA 1CWVA 4B9GA 3LIZL 4IRSB 2D7MA 4JLRA 1U3HD 2VN5A 4X6DB 4R9HA 4IJ3C 3FHEA 1BFVH 3OVUB 1G9MC 4FQ1H 3QZMA 5IZ7A 3UJJL 1F4XH 1MOEA 1OCWH 2BERA 4JVWA 3TA4D 5GS0L 2XZAL 3I74A 1BJ1J 1GYUA 2J20A 3Q9QA 3BVVA 4R7DA 3HZMB 3QQ4A 3QRGL 2XNAA 4DP2X 5I8KH 3U6RA 4FFVD 4FAAB 3QFJD 1RZPA 2PCFA 2X05A 2FX9H 3ZMRA 1UD2A 1ZAGA 2A6DA 4N26A 3O2DA 3ERXA 4YDLC 2X28A 2YOCA 2P5EE 5CIPA 5B4MD 3WDHA 1T89A 2BC4A 3B8SA 3PNWA 2P5WB 4HV8A 4GQRA 2V9TA 4NKIL 1M1SA 2YUVA 3CFEA 4ODXA 2VXSL 5KS9F 1AXTL 3RA7L 1FNEA 2LABA 4X9IA 2NTFB 4EN3B 5I2IA 3K71B 4Z78A 3U2IA 2IH1B 3L3HB 3K8MA 1CIUA 2ICWJ 1CGVA 3H0TB 4XTRD 3R7QA 5KSAA 3HN3A 2LAAA 1CXFA 2CUMA 3RAJL 4PJGA 5E1AB 1J0HA 2E56A 2DQTH 1LD9A 1UASA 1NCGA 5L7XL 1YNTB 4QHLB 2AAVA 2P43B 3B7YA 1IZKA 5CJXC 5EZLB 2ZWSA 4GLRH 3IMWA 5IK3B 1VLXA 5MEPA 1ESOA 3P3YA 3GS4A 4ORZC 4S1RL 5DZNA 2EDQA 3D3VA 5F8QC 3M7OA 1C08A 2JQMA 3WI9A 5GRJH 5BOPA 1N12A 3ECWA 3ALXA 4UTBL 2Z31A 2GAZA 4O2FA 2DLFH 2O5YH 1V3KA 1CBVL 1BYPA 3UIYA 1MLBA 3DK0A 5IHBA 4UZGA 4NT6B 1GHFH 2DQMA 5H8DA 3SGEI 1RZKH 3K6DA 3MAWA 4J39A 4M6MH 1T4KA 1E65A 2HT4D 1MREH 2KS0A 3T2QA 2VDQL 4IOSA 1AGCB 1AI1L 1SEBB 3IKCA 1F4YL 3FU3A 4KJYA 4E42A 4UQIM 4BWTA 4HFWA 4JR9H 3RJDA 2KI6A 3ZN6A 1J10A 4KKNA 4LASL 4OZIB 2EDHA 2Z0BA 2WCSA 3LZPA 1Q38A 2H8PB 2HFTA 5HHVL 1RJYB 4E41B 4G42A 2NUTB 2ADGA 3Q9PA 4JG1H 1BBDL 1UURA 3MFGB 4NJAH 2MSPA 5AVXB 4MXWH 4OD1H 4Z8FH 3S3PA 2OCCB 3E8VA 3FUIA 3LRMA 2FYYB 1CF8L 1OOAA 3LQMA 2WVUA 4HV8B 2NY2D 1F1GA 1RL1A 3RVXD 4WCYH 3QJRB 1KB3A 1IE5A 3ATBA 4TRPH 4Z78B 2IH1A 3L3HA 1QEWB 3TL5A 3EJTA 2Z4QA 4QF1B 2C1PB 4QRUB 5DZPA 1JNNL 5SV4A 5D1QE 4DGVL 2FX7L 2O6EA 3H4FA 4PRPB 5EEWA 3ABZA 5F9JB 4AJ0A 4P2AA 3C5ZB 4HIPA 2MCG1 2DQIH 3PXLA 5AB2A 5JHDD 5EZLA 4G6AD 1YMMD 1ZTXH 4Y19A 3BP6B 2AJSH 2K3HA 2WLLB 3RWJB 1TQSA 3LSOA 1X7TA 5L2KA 2YAHA 1JWSA 2CDEB 3X12B 4E9WA 3G5ZA 5F1IB 5HYQA 3TOPA 1IZJA 3FN0H 1JNLH 2XWTA 4O02B 1P2CB 4OU3A 4OFYD 5LNDA 3OKLB 1YAIA 4H2CA 1WIUA 2XKSA 1AC0A 4EIGB 1IEBB 1YZZA 1S6NA 4Y9BA 1MUJA 1WZLA 2YPLA 4L4TB 3TYGH 3FB5A 3WY4A 5HYJA 4DUVA 5IB1A 5AZ2H 4HIXH 3BH9B 1CCZA 4JZJB 4J4PD 4RGNC 2AK4D 1JFHA 3BW9A 4NYLA 3SPCA 2DH2A 3DUUA 5SWSD 1KGXA 1J86A 35C8L 2NOYA 2W95A 5I8EB 1J1OH 3BWAA 5CGMA 1AYRA 3RNQB 5FPIA 3TLRA 2J88L 1M05B 1R3HB 1RZGB 4QHKI 4J3OG 4ZBJA 4LE8A 4OCRH 2N1KA 3L16A 1U8IA 1KT2A 5CCGE 2IG2L 3FO2A 3PQYA 4UTCA 1CGSH 3NZSA 4X9HA 4IMKA 4PJXB 3FUMA 2F53D 1DVFA 1CFQB 4WEEA 4FQIH 4L2YA 4X99A 3ZYJA 3BPCA 4Z6AT 1BVKB 1JK9A 1RK0A 5HGBB 2O5NA 3MRPA 4AGOA 2FHFA 5CN1A 4FG0A 4P3WA 1KJ2A 4O2CA 3NIDF 5JIPA 4HU8A 1L6XA 3BD4A 1JXKA 2OSYA 1AR1D 4Z7VF 3ARQA 4LOFA 2OTWA 1NINA 3A67L 4YHIA 5D93C 3NT0A 4UQBA 3WIFB 3OB0H 4FYQA 2GSIB 2Z1KA 1FGNH 2P5EA 2BSRB 4XB7A 1UYWL 4XZUA 1QMUA 2Z8VC 3QJFB 3G5VB 4OF7A 5FUCC 4Z7VA 4DTGL 3SKMA 4WSKA 5ITFA 4WI0A 4HIEA 4Y5VC 5MEND 3L95A 5DMGC 3QAZC 2OXHB 1DL7H 2DQJH 1TDQA 2EQDA 1BLNB 1CURA 3EJZD 2WQVA 2AKRA 1IBGH 2WLLA 4KKQA 4WO4C 1YJDH 3GBML 4W4OA 1J05A 1PU0A 4URKA 1HTYA 4HPHA 4JRYA 2DYPB 3PCYA 5B1CA 1T0OA 2ERJC 1MRFH 2BNRD 3QQ9D 2VSCA 4XN2A 1CFVL 4TUOA 2NNCA 4FZEL 1TZHA 3S5ZA 1EHXA 5D6DA 1CD9B 4BUGA 