3IE4A

B-glucan binding domain of drosophila gnbp3 defines a novel family of pattern recognition receptor
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
101
structure length
101
Chain Sequence
YEVPKAKIDVFYPKGFEVSIPDEEGITLFAFHGKLNEEMEGLEAGTWARDIVKAKNGRWTFRDRITALKPGDTLYYWTYVIYNGLGYREDDGSFVVNGYSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gram-Negative Binding Protein 3
publication title The N-terminal domain of drosophila gram-negative binding protein 3 (GNBP3) defines a novel family of fungal pattern recognition receptors
rcsb
source organism Drosophila melanogaster
molecule tags Immune system
total genus 18
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2140 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3ie4A00
3AQZA 2RQEA 3AQYA 3AQXA 3IE4A 2KHAA
chains in the Genus database with same CATH superfamily
2YOAA 3TYFB 5I15H 5C0ND 2ZOTA 1ZS2A 4HIEA 1QLEL 1KBGH 2F8XC 4OJFH 1KB3A 3KVDD 1WC7B 1LDPH 1MRFL 2SEBA 4R8WH 1UWEL 1YUHB 3ERXA 1TJHL 1KIPB 2IG2L 3DVGA 1DUYB 2BSTB 3FTGB 3LKNB 4ONFL 4KJQC 4Z8FL 4B9IA 3FUDA 3PS6A 1KMGA 4HKXA 3O0LA 1BZOA 1N6QH 4U3CA 5ICXB 2IADB 3MA9H 4JFDA 5FPIA 2D7PA 1J5OH 4O02H 3ARGC 3VI4E 4W9KC 1J8HA 1N0LB 1C5CH 3SE9H 3MRLB 1D5BA 1KGUA 4OCMC 1T22B 3OLIA 1H5BA 4N0CC 4R7NB 1CCZA 3DJSA 4JVWA 1AHWC 3TBSB 5IHUL 4EBQL 1OCRB 1FO0L 2V17H 4MD4B 4IKIA 5LQBH 1UM4H 3I6KA 2V7NA 1RP8A 4I88A 4XP6H 2VWEE 4ZX6A 2WNKA 3F58L 5C07D 3SJVE 4DP7X 5JIMA 3N43F 2VLJE 4UQ3A 1HXYA 4Y4HC 3IJEB 3NH7L 3VDCA 1F00I 1MJ8H 5EIIB 3E3QC 2XBDA 2BXZA 3AXHA 5TK4A 2E9BA 2WLJA 3BMVA 4OD3H 1C16A 2DTML 2J88H 2VQ4A 4QEGA 4I48B 3SODB 1AMXA 4FQXC 4UWQB 4JQIL 4C56A 4UTCA 4GP5B 3LZRA 3SPCA 3Q48A 4WNQB 1E3FA 5E2UL 5HD8D 4MSWA 4PAZA 5E70A 2WXRA 1OSEA 4MRBA 4YWGH 5E0FA 3O41A 3MROA 3PWUA 1TYEB 2X42A 3UPCA 3TN0B 3BZ5A 2PMZA 2YD1A 4WFHD 2XXCB 3H85A 3B37A 3LQAH 4HAFA 1XCWA 4YR6A 3ALWA 4NQDB 2EUVA 1GGBH 2EICA 1YMME 1QFWL 1Y18A 3G04B 5DO2C 3EADA 5DT1H 3HMWL 4IDJH 3M1BB 3PHOB 3X14A 1HSAB 2A6KA 3QQ3B 4U4IA 4TUKL 1HEZA 1NGQH 2VGLM 5G55A 4U1SA 1HQRB 2WXHA 4QRPB 4JR9H 3TV8A 4ONGH 4DW2L 1JGUL 1C5DA 3TJEH 4RCAA 4L3EA 1LGVA 3BKCH 4PG2A 4Z7UA 4Y4KC 4K9EC 3BZFB 4J4PA 3CJJA 2OTUA 2FBJH 1IAKB 1S7TB 1J18A 4NN5B 2VDMH 2CPCA 3CHSA 4BHUI 5E1QA 1J5DA 1ZHLA 2JJWA 3C5JA 5E94B 5HHQA 3EFDL 4OGAD 3ET9F 5I76A 3EGSA 1E5YA 2EEDA 4JLRB 4A2FA 2FRGP 1VFAA 2UXVA 3ARQA 4HUWB 4MHHG 1RSFA 5D9SB 3RNQA 2HXAA 5I18L 5IEHB 1NCBH 2RALA 1FHNA 1FFNB 2VR9A 2R56H 4K9EL 5JZ7D 1R5WB 1V3LA 3TZVC 4YSUA 1EHLL 5GS0C 2WYIA 1HFUA 2DLFH 4XPBL 3ZE1F 4R5TA 4NUJB 1NLBL 3MRNA 4ADIA 4G43A 3GSUA 2EDNA 2EDOA 4GI9A 4S1RH 3BP6B 2O26U 3TWCL 1EZVX 4FA7B 5BVPL 3MV7A 3MX0B 4CDGC 3DYOA 4H88H 3HG1D 4AIEA 1FGNH 3WKML 2VZSA 2AQTA 2DZEA 5DMKA 3WLWC 1JF1B 2GUOB 3H9ZA 2DI7A 4WWKB 1KJVA 1PFCA 2XN2A 3AU1A 3LD8C 3PU7A 4OLXH 1VZIA 2ATKA 3CE1A 2MCPH 4G80A 4MX7B 4BWUA 2VC2B 4J3OH 1AHKA 3AC0A 2E6JA 4P04A 3HZMA 3X2QB 4UQCA 1TPXB 2OK0L 3PGFH 3QO1B 1XQ4A 1DSYA 2I24N 4C56D 3T8XB 1N5YL 1CBVL 4X7EC 2OX5A 5KBPA 2G3MA 3NEXA 5FGCB 1U8LB 2YQ2A 3TV3H 1K5WA 5DD5H 1NEZB 1FZKA 2HTKD 3NPZB 2X4TA 2NZ9C 5CP7B 5EF1A 5MHSE 3GSXA 1K6QH 5AW3B 3IN2A 4IRSA 4ZXBD 4G6AD 3R4RA 2IFFH 1MFCH 4W9EC 4WAFA 1WITA 2VL5B 4QNPF 2Z0BA 1SNRA 3W5NA 2V8MA 1T83A 4YDIL 4U1GB 4YN3A 2YGQA 1KTDB 4F2FA 1EZUA 3D2UD 4XC1L 3OMIB 4IMKC 1BBDH 4LSVH 1F4XH 3EYFA 3WN6A 2N7SA 5GIRB 5HYQA 3X12A 1CD0A 4RH4A 5IJDC 4U6XA 5BOJA 4MJ5A 1G84A 4K07A 1RZGA 3MLRH 4UILH 1H6UA 3L5XH 3RAJL 3S35H 2ZOLB 4J4PD 3T4AC 4M7LH 3CUPA 1O9WA 2WZAA 4YDLB 4ABWA 4OLVL 4ZUWA 5DD3H 3MLVH 3QDJA 5SWZB 3C8KB 5F3FA 1TVBA 1CT8A 3CD4A 2X1OA 2CIKB 1B6UA 3NIDB 5D7LA 3TBTB 5H8DA 3WAKA 3VXMB 1XL4A 3QEQE 3QISA 5DK3A 2EADA 1GXEA 4DN4L 1IM9B 3CK0H 5MERA 3HC0B 4LEBA 2XZQH 5FYLD 3WHE0 1B88A 2Z1PA 1OGAE 4BCXA 1J5CA 4AMKL 4ORGA 4MMZB 4XXWC 1O6SA 5DJDB 5ECGA 4OVVA 3US9A 4G7VH 4UQEA 1QFHA 3VQ1C 2R4SH 3IYLW 1QVOB 4GSDH 1CG9B 1G9HA 4XP1L 5I1GH 4CVUA 3N2JA 3ZXAC 4UV4H 1HL8A 4HISA 4ZW5A 5IB2A 4EDXA 4YHPB 2CALA 4E42A 1W72A 1HKLH 2NY4C 3L13A 3QPKA 4AGPA 2FEEL 4Z7QB 3DIDA 2BMKA 4EI6A 1XGZA 4JQVA 3F7YB 4DKEL 3E6FB 2XRAH 2CLZB 1MCDA 1EXGA 3MACH 1D5IH 5DQJA 3HC2A 3PWPA 2WD0A 4MA8H 5CP3A 2R39A 3V7AG 3TT3L 1YHPA 1DQLH 2G75A 1K2DA 4H13C 1W16A 1K3IA 1CGSH 5I1IH 1DUYA 1RMFL 1FIGH 5KYXB 2R1XA 1MCWW 1FZOB 1AI1L 2DQIL 5BXFB 1VGKB 2YOCA 4OJAA 3FU7A 4NRZB 1JYNA 3V6OE 4BGLA 1YYML 1AZBA 2FD6H 4RAVA 4WVRA 5IGXL 4AEFA 1BECA 4H8QA 5KUMA 4WTQA 2HJFA 2VRAA 5KVGL 1BM3L 2ADYA 2WMPB 5BRZE 3L3DA 4UDUA 4G1EB 1I8LA 1I9IL 3CQFA 4L0YA 3DV4B 1RZFH 1WEJH 4UOZA 3X17A 1MHHB 2WVTA 4PJBF 1BD2A 4PJBA 3VFVB 4AGNA 3AFLA 4GXUM 3FDWA 3OZ9L 4JPIA 1U8KB 2NY3B 3C6EA 1U8JB 1N7ML 1Z0MA 5KANI 1BQHG 2V2WA 3MI6A 4D0BB 3DX9B 1S8DB 4GW4B 4ELKB 3B3IA 5D7LD 4M93C 3D7PA 3UBFA 1JL8A 3MRIA 4JZJB 1RURH 4P4KA 4L8DA 5BPPA 5DJ6B 5A16B 4GT0A 4I48A 5I26A 4NKIH 1SQ2N 3VTAA 2L7UA 4WNQA 3DSFH 1CYWA 5ISZD 1SXCA 4EEEA 1ZANH 3MRJB 2VRKA 4OZFB 5LO7A 1NCGA 1A02N 2QJDA 5B22A 3WDHA 3G5WA 5E56A 3TF7C 4Z7NE 3TN0A 3BWUC 2J73A 3FT2B 5B1CA 3WHXB 2APFA 3O3EB 1W0VA 3DJTA 4JM2B 1FAIH 4G8GB 4HKJB 1YEJH 5DS2A 2DQDH 4WEEA 4F1ZA 3D0LB 3L5WB 