3IEBA

Crystal structure of 3-keto-l-gulonate-6-phosphate decarboxylase from vibrio cholerae o1 biovar el tor str. n16961
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
213
structure length
213
Chain Sequence
TKPMIQIALDQTNLTDAVAVASNVASYVDVIEVGTILAFAEGMKAVSTLRHNHPNHILVCDMKTTDGGAILSRMAFEAGADWITVSAAAHIATIAACKKVADELNGEIQIEIYGNWTMQDAKAWVDLGITQAIYHRSRDAELAGIGWTTDDLDKMRQLSALGIELSITGGIVPEDIYLFEGIKTKTFIAGRALAGAEGQQTAAALREQIDRFW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hexulose-6-phosphate synthase SgbH
publication title Crystal structure of 3-keto-L-gulonate-6-phosphate decarboxylase from Vibrio cholerae O1 biovar El Tor str. N16961
rcsb
source organism Vibrio cholerae
molecule tags Biosynthetic protein
total genus 73
structure length 213
sequence length 213
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3iebA00
4YMZA 2E77A 1KBJA 3PG8A 3I68A 4UMBA 4O1AA 5ABTA 1CX9A 1LLWA 1P4CA 2Q8LA 4M5PA 4Z0SA 2VEKA 4EF9A 3NQ8A 4RXFA 3W7OA 3TDFA 4LS2A 1JUBA 1IXQA 5F2IA 3LV6A 1LORA 1T0OA 3LXCA 1WBJA 2PE4A 2ISWA 4EF8A 4O10A 4H3DA 1ME9A 1FY6A 1SZFA 3MO7A 3EX2A 1T99A 2NX1A 4HKPA 2X30A 4O1BA 4UTKA 2EAWA 2B7OA 4LV9A 1JCYA 3KHJA 4O50A 5C54A 4GUIA 1TTJA 1H63A 2NXHA 2G96A 3GAYA 4K7VA 4QAIA 2E6AA 3TAOA 1TPFA 3NPUA 2E09A 5KZMA 1THFD 1B4KA 3HB9A 2QCFA 2VKZG 3P5ZA 2BXVA 3M5XA 4C1KA 2IQTA 4N4PA 2AQWA 3MP3A 5CZTA 3JR2A 3EX4A 4LRTA 2ZFAA 1Y0EA 3E0IA 4XZ9A 3S5ZA 2E6YA 5K9CA 4U28A 3PS7A 3N14A 3STCA 4KFOA 3QSTA 3S5NA 3WJYA 4MOZA 1XXXA 3ZWSA 2BZNA 4HT3A 1OYAA 5C6MA 3F4NA 4RLIA 4MLJA 2H8XA 2H8ZA 3LX9A 4XBKA 3GDRA 3OG3A 3SZ8A 3GB6A 3GXNA 3TXZA 4QNEA 1KM5A 1M7OA 1EWEA 2NXGA 3W7IA 4FX6M 3MP5A 1LYXA 3QW4B 4O52A 2CZEA 5F1UA 4PEKA 4JYEA 1G4PA 2GVLA 1KM2A 5EY5A 4UFMA 2Q3RA 1PE1A 4QM1A 3L21A 2OZ0A 2DZXA 4A29A 2FLIA 1MEWA 1KLYA 4PL1A 3LXBA 2VFGA 2A21A 2ZZ1A 2YSWA 5A5WA 3GZ3A 3M5VA 1H50A 1ZAHA 3G8RA 1M7PA 2J9XA 1DORA 2C0AA 5HULA 2XN1A 3DU0A 3TSMA 2WV8A 1KM4A 4EOUA 2PURA 1P0NA 3LHVA 3DENA 2CZFA 2O7QA 3A5FA 4NJKA 5FEXA 4JTEA 1OK6A 1GVOA 3P60A 3HG5A 1MZHA 3W1MA 1X6UA 2WKJA 4X3ZA 1KTNA 5EBUA 1F76A 4JTJA 1K7XA 3DH7A 4BK9A 2R8WA 2CLOA 4O17A 3GYEA 3M43A 3NQDA 4ZQNA 1W3IA 1AL7A 3FFSA 4O12A 1RPXA 1WAUA 2NUYA 3N2MA 3M44A 3W72A 3FIGA 2CLHA 4LVGA 5TIMA 1JCLA 3JS3A 2Q8ZA 2Y63A 1G4SA 3QMSA 4H4IA 3W1LA 4P61A 2YPIA 3HJZA 2Y88A 3H53A 