4Q8BA 2I69A 2QKSA 2OPCA 2WBJB 4KTEH 4TOYH 1IJ9A 1KN4L 4HA1A 3HG4A 4YPGB 1R3JA 3KYMB 1TYRA 2YFOA 4QOKA 4AYEC 2VDOB 2OK0L 3ETBF 5DMIH 1IGTB 1L6ZA 3LZFH 4LEOB 4WO0A 4Z77B 1QLEB 3EOTL 4K07A 1WDAA 3WSQH 2BSEA 1R3KA 1K72A 2J8HA 5ICZA 2EEBA 3KE0A 2Z8RA 3OJDB 4HWNA 3HIZA 2WINA 3KWUA 3JWNG 3OGCB 3VFWA 1SZNA 4HCIA 4UT9H 4ZPTB 3MV9D 4LB8A 4KTYA 1KJMA 3SE8H 1BZ7A 1UHVA 4PRBB 5JPNB 3VXNB 5JHMA 2MNJB 5HGBA 3KMDA 4XPAH 5T3XD 4AENA 5IW1A 1JWMB 1NOAA 4MJ6A 3D25B 1TMQA 2VDOH 4UM9D 1M42A 4F2MA 1UFGA 1AHWA 2CQVA 1JRHH 4P2OB 5J13C 3CCHA 5J6GB 4NSKB 1QR4A 1HSBA 4TULL 1X5XA 3AXIA 4PYGA 1K8IA 4K7FA 3V0VA 1VHPA 3G5VA 4XC3H 3QEGH 4NXSA 2LU3A 5BJTA 4GAYB 5ITBH 4HEMA 4HIJB 1TJGH 1J9CT 4HWZB 1UWGL 2Y9RT 1L9NA 2EH8H 4PHXA 4M9OA 4N2AA 3ZT7A 4HFUL 4MYPA 3TF4A 4ADIA 3VX1A 3CFIC 3QUXC 4LP5A 1HNGA 4Z3IA 3V5KB 4MMYB 3V52H 3L5IA 1I8AA 3PE9A 1WO2A 1H9DA 4FP8L 2ZYSA 1IIIA 4XT1C 1FUNA 3X3FL 5JTWA 5K9QG 1MWAB 3AFLA 3O4OC 4ODSH 2W88A 4APQA 1KTLB 2VXQH 1HXYA 2ADFL 5FW6A 5C09E 2XN2A 4ZFZA 4GI6A 5B1BB 3U7YH 3TV8A 3TA3C 4YPGA 4OD3L 5ADPL 4B95C 4E68A 3GB7B 1WA0X 3BIKB 4MSWA 5HPOA 1PKOA 4MZ2A 1AH1A 1ORSA 4LPXA 4EI5D 4NO5A 1PEZA 2DKUA 5BMFL 4PJEA 4ZMPA 2GY7B 5HDBF 5KVFL 2Y6SC 4MJID 1IC0A 2P4AB 3OKOB 3S8GB 5K9KB 1LXMA 1R5WB 1B6UA 3VWJD 4G8IB 3V4PH 4TTDC 3MUGA 2NXYD 3WXVH 2WUCL 3L7EB 1PZBA 3UTOA 4BQ9A 2NY2C 1Y0LB 3MJ6A 4KFMA 2E8ZA 1QBML 3D4YA 4NO0D 2VDML 4X4ZA 4HT1H 5CN2A 2OMWA 4JQIH 2AABL 4ZK8A 1FFTB 4C56E 5FUOH 1T1XB 3GGWB 4YDKH 1OXYA 4XCCH 5D1XA 2QKIC 1YEIH 2F7QA 4JQVC 1B90A 3ARGD 5CLTA 1QSFA 3MCLH 5CLZA 6PCYA 4HWZA 3QXVA 2W5PA 2C3VB 2VMDA 3K1DA 4YFEA 2CO6B 4BA0A 3D12B 2GK0A 2WY3B 3PL6D 4IDLA 3L5JA 1AKPA 4TS6A 3JVFC 3BKYH 2V2XA 4K8RL 4BE5A 5ABDE 2HN7A 2JMRA 1WAAA 5HDRA 4GNKB 3A23A 4FXLA 3TFKC 4F1SA 1TKWA 4W4NA 4KHTH 3MROA 1OE3A 4RFNB 4YDVA 3RGVA 4NZJA 3TT3H 4N8UA 4AM0B 1L9PA 4UU9A 1OAXH 2F8XC 3UJJH 1O5PA 2VZUA 3VFMB 4B9KC 2ZP9A 3GJEB 2ZWKA 5FO8B 4Y1TA 1I7UA 2APBA 3VI3A 1U91A 2EDTA 5EG6C 3IJSA 3K8LA 3FSWA 1NFDB 5F44A 1FNLA 4IGBD 4LK4A 4OBRA 3T08A 3DX2A 3WFEH 3A21A 4BDVB 4NC2B 2W92A 4OIAA 4RZCA 3N3EA 4A2MA 5KZCB 2QSTA 1IGCH 2Q86B 2DJSA 4M9PA 3CX5J 4BQ6A 1SJVA 1TVDA 2VZTA 5G2NA 4HOZA 5FUZL 4YLCA 4ENZA 3QDJD 1NDGB 4I48B 5JQ6H 4F8TA 3ATFA 2CHNA 3HZMA 2K9FB 4WEBL 5DS1A 1MFVA 3HE7A 2IDQA 1URIA 4G8AC 3T0VA 5F7WC 3KAAA 4G6FD 3FPXA 4NOBA 1BIIB 2GFBB 1EJ8A 1UD8A 4FJYA 5FYLD 2VLLA 4MWFA 4JDVA 3L7FB 2YSSB 1RU9H 2O6CA 4UT6H 3MREA 2WIIB 3RVVC 4ZMAT 3CZKA 4QO1B 2NTFA 4FE9A 3TNNB 1QR1B 1G9HA 1SLVA 5ENWB 1IGFL 4DK3A 3FT3A 3WEOA 2BK8A 4O58L 3GFUA 1L9QA 4ZFFB 5AVZB 4MD4A 5F6HJ 4R7DB 3CIQA 4AMKL 4XXWA 4NC1C 5D2LB 3ZKXB 3G7TA 4G8GD 5A7BA 2GJ6E 4MJIE 4M7JL 2PCFB 1TXKA 3ZL2A 1KEML 2EVIA 1TNNA 3VFUA 5ALCL 3NJVA 4Z1PA 1IAKB 3I2CL 2ZUUA 3BVDB 3VM5A 1GW6A 2KLSA 3RY6A 5EDSA 2ADYA 4PJHE 4CADA 4FFYA 4N5EC 5FF6A 1G6VK 3IVKB 4R7LA 5D1ZB 5ICYA 2HVKA 1AGDB 5FLVA 4G6KL 2YAFA 4OFDA 3AWEA 3OR7A 4PG9A 5DUPH 3KGRA 3OAYH 2FO4B 5DRXB 5ID0A 4PRHB 4OH2A 4BWWA 3G5XB 1AP2A 4QXVA 3JWOC 4L4TE 4NT6A 5FFGA 4FLQA 4AJVA 5I1LA 1J9QA 1MFMA 1NCOA 4K94C 3M8OH 5I74C 2H2PD 4GMSL 3R0MA 