3LV3A 3PHOA 3H42L 4X0KB 3JVGA 4KK6D 4OM0H 1BJMA 1Y6MR 1CLCA 3T0XA 1INDL 4Z3EA 3ZDZE 4OGQC 2HVJB 4PJFB 1AGEA 2HT3D 3LRGA 4J39A 1LQBC 3H7BB 2Z31A 4MQXC 4JY6B 1ADWA 4PW9A 1T7WA 4HFWA 4X99A 2ZF8A 4AGQA 3T6VA 4KUCF 5C7XL 1QFOA 4RDQF 3DTXB 4LFHG 4OH2A 1QKZH 3N50A 1RUAL 4JLRA 1JF6A 2RR3A 5D9SA 4QMEA 3QRBA 5E6ZA 4QF1B 5C0AA 5E9AA 5DRWB 1R5WA 4K9JA 2YS4A 4LLDA 1AR1C 2BOCB 5E1HB 4PLJC 4KRNA 1FSKB 4M43H 4MYPA 2LLNA 3DIFA 1S7VA 4NGHH 4CNIA 3D07A 1JZ8A 1F8TH 2X6BA 1L9QA 1SHSA 3U2IA 3IU4L 2HJLA 2QDVA 1ND0B 4XOCA 2VXQA 2P26A 5BV7H 1BMGA 3IGUA 5GGSY 3T77A 4E36A 2JB5L 4RBPK 2YKKA 2GUOA 1HK6A 2VW4A 1VF5C 4DWHA 3QUYB 2ICEB 1PG7X 2YSSA 3ZJAA 3CDGB 2QQNH 4NI6A 4BM7A 2I07A 3CFNA 3UTTB 5AG9A 5LGJB 3VFNB 1SXNA 1TZGH 3AVEA 3CHQA 1MEXH 1YNTB 1WYJA 3HPJA 4ZODA 3QK0A 4FFYA 4YSQA 3V52L 3PP4H 4M9OA 2MQGA 2VSKB 2W88A 4FJZA 3UZEC 3TBWB 1CLOL 1XWVA 4JEGB 5I19L 2HKHL 3APFA 2NNCA 2A1WL 5E2WH 1KFGA 2AK1H 2CZNA 4KQ3L 4PY7B 2QL1A 1NGXB 4XWGL 2E74C 3TN0D 3QZBA 4GBXC 3T1FB 5M95B 4N9GA 4XHJC 1SMOA 5C0EB 3F12B 5ESVB 4CSPA 3L3JA 5D6DC 4ZYKB 4FQCL 1FL3A 2A4EA 3ZRCC 3TBBA 1FC1A 4XMKL 1YY9C 5DRXB 4LCVA 4G2AA 3V8CA 1G5AA 3OKYA 4KFZC 4CSSA 4P0DA 3V0JA 4POYA 5K9QI 3BW9B 4A7TA 4QRPD 4P5KB 5GIRA 4DKFH 2YRPA 3QPQD 1PMYA 2VDPL 4CMHB 5F1SA 5TQ2H 3S37X 3H4FA 4JDZB 3TJHD 3D9AH 3LXCA 2ZOLA 4FL4C 3CVIH 1ECZA 3BQUB 1JD9A 2EINB 3FO9B 2J8UE 3PYCA 4Z9KB 5LBVA 5G4OA 4BUGA 2HA1A 1JGDB 4FTDA 4IOSA 3D3VB 3UJTH 5J0BA 1NCTA 4KZEL 2Y22A 1OAZL 2NUPB 4L8SC 4ZAKC 4FZ8L 3VA6A 5DWPA 4M62H 3IMBA 2E27L 3O2DA 4PJXF 4DN3H 2LFEA 4PJXA 4G3YL 4I0PC 4NUMA 4XCFL 4YEFA 4FEIA 3HC0A 4DP9X 3GJEA 1TVDA 3P4MB 3LNFA 15C8L 3TEYA 1ACZA 2QV4A 3ZTNL 3SCMC 3IDMB 2ERJC 3GMQA 5FS5A 5CF3A 1NGZA 4DETA 1MCNA 2PCYA 1QSFA 4P5RA 4YDKL 1BMWA 3JTBA 1CG9A 5F71A 4P2QB 2BY0A 2VR5A 2YPVA 2FEDC 1ADQA 4WK2B 4DPBX 2DQFA 4WWKD 1RUPH 2MFNA 3QH3A 3ZT7A 1EUTA 3I9PA 4BH8B 5JIPA 2YZ8A 4O58H 4PCSA 1JXFA 3QEHB 3QQDB 2YARA 2YMOA 1U0QA 2XNAA 2VE6B 3KBPA 4JRYE 4V2BA 1G1OA 3LYRA 1IKFL 4JKWA 2IQAA 4K7FB 1G9NH 2EVGA 3QUXC 2NDFA 1CE6A 1JFQL 1HYRC 1QI4A 4YSCA 2CHXA 2VQTA 3U36B 3V9FA 3MRGA 5H94A 3RU8L 4AIZB 5IESL 3OJDB 2OP4H 3OAUL 2GSIA 2XPGB 3KDMB 5AB1A 3EYQC 1AGBA 1PJWA 2GBTA 3WDJA 4ZZFA 6PAZA 1FV1B 5IQ7H 1MLCB 4YO0A 4APQA 1DSFH 3BKYH 4NQSB 4U1KA 3BLBA 1JV5B 4C59B 4AYID 4ZFGL 4NOFA 4Y1SA 3GXUB 1QQDB 1HXKA 1Y0LB 4Y5YB 1J8KA 4RWYH 5DHXB 1PEWA 5BW7C 2XBTA 3DV4A 1GJWA 3OXSB 4UBDD 3PGDA 3M17B 2LU5A 5B7FA 5E8EA 3ULSA 3EFOA 3E38A 2P46B 4NO2B 2BSSB 3K1KC 3UH8A 2ZXGA 4HD5A 2VUYA 1M7UA 1RFDH 3HHSB 2CDEB 4YUEL 3BUYA 2WJ7A 2BRRL 2EVIA 3Q8BA 1I8MB 5SWZD 5HHXH 2LE9A 2N1KA 3U4EA 4M8QA 2CUIA 3EYUH 1AD9B 3BT2L 4JFOA 4KI1A 3ZZ1A 1X7TA 1YUKB 1RZKC 4U49A 4MBRA 5J89A 4QRRB 5AWNH 4WFED 5JXEC 3VXMD 1DBAH 3JWDH 4HP5A 3B7RL 5DJ6A 2ZPKH 4UQDA 4MXVE 1IM9D 4JM4H 4AG4H 1FNLA 4XBPA 4M1GL 6CGTA 4GRLB 2W5PA 1OOWA 1AXSB 2ODIA 4OB5L 2AJUL 4G7YH 2G0KA 4TNGA 4XVTL 5DS8A 5EFIB 5HHMB 3L6FB 3T6ZA 1RZKL 3RJOA 5L0QC 4Z7OF 5KBLA 1J0KA 4N8UA 4YOKA 3ILEA 3FT2A 3OPZH 3WHXA 4W6XB 1JPST 1L9NA 2E8YA 4PRIE 5CCKL 3AACA 4JM2A 3R8BB 1JS4A 2IBBA 1TVHB 2WXGA 3JV4B 4IHOB 1TKWB 1DVZA 3L5WA 2XYCA 4M7KH 4LVOB 1OAYH 2LU7A 1SF3A 1EA9C 3D39A 4PW4A 3W2DH 4PJFA 2HVJA 3DO7B 1PEZA 2OCCB 3N85L 4QPEA 1IKNC 4XC3H 3LX9A 2A4ZA 4JKPH 3WS3A 2QLYA 4POZC 1HHJB 3NSXA 5B1BB 3LTVA 1RUQL 3D51A 1VA9A 1NCDL 2FECL 3AW5A 3CFQA 4HEME 1MREH 1DBKL 4OZIB 3VD3A 4ICXA 5EBWB 3GRWH 3HBGA 1TQWA 1BPLB 2BJMH 4FTVA 2Z91B 2WB1A 5D8JL 4KH2A 3RY5A 2WSDA 2P52A 1KCUH 2YLKA 5IQLA 1RK0B 3JV0A 4AENA 4Z7VE 5F21B 3RVXD 4ENEC 1EEYA 3OQ3B 2ZYRA 1UH4A 3HHRB 3I6LE 3L1OH 4MCMA 3ZO0A 1I3RB 2EXSA 4Q0XH 3MGTA 3L9RB 1R46A 1I9RH 4EUPH 4X8GA 2IEPA 3MJ7B 4KKRA 1J9TA 3EO9L 3LDBC 5EZIH 3I74A 2JTDA 4CVZB 1WUZA 4JCMA 1XMWA 2W07A 1EO7A 2WZ0A 5FUCC 2WINB 4LMQI 3IFPA 4FX5A 3THML 2VXUL 1YAZA 4DZ8B 3VFUB 1HQ4B 4L4VA 1DLFL 1EJOL 2NY3D 3GMNA 3W0WA 3DSNB 5EBGA 3RGVB 5HI3C 5JW4Q 1ZT4A 1GOGA 4ZNEE 2W1NA 3UTTA 2AV1A 4WUUB 3M88A 4GNKB 2WNWA 3WIHA 1YNTA 2LVEA 1QA9B 1NPJA 4EXPX 2ZJSL 5DHVA 3VXQB 3D08A 4KWUA 1U95A 3AB0C 4K5NA 3TBWA 5L4MA 2W60B 1XBRA 1WWAX 3CZEA 4X8JB 3KWUA 4DQAA 1KJ3H 3ETTA 1T7VA 3L3OB 2FYYB 3ZR5A 5IOKA 4QD2E 1W9XA 5FO9B 4IIQC 4PY7A 2ADJA 4RBPH 4X83A 3WLBB 1NAMB 1AH1A 2F1EA 4S0TD 3K81A 5KN5B 2MQCA 3ARSA 3IVKA 1PZ5B 5GGTL 4MJJA 2QPDB 2ZTBA 4LSQH 1SDAB 4LVHC 4BK5A 4JM2D 1MCIA 4LRIA 2PR4L 2YUZA 4G8GD 4OFDA 4ZMPA 1YJDL 2WBJB 5E99L 3S3BB 5GRUL 3BVTA 3VD7A 4M6AA 1L9SA 4A67A 4BFFA 3QIBB 1JDDA 3WFDL 3BE1H 2ADGB 3RJDA 4HHWA 3LPFA 3O6ML 4RGMB 4ZD3H 1A1MA 3BJLA 1UZ8A 4Y1AA 2GT9A 4DQOH 3OZLA 1WA0X 2A9NH 3NDZE 3O6LL 4JFEE 3HAEA 4WTZG 3VJ6B 2BNUA 4FQLL 3RWFA 5FYKH 3HI6L 4YHOL 5LN4A 2H8PB 3KLAA 1B4JH 4FMKA 1S7RA 1JGDA 1HZKA 3TYGH 5IG7B 2NUPA 3SPJA 2OMUB 2DH3A 4M7LT 2WLLA 5EHFA 5HP5A 2BVEA 1T1WB 3P3TA 1KJ2A 1R3JB 2EABA 4I13B 2Y69B 4P2OA 2AEPH 4WY7H 3P9LB 2BPBA 4JFZL 2OMWA 1D2OA 3C6LB 3N9GH 3KPSE 1VB9A 1M9SA 2VZTA 3MNDA 2GK0B 4GXVL 4P48A 1CN4A 4KDVA 4ODUB 4JG1L 1FFQA 4K73A 3QUGA 4N5ED 3QVAA 4X9IA 3T0EE 4HV8A 5HYJE 2I5YH 5FA4B 3QSKB 2ADFL 3OMAB 1EJ6A 3VWKC 1N18A 2VAAA 3S97C 3WO4B 1S9KC 4YZFF 3GMOA 1BWMA 2OL3A 3BVDB 