3NSXA 1SJHA 2DQUL 4LU5H 3FO9A 1E50A 4P9MH 1OARL 3I9GH 1SXNA 3IKKA 3GHEH 4MA7H 5EUOE 4DUWA 3QPXL 3BZ4A 1H3UA 2J2ZB 3DTXB 4YQXH 4L8SC 5C9JB 1DFBL 3JV6A 1XZ0A 2DIEA 5ESVB 2CIKA 3BGFB 2BRQA 3AREB 4L5FH 3H9SD 2NMSA 4Q58C 1XX9C 5H2BA 5IWLC 4BQBA 3IRPX 1YHPA 4PRNB 2C9QA 5SWSB 5F21B 2QVKA 2ROXA 3VTMA 3QZLA 1G7PA 5DFVD 3RWGA 3WOVA 4M8UA 5DQ9B 3PAZA 1F4WH 4L2LA 1T5WB 1WFIA 1X5FA 5HHMB 2J72A 3G6AB 3O8XA 5GRWA 3B1TA 5F9WC 4LIQL 4JG5A 1KELH 4U05A 5J56B 2X1QA 5CINL 5AOIA 3HPLA 1KDIA 4HWUA 1F90L 1GS8A 3EYOB 4W9CC 2WXKA 1TVBA 1K9TA 4IU2A 4PJ5B 4XBGA 5H4YA 4UUJB 1IKFH 4YZFF 5L4JA 4YDLB 2ZKWA 5F9JA 3MLSH 4OZIA 2WWKT 4RFOL 2AJVH 1A6ZB 3QEQA 4N5UA 1VGEH 1W9XA 4OM0L 4E5XA 3BMWA 5I66B 1FV1B 1EHLL 4FNQA 1GH7A 2X44D 4G9FE 2YK1H 5D72H 5F0PB 3IDNB 5LQBH 1A4CA 1E28B 2FBRA 2VR8A 1UACL 3MVSA 3QR0A 3KCPA 3VXOB 1A9VA 5DRWA 3D2TA 3P3SA 1E4HA 3QEHB 1VEOA 4ZYKB 1BD2A 2XU9A 3ABLB 2OYKA 2OBGA 4KH2A 1E4WL 3VU2A 4DVRL 1RIVH 4CC4A 1J1OL 3ESMA 3KJ6L 4RAVB 3LY6A 5AAMC 5E51A 4EN2A 2UWEF 2IAAC 4QRBA 3C60B 5L4IA 3QYNA 5IB1B 2CLVA 2A73B 4Z7NE 3SYOA 3RBGA 2Z7ZA 2A99A 3ZKNC 2GJJA 3LQAH 3OG4B 5E1IA 5FDWB 5TDNA 3Q2NA 1OAKH 1T3FB 1J48A 4PRHE 2WXPA 4FXGA 1CGSL 4M5TA 1SOSA 5HI5C 2QADC 4U1JA 3SE4A 4TL4A 3AREA 1P2CA 5IQLA 2VRAA 2HB0A 4UI2A 5BO1L 4CW1A 2WLIB 3NPSB 1IBDA 1NGWB 2F74A 2V17H 5C07D 1BM3H 2BVQB 4X9FA 2XWCA 3OKDB 3VDCA 3I9PA 3LNGA 5FYLE 5IOPB 2PWGA 4PREA 3IN0A 3WAJA 5E4EC 1CE6A 4ES9A 3GHPA 4HLJA 1BD2E 1EAJA 1ZVSB 3GMOA 4WU7B 4J23A 3JV4A 4PLKC 1YEJH 3PUUA 4GW5A 4OF3A 4W93A 1CD8A 2XV3A 3QDJE 1RUML 3ZE1B 3VXMD 4UUJA 4Y7MA 3I85A 1M4KA 1Z3GH 2EO7A 4P2QE 1MVYA 2BX5A 4FFVC 5PAZA 3TWCL 5DJ6A 4IRJB 4BK4A 1G0YR 5F7DB 2Y5TB 3I50H 5GRVL 1Z0NA 3M07A 1HU8A 4MB4A 3MA7A 1VPOH 4PJ5E 3MJ9A 4GQ9L 2CIIB 3T2NL 2X10A 3EHBC 2VZ1A 1OSEA 4QWWD 2V9RA 1NGZA 3V0GA 4AEHL 4GSDL 1S7WB 3WS6A 1YEEL 1MY7A 2PO6A 3GRWA 2JIXB 2ZNXA 2AVFA 1ZJAA 2JKLA 3IJEA 1NGQH 3DV6A 3H9SA 3QBTB 4OZGA 5KYYB 2DMKA 2IALB 4G6FB 1NSNL 4PRDB 2VO8A 3MV8B 1Q0XH 4YNYA 1CGUA 3L2MA 1HESA 4M62L 1FIGH 3SYQA 1JGVL 2ITDB 25C8L 3IAQA 3V6ZA 1FVCB 5D7JD 3F3HA 1PLGH 2ZKXA 1KYAA 5MHSE 1A0QL 3ILPA 5JORB 3Q43A 1U6AH 2C1OB 3LQZA 4PSRA 1BEYH 4N5ED 5A2CA 3ULUE 4APXB 1FZJB 1D9KB 1S7UB 1RZFH 3NZHH 2IH9A 1BZEA 4L8DA 3T1FA 4NKMA 4OZGF 5EZOH 2BO0A 3QG7L 4LQ1A 1GKEA 2XZAH 1XCXA 2AEQL 3FQUA 3O11A 5CSGA 5E4IA 1BAGA 5LAXA 1MG3C 3ZRSA 3AC0A 3ZSTA 4AEFA 3L9RA 1J9SA 1QO3B 3FTYA 1H15B 1KV7A 4I18B 3MFFA 3ZDYE 1R5VA 5DLMH 2RHEA 3FKUS 1ICTA 4W81A 4Y16C 5AW5B 3P0YL 4RA3A 7FABH 2IFGA 4YSAA 1T5XA 4QHNB 1W2KT 3V5HB 4CSZA 2BP3A 3O9WC 4IIQC 1OCCB 1I8MA 1MJ8H 4HIHA 4KKCC 3I6GA 4PFEA 3WE6A 1WWAX 1RLWA 3D25A 3Q13A 5CEXB 2VXSH 3UAJC 4JPVL 3KL5A 2NY5C 1Z9SB 4P9HH 3GSUB 4K15A 1NWOA 1A3ZA 3QC6X 4E0RA 2BVPB 2F58H 3TXAA 4CRPA 2EXTA 1CJYA 3I6LE 1HH9B 5D7EA 5EORH 2YD3A 3ZE0E 2OCFD 2VR4A 4MQ7A 1YPZF 2VDQB 3IB4A 3PAYA 1XGUB 4LCWA 4M1CD 4UM8B 3V10A 5ILTH 4GG6A 5LJYH 4OLYH 4OJAA 3NTCH 1KLUB 4WWKA 2J44A 3FFDB 3L3KA 3NCEB 2YQ3A 3QUMB 4HGKC 5D2LF 3TJEH 3QZPA 3X3FH 4JPWH 1BQHA 2X7LB 4X6FB 3S96A 1KLFA 5JHDA 3QEQE 3SEPA 2B0SL 1OHZA 1XIWC 3TIEA 3PXHA 4KY2A 3ULSA 4AGNA 4YHML 3TH2T 4TNVF 1V7MH 1DBMH 4P05A 5EF1A 3CC5B 4HP5A 4Q6YA 3MNWA 3BESR 4DGUA 1S7VB 2NY1D 3HG1A 4HJJH 2BLFA 1J9TA 1J87A 1OPGL 3DBXA 5KVEH 2R0WH 2WPGA 1S7SB 4HIJA 1IQDB 1SXZA 5JIIA 3HZ3A 2P5WD 1C8PA 3T2PA 3KL3A 4JY4B 3N0AA 3X11A 3JWNC 4KZCA 1F4YH 5CAYB 1FRGL 4CNIB 3E6HB 1U8QB 4OGYH 1G84A 3L3JA 1XR8B 1AXSB 1D5IH 4N86A 3BUDA 3S2CA 3FU8A 2WN2A 1QNIA 4C55A 4ZUSB 3MRDA 2SODB 4ZUVB 1DVYA 1KJ3L 1YEHL 1T83A 1KBBA 2IQ9H 4XXWC 5I1EL 2FEDD 1JPFB 5ACMA 3X3GH 1A4BA 1JD7A 2BWIA 2GCYB 2VXVH 1P7KA 3EFFA 4DAGL 2DB8A 1PY9A 2VDKB 4DN3H 3U7WL 1A7NH 4AJYV 4G7QB 2NRDA 1B88A 2X4RB 1TZ8A 4WIQA 5B8CB 4BZ1A 1U3NA 4QXUH 4ELMB 4QJ5B 4NO5B 4HMDA 5I1JH 1A3QA 3UYRL 2G4GA 4AQ1C 4I88A 4GG8A 2Q10A 4ZZFA 4JHBA 3QAQA 5JUEL 5K9KA 1GXEA 3HRZA 4L23A 1FDLH 4Q9RL 1TLMA 2QPFA 4NPKA 5ISZE 2HKAA 3FQNA 1KLFB 4ZUUA 4G70B 2WZPD 3NJXA 3ZE0B 2RAMA 4PGDA 1E9PB 3M17A 1UQSB 2FR4B 5DSCA 1NPUA 3ZYIA 5IVXF 3OZLA 4ODBD 4ODWA 1ZLVK 4G3YH 3RGVB 5MEQB 1FNEB 2CHXA 4EBQH 4Z7UB 4ZO8A 3L4VA 5F70A 4KUZL 2I60H 4UZSA 3K0WA 1QLEL 3KYOB 3ZTJG 3CBJB 1QBBA 2CPUA 4NX0A 4YBQC 5BS0A 2WOYA 3DDFA 1C12B 4OJYA 4F57H 1L6PA 2QV4A 3N9GL 5EN2A 5LO7A 3WL9A 4N2KA 5DA4A 3B83A 2GK0B 3GO1L 2N7AA 4F7CA 5C0JA 4Q9QH 4D7BA 4E9SA 5KS9B 3MMEB 5IVZB 1WCBB 1F11B 2JJWA 3IMSA 4Y9CA 1UZ6F 4F7EA 2HN7B 2DZEA 1IKOP 1F5WA 1QRNB 3QS3A 5HHQB 2FBOJ 4XC1L 2DV6A 5EN3A 3PWUA 5K9OA 1BQUA 2Y23A 3HNSL 2XI9A 4LHUA 2GTZA 3H6AA 1TQVA 1NM9A 2FX9L 2NQ3A 3IDYB 4XPGH 2NY3C 3AABA 1D6EB 4A37A 3FAXA 4HMEA 4ZOAA 3VFMA 5DWUL 1EGJL 3U36A 3SDDC 2GHWB 5DC0A 2A9DA 2P45B 4OJEH 5F1NB 3O2VL 2CKBA 3UO1H 4I0PC 5B4MC 3EFFB 3T3PB 4N2MA 4BDVA 4OZIF 2ATAA 4KO7A 2ZG2A 4EE2A 5JXEA 3A6OA 3RE0A 4U3SB 5EU6A 4HJIA 1TITA 3VJ6A 1ID2A 1KEMH 1AS6A 2PYED 3AW5A 5E70A 2HG0A 1AR1B 2RFXA 4CKQA 3QQ3A 1XGRA 3HFMH 2P47B 1KN2H 1JMZA 3MNMA 2NT1A 3QJUB 4M93C 2HX7A 4K5MA 5L6YL 4PP2A 3MGOA 1USQA 3MUY1 4BCXA 2QHLA 3BUBA 5DJ2A 2VJ8A 4XOCA 4JFXA 2IV9A 2WKOF 3IGAB 3VM7A 4PV8A 3P02A 3QUML 4X80H 1UT2A 5I75B 4LSRL 1WJ3A 4E9LA 3FC8A 3D39A 4LARL 4FQHB 3UH8A 5KS9E 3NCJH 3UPAA 2OMYA 3M8OL 1IBHA 3S3BB 4WLCA 1M9SA 2BSCA 3FT3B 3WHE0 3KNBB 4J3OD 4LOUC 1F4XL 2B08A 2VQ1A 3QPXH 4DJMA 1UWXH 1PKQB 4NWUH 4D94A 3I6LD 1VEPA 3CLEL 2IWKA 1I1AB 3RGBA 2G2RA 4LF3A 2NW3A 2UZPA 3D18B 1I1FB 3L17A 4X4ME 3ILQC 4UBDC 1DLHA 3DV4B 3FTVA 4GAJH 1IO4C 1HKLH 3OM3B 1UUNA 1ZHLA 2G2PA 1TCRB 5CJQH 4YLQT 2BVTA 4GKZB 4PBDA 1WE5A 4OFPA 5K9OB 4EXKA 4LHUB 5EV7A 5HDOA 3O3UN 5FF6B 3AG1B 3Q6FA 2WYHA 1ZTXE 5AWNH 3FU5A 1WZMA 2GTWA 4Z95H 3T3MF 3ZRCC 4KFZC 3B43A 1YMHA 1NDMA 4BXVA 1ZT1A 4U1MA 4UQ3A 5CIPH 4B53A 1FYTD 2YUWA 3D39E 1A6PA 1IAII 4HC1H 2HCZX 3ARSA 3RAJH 3GSXB 5IQOA 4N1HB 3G6DH 4R4NC 4X7TA 4MQSB 4MDJA 4NZDA 4U7SA 2XWXA 3QP3A 4MLSA 1HXKA 4UZUA 3IJHA 3QORA 3H3PH 2ZSVB 4LNRA 4DGIL 4RWHA 4G5ZL 3S35L 1LP9B 1A6AA 1JNNH 1GSKA 3TPUA 5GS1B 3DO7A 1EHLH 1QVOB 4X7SL 2V5SA 3NJKA 2YC1A 5DA0B 5DHDA 4DHLA 1FE8H 2I5YL 5F1OB 1Q90A 2EIEA 3BH8B 2X0UA 2R69A 2NY2B 1P6FA 4LCVA 2H1LM 3EJUA 1ND0B 3MO1B 4D8PA 1OK8A 1F6FB 3SE3A 1E7VA 2PWFA 2Q8AH 4XZ4A 1RZ7L 2EDOA 5CLYA 2QJDA 3BPCB 1IAIM 