3KYMB 4P99A 3QUYD 2G60L 5EZJA 3FB5A 3GHBL 3QAQA 2JKIS 5D2NE 4RAUA 3FMGL 4E9LA 4AQ8A 5HY9A 3QEHA 5EUKA 3UTTD 1T89A 5HHOA 3H6AA 2BCMA 3MJ9L 4U1LB 4F15B 5D1QE 3O45B 4XVUD 1LILA 1NOLA 2ILLA 2OJZH 5IT2L 3P3YA 4AM0Q 1BF8A 3MBEC 3T8MA 4N6QA 1NCWL 3S36X 5FCUH 3UPRA 3HN8A 4A63A 3UMTA 1U8PA 2CNZA 5GZNA 1Z9PA 3A3YB 3NG5A 4L29A 1VKXB 4XVSH 3C87A 1MAKA 3OKNA 2JNZA 2VLMD 1UASA 3V2AR 1H3XA 5BO1L 4FQHB 1HAWA 2Q3AA 4JPKL 1YAIA 1KCBA 5JIIA 4MDJB 3OKMB 3V4UL 3BAEH 5F7YC 3ZN6A 3OXSA 3M17A 4FFWD 2HMID 2ZYHA 5FHAH 4M5YH 1QPKA 1F6AB 3GUTA 4OLWH 1M2OA 3ZRFC 3MJWA 4JFFA 2X4UB 1A0QL 5I8KL 4UOQA 2DKMA 4LCWB 3DXAE 3GZQA 3H8NA 1PAMA 3D1MC 3UZVB 2CCWA 3NJJA 4JB9H 1JXKA 3F6LA 4AQAB 5CJ8A 1CTOA 4XO8A 4N2BA 1GZPA 1WBYA 3IDXH 1QRNE 4MS8C 5M94B 1GGCL 4WK0B 4HOXA 3E8UH 3P4NB 1FH2A 3OAZH 3T3PE 5I1KH 3P1VA 2IH1B 3U6RB 4OBSA 1OAUH 1OHZA 4G6MH 2FUTA 2Y24A 4D7BA 2R29H 3I84A 4KMQA 1TTUA 5AOZA 3MC0A 3QP3A 3V7AE 1OTUD 4W1TA 3K46A 1JZ3A 4U1HB 3SDAC 4N4YB 3B9KB 1R3KB 4YE4L 4OCNC 5F44A 1JGIA 4GAFB 1WGVA 3RZCB 4XCCH 5KBNC 2JCCB 4JGNA 1BSIA 4P2QD 4TN9A 3KWXA 3UBXG 5TE4H 3ZYZA 1M57B 3KCPA 5E08H 2K7QA 3MUGB 1TVHA 4FQJH 3WSQH 1IAIH 1MFMA 5EPMB 1WS8A 5EC1B 1RZIA 3BUTA 3NCWA 1BREA 3QG7H 3IU3A 2R9HC 1ZV2A 3DUHA 3LIZA 1UT1A 2GJ6E 3UX9B 4JRLA 4J2QA 5F1OB 1X5HA 2OCJA 2ADIA 3CLEL 4KVNL 1EO8L 4LIQH 3UGXA 4JFPA 1P1ZB 3ZLQC 4FP8L 5EBWA 1FIEA 3MUJA 2VT0A 2IGFL 2I85A 1GW0A 4XMZA 3RZWA 3T71A 1G1YA 3DGCR 1H15A 2H1LM 1P5UB 5FYJL 3SKMB 3MLTB 2CRMA 3KPNA 2W81C 4I3GA 5GZND 4PVLA 3VXSB 3ARDA 5I6XB 4M29A 4YQXH 2QSTA 2G2RA 2XXFA 2WYTA 3DX3A 4RLDA 3CVHH 4G9FE 5DHDA 1A64A 3MV8B 3ISWA 1I8UA 1TSHA 1CC3A 2FGZA 3FFDB 4NZFA 5DF0A 3WN5A 5KS9E 5JHLH 2X4OB 1NCAH 2CR3A 3IETB 4UQ2B 4CVZA 2F61A 3ARWA 3TH2T 5JHMA 4M6ML 1PG7H 2VR8A 3ARBC 1PZSA 4HT1H 4MAYB 4RSVA 2ZOKB 2IQ9L 4FXLA 2LV4A 1B90A 1HCYA 2E7CA 1GJIA 5D7IE 5AQ0A 1IGCH 1ZIAA 4JFFD 1FL5A 4XVJH 3DX6A 2ODHA 3MOBL 2IAMC 4UI2A 4JFQB 3EOTH 1JGEB 3H3PL 4ERSL 3NN8B 1CICC 3DKHA 3V4PL 2VN5A 2LLGA 3FQYA 3VFWB 1CD9B 4WGKA 4P9HH 4WUUA 4QRRD 2CR6A 2ZF9A 1UXWB 2AMUA 4YC2C 2IFGA 5B1JC 3AY4C 4MS6A 1FZMB 2PPDA 4CGUB 2Q76A 4EIBA 1HJBC 1IEBB 2KERA 5TQ0L 1AVAA 1T03L 1LEKB 1YEIL 3FF8A 4X8JA 1SY6L 3VM5A 1XXDC 5CLYA 5GZOA 3L4UA 3L3OA 1XCQB 2XOTA 3N06B 4CU8A 5H35A 1IZJA 3X1GA 5GGVH 4RRPM 4X5XB 5HHMD 4WTWA 3D52A 4UIKL 2G5BA 3NJIA 5JMOC 2YFOA 3U7YH 5IFAH 2B7DT 2Z7UA 2X89D 4A68A 2NR6A 1AC0A 1EBAA 2GI0A 3MBXL 1R3IL 4QHPA 1ZDQA 3IMTA 4ZS7L 5AAMA 2FJFA 2BXYA 4WO4C 5AOIA 3CX5K 3LN4B 4I9WD 2WUBL 3O0RH 3QIBA 4U1NA 5FW6A 2GJJA 4JJHA 4ELMF 3B8YA 3SDCB 1X5IA 2H4EA 1JPGB 3KHQA 2AQ2A 3FRPG 3ZTCC 1OCWH 4OR1A 1UURA 3QUMA 4WDIB 2EIZB 1HHIA 5ACZA 3MV9B 3IFNH 1DBMH 5LLIC 5IG7A 1HCFX 1L7TH 2OMUA 3NAAH 1MCLA 2EDDA 3T08A 4OKDA 2HT4C 2QQKH 1QI5A 2YIHA 5B3JF 3P9LA 4W9ZA 2YK1L 1RHHB 1T7ZA 1OE3A 5T3XD 5CJ5A 5CFHA 2NLJA 4OKVA 1E8YA 4GQ9H 1S9XB 2LABA 4E0RB 3RPBA 3UC0L 3QFJE 5ICZB 1DBBL 1U42A 3DWTA 4HHGA 2H32B 2JIXB 3CXDH 2Y06H 1TTBA 5AZEL 2G4EA 1VSCA 4FN0A 1NAML 1Z9SB 3LQZA 3FT3B 4DGIH 3CCHB 4G59C 3IKKA 3RGVD 3KYMA 3T2PA 2FAUA 3T04D 2NY0B 4D9QD 3OC8A 5EBLA 4WUUD 3CLFL 5CD5C 3ZTEA 4JO8A 4AEHL 3W57A 4OFYA 3HRZB 3TVMA 1Z9MA 4KKPA 1ZEAL 1MIEH 3O8XB 2ZX6A 3O4LA 4OCWH 4PJ9B 1VAHA 1MPAL 2P8LB 3UTSE 4ZX4A 3QZWA 4KKLC 2QPFA 2AJZA 5EA0L 5JQ6H 2R2HB 2WANA 4RQQB 4LO9A 2VDKL 1FDLH 1T3FB 3DGDA 5FFGA 5GSRB 2XX0A 4PPTA 3WIIL 4L8BB 1NGPL 4UF7C 4K3EL 3VRIA 1VADA 2WXKA 3WUWA 4MGXA 1W8OA 3C2SA 2OYKA 4PBVC 5CU5A 1IBFA 2OMXA 3O9WB 1VKXA 2N56A 4JNXA 3JWNC 1UD4A 4MJIA 1RU9L 4Y2LA 3BGFC 1TJXA 2C26A 2WBJD 1YEEH 4N8CL 3C60C 4FQHA 1KLUA 4RFNB 2BSED 3CAFA 5FUZL 5J3HD 3QZOA 3FC8A 3NCXA 3QIBD 4P07A 4R97C 1GIGL 1HH6A 4ZFFB 1ETZB 4FS0A 1UENA 2F19H 4NP4L 5DJAB 4Y4FB 3N42B 2VM9A 1CXIA 1PDKA 3QQ9C 5EH1A 4G8EA 1XD1A 3KD4A 4TF4A 1BAGA 1AZRA 3SDXB 4HPOL 4L0ZA 4ZMWA 1E5BA 1B4RA 1ZGLP 3QXAB 5K9QG 3ASOB 2R7EA 3TP4A 2Q7AA 5K9JL 1DHKA 2AAVA 2MH4A 1S4IA 4QHNB 2X05A 1MNUH 3EUDA 1NCOA 1D5ZB 2X5PA 3ZHDA 1NIBA 2E76C 2X4RB 3RUGB 5ADOH 1BZ8A 3CSFA 2WVUA 4E9QA 4DK5A 2DICA 2RIKA 1N9PA 1ZV5A 2DIBA 2IH1A 2FQGA 4XZUB 2ED9A 5D2LE 3NIGE 3KYNB 3CZSA 1GZQA 1P4IH 5FKAA 3C6LD 5I9QC 1DDHA 3U6XA 1KULA 3D30A 1TTGA 2ZZUT 1Q1JL 3O6KH 4WFHE 2Q8BH 1THCA 4MXQD 3OGCB 1YPZE 1GC1C 4DGUA 4KHXL 4YIQB 1K8IB 4ALAC 5IBTL 5IEKB 4YSPA 1IAOA 4FHKA 1KDIA 4WKXA 2RMNA 3P73B 5DMIH 1JWMA 5EUOE 4B9PA 3KMDA 3AY2A 1EZSA 3I85A 1AQKL 3UYPB 4TOYH 4AXWA 3I3BA 1U3HB 3MRCB 4LSPL 1AXTL 3QRLA 1EX0A 5ETUB 3QWOB 1GC1L 4EE2A 3LKOB 3NJXA 2FWOB 2V5YA 4W9FC 2HPTA 5J1AA 4O02B 4NN6C 4I7ZC 7CGTA 3HFML 5FC9A 2H3NB 4XBGB 4DP2X 5DGQA 4O00A 4NKMA 5IW3A 3S34L 5K93A 3L4YA 1KIRB 5EMYA 1GA2A 1WZAA 3C5SB 4M8VA 1IFRA 5AVUB 4JFTA 3UBHA 3WFBL 3H9YA 3G5XB 5EORH 4ZMOA 3ULUL 3FUIA 3NABH 3UACA 4TSBH 2BINA 1EGJL 1R5VB 2DQTH 4OI9A 4I3SH 1A6ZA 3RFZC 1F58H 1CF8L 1E4XI 3FQ2A 3U2SB 4LLQB 2X4QB 1IC4H 1ZWIB 3BSZA 5C0GA 2CO6B 4BZ2L 3ILQD 4U33A 1DEDA 2IWEA 2NSMA 3HMXA 3IETA 2B1HH 3HG1E 1E9QA 1ACCA 3M45A 4LHUG 2FCBA 1MUJB 25C8L 4L5FE 3ZY7A 3QRGH 1FBIL 3GNML 2VLLA 3B6SB 5E9NA 4IQHA 3ULUD 1R24A 2RB8A 2H6PB 3QJFA 4H20H 3AQYA 2VLRA 5T3ZD 5SWQB 5C2BL 3E9TA 1EV2E 4LCWD 4MDIB 4H40A 