3LQAC 3AGVA 3TYFA 6FABH 2DWTA 3G5WA 2P5PA 5JHDE 2VQ4A 2IPKA 4N0YH 5FGBA 3TO4C 3VGFA 1YQ2A 1G7QA 3ZTJH 4FP8H 2B3IA 2DMHA 4IK6A 3DRQA 3KPSA 3A6CH 1H8OA 2W81C 2WHVA 1G1KA 1MY5A 1QZNA 1BXXA 4HK0B 5SV3A 1LE5B 1IGML 4OB5L 4OZHA 3SO5A 2OXHA 3SPIA 1E8YA 3QW9A 3PWPD 5DQJB 5T3XL 2AXWA 2QVFB 3V6FA 1SVCP 4GKZA 4R4ND 2A77H 3CVIH 5DD0H 5DUML 4A7VA 2OCJA 5BXFB 4KKCD 4DGYH 1NCBH 2IG2H 1RH8A 3GSQB 4ONFH 3TCTA 1M71B 1UZGA 5MERB 4QTFA 4IRJD 1FYHB 1YEJL 2VUOA 4AV5A 3EYSH 4JDTH 3K2MC 3LEVL 5BZXA 3KPRA 3DGGA 3N04A 2FX7H 1F1AA 4UQ2A 1T21A 1OD9A 2LVCA 1EFQA 1QUPA 4HGWB 2QGBA 4TUJA 4ELKB 5DO2C 1OGAA 3WNOA 2BIQA 4LNRB 5BVJB 5AYUH 1ZA3B 3AS1A 3ROOA 3T6XA 1TTAA 3BP7B 5TE4L 1ZT7B 5CJOH 1YEFH 3GUFA 5EOCH 5LUMA 1E9OA 4ZPVB 1QHQA 2FO1A 1RK7A 5DJ6B 4HHAB 2AFNA 1O5DT 4YC2B 3OHMB 3L1FA 4U0RB 3SDXA 1REIA 3D50A 4WTZA 1X5ZA 3BMVA 1NSNH 1MWAL 3MV7E 1ZTMA 4K55A 3CDZB 4KX9A 2HJLA 1RKRA 1X6LA 1GYWA 3IAPA 4HALA 4XNXH 3T2LA 1PLGL 1CUOA 1SY6L 2CJUL 2QV2A 2V33A 4WHDA 2MFNA 5FWQA 5IMOB 4MD0B 3V0IA 5E0QA 3NIDE 5D1ZI 4Z7VE 3W2DL 4PGJA 4EKJA 2CLZB 5GGTH 5C8JB 1TEYA 1EIBA 1F56A 2MQ0A 2E7LC 3RTQD 1E0OB 4KRMB 4OCXL 4OCRL 1WS8A 4XX5A 3R7RA 3MRQB 3W5NA 2ODHA 2CJSA 1L9TA 4NAMA 5FV2A 4HPYL 4QRPE 4KKBC 4ZNCD 5KOMC 2XXGA 3E2HC 2FWUA 4KUCD 3SGEH 1E3FA 1LEKA 3X12A 2YSTA 1NKOA 4ELDA 5I1CH 3FCUB 4KY1H 3T9WA 2NXYC 4GKOA 3N43F 2ITEA 5PCYA 2D3JA 3FQ4A 1WZ1H 3ARVA 2VN3A 3MV8A 4YNYB 1BXAA 1DJIA 4FYTA 3EKCA 2F5BL 2WXRA 4LDCA 3A67H 3EH5B 1NBVH 3P4OB 4XPAL 2IANE 1I3GL 2P80A 3V5HA 1J0JA 1RAMA 2OM5A 1MFEH 4XCFH 1QOKA 4UIMB 4ODTL 2F1AA 4ZFOB 2QTVA 4L8DB 1X5JA 3MRRB 1E3ZA 5AW3B 1JPGA 3BWAB 5G4MA 4MMZC 2DMBA 2OR9H 5AENA 3UTZA 4ODUA 1WFOA 5KBDA 1UOLA 3GMQA 3FFOA 3P9MA 4DEPB 4IEFA 4DP7X 2BOBA 4PRIB 1N5AA 1R5VB 3BFQG 3OKOA 4MGXA 4HJ0C 3ECQA 4QEGA 4ZDHB 2M26A 1DBML 4AQEA 4HZLB 3BUYA 5CP3A 4P2RA 2F9BT 1BZDA 4X6FA 3I2CH 4Z3HA 3AREC 3W0WD 3WN5C 1U41A 2W94A 1U3HC 3EUDA 4L3CA 5HHNB 3MRIA 1VACB 2VJXA 3BAWA 3N5AA 5FYKL 3WJJC 3QIWD 3OKKA 1D5ZB 1XGZA 2Q3AA 4UT9A 3LZFL 3FH8A 1JE6A 3NQIA 4XN7A 3VXME 1G94A 2EUXA 4KQ4H 3VMNA 2BWQA 5TF0A 4KO9A 2BMKB 2Y7LA 1XCTA 3S0PA 2FWOB 4U3HA 4JKLA 5DS8A 4CC4C 1EUUA 3C9NB 3NJNA 5DTFA 4GG6B 4GMSH 3NG5A 4N6RB 5I8OL 1CICB 2V7HA 3FTGA 1IC7L 5D7JA 2CE6A 4ZG1A 3GHEL 3ILQD 2XV6B 4MA7L 4OCNC 3EOAA 3RUGB 3QIBA 4NQUA 3SE8L 2X7LA 1S7XB 4G71B 1X9LA 4G7RB 4FERA 4IGBC 1PNCA 4BZYA 3IE9A 3TCXA 3VWKA 5EFIA 3AXLB 1M9WA 1HAUA 1GPOL 2XQBL 3OXRB 2J56A 4ZFOL 5I76B 3S88L 1H6UA 4G8GB 4UDTB 1BVZA 1LP9F 1LVEA 1DVZA 3FNKA 3I02A 3HAEH 1FHNA 2DLTA 2E7CA 1FL3A 2NXZB 1DO6A 3ME0B 4F33A 2QMKA 2AI0L 3V4PB 1WTGT 3ULVD 1ZHNB 3QEGL 4J8QA 5ABAA 1OB0A 3RWDA 2F1EA 1GMEA 3KH3A 5I6NA 2IADB 4XAKD 4YDKL 5D1ZD 1JGLL 1OAZH 1JPGB 2YUXA 4DWHA 3VQLA 4R26H 1F90H 1A7QL 2OMBA 2W9DL 4JREC 4CMMB 3ULUC 5FFOA 1EHAA 4KI5D 1Z9NA 2CUHA 3H42H 5HDBE 2WO3B 3NACL 2AZAA 3FTSA 5L7XH 3SPVA 3T2OA 2F0CA 4S0HA 5BRQA 1EQWA 4H4NA 4CVXB 2P24B 1IBYA 2MCPH 2XTLA 2XG5A 5CZKA 1I7ZB 2QT6A 1FJ1A 2EYSA 4CSTA 3HBQA 5E6UB 1LMIA 4PRIE 4HUUA 4NRXA 2EH7L 4LSTL 5DSCB 2E4TA 1UACH 3L7FA 2YSSA 3POCA 1U8PB 3N9GH 4NM8H 4XCEA 4P2QB 5DZLA 3TT3L 4MCZB 5DHVA 1DYZA 4J1UA 1SLWA 2CBMA 1HINH 1KTBA 2AJ3A 5F3HA 4WI5A 3BSZL 1N59A 2XIIA 2DKSA 3GHBL 4LESA 4YHPA 3RQ3A 3CU1A 3L3DA 3UC0H 5BMFH 2YGVA 3HNSH 1FWXA 1NBZB 1UJ3B 4NM4H 3KPRE 4PV9A 2PTTB 3G5YA 4NQEA 1EUTA 3QG6A 5I1HL 4LMQE 3OKEB 4AV0A 5KEZA 3IU3B 2I85A 3GLZA 2CAKA 4YSEA 3NN8A 4AGQA 1VZHA 2EACA 5DWUH 1HILB 1VGKA 1HCYA 5MENB 4OVUA 4CADB 1ACXA 2DLIA 2HFEA 4KITB 4BSJA 5I76A 5HHVH 1OGTB 1NPNA 3VI4B 1WGVA 2GHZA 2RD0A 1GOGA 3KPNB 1UM4H 3X13A 1A4JA 4P07A 1FH5H 2ZXQA 3SD5A 1B9ZA 2HKFL 4NP9A 5FUOL 3TESA 3OLIA 2FT6A 3V4PA 4HUVA 2VKXA 1ZGLM 2P8PB 1MHHB 5DK0A 4J2QA 1WD9A 1A8JH 4OIBA 2K7QA 3NGBB 4TRPL 5KS9A 3IETB 5CEYA 1EJOH 2K6ZA 1FG9C 2EIJB 3B9DA 2FWSA 1KEGL 3LV3A 5IUSA 4FQQA 1RUMH 2YZ1A 1XZ0B 4P3CL 1DDHB 5KUKA 4BFBD 1F3JA 4AUJA 5FAAA 5KYWB 1BJMA 3V4VL 4MRBA 1EA9C 2Z91A 4CJ1A 4WUUE 4X6DF 3VTTA 4R90H 3BZFA 3IXTB 3S3CB 2GC4C 5BRZB 2EDYA 5IMLB 5F1NA 1MZZA 4TYUA 5E6RB 3VFNA 2FGZA 4X6DA 1FO0L 1TYEB 3SDYH 2FJFA 3LN5B 5EU6E 4MCZA 1AE6L 2GJ6D 2Y1AA 4G7SB 3KLDA 4CMHB 1KTJA 2J6EH 4U3SA 4JY6A 2DPKA 4M8QB 3DVGA 5E03A 2P7TB 3D87B 5I1KL 2YA1A 3H0TA 4BYHA 5IESH 1MHEA 3DLQR 2BSBA 4X5QA 1J0ZA 2VQ1B 3DI2B 5FOJA 3RLSA 3RWEA 4BFEA 1PY4A 4GUPB 2NNAB 2G3NA 3NCWA 2HX9A 3IF1A 4P46A 3VFPA 3CBKB 4F8QA 3U6RB 4FQ1L 4OCYL 3GBEA 2XY2A 2HPTA 5BS0D 1N7ML 5IK3A 1SLUA 1R0AL 4YQXL 1CDBA 3NN8B 4UNUA 3U4AA 3ML9A 1MLCB 1HQRB 3EF7A 4PJHF 4BFIA 5EULV 1H9VA 1A1NB 2ADJA 3CFEB 4KC3B 4ODXB 2Z7YA 4FTVE 5E7FA 1GZQA 2FL5A 3MODH 3CFMA 4ZAKA 1RK1B 3BHBB 4FXKA 3H9YA 2FH8A 4FXTA 3N41B 1LTXA 1U36A 3FU9A 4EUPA 5I8CA 3CGTA 2QVMA 5EBWA 1JF1B 2EDBA 3HNTL 3VG9B 3ZUCA 5IBUB 2XKUA 4NKIH 4PJHA 1TSHA 4FEMA 2BJMH 4QHUA 4DGIH 5K5YA 5SWQA 2PKDA 4ZMNA 1EEYB 1UH3A 2A73A 4YJZL 1HHKA 2R1XA 1BZ9B 4PYHA 4JPVH 5KSBA 4WO4D 3TBVA 2HT4C 5EUOF 4NCC1 1DVUA 3QORB 2VW6A 2DQTL 2GJPA 4QOKE 2WZ0A 5ESAB 4AY0A 1GZPA 1AGBA 2RMNA 1WBYA 3QULB 1SN0A 1F3JB 2W0PA 1ZVNA 2ZUQC 5IMMB 3GRBA 5E9DD 1BQRA 1LQSR 4GIOA 5KBPA 1DL7L 4G42B 5JIMA 2O5XH 1ECYA 4G6KH 3DPBB 3MRLB 2F7RA 4AYGA 5JYLA 3KZ8A 1ND0A 4D8PB 4CA4A 4OKDA 3QPQD 4MWFB 3VX0A 1JZ5A 2KLTA 1YDPB 4JJHA 3F01A 3HS0A 2XYCA 1QATA 5JOEA 2DQUH 5KAQG 3GC3A 3TIDA 3LZQA 3NVQA 4F15B 4HK3N 2EDKA 5T3XH 2V4LA 4HJJL 1HHJB 2GI0A 1JZFA 5IJVB 4HEME 1AQDB 1EHNA 3NJMA 2VDQH 5C08B 1HOCB 2PPEA 1E9QA 2CKNA 1Q8MA 2NQDA 2G5BB 2JLPA 2EIMB 4JM2F 3OQRA 3LN4B 4M02A 2OK0H 3MA7B 3LKQB 3V5DB 4P06A 4AE1A 3II1A 3HW7A 1SYSB 5GRXG 3PGDB 1TO4A 1A1NA 1F4WL 1NQBA 3K91A 4KZDH 3WIAA 2OZ4H 1PG7W 3FB7B 3KLAA 1RHFA 5BO1H 4A2EA 4OV6F 1JGIA 2C8NA 3HI5L 1I1AC 2GJZB 4R3SA 1PD1A 4N3UA 1BXUA 3D4GA 4P46C 4F7MB 1K6QH 4NQCA 3OTTA 4AYSA 1MUJB 2BZCA 5F1KC 5LB1A 2Q7YB 5IGXL 4JMNA 3OAUH 4XVSH 2OL3B 3K4DA 5IR1A 1T1ZA 4PJBA 5SX5H 2GUOB 2XY1A 2ZXBA 5CJOL 5EOCL 2EDRA 1V7NH 3GLEA 4OI9A 5C0CB 2AK1H 3NP3A 4QWWC 8CGTA 1PZAA 5IFHH 3MV9B 2WQUA 3GSWB 1YNLH 3BO8B 1JRHL 3WJMA 2BNRB 3ARBC 5F7UA 2GT9A 1NEPA 2JTDA 1QP1A 5I75C 1XQ4A 4DERA 5BXFA 2WNXA 5ICXA 3ULVC 2CBTA 2X1WL 3AG4B 5JXED 5DEGB 3W3BA 5D72L 1L5GA 3HMXL 1D2PA 4BCZA 3VXRD 3VG0L 1G7HB 3ZO0A 1ZTXL 1E3XA 1I9RH 2KLRA 3KBPA 