3PDGA 1AOZA 4U3SA 3B2VH 3CFCL 3V55A 3RGBA 3W9DB 1ZLSL 4QYAA 5C0CB 4NQXA 5ALCH 4MCYA 5LBSL 5HJBA 2E7LC 4TL5A 1D7CA 5TD4A 3GM0A 3IMRA 4F7CB 4OCSL 5GGRY 4J5VA 3T0VA 5TTRA 1MLBA 2LTQB 4OCLC 4Y5VB 1QPPA 1H3WM 5JXAL 4JREB 3B9KD 1OHQA 1K72A 2YD5A 4PSRA 3RZCD 3CN0A 3VO0A 3I9GH 2HJKA 5E2TL 1A6VH 2XC8A 2VDMB 2R23A 4ODTL 3IJSA 4W81A 1XF2B 3KPLB 4HZ1A 2YN3A 5HD8C 1D2PA 4NO0B 2WXNA 4FYRA 5IFJB 3L95B 3EHBC 4I18C 1G9MH 3ZL4L 1SOQA 3QEUB 2IDTA 4G70B 4NM4H 2OM5A 1VFOA 3VB9A 1CDJA 1D6EB 2V5TA 4J1UB 4P4RA 3BUPA 3TEZA 1MHEA 4LDEB 3OR6A 3KPQA 1K3ZA 3GSVA 1AFVH 5FCSH 2F53A 2XLLA 4XVOA 3HCVA 3OJVC 2HRPH 2NNAA 1CLVA 5K1NA 3MV9A 5TE6H 3W39A 4N0UB 5JIHA 3U4KA 2EH8L 1AE6L 4JM0A 1JSYA 4Y9CA 4YBHA 1RZPA 3VXSD 4XZ4A 4LHJB 5FYLE 3HZVA 4Z7AA 5I82A 5F7UA 1T2XA 1RIHH 3V0EA 3HBQA 2IMMA 1MRCH 1JNHB 4WW2F 1QFPA 3K91A 4PN6A 4WW2A 4KK5C 3MV8D 1NSNH 4GG6B 5EO0B 1YQ2A 4RESB 2GHZA 4ZUUA 4TNWK 3KLLA 2Z93B 1ZLVH 1CJYA 1ZPUA 3O2WH 1T6VN 3WTXA 2AW2A 3F7VB 4MAYD 5A2CA 1T4KA 3V79C 4DCQB 3FPXA 1Z9SA 4YSRA 4IS6A 5JNYB 1G6RH 2VLRD 3FQ4A 2M2DA 4UB0L 5CUSH 3TTYA 2BSRA 3T3MB 1H5BC 2UZXA 4X9FA 3IXAB 2A7BA 3KYOB 1A9BA 1JI1A 1LWJA 3QDGB 4KAQH 5AVQB 5GISL 1J1OL 3S36H 4FYSA 1IGML 5A7EA 1SLXA 3HRZA 1QO3B 2I69A 2VDQH 1SN2A 3WENA 2BRQA 4ATTA 2P8LA 4IKNA 4YHYB 1JZJA 4BSVB 4HXBL 2IV8A 4X6DF 4JRFA 3WY1A 4X6DA 3AS3A 3NT0A 4QHLB 3MREA 5EEYA 1MVYA 2AJVH 5KBKA 5MENE 3A67H 3M86A 1M7DB 2DYPB 4PVNA 4GLRH 2DAVA 2WIIA 1GR7A 4O5LL 3U0TB 2NUTB 4QO1B 3BEWA 1F90L 4PRNA 2C1PB 3ML9A 1HOCB 3ILPA 3GHPA 3P3UA 2HT2D 1CUOA 2XV6B 4J3XA 2WQVA 4HXAL 1JZEA 3NDYE 1JUFB 4HG4J 3S3DB 1F6LL 3SDCD 1W15A 2QTVA 4N1EA 1BFTA 1HCVA 5CGYC 1F3DJ 5DEFB 4QWWD 4WWID 4PJDE 1B0RB 1UCBL 4PJHE 3MR9A 3WGUB 4UTBL 3QIWB 3SPHA 3EYVB 3MV9D 3L4ZA 4WCYH 2K6YA 2A77L 1DFBL 3RUGA 3EG9B 2XACC 1NUGA 2C1OA 1OWRM 5I17B 5ISZE 4FEMA 4OZHF 3SDDA 4PG2C 5T33L 4OZHA 4CVWA 1CZ8L 4BFIB 2BO0A 4J4PC 4Z76B 3N44B 3VXTB 1NC2B 1CGYA 5I71C 4Y9FA 4PGJA 5D1ZA 3ME0A 3VX1A 1QTSA 1BVKB 3ZU8A 1DVSA 1BQ5A 1TEYA 3D0VB 4JY4B 4ZMYA 3VXUE 2B9AA 4PJAB 3OPUA 4PJGE 1JD7A 2JIXD 1TZIB 4GMTL 4BWWA 5MEOB 5E2VL 1OZUA 2B59A 3K72A 5I8OL 4LSDA 4PRDA 2O6FA 5EEVA 3B9VA 1ZVHA 5CWSB 5GRJH 3MXWH 2WTPA 1DJSA 4HZLA 1J0JA 3SDYL 2H7WA 3ABGA 4H4NA 4NLAA 5ETUA 4WJG3 3QWOA 3NGBB 4U1MA 4H2CA 3RKDC 1RJLB 3DO4A 1LLAA 5FM5M 4N20A 3BRFA 3O8XD 2PCXA 3CSPA 4PJ9D 1R1CA 2DJMA 3QA3A 1J9CT 3CC5A 4MA1B 5D7JA 3C5SA 2WLYA 1E7UA 4Q89A 3H3BC 2Q20A 3FH8A 4E68A 3FN0H 1X9RA 3QFGA 6PCYA 2GABA 3BH9B 2R0LH 3BO8A 4KTDL 1R5VA 5E8NB 1DYZA 1MQKH 1XH3A 2X7LB 4IRZA 3G5ZB 3TEXA 2D4FA 3UIYA 1UA3A 3Q5TA 3SGEI 4LLQA 4GG8B 4NYLB 1PSKL 2Y36H 5D55A 5GRWA 2FJGA 5DD0L 1UVQB 3MODH 4AYSA 4YBQC 5DCCA 2PYEE 3ZBMA 4HIIA 3AXLB 1EZVY 1QACA 3VU2A 3EOBB 4IRSC 4Y4FD 4ZO6A 2VR3A 1DUZA 1L4IA 3BH8A 1KXTB 3GO1H 1CFTA 1ORSA 3NFSL 3Q6FA 3OMNB 5C08A 3B6SA 3WELA 3PV6B 5I15L 3QEGL 1QBAA 1MWAH 3EGDB 1KBGL 1XX9C 4PS4H 4CRPA 1LDPL 1HXMA 1ET5A 4R8WL 1MCWM 1DZ0A 4DTGL 3TBVB 4KPHL 4KK8C 3W9DA 4H8UA 1N6QL 1C12B 3K80A 2Z35B 5DUBB 3MA9L 1BEYH 4KXCA 2QGDA 4F7CA 3AGVA 3F3HA 2ESVB 1D5MB 2EE2A 4O02L 5DDHB 1J5OL 4OV6F 3F64A 3ML8A 1C5CL 3QO0A 1KLFB 3SE9L 1TG8A 1Z3GL 5B39B 1UXMA 2FT8A 2WNXA 1NWPA 4NQDE 1ZT7B 5ESQA 4H1LA 4AYMC 4QXTB 2KMWA 3APMA 1T66C 4U2YA 1YY8A 2J8HA 2C4XA 3ES6B 4NQEA 1M05A 2V17L 3CGTA 1TQSA 1UM4L 4WKZB 5LQBL 2HLFD 3L2MA 3CDZA 1LK2B 5CEYB 1IGIH 4RMUA 1U3HD 3PAVA 2VQ1B 3KPLA 3P2BA 4IGBA 1XF2A 4OFKA 1Z5LB 3EJQA 4QRPE 4ZW6A 2ZUQB 1LEGA 1IO4C 1JDCA 2EDFA 2PUQT 1MJ8L 4OZGF 2BNQA 3QEUA 4OZGA 4XPHH 1YCSA 4PLNC 3HIZA 2R2EB 5DRNB 5EO9B 4YH6A 2JKTM 4Y5XA 4HA1A 3RL1B 2J88L 2ZXQA 3N40F 4LBEA 5FM4A 5EN2A 3F7KA 1IUZA 4W9JC 1AIFA 5FAAA 3LB6C 1AGFA 2Z4QB 4MRCA 4YL9A 3PG2A 2V9TA 2MPAH 2FJHA 2XQ0A 3PAUA 5AL0A 1T1ZB 2DB8A 5EU4A 1UM5H 4JQVC 4BE6A 4HS8H 5JPNB 4TTDC 1MVUB 4YWGL 5BV7B 2VMJA 2OI9B 1Q72L 4CKVX 4PJCF 2UWEB 4PJCA 4TUOB 3NFPB 2G5RA 2NY1B 5E24E 5BJTA 4Y89A 4HJJL 1NIAA 2B5IC 4N0FB 2A74A 1RHFA 1GGBL 1NCCH 2FWLB 4K94H 4NO3A 5EO0A 2CHDA 2GKIA 1OD7A 1OD9A 1JE6A 1IC1A 2XKNB 3ATAA 3LXUX 4HWUA 3VFOA 5GGRB 4IDJL 1G7PB 3LN5B 1HE8A 2FL5A 4KKAD 4XMVA 1NGQL 1KN4H 4QRQA 4JX0A 3SGDI 1UT9A 4N25A 4AYFA 5HYSA 4TLKA 1KB5H 2C3VA 3O3DB 1E2VA 3JT2A 1Q94A 4JANB 4NIKB 4PP2B 1I8LC 2G3ZA 3EJPA 1FG2A 2NT1A 4ZW8A 1TF4A 2DMCA 2VDML 1OGTB 3QDGA 1WAEA 3BYYA 4W9GC 3JWNG 4X5PA 5C0CD 5KAQG 1WF5A 4G5AA 4UQAA 2H3KA 5D96C 1FJ1B 2P5EA 4ELDA 2WLMA 3QJSB 4XX5A 5B8CA 2HTLD 2R56L 5TF0A 7PAZA 4E5XA 3G6JB 3HKFA 1DQQB 2DLFL 1WAAF 4XGZA 2NY5C 4U6YB 4FXGB 1WAAA 4FG0A 1II4E 2V3DA 4FXKB 5A2AA 5F7NC 4KTEH 4KRPB 3ABKB 1CR9H 4P4KC 4V1DE 2KL6A 3U9PH 4X4ME 2JKSA 2B4CC 3A6CH 4X0NA 1PD1A 5MEQB 3CSGA 4QO1A 2LHAA 3P02A 4H88L 5GSVB 4CW1B 1FGNL 3L3IB 1OAKH 4A1RA 3NCMA 3IDYB 1HOCA 1RV6X 3U2JA 1UJTA 4PRHE 6FABL 5HGBB 1UD3A 2IXQA 3ZZSA 4LRNL 3PQYB 4JO3L 3GRBA 3TN0C 3HUJE 2MCPL 4P2RA 2B1OA 2VRQA 3MOAH 2IPTL 3Q2CA 1JJUA 2AKRB 3PWJB 3PGFL 3A21A 3HVDA 4YSTA 2BOLA 2P5WA 5SWZE 1B0RA 4RIRB 3SY0B 5JYLA 5FF6B 1MJJB 1YEKH 4CVXB 3NIDE 4OCXL 3S3JA 1XCXA 5BQDA 2PTTA 5C0DB 3CN2A 3JVGC 3VXME 2QFRA 3TV3L 4CMMB 2F8OA 4X6CB 2XVBA 3RLSA 1W2KT 3H9SB 1HHHA 1H19A 3EDFA 1BFOB 