1XF3A 3MFFB 2AQPA 3T2NH 4Q9RH 4FYSA 4XNZB 3U0TA 1HHHA 1E4WH 3FN0L 2Q7NA 1X9QA 4S1SH 1M7XA 2GBVA 4GI9A 2J21A 3SN6N 3RGHA 2IGFH 2YN5A 3MGAA 3TO4B 3UBFA 1INDL 5AAWA 1D5BA 3QWRD 1NMBH 3FH7A 5JW4M 3TS8A 1XD1A 3TYGL 3MOBL 1D5MA 5I1CL 1GZHA 5I1DA 2EXYC 5LCVH 4GAGL 1TTUA 5B1JC 1TPXC 3W9EA 1RP8A 1AVAA 2AAAA 2APXA 2FLRT 3FQ1A 4N4YB 3U7YL 4Y16B 4UM8A 2JB5H 1C16B 2FK9A 3QG7H 4AIZA 2KUTA 2AKRB 3WY1A 5BRPA 5E6IA 1BX2B 3ZXAC 3QR2A 4FNRA 2WLMA 4BKTC 2AHIA 4FDWA 1KCSL 3DXAA 1JZ7A 4NO2B 2EDJA 4ADJA 1AIZA 3LPFA 2VM3A 1WIOA 3UBXA 2E75C 1A6WL 4K2UH 4L3AA 3EH1A 5D7IB 3VFTB 2P80D 4ANUA 3US1A 3QFDB 3CHSA 4UQDA 4XPGL 3WIFA 1JOIA 1LK2B 2DMGA 5C8JA 1BAFL 3LS5L 3NZ8A 4MXVE 3V4PL 3EYUH 4NWTL 4XOAA 1PZ5B 5J11C 2IWFA 3C60A 4ONHB 2ORBH 4HDIB 3MQIA 5LBSL 4UIMA 5DVMA 4QKTA 4PW4A 4PS8A 3CN1A 3DX9A 3VFOA 5EOTB 4LRIC 1A6TA 4FQXB 5BS0E 2HWZH 4B27A 4OZGE 1E4JA 2M83A 1MI5D 4FFWC 4IBYA 3HR6A 4GQ9H 4U1NA 3PWLB 1KSRA 3WD5H 4J4PC 1YEIL 2IO5A 1E8XA 3N85H 4BFFA 1A1OA 5E2UH 4GSDH 5FYLH 4DKFH 4UM9A 1MCCA 3P9MB 3D52A 2FB4L 3NTCL 4N2DA 5HYSB 1ETZB 2VYRE 1ZS8A 4XHJC 3OGCA 1A47A 2A9BA 4ZPTA 4C4UA 1U4FA 1ET8A 1Z5HA 4HZLA 3VGBA 1K4DB 4Y1AB 2WGXA 1Q1JH 3QUMH 2CDFB 5D8JL 1EEQA 2WBJA 3R06B 1KFAH 3A22A 3M1OA 1OVZA 2NDFA 1L3NA 1CU4H 1CFVH 1UZ8B 3P11H 3PPEA 3Q01A 3QWQB 1JN6A 5D9SB 3ASOB 4KHTL 3JV4B 3OMAB 4QIRA 4F27A 2WBJD 1NL0L 1U92B 3OXSB 2V3DA 5HGHB 1AQ8A 4JANA 3REVB 3IBOA 5AFAA 4YHYC 2XTSA 5IB5B 5IQ7L 2OL3L 1K8IB 4PAZA 5DJCA 3V6OA 3DBSA 5I1DB 5EB9A 4C4BA 1KB5A 3ZL1A 4KZEH 2BDNH 1T6WA 1YPZE 4NLAA 3VFWB 2P44B 2F18A 1QFWI 1IGCL 2A4ZA 2FNWA 4PJGE 1CFSA 4JMXA 5D2LE 3HB3D 4PHZA 4Q14A 1MI5A 7FABL 2JK5A 2ZUTA 3AS3A 4NO2A 3L1GA 1OP5K 1E9PA 3ETTA 2Z6FA 3M17B 4WGWB 4CU6A 1Z5YD 1B2WH 2R2HA 4PJFE 5DRZB 4RISL 4L4VB 3QFDA 2AXFA 3VE0B 2XVLA 1BCIA 2HRPL 3EJSA 2IQ9L 2V9QA 2CCVA 2DWEA 3ALPA 4IU3A 3U30C 1FVCA 5E1HB 3KDMA 3WUWB 1PEWA 4N20A 4KVNL 1G0DA 1XCTB 3K4ZA 5IY5B 2DBLH 3PNRB 5K69A 2OZ4A 2DWSA 4I7ZC 5FHAL 3MV11 2JCCB 3ZHFA 3G6DL 1V3JA 2IBBA 3EH2A 3CTTA 2E8YA 2V7HB 1CICA 2JJUA 2PCXA 3FTGB 4FQCH 5C0JB 5EF0A 1ZIAA 4XBEL 3CHQA 4PJEF 3D9AH 5CN3A 4NRZA 1A6UL 4LLDA 5EBGA 5I1JL 2OMZA 2HLFD 1ZEAH 3ESPA 4IIZA 4CMMA 4PIRF 1U3YA 4X42A 2WIMA 3L9EA 1UWGH 4GLRI 4UV4H 3T3PF 5LAXB 3UGEA 3GIVB 2QLVB 2JB6B 2VLKE 1H3GA 2Y07L 3E8UH 3N91A 4WGVB 5ALCH 1HE7A 3ZZLA 3ARDD 3BPOC 2IAND 2CDFA 3ATDA 2XZCL 3ME0A 4F33B 1RZ7H 2ED8A 1YAZA 1XCQA 1XGTB 2XLLA 4FN0A 5IP4A 1PX8A 1U8KB 2LV4A 4JLRB 4MBOA 3V4VA 2R69H 4P2QA 5TE7L 3WKMH 3WIHA 1T7ZA 4LSSL 2I60L 4XP9L 5FC9A 4QHKJ 4KROD 1Y18A 5CZVH 5DD1L 3L08A 2F54B 1KY7A 2BP8A 1UKTA 1U30A 4XP4L 1QASA 3ROLB 3PUCA 43CAA 4OI7A 1JHTA 4POZD 1ZLWH 1SHXA 4PV9B 1JVKA 4K3EH 3MZTA 5JR1L 3VCLA 1O75A 3IAGC 1BLIA 3CFCH 3UBHA 3KVQA 1RCYA 2OSLA 1U8LB 1YEHH 1ZV9A 5A3ID 5KVFH 3BRFA 5I5IA 2JKTM 4IMLB 1MCLA 3GMNB 1JD9A 5IVXE 4HS8H 5FCSH 4ZX3A 3FOMA 4UAHA 1KJ2L 2WSPA 2CH8A 3T65A 3H3BC 1UOVA 3U4KA 4RAUA 4TUKH 2C9XA 4IKJA 3CSBA 1A7NL 5G4OA 1EGJH 2X9ZA 3F04A 5GGVY 1Q9LB 1L9MA 2UY6A 4QRPB 3CNKA 4MJ4A 1Z2KA 4FQJL 4NUJB 4RMRA 4P5MA 2GIYA 1ROCA 2JCCA 5F0JB 3QQNA 3AM8A 2IVFC 