4HK3N 2Z31C 3OGOE 5A3IC 1KT2B 1XIWB 1MFCL 4D8PB 2MWCA 4PBXA 4J3OD 1QLEH 1KGWA 3CVCA 4NN5C 1BVKA 5FKPA 4YDMA 4JY4A 1UJ3A 2BVQA 1UWEH 5BZXA 4ANXA 1BBDL 1TJHH 2IG2H 3KH3A 1F4XL 1OE1A 3F7PC 5BZZA 1PYWB 3NCCB 1FFPA 3GXFA 4Z7QE 3UO8B 3NSDA 4RGNB 4UILL 3ZUCA 3S35L 3L5XL 4M7LL 5EF2A 2HG5B 2YD0A 3HE6A 3GMMA 3CZFB 3V0FA 2ETWA 2JQMA 2X53A 3B43A 5DD3L 3MLVL 3QDGD 1A6AA 4ZT1A 2OSYA 3UJIH 3E6HA 1IARB 4F33B 5B1AB 4URKA 1NMAH 4QHKI 4FKHA 4H26B 4I2XA 4EBQH 3QQXA 5AKRA 4F8NA 4FFVD 5EOCJ 3G5VB 3CK0L 5ERWA 4TQHA 1CDGA 1L9TA 2ITEA 1OT1A 1HZHL 1BLNB 4GO9A 3NZSA 4X4XB 4ONHB 3BH9A 3VFMA 3KLHD 1SM3L 4LL9A 4IBVA 2D3JA 4M5TA 1KGYE 1QX1A 3BUBA 2DYPD 2XWZA 2JLPA 3K7UA 4G7VL 3QUZA 2VXQL 4LLUB 3U48A 2XWEA 2CGRL 4UIMA 1HYSD 3QNZA 2R4SL 3RBSA 4GSDL 4NYLA 2AJ3B 2DTMH 3C12A 3CFDB 3DECA 3O11A 5I1GL 4IBQA 5E5MB 4HCRH 1EH9A 2FWUA 1ZPLA 4L1SA 3FTWA 1FH5L 2D0HA 5DHEA 3TCXA 3ZK0A 1HKLL 5I73C 1BJ8A 4S2SB 5HJ3B 4PWIA 3PWNB 5I1JH 1S5HA 2OFQA 2O5YL 2D7OA 5E2UH 2W9EH 2XRAL 1TTFA 4GW5B 3LS5H 3NIFF 4TUJA 3HB3B 2M1KA 1PZBA 2WYHA 4MA8L 3EGDA 4OIFA 3ENEA 2CJUH 1DQLL 3B83A 3QIWD 5INDB 4LK4A 5BS0A 2D03H 4N2FA 1CGSL 12E8L 1QFWH 4AI7A 3KW8A 5I1IL 3A4DA 3AM8A 1IGTA 5DK0B 3TBVA 1FIGL 2WVSA 3ULAB 1T1XB 3UGUA 3HMWH 2EYSA 4Q97A 3UADA 5DO8A 1XCTB 1NM9A 2JQZA 4A2GA 4TUKH 5TJWK 4NNXA 5E8DH 4YAQA 1NC2D 2FD6L 3D4YA 3GLAA 5DDHA 4NP9A 4DW2H 1JGUH 1WZ1H 2WO3B 1TR7A 4XCNB 5CEZL 3FU6A 4RMTA 5I1EH 3WU1A 1M71A 4QXTA 4Y2OA 3NRPA 1T0MA 4FXTA 5GGVY 1RZFL 1G0XA 3ES6A 4WUKH 5C9JB 2WN2A 3UL4A 2QV2A 2LQRA 3QC6X 3UABA 1TZHB 1AQDA 5KEZA 4D0BA 1YSOA 2VQ1A 2OW6A 2NXYB 1L3NA 1WIPA 1Z3RA 1Z5LA 4PR5A 4XOBA 3ZZLA 4KKZA 5I18H 4K9EH 4R7DA 4GAAA 3TA3B 1CIDA 1QEWB 3BDYH 2FH8A 3RURA 4D9LH 1EHLH 4RMWA 2Z8VC 4R0LA 1EXUB 1CGVA 3O2DL 1RURL 2J20A 5DSCA 2NY6B 4O2EB 4QOKB 4EUPB 2MKLC 2HFFA 4NKIL 1MY7A 3CHPA 3OKDB 5BVPH 4M7ZC 5IMOA 2YAPA 2MKWA 1WCQA 2H9GA 1KPRB 1ZANL 2WLNA 2GK2A 4P9MH 3WXVH 5GS0H 4FG2A 4AUYA 4KV5E 1E4WL 4PYHA 4N8PA 1W8EA 2I9LA 1JF5A 2XIBA 4MWFA 4OLUL 4P23B 2YPVL 5D70L 5DJ0A 4KKBC 3LS4L 4RX4D 1BV8A 3WMPA 2R1YA 2WO2B 4TYUA 1E3XA 2ZYIA 1FAIL 3MBWB 2VSDA 2D2CC 4U4BA 1MFVA 4ZTOH 5AW9B 2XKNA 2XJKA 1AGCB 4WGVB 5I1AB 1E4KA 2JI2A 5E4EB 3V5HA 4F2MB 2BCKB 3VAEA 3EFFB 1WFMA 2FSEA 1UXSB 2CO1A 5FO7A 3A22A 4APQC 1U8OA 4IMLA 4NZ8A 1P4UA 5FB8B 1YMHA 5DHMC 1A1OA 4MMYB 3AS1A 2OXHA 4ZO9A 3SQOL 1BYPA 4Z0BH 3N41F 1UB5A 5HHNB 1GGYA 4L37B 1WAPA 3C09B 1HHKA 2DM3A 4CADB 3L4CA 5I28A 3AWFA 1GRWA 4YDIH 2B3IA 1TTRA 3WFHB 3ATFA 2X10A 1QKZL 5FW7A 4ILDA 2BFVL 2CKBA 2ESVD 2NY7H 4MB1A 4AW7A 1BZ7A 5K9KB 3G6JA 1JWSA 3TH4T 4Y2DB 5HGDB 4NNYB 4FXKA 4M43L 3X11A 1WSST 1JZDC 1OGSA 2V7HA 4D2NA 2O4EA 1MFNA 5JPMB 2ZCZA 1MI5A 2W0FB 3GJFK 2HSIA 3PABA 2GCYA 3RWDA 3NCFB 2K8QA 1N70A 4CW1A 1HHGA 3L3IA 2BVPA 5IJKA 1TZ8A 3NMEA 5HGBA 7TAAA 2DQHH 2NYYD 1H0DA 1HC1A 3PQYA 3QB7C 4QGTA 4Y16A 2C9XA 2QQNL 2DQJL 4HEPA 1Q9KB 1MEXL 3T65A 3PWJA 4GFXA 2YGPA 4TMPA 5LGKA 3PP4L 1QW8A 1XSKA 3D3VE 4YHIB 3KBHE 2K9UA 4KO5A 3STLA 4OCRL 4K23L 4LLVA 3RWEA 3DVNA 4IJ3C 5T1DH 3NBNA 4PTUA 2PTVA 4ZFZA 5E2WL 2AK1L 4PI2A 4TXVB 3T6WA 3DJRA 4D0DB 2IGLA 1GH7A 2IPKB 2NY1D 4DKEH 1I3UA 3L81A 2ZCHH 4LDOB 3KJ4B 4JO2H 1IGJB 2E46A 3TT3H 1S9VA 2ZXDA 5C9KA 3HE7B 1LP9F 3DI2B 2YXFA 4FLQA 4XX1E 4P2QE 4BSWB 1MHCB 2UYLB 4R96A 2ZAGA 4A7SA 4F9LA 1HI6B 2QVKA 4G6KH 1RMFH 3QEQB 2EC8A 1NC4A 1K4CB 1HDMB 1AI1H 2DQIH 3BPNB 4KGJA 5TQ2L 5LB1A 1CL7I 3D9AL 3FOLA 4PJ8B 2HRHA 1YYMH 1OP3H 1U33A 3F2LA 4ODXA 4I3RL 4HS6B 4FG6C 1E27A 3ABZA 5KVGH 1E2WA 1BM3H 4PLOB 3QI9B 3UJTL 5ANHA 4I85A 4FLRA 5D1XA 1X9LA 4PWEA 4F33A 1I9IH 5CJQL 5DVPA 1S9YA 1DJWA 4H26A 3G6DL 4DN3L 1F4AA 1YEDB 4Q74A 5L88L 2V3EA 4LARH 4IRJB 3KBEA 3OZ9H 5IB4B 2EUWA 1QSZA 5E9DA 1KY6A 4KRPD 5D6CB 2YEQA 1PVHA 1ZK9A 4BUQA 1FL6A 1JN6B 2DBLH 3RIAK 2BLFA 2CLVB 1LDSA 2DIEA 1PFOA 3KPRB 3QAZB 1DJHA 3FUEA 4YFLF 2ZP9A 4E9RA 4EN3B 1MFBH 1FVDA 5D4HA 5AAPA 4G42B 1KTLB 3BZEB 4PTTB 1FNAA 3P30H 8FABA 3PQYD 1GGTA 4Y16D 2CBTA 3PWNA 5T5FA 1I8IA 1OF2B 2VN7A 3CHOA 1QSEB 1LMKA 5FYJE 2WXFA 1LE9B 4G72B 3FT4B 4V11A 4BK5C 3VI4F 1MRDL 4LRIC 3VI4A 1G9NL 3WNOA 3ZKMC 1I1AA 2F54E 5INDA 2JKNA 2J3SA 3FFOA 4QRRE 5BRZB 1XAUA 3MNWA 3HR5A 4E41A 4UZSA 3GBML 4AC4A 4M61B 1PG7W 2QHLA 3TIDB 4IIZA 1ED3B 5DK0A 2G9HB 1KGCD 3H9SD 2OP4L 1SF5A 4OJYA 5KBDA 2HMIC 4CMHC 3ROLB 4ZX5A 1JMZA 2JVUA 5HDBE 1KIQA 1QMUA 3VFGL 3OLDA 5EN3A 3SJVA 1XIWD 1W8NA 4Y19A 2VLJA 2X4NA 5HHME 1DSFL 1E42A 3BKYL 2PLTA 3IDGA 2EDWA 2VMDA 3U9WA 2DH2A 1ES0B 1AOHA 1XGUB 4JVUA 4KJPC 3EJYC 3QIUB 1H6FA 1N12A 4RWYL 3BIAX 3KL0A 5A6LA 2OJEB 4P2OC 2E4FA 1FNSL 3V5DA 1TZHA 3UDWA 1NFIB 1VFMA 3MNVB 2DIJA 4RGND 3CXHK 1JYXA 4Z3GA 1RFDL 4U0RC 5IMKA 1OTUC 4ZNCD 3CDYA 3EYOA 1A6TA 4IOIA 4YFEA 2E7HA 3FSWA 1E9OB 3U82B 3BSHA 1LWHA 2Y7MA 1GSMA 1QEWA 5JW5A 2YKLL 5D93B 1IGFL 4Z7NB 2C7FA 1EXUA 4OF8A 1NOFA 2CO4A 3ULVD 4OZIE 2GTWB 3CVHB 3IDJB 5AWNL 3REVB 1DBAL 1SEBB 3FB6B 3JWDL 1JZ4A 4IJTA 1YMMA 2YD4A 2KQNA 3IU4H 3HI1B 4JM4L 4AG4L 5A7BA 2QGEA 1KF9B 3BVUA 5CKAA 3NSFA 1YEWA 4AQ8C 1S78D 3MFFA 5E9DD 2ZWSA 2WK2A 3ZDZB 1VPOL 1WA1X 3BQVA 3CSYA 4OFPA 1I53A 4XWOC 1OANA 1AAJA 5T3XE 3GZOA 4B60A 2XICA 1XZ0B 4P23A 4ZUVB 2EZ0D 3HI5H 2DF3A 2DWEB 3OPZL 2CUAA 3SZ6A 3KZ8A 2XWCA 3TCLB 3V52H 2YQBA 4WNSA 3ECWA 3NCJH 3MBWA 2FK9A 3B7TA 4YSSA 5IREA 3DPDA 3H2QA 4MNQA 4M7KL 4Y7MA 5CBEA 4ODHH 3EFFA 5I19H 2O5XL 1OAYL 3MZGB 5D71L 4QUOA 2A1WH 1Z1WA 3RTQA 5KSAA 3FOMA 2VJXA 4UT6H 4KQ3H 3QNYB 3HB3D 5FB8A 3SE8L 1XD0A 2FIKB 2YMXH 3Q2VA 4G8FB 4JKPL 4BDVB 3B2DC 2V2TB 2XPYA 1CXEA 1NBZA 3BVNA 4Q6IB 4B41A 1AXIB 1JWUB 1MDAA 1E28B 2FEJA 1TYRA 5ELIA 3S6CA 3CPUA 2JSFA 3UAAA 2DQGL 5DVNA 4GAJL 2WSKA 3GRWL 4FQCH 2ZUXA 5FUOH 4FMFA 2Q87A 1WD9A 1KCUL 3SJVD 5T1LB 4Z23A 5L9DH 1MVFA 2GFBB 3SPIA 4S10A 2CWRA 2VDPH 1EFXA 1V3MA 4HALA 4LU5H 5K9KA 4UT9A 1M6OA 4N2OA 2ARJB 4XB8A 4ONOA 5INCA 3WE6A 3AGWA 3PGCB 4PFEA 5EZIL 4JFYA 3HC4L 3W81A 1OAZH 2YXVA 5CZKA 4FZ8H 2J7LA 3OHXB 1JCKA 1XGPA 3RX9A 1AQ8A 1G7JB 3MCKB 4X42A 5F1KC 3ZGIA 4G3YH 2AS5M 2JKLA 4X7CC 1XH1A 3GK8L 4TRPL 1D7BA 4KQ4L 4XB7A 1JG9A 3WNLA 4IEFA 4LAQH 4XMXA 1OQXA 2NY6D 2IALA 3UTPE 1IBHA 1YMMD 4QOKD 2YA0A 1NMCB 3GGWB 2GJZB 3DOSA 2W0KA 3GJFH 5KYYA 1KJ3L 2WLKA 3EJJX 4HJGA 5DC4B 2HKFL 2P80D 2XWTB 2B77A 3MO1A 5DHYB 2FB4L 1SHMA 3DI3B 2QVTA 3GLDA 1WT5A 1TYJA 3T6XA 4EI5A 2CLRB 2L4OA 2EO9A 4D3CH 3GKWH 4P23D 4ADJA 2JFCA 1Z9NA 3L7FB 1J05B 3FQWA 3G5YB 3L8QA 4EN2A 4LSQL 4ZMXA 3VXOA 5I8EA 4AIXA 4LLYB 1JFQH 1G7QB 2E8ZA 5E6SB 1MCRA 3QNFA 4ODBD 4BSWA 1OT2A 2Y6SD 1DJYA 2DS4A 1MFEH 1WFOA 3ARDC 3LIZL 3FCSB 5F7BA 3OAUH 5E5LA 3BE1L 2QT6A 4S1QL 5F9OH 3VGEA 5IHZB 2D8KA 5EU7C 4ZX3A 1QLRA 3KW7A 1R3HB 4PJ8A 4DQOL 2FQEA 1OGAA 3WN5C 3V4VH 5LAXB 3L48A 5AVSB 4X7TB 1ZLEA 5TPWH 1JHLL 5T1KB 3DURB 3ROOB 3S88L 3B7UX 2DI8A 3ZSSA 1NMBH 2CKNA 3F04A 1HINH 3QXTA 4PRAA 4XH2B 4ZDHB 2Q7NA 5MEPA 4X7FC 1HL9A 3UO1H 1XT5A 2AEPL 1U30A 2NRDA 3OM3B 4GQPH 4WY7L 3F7QA 3G6AB 5DUPL 4IRJA 1CI5A 1A47A 3N9GL 4S0HA 2WLZA 4Y2DD 1HESA 1VCAA 1SUHA 2G2PA 5IB4A 1ZHKA 2WVVB 1H3GA 3BIKA 1AP2A 4GRMA 4L4TE 2BRRH 4JRYB 4XNZB 2QMKA 3B3BA 4NHUB 3VFPB 4PHZA 5IJBC 5KG9B 4YGVB 5E00A 2YJLA 1JN6A 1FFOB 4IU3B 1CYGA 1M7IA 2WIMA 4DEPC 2ICWB 2F7RA 2CLVA 3QFDB 3V5KB 2QLVB 1G87A 5K1JA 4GO6B 5GZOC 3K2KA 1MSPA 4GFTB 1HH9A 4ACPA 5J6HA 4M1GH 1GCYA 1YDPA 4PTTA 3OJMB 5D7EA 1I3GH 1XEUA 3M8OL 3ULUE 2PW1B 2XN9E 4XNMB 5HHQB 3V0WH 5TDOB 3WIAA 1H9VA 5EDSA 2DLIA 4IU2B 5I0XA 1I7ZA 2KKQA 5CNHA 3V6OA 4OB5H 2AJUH 4XVTH 2NR6C 4LCWE 1A3QA 5H4ZA 2GTZB 1T7XA 1RIVH 1RZKH 4YNYB 1ITCA 4G1MB 4NC0B 4WHYG 5IVZA 1R9FA 2OJZL 2C3GA 3H56A 3LKQB 3MUY1 3MRKB 5BRZA 5FOBB 1NH6A 4F20A 5IKCA 4Q2ZA 5T8IA 3TIDA 4YSDA 1ED3A 3QIBC 3FT9A 2G9HA 3BD5A 2AV7B 4MJ6B 1CDHA 3DUUA 1O9ZA 3T5WA 1LO0H 3FFCB 3DGGB 1I7UA 4UAOB 1A9EB 3FO2A 4HKZA 2NQCA 1JOIA 5A40E 3LKPB 4DVBB 3B9EA 4OFQA 4JZNB 4PQXA 1I82A 2JCCE 3HE7D 1SEQH 2DRUA 1RUQH 3P3RA 3PNRB 3ZKQD 4JN2B 2FZ3B 3II3A 2JKXA 5J9PA 3BEVA 3K0WA 3VCLB 3QEQD 3BAEL 4PD4K 1XGQB 2RFXA 5FHAL 4M5YL 1CFMA 2AEWA 1NFIA 4LOUC 4DKAA 4U31A 1IT9H 3BX7C 4P05A 2IDCA 1U8NA 2D0FA 3H2PA 4PJ8D 2QKIB 5AALA 2V4LA 5AZ2L 2V6HA 1J10A 1ZSHA 3HG5A 5KVDH 5E4IA 4JB9L 4O51A 3PJSA 3QUKB 1FVEB 5AB0A 3IDXL 4DGYH 3EO9H 4GS7B 3L4XA 4WZ9A 3H9HA 3HI1A 1PLCA 1OAUL 4U6HB 5EZOL 3VSVA 4P3DA 4WU5A 2PR9A 3CZLA 4IRJD 3FH7A 4TLTA 2XY2A 3CFEB 3O3AB 3VXSE 2H45A 3O3BA 3TF4A 32C2B 1WCBB 4FLSA 2O61A 1DLFH 2A6JB 1CIUA 2HUEA 4NX0A 3LKSB 4AQ1B 3GQFA 1BVLB 4GI8A 1NZRA 1S3KL 3TU6A 3TVMC 4OTXL 4PRPE 5I75B 3MV8E 1VZGA 1LD9A 1WV7T 2WV3A 4X9YA 2JI3A 4EVNB 3AREC 4XCCL 1XGYH 3BN9D 3EH2A 3KH4A 4YPGB 1YO4A 4QRUA 5TE4L 3KPRD 3T0AA 4F9PC 4NXSA 2NDGA 3ZTJG 3M6DA 3TCLA 2ZJSH 4EN3D 3RDTB 4Y1TA 2XA8H 1U4FA 1CLYL 4R5XA 4XPTH 2Y7QB 1MELA 3INOA 2VQUA 4LCUA 2J1XA 3GYRA 3PL6A 2CDGA 3LZLA 1H3UA 4N28A 2N3JA 4JRXB 2HVKA 4HOZA 4Z7VB 5C70A 3QG7L 4D8OA 1IE5A 3QNYA 4YHKH 5CMAB 3LVEA 1MN4A 4G8FA 1HAUA 4J3BA 3VXRB 3GUFA 5FK9B 3ECBB 3UAEA 3ARFA 5BRZD 5C6PB 3I75B 5GGTH 4NC2B 4LIQL 2JJTA 3DJZA 2HVBA 1QEXA 2PR4H 3NFNB 4H2AA 1JRHI 3OBAA 1GOFA 2CRYA 3WNNA 2Y25A 4K8RD 5IV2B 5K9OB 5I74B 3WFDH 3US0A 2WLIA 4YQXL 1AG0A 1G0YR 1NCHA 2XHNA 3FO1A 4HBQA 2Y3NA 3ZKND 3FSAA 3V6FA 4X4YA 3QIUD 4PJEB 4PV1C 5JHLL 5TDPA 1NCAL 3GLZA 4FABL 3T4YA 1IFHH 1SOKA 4FNUA 1CFNA 4J23A 5E2JA 4HT1L 1WP6A 1ZHNB 2DQ6A 5HI5C 3R06A 1F11A 2TSBA 3RWHA 4GW1B 1J8HE 4NENA 3TGXA 1IGCL 2CO3A 3EJZD 2PW2A 5KJ7E 3K1DA 3MCKA 43C9B 5F3BB 2VSMB 3CPLA 2FIRT 5HVFB 1WWBX 1SDYA 1FN4B 1E4HA 3EF7A 4L18A 1XXFC 4GXVH 2CRZA 3C2AH 1S7WA 2VXTL 3ARYA 3BLPX 3GRGA 3ZHNA 1HSBA 1XL6A 3BXNA 3IB4A 3P2DA 1BA9A 1VGEL 3KGSA 1A4BA 4WHTB 4W9LC 4IK6A 5IHHA 2XWTA 4APXB 3WFEH 3PPEA 5GGVL 3KPPA 4ISVB 4LVNC 3B56A 3GHBH 3IXTB 4DIXA 5SV4A 2JKRM 3FMGH 1G6RB 5E8PA 5CIPH 3KGTA 3M07A 4WWNA 3U7YL 1J05A 1JZHA 3HTLX 5T1MA 1YQVL 2EO1A 2J8UF 1A5FL 2J8UA 4KMLB 4KROB 2BY1A 5J57B 4LLYA 3GDCA 1G7QA 4K7PX 5IT2H 5KUKA 1TU2B 3K6NA 3RVUD 1UEMA 3GSNA 1UH3A 2VDQB 4HLZG 1NCWH 1X9QA 5FW8A 2BC4B 4Y2NA 3O0RL 3JWOC 3RWIB 4UANA 5I6XC 2E59A 2XTJB 1RQ5A 3D85A 1C8QA 3A6BH 3ARFD 2K0RA 1I8KB 1R3HA 4KK9C 4MB5A 4PREB 2BVOB 1SJEA 4DZBB 1A3RH 2QVMA 1SOSA 3QJRB 2RD0A 5ID1B 4KQ0A 4PBWD 5HYJB 3IFNL 2XG5A 4RZKA 4X9GA 3PXHA 5BO1H 1L7TL 3C9NB 3L3GB 4JPKH 3TBYA 5IIEB 5LDSA 3NAAL 4ZDHA 2IC2A 1J7VR 2QQKL 1OP4A 3G6AA 3L17A 4KY2A 5EU3A 3ISRA 3Q9QA 5D2NB 