2WLNA 1MF2L 4KNQA 4JQIL 4IMKC 4KKAC 4XE0A 2EE0A 4PJAB 4HISA 1NCIA 2ZWZA 3EJJX 1JDAA 4CC1A 2GJ6B 3NPSC 5E23A 2CA4A 4JDEB 1NCJA 1SFHA 5IB4B 2H2PC 4RGNE 4R90L 3O6FB 3C5XA 5DURB 1PBYA 1IX2A 2QPSA 5DU7A 3FQRB 5JOFB 2XTJD 2XN9A 1FO0H 1DQML 1W8OA 3X1FA 4RFOH 3BKYL 2Q2LA 4K8RH 4WW1B 1CXEA 3CLFL 2ROYA 2IBGA 4OZFB 2PWEA 4KUZH 3BZEB 4U0QB 5I0DA 4NN6C 4PVLA 2FATL 2VLKB 5DK0B 2QSCL 2IDUA 1A7OH 2ATKB 1E6OH 3US9A 1VDGA 4OZIE 4IDJL 1R5IA 1J0YA 4MDIB 4A04A 1NMCC 2CM6A 1Z9LA 2IC2A 1G9NL 4M3KB 4M8QA 2P7TA 2D3VA 4LZKA 1OLLA 3QQDB 2EIZA 5HTSA 3IGUA 1TETL 3ROLA 5FR3A 1UB5A 3N40F 5CBAB 3AS2A 4WSJA 2VXQA 1FLTX 1IE4A 1MHCB 4NP4H 1HJCA 2BVYA 2MPAH 1F6AB 4DO6A 6PAZA 5KVMC 4ZMYA 3A0OA 2NY6D 3VXTA 2I26N 3SGDI 5TD4A 4YXLL 2V2WA 3R0NA 3TJHD 1AZCA 5JQ6L 2X4NB 4N90D 1YN7A 4CILA 2DLHA 5LKNA 1SVBA 5E2JA 4JO3H 2VISB 2N7BA 1C7TA 1ZPUA 2HT2D 1TZGL 5BV7L 4Z95L 3O2VH 3II2A 3TP4A 5AKTA 2A6IB 5H35B 4EKXA 5F72S 4PJ9B 1F8TL 1CFNB 4JFWA 2V17L 1FZMA 1M2VA 2L8AA 4N0UB 5SX4H 4HC1L 3T0WA 2FZ3B 2A9MH 4PRHA 5FYJL 3KYNB 3UP1A 3IF1B 4LOEA 3O4LE 5JDSA 5D93B 2W9EH 1F0LA 4F92B 2DYRB 2DD8L 4GMTL 1OAUL 3FT2B 4ODTH 4KDTC 3OX8A 3TV3H 1KLGB 1GCYA 5L6YH 1YNTF 2YBRA 2UUDK 2JCCE 3Q1EA 1JSYA 2YFNA 4I0KA 4IBTA 4JFPA 1WQVT 1QSVA 4X4XB 4W6XB 2BFVL 2GTZB 5D1ZA 2W9LA 1QW9A 4AG4L 3K2KA 3T3ME 3QZOA 3PHOB 4KDWA 4PGEB 5I8CB 2WAQA 3ECBB 12E8L 1KPUB 3H7BA 2D31A 1KCRH 4MNQE 1JF6A 3LIZA 4RRPM 5CSZB 3BZEA 1MELA 1ZDSA 3Q6GL 4OFKA 1V10A 6FABL 1ZMYA 4MJIA 3G6AA 3O8XB 4N0YL 2YXVA 1U8MB 3CLEH 1YMMB 1BZ9A 4ZMTA 1EH9A 4ZS7H 4QXTB 5BZDA 2WZPA 5KVDH 5DJYA 4C8XA 2OXGA 1KXHA 1OANA 1Q0XL 2E3VA 3BZ4B 3HPLB 4GAJL 3V79C 2XBTA 3UERA 3EXJA 4J3UA 1N0XL 3BP7A 4KVCL 5TGBB 3PP3K 3KBEA 5JLZA 5EOQL 1B0WA 5DFTA 3SO3C 3CSPA 3LRKA 1TZAA 1PZCA 2P3YA 5TF1L 4Q74A 4H0LC 4JN2A 3FQ2A 4HUKB 4CKVX 1N8ZA 1S46A 4JFXB 4DF9A 1H8SA 5C0CD 43C9B 3DGDA 1SLXA 3ABKB 3EYVB 5DUMH 5E6YA 4HSQA 1WYJA 4E2OA 3V5DA 4EO5A 3DPDA 3Q8CA 2V37A 3KPPA 1AZRA 3F58H 3KM2A 1E42A 3SQRA 4OGZA 4AL8L 2WB1A 5HDLA 3MRPB 5T8IA 2K8MA 2A6IA 4OF0A 3SKJH 3K5SA 5H35A 3ALWA 2M1KA 5GGRB 1ASOA 1YY9D 2YRBA 1BD2B 2OTWB 1T7XA 1NC4D 4XHJD 2DYSB 1CF1A 2N0MA 3R8BB 3WEMA 4ZZKA 3CVHB 3L4UA 5IROD 4G1EA 1E9QB 2Z4TA 3F6JA 4QRRB 5C71A 2R0ZL 3ARYA 5ACLA 3VG9C 3ULUH 2E46A 4LLYA 4NPYB 3LKQA 2GT9B 3GBNH 3UTPE 5IWLA 3FQTA 4YSPA 1S7QB 3OKNB 2IDTA 4K7PL 5BOZG 3CN0A 4MQXD 3CC1A 3DX0A 1NMAL 5KVFE 2AJVL 1WUNT 3V4LA 3FT4A 3MBWB 4NQVA 2Z7WA 2F7IA 2QFRA 1RERA 1CC3A 1D3CA 2HRLA 1TPXB 4F93B 4PTTB 5IOPA 4LEEA 2CBOA 5C0EB 1KGIA 1JWUB 4EZMA 2Q3XA 2UZIH 3N50A 4NKDB 2J71A 1BFOA 2X09A 4WU7A 1URLA 3S7GA 4UTAL 2OXGB 1JPSL 1WBZB 4XMPH 4EI6A 3KPTA 3SY6A 3BAJA 3K80A 4YVUA 2MEJB 2O1AA 2XQYK 3BSZH 2IH3B 3DVIA 4HCGA 2QGDA 2VW4A 1L5GB 5I0YA 4Z76A 5ALBL 5DVPA 5JPNC 4TXVB 4BELD 1RIUH 5E08H 3C8KB 4IOSD 1XXDC 4ONFL 1EZUA 1R1CA 4B9PA 2NY4C 2W0LA 1PG7H 5I1HH 2BXYA 2PP7A 1OD7A 2E9BA 3STBA 3RPIB 4HPOL 3CFKA 4N90E 4ZW6A 4E9RA 3FXIC 4M7LT 1XMEB 4F8OA 3LS5H 2R83A 2XN0A 3FT1A 4WWOA 4NNPH 3FRPA 4DKAA 4MB5A 2O93L 1D5IL 2VDPH 3C8DA 1AGFB 4FHJA 2BHYA 3DIDA 4PN6A 4C57C 3NFNA 2DM7A 4K9EL 4JFDD