3RP1A 2C4FU 1JZ5A 2QZ5A 4GQ9L 4XCYA 5IR1A 4CU7A 3K71B 5I8KH 4XN8A 4JRYA 4NKDA 2GIXA 3MRDA 4NHUA 4JAMB 1JVKA 5F3HB 5DK2A 5HYEA 5KG9A 5DJZA 4NXKA 4E9SA 2PF6A 1ACYL 3V8OA 5DTFB 5F88B 5HSFA 4HJ0C 4TLUA 3CXDL 2IANE 2Y06L 5SWSB 5I66A 4L9LB 3S4SB 1KBKA 1MFAH 2A83B 1Q0YL 4MAUL 4DUWA 4HIHB 5CN2A 3KS0J 4G7RB 1E67A 1L6PA 4EKJA 3ZE1E 4NQVB 3SDXE 3FW6A 3HAEG 2KPWA 1ID2A 2QVIA 2J1YA 3GIVA 4RFOL 1KBVA 2MNWA 5K69A 4NOBA 3MV7E 3U9UA 2E7MA 3LPWA 4YNYA 2P3YA 1QOKA 1N6VA 5F1IA 5IJVA 4X2UA 3MRKA 3T2QA 2A38A 5D1ZI 2AJSL 3RVWC 5JQ6L 1FDLL 2UY7A 4L1HA 1DVFB 3MNMA 4XMPL 4MJ6A 2P8PB 5J8OA 2GTQA 4OT1H 1AZZC 1BBJA 3W11D 2VM4A 4IM8A 4ZPVB 1DDTA 4B0MM 1JK8B 3LKPA 3S7GA 2IBZX 2P5PA 4HS3A 4QT5A 4DVBA 3B5GA 4TNVK 3DXAB 1CFQA 2Q6WB 3CLEH 4KVNH 3RI5K 1EO8H 1ZAGA 3X3GH 2J4WL 5HGHA 4PS3A 4DP4X 4O2CA 5CR1A 3LEXB 4WW1B 1QRNB 1TTCA 2HFEA 3VQLA 3VCLA 2Q3ZA 1UD5A 4MXVF 2WNGA 2F19L 1IILE 5ENWB 3UEZA 5B21A 4GAGH 4WW2C 4KOBA 4MJHA 9CGTA 2QKIA 4NQTA 4WI6A 5T1KD 5A2LH 3LMJL 3PAYA 5F0JB 2J8OA 2VTFA 1U8CB 4KI5D 1T5XA 3QUKA 2BWDA 1FVEA 2Z8WC 5ADOL 5CD3A 2HWZL 1NFDB 3MV01 4S1DD 5GGUB 4PRIA 5HGAB 5FYKL 3WL9A 4U6HA 1XF5B 3QZNA 1P4IL 2PXYB 3DX8B 3OKOA 1TJMA 3F6JA 1N68A 4TUUA 1UOWA 2A6IA 3L3HA 1ZVYA 1DBJH 2Q8BL 3LRKA 3LN9A 2FT7A 3FT0A 3O6KL 3QT2A 4JRYD 4PV8B 3V6ZB 4G11A 3H3PH 4PP1C 1MWAB 1X5ZA 2D2OA 3V4PH 2JKWA 2GJ6B 4KJYA 3WY4A 2I9TB 1UEYA 4LSUH 4NIYE 2OR8A 5SX5K 5DZVA 5DMIL 3VX0A 3BWAB 3RRQA 3P4OB 4HEMA 1KSRA 4TOYL 3CFKA 4R4BB 4GXFA 2I7OA 4AWJC 2YD9A 1PLBA 1SYVA 1CMOA 1D9KB 2OBGA 1YEIH 1BQLL 2VB5A 3W37A 3SO3C 4LOFA 1SY6H 3BHBA 2EEBA 4X98A 5BQ7B 1DTUA 1BQHB 2HRGA 3NCEB 3MGOA 5HDLA 4OV5B 4HSCX 4UIKH 1S7UB 4G9FB 4ZUTB 1AIZA 4YDVB 1JPFB 2ZG1A 3L4WA 2J43A 2Y0SA 1OCOB 1LJMA 2ED6A 3CIQA 1KCRL 2G3XA 1YEGL 1DVQA 1NBYB 3NFNA 4GXUN 2C4FT 4ZS7H 1V7NL 4G6FB 1TNMA 3TBCA 4TSBL 3VGBA 2WGXA 1BZQK 3FFCD 2COQA 5CSZA 3BH4A 3HN3A 2DQTL 4XN2A 4XTRD 2WUBH 3PWPE 1F6FB 4LCCA 5B7MA 3DX7A 4I3SL 3BP7B 4HK0B 3UYOD 5HJGA 3DK0A 2XG4B 2DW5A 2R0KH 3RY4A 1IIKA 2N1TE 5I6LA 4LHQB 1VEMA 3VTMA 5BOZG 4ZNEA 3D06A 1OOAA 4XBEL 1AQMA 1JFHA 1PZDA 1QW9A 2OTWA 1DJIA 4KVPA 4PS7A 1CF1A 3SDDC 4D9RE 1HCZA 5CM1A 3P9MB 2W80C 1BVOA 4ZSOB 5KSUB 4GRWH 4HBCL 4JN1L 3N40P 2APXA 5D1ZC 5IJCC 1KNOB 4KXAA 2YK1H 2X0UA 5D72H 3HS0C 4F58H 2W38A 4U7MA 2XX1A 2CD0A 1T7YA 3B2VL 5J13B 1QR4A 3SO5A 2AERT 3IWUA 1SJMA 2DL9A 2Z3FA 2PPAA 1DBBH 1A2YA 3RVTD 5ALCL 1QFUH 1NDMB 2QADB 4N0UE 5K39B 5HVHC 3L7EA 5IW6A 5AZEH 2ZWLT 3IDNB 2A73B 2KH2B 4ACTA 1PKOA 3EBHA 2R2CA 5IM7B 3U4BH 5GS1B 2ZSVA 5CCHE 1RPKA 2F5BL 3IXTA 1M9WA 3WXWH 3QHTC 1KB5B 1NGWA 4GG6E 4HWBA 5B38A 5GXBB 3CLFH 1AS7A 1ZVSB 4AEHH 2L7EA 3UG5A 4JFEA 3I9GL 5D7JC 1XR8B 3OR7B 5HHPB 3RDTD 4ES9A 5KYWB 4NN7C 1MPAH 3EJTA 1K8DB 2APBA 2PCFA 2X2HA 3CBKB 1WQVT 3IFOB 1CK0H 1TU2A 4W4OA 1R75A 2ICCA 3RKPA 5I2IA 1CVSC 4JRXD 2VDKH 3HR6A 1G9ML 1S7SB 4NM4L 4PGBB 3WIIH 3VXRD 3S8FB 4NQUA 3A4FA 3OKLB 2GB2A 2BFGA 2D7TH 1RVFL 3KPSA 1FP5A 3PIQB 3EW3B 5A2IH 4AVHA 4OJDH 3QFJB 1YNKL 2YSTA 1RU9H 3DIVA 3HNTH 3MQIA 5BVJB 5HYJA 5ID1A 3T0EA 5CLWA 3SBPA 4ZFOA 3FT1A 3C9NA 5FUZH 2DOCA 1QPXA 1GIGH 4DO6A 4N2AA 2YPKB 2B8OT 5IF0B 1WLHA 2XI9A 2P49B 5D2NA 4A6YH 3JWNH 1NSNL 1WS7A 4HPOH 1ET7A 2WTOA 2MEJB 1PZCA 5KBMA 1ZHBB 4LQFH 4KY1H 1XBDA 4AQEB 1FYHB 2G30A 4AZ8A 4DERA 1W0WB 4QJ5B 1NIDA 5K9JH 1G94A 2EIBA 3O2WL 4J3UA 5D1QA 3SE4A 4DKDC 3ZDWA 4R3SA 2A6DA 4YBLB 5J5EA 4L9LA 1S3RA 4ZQTA 2LTQC 3S4SA 2XKUA 4P5TB 2A83A 4DSYA 5E6IA 2OR7A 5CUSL 2XVGA 4XO9A 3Q13A 2VISB 3O3UN 5E1IA 1W80A 1Q1JH 4KAQL 3S36L 2ZAIA 3UIZA 5D5MB 1QLEB 4L1TA 2WQSA 2K7PA 3IJ7A 2X2YA 2VDQL 4PGCA 1UOLA 4IGBC 1S5IH 4I0CC 1UKQA 1X5XA 5ICYB 5F2FA 2J1WA 4KRLB 2AMGA 3ETBF 5DVKA 5ID0B 1DVFA 4QTHB 3APNA 2P8PA 1AXTH 4LSPH 5IBLD 4Y5XC 4LNRA 3II1A 3N41B 1CWVA 1X7QA 3A67L 1ZSDB 2PWHA 2OLDA 1GC1H 4DPAX 2YD3A 3FUKA 3KEHA 1OTSD 4N6RB 4ZPVA 4ALAH 4F7MA 2Z0UA 3S35X 1PQZB 3HFMH 2EE0A 4PJAE 3DXAA 3LPOA 5F9WC 4KROD 5AL8A 1P7KA 1TFHA 4I5BB 1HEHC 1RD6A 2AXGA 3LRSB 4WEBL 4UNIA 5FR3A 3EZ8A 2OV0A 1QRNA 3WFBH 2P4AB 1CQKA 3KGRA 3T3PF 1FO0B 1P2CB 5D2LB 1ONQB 5JHDB 3HW7A 1EGJH 1TO5A 1N8OE 3PE9A 2A74C 3ARGB 4AT6B 4LPTA 4NPYA 1P6AB 3KPSD 3DETD 3II2A 4LP8A 2ROXA 1YPZB 2GSGB 4NRYB 3G08A 4F57H 3T0ED 5HYJD 1AHWB 3IMUA 4WCYL 1XDTT 5EO1B 3QZWG 4MNHA 5DFAA 2WAHA 1NQBA 1XF1A 3JUZA 1JXGA 2YAHA 4LKCA 3VMPA 3ATEA 25C8H 5F9AC 3IRZA 1UD8A 3B9DA 1KTJA 2EXWD 1GW6A 4LF3B 1XF3B 3FN9A 4Y4HB 3GSQA 3ZE0B 1DJGA 1W6LA 4ECNA 2ZOUA 4HPYL 2DV6A 2EH7H 4L23A 4PV8A 3OXRA 3QYCA 3BN3B 3UCQA 4WV1A 1GYWA 4YHYC 2J72A 5JYMA 4PJXE 4FQXB 5SWSD 5B8CC 3RL2B 3U1PA 3VUAA 2KI6A 5E6ID 4X6BA 3REWB 3QCVH 4R4BA 5L2JB 2XWBB 3MXWL 4HWEH 4GOSA 1B4TA 3KLHC 2G5UA 3DA0A 4E9WA 4EXKA 3TNMB 2ZP8A 4NT6A 1OT4A 3GSOB 4OV5A 4JG0L 2WWKO 1P7BA 1X4YA 1UT2A 4L2LA 3HG3A 5BZWB 1JPFA 4EQ2A 4JHAL 3ZE2B 5KS9F 5SX5H 2PPCA 5KS9A 1GAFL 5E2TH 4D94A 4NBZB 1DVFD 4Q56A 3FN0L 4RFEB 1RXLA 4PCTA 2AXFA 3AAZB 2X3AA 3DV6A 2ESVE 1JV2B 1MCQA 2IDSA 2R0LL 4N0YH 1T20B 4L3CB 1MQKL 1U21A 3TTSA 1KOAA 5D7IF 2XCMC 3BP7A 5D7IA 3ZL4H 2WOYA 4Y4KB 4P5MA 5E95B 2XIDA 2PCPB 3DXAD 1ILSA 1JHKL 2B20A 2Y36L 3MDJA 3U30C 5DZLA 3UAJA 1QRND 2PWGA 5KAQF 3CX2A 2MMXA 2OXGA 4OF6A 4HJSA 4PLKC 2PO6A 4NQQA 3GO1L 3ZGHA 1ZA6A 3MRBB 1NKGA 5KSUA 1ZLUK 2AABH 1MWAL 4RVBA 3EJCA 3TZVB 3PWLA 1ZS8B 4PS4L 3FCGA 5EEWA 2XFXA 4NPJA 1UJ3C 4TVUA 4XNQB 1WBXB 5FDWA 3HN5A 2B1AL 3UTQB 4YHZH 4LZKA 1OLZA 5IW1B 4X6FA 4N2MA 3NJKA 1NA8A 1KGJA 3BGMA 3BP5A 1SVBA 5K39A 1R5IB 4HJIA 4Z7WF 5AKVA 2PXYD 4Z7WA 3HE6C 2A73A 4FCHA 3LD8B 5JOFB 4PGDB 5IM7A 2Z4TA 3IKCB 1V10A 2ATPB 4CA4A 5GS1A 2GJ6D 4K7PH 1E3ZA 4EZKA 4CILA 5KVEL 3Q0HA 2DWDB 4HC1A 1IGMH 3QXDA 4LPCA 2AEQH 3AADB 1IGIL 2P28B 5AUMA 4FYQA 4NSKB 2EYRA 2NQDA 4XNYH 5KYWA 4UQIM 1MIMH 3NRFA 3IAQA 1D9KD 4EF3A 1H9DA 4HXBH 1UXLA 1TQBC 1O5PA 2ARWA 1NDGA 1T4WA 1UWGL 3QUZC 4QHKJ 1S7SA 4Z7OE 3C75A 4PV9A 4PGBA 4U1JA 3OX8B 1ESOA 4GSQA 4QI3A 4I4WA 4G9FD 5EWIL 4NO5B 4KHTH 3LZOA 1OV8A 5LDUA 3PIQA 2RJMA 3LJ3A 2NW2B 3HOGA 4K94C 3ESVF 1L0YA 1F90H 1NM4A 3QFJA 4PJIB 1UM5L 2WCSA 4G6FD 4HS8L 1NUFA 1OCZB 2C9PA 3QR2A 3FCTB 1RJYB 5DEGB 3PP3K 4HXAH 1CTMA 3LSOA 3DMMC 5I5JA 2C3XA 2EACA 4OSUL 4AYEC 2CMRL 2VN4A 3MRPB 3T4AB 2YC1B 4RSYA 4YDJB 1E9PA 3BZ4B 4IKLA 5TGBB 3H0TB 4TSAH 4K94L 2AZAA 3HHMA 4FZEL 3AM8C 4LE8A 3UAJD 4LEOA 5LXGH 4JJ5A 2K45A 2G0LA 3E1F1 4JGMA 1DO5A 2PO6D 4JZOA 2A77H 3SQBB 4BFJA 4FDWA 3UTSA 5C7ZA 3MCYA 1L5GA 2P44B 2J6WA 2YGOA 2FGWL 4AEIH 3D5OF 1QZ1A 5T33H 1Q0EA 4TQ8A 2FJSA 4GQRA 1BIHA 2OQJB 5AENA 3DBSA 3DRTA 3UJJH 1OXYA 3CXHJ 4N3TA 3JV6B 5B3NA 2FLRT 3QG6B 5MENB 4AJYV 2FBOJ 2FO1A 2YGNA 2AP2A 4XN4A 3WJMA 2QADD 3T2NL 4X6CE 4GMTH 4RMVA 3X13A 5E2VH 4QY8A 1VHPA 2ZWYA 3H9SE 2EAEA 3K3QA 3FQRA 4AE0A 5IHLB 1AKJB 2NY4B 3UMNA 2YWZA 4ZRGA 2NYYC 1LNUB 5AW5B 5ID0A 3QWNA 4QRTA 1FNEB 5DEJA 4R0LC 4HH9B 1UG9A 4M6NL 1A3LH 4XMLH 4YXHH 4KTEL 2B16A 1CR9L 1IM3B 3U9PL 3GS4A 4W70A 4DAGL 5LNEA 3AQDA 4BQ9A 3A6CL 4PJHB 1AYRA 4HKBA 2ENYA 5IQOA 4LSRH 2F0CA 1YN7A 1A4JA 1IL1B 4QTFA 1E6OH 1OAKL 3VH8A 3LRSA 4NPKA 5EOTB 2OI9C 1KV3A 2H0EA 3NCYS 1FO0A 4XHQA 4M4RB 4M3KB 5D2LA 3NIGF 3HZYB 5C0FB 3MOAL 4KTDH 3QCTH 4RA3A 2MTPA 4A38A 1O7DE 5DJYB 4W9CC 1IC7H 2DEYX 1X5JA 2CUHA 1SXZA 1A4KB 2DQCL 3DTDA 5EC2B 1E4KC 1NDTA 2JB6B 3QFJD 1U8HB 5AOLA 3GIZH 3Q3GB 3VXUB 1HJCA 4QCIA 4OLZH 2IO5A 2WWOA 5GRZA 3STZB 3NZ8A 1AD0B 5EUOA 1CD8A 1WTLA 4UAHA 1AZNA 2H2SC 2ITCB 1G7IA 1RLBA 3E2HC 4JQIA 4NCC2 5I8CB 1U91B 2AK4B 4OUUB 4YFLI 1L9OA 4LCYB 3QEGH 5G5DB 4H25A 4ZUSA 2P7TA 2BIHA 4ZS6D 1NEUA 2R69A 1MAMH 5CS7A 1LO5A 4JDEB 1KFAH 1E5AA 1KBPA 1A7BA 3O81A 1X9UA 4HX1A 3UTSD 4DTGH 3W9EB 5I1HL 4KPHH 3DX2A 4FQXA 4GI6A 1DVTA 1X5AA 2OMTA 3L5JA 3MGAA 1R19A 1TJIH 4P5TD 3REWA 3FQTB 2MOVA 3MLWH 3TFKC 2EYTB 1KXVA 1MFDL 4FXKC 4PWHA 5I5IA 2UXFA 3L3KB 4XE5B 3WTYA 1GHFL 1KWKA 1Z3GH 3OZKA 1PY4A 4P5SA 1UA6L 1IV8A 2DBJA 1IAIM 3UJIL 2XBZA 1NMAL 3TC9A 4N2LA 3TO4C 2H0FA 2LU3A 4G6JH 4YZFE 5IJKC 2ZCKH 2D9CA 2PYEB 3CFBA 1XGRB 4TQEH 3RNKB 1UZGA 5BZDB 2Y3AA 4TPRH 4Y16C 1CFVL 4BRVA 4EKXA 3HG1A 4RFEA 3Q5YA 1ERNA 4WEUD 4ZTEA 4AJVA 4MZ2A 1N2RA 5HHOE 4A7VA 1SVZA 3V9EA 2MTAA 1P4BH 2Q2LA 2YBRA 2AJYH 3R7RA 3QNXB 5EU6B 2OSXA 2PCPA 1Q9LA 1PS3A 3WIFB 3UBXB 5MP6L 2JF1A 3N1MC 4HCRL 5DFTA 2RQ8A 1EIBA 4ABUA 4KJQD 1HL4A 1B6DA 3IBOA 4PJ7F 2FHCA 2FTAA 3ECUA 4PJ7A 1C08A 5I1JL 5I16A 3CN4A 5JHDD 2W9EL 3RPIB 3LS5L 1JPSH 1M3JA 3ARGD 2F7IA 1Q72H 1BVZA 3VWJB 4NC1C 2W9DH 5FM5O 2WQAA 1LEIA 3MA7A 2CJUL 1AR1B 4HJJH 4BBWA 4ZXBA 4ZOCA 1BZEA 2D03L 4JMXA 4N0CD 5IOPB 1AG6A 1W72H 1AQHA 3SKUD 4F9LC 4QOKE 2UY6A 3UTOA 4WI2A 4ETYA 1SZNA 2CNYA 3D8MA 5IW1A 4IK7A 4RRPA 3D2UA 4A2HA 4U2ZA 5CP3H 5E8DL 3I02A 4Y4HD 1YYLH 4ESKA 3SKJH 1S7QB 3P11H 3KVPA 5JOFA 4Z7UF 1WZ1L 3IKCA 1ZLUH 1EK3A 2JK5B 2E0PA 5I1EL 4WI0A 5D1XC 4P2CG 3ESMA 2Z7ZA 1MH5B 2MHAA 4FQXD 4WUKL 4YSOA 3IGAA 4F2ME 2BSCA 1Q9WB 4J8RB 2YZ1A 1F4WL 3M46A 4GINA 4HCFA 1K5NB 2CCLA 1M53A 5C3LD 1AR2A 3MJ8B 4W6YB 5DWUH 4JPVL 2VLKB 2Z9TA 4AH2A 4KZ0A 3BDYL 1Y6NR 4D9LL 4GBXB 4BH7A 4MZIA 2VDPB 3CN1A 1X3DA 1U58A 5H2BB 2VIRA 1HWGB 2H2PC 3V0AC 5G4MA 3H1ZA 4UZUA 1SYSB 4NZUL 4UYPA 5DO2D 5IB5B 1KIUA 2JJVA 4L8CB 4HIJB 2X3CA 3SGEH 2CDFA 4XP4H 4Z78A 3GMRB 1O5DT 3NSJA 3DO3A 1LO3L 3BSGA 1OP9A 1DN0A 1T21B 4P9ML 6FABH 1Z9LA 2NTFB 1R3LA 4OF7A 4PVMA 5FGRA 1PGRB 3WXVL 5GS0L 2BP8B 2NY5H 4JO3H 4LRNH 5DVOA 1U8IB 3CZKA 2WXIA 1MJ7H 2QR0A 1I1AC 2UZIH 1E40A 1CFSB 2IPTH 1IGYB 1I75A 1OTTC 1BOYA 1F3JA 2YC1A 3BZ4A 4FL4B 4H1LG 2B4CH 4IOFC 4AUUA 3H0TA 5I1LA 3C5ZA 3BKMH 1E43A 4P8QA 4B7LA 3VI3B 4FQQB 5T5FL 4A66A 1YEFL 4ZTOL 1ASQA 2WZ6A 1FA4A 4OCXH 4ZAKB 1BGXH 2R2BB 4L8SB 1QUNA 2C7UA 3FH5A 4NKOA 5CEXA 5DJCB 4A7QA 4B9FA 2A99A 4X80H 2YPLB 3GJFB 1JK9B 1RY7B 2EEAA 2GW5A 4I0PB 1F4HA 4PD4J 5EU7E 3PP3H 3EO0A 3C8HA 3I2CH 1JIBA 3TZVD 4ZW3A 4AJWA 4GB9A 5DJ8B 3FRPB 4Z0BL 2F6AA 3SCMB 2ERJB 3RB7A 2Y07H 4HU8A 5MENA 1K4DB 3GMLB 5DRZB 5M7QA 1KV7A 4F7TA 4V1DB 3MLZH 1PX8A 2NXZC 4LDCA 3C08H 4KNUA 1DCLA 3UDWC 4EQ3A 3QORA 4GIOA 1N19A 5DD6B 3FONA 4PRHB 3NZUA 2NY7L 4HSAC 4W68A 4HD9A 1IBYA 3BP4A 1WDAA 2FQFA 3HUJB 2UX7A 3TPUB 3OKKB 2FATH 4KZDL 1J87A 1U8MA 2NY2B 2GC4C 3FQXA 4B5ZA 4PJDF 1LO2H 3QUXB 3V4VB 3VFRB 4PJDA 4HOWA 4PJHA 1B9ZA 3OKEB 3VD9A 1IL1A 4YE0A 2NZ9D 5E1AB 3X3FL 3GEWB 2YBGA 2X09A 3KJ6L 5CLZA 2DQHL 3WFCH 4HGKC 5HYSG 2EDEA 1HZHH 3RX7A 5ISZA 3ZYIA 1KB9K