1SU5A 1L9WA 1V5XA 4MZYA 3BLIA 1ICPA 3IGUA 3KXQA 1PV8A 5CKSA 2TRSA 4FNPA 3GLCA 1AW2A 3M16A 1J4EA 1LBMA 4UCGA 2BTMA 3W70A 4NXSA 3VFLA 3M41A 1QPOA 4QJ1A 1N8FA 5D37A 4ORMA 3N73A 5I3IA 3PWAA 1ME8A 4S2BA 3G1HA 3GDKA 5LHFA 2YZRA 1W8SA 1M5WA 3NQEA 3THAA 3H54A 3MI3A 5FESA 4Q4KA 3GAKA 3LCIA 2TSYA 3GXTA 1HUVA 3NYZA 3IIVA 3MW7A 1LTDA 2ISSA 3LM7A 3P7YA 4QITA 3KRUA 2A4AA 4AWTA 5LNWA 4AMAA 3W7JA 4QNWA 1BTMA 1YPFA 3O63A 5J5DA 2WOQA 3L2IA 3LDVA 2B4GA 2QEZA 3TAKA 3WJWA 5FF7A 2UV8G 2WSRA 3LGEA 3LCWA 3L67A 1H60A 3HG3A 4Y90A 3TH6A 4LNYA 1KBIA 5FEZA 3N34A 1MSSA 2JGQA 3G24A 5D09A 3S5OA 4O11A 1JCNA 2PCQA 1NF7A 2YR1A 1FQ0A 3L65A 3UWVA 1W5NA 1VS1A 1QPNA 4Z08A 5AHLA 4IXXA 4O18A 2Y61A 4UTWA 3KVKA 3PR2A 3MHUA 2ATSA 1F05A 5EA9A 3W2MA 5F2GA 3NNTA 4MZ8A 4FX7A 1TIMA 4R34A 3DKJA 1ZCOA 4O8RA 1TV5A 4FB7A 4FNQA 3DBPA 1WDWA 2A7RA 2VFFA 5E93A 5HINA 1IIHA 2NX3A 3ZWTA 5FEWA 5I3GA 3NL3A 1P0KA 3LHUA 1RD5A 4YWIA 2CWNA 3O1NA 1DJNA 3T44A 2YCEA 1KFKA 1H7OA 1TPB1 2WSQA 1SO6A 5AB3A 4RXGA 3U6WA 1W31A 1FWNA 2DZPA 3W1TA 4ZL1A 3CIWA 1O4UA 4LW7A 4HNUA 1I4NA 1IF2A 2GJLA 1O94A 4FNSA 1UCWA 1JCXA 1RZMA 1DVJA 4NJJA 1N7KA 2G5WA 1W3TA 3HOJA 4TIMA 1VYSX 3FLUA 3F4WA 5FF2A 1TPH1 1MXSA 3TK7A 1F6PA 1KV8A 3EXRA 3W9ZA 4AWUA 3EKLA 4W9TA 1QWGA 4PTNA 4G1KA 2DZWA 4CCCA 2C18A 3HGRA 3V1PA 3SECA 4WQ6A 1FDZA 5EPDA 3NEVA 5LNVA 1OF6A 4TMBA 4PA8A 4XUGA 1YYAA 2GQ9A 2WQPA 3MBFA 4JD4A 5DBUA 1LROA 1QO5A 1LLZA 1CW2A 3LRMA 4LWWA 4DPQA 3CEPA 4LV4A 2H6RA 1ZNNA 1XBZA 1KFCA 1LRQA 2B7PA 2G95A 1QAPA 1F7BA 3NPVA 3TSDA 5MHBA 4JYFA 3TFXA 2YW4A 4JX5A 4LVDA 1DQWA 1WBHA 1A5AA 5I3HA 1GT8A 1YTDA 5LGZA 1ADOA 4IJBA 2Z6JA 2QCGA 3WK2A 3LTPA 1ONRA 3PUDA 3WJXA 1HL2A 3W7QA 5DELA 3R13A 2DU2A 2QDHA 3EX1A 1H7NA 3NOEA 4UFIA 3PBWA 4JEQA 3TJXA 2XN2A 1HFBA 1LDCA 4AF0A 2H90A 3S9YA 4KFPA 4RZ6A 3L0KA 3NQFA 1Q6QA 3TX9A 3W74A 2X1TA 1L2UA 5LHEA 5DXYA 1TREA 4UTJA 3C56A 1GG0A 1AG1O 4UTUA 3JRKA 3MMTA 3O16A 4WZHA 3LRKA 1NF0A 1G6CA 5DN1A 2WSYA 3L66A 3PBVA 1B9BA 2ZZ7A 5FF0A 1YXCA 3HG2A 3LHZA 4HHPA 1VYPX 3CT7A 2H3BA 4ZQCA 4IMFA 1C9DA 3NDOA 3W71A 1TV7A 3C8FA 4LRSA 1FDJA 1RQEA 3MYOA 3UWUA 4LS1A 2ATMA 5G4WA 1W5QA 1LBLA 2VFIA 1X1OA 4MY8A 4ADTA 4WXYA 3W86A 4N9CA 4O13A 3FYPA 3LCHA 5CPLA 1IXOA 1J5TA 1JVNA 4XTIA 5HJLA 5K9DA 4N9EA 5D03A 4R33A 3NQ2A 4NJHA 1X1ZA 2D73A 2R91A 4NUWA 2YW3A 4UXDA 5F2MA 3FJLA 3M5YA 1L6WA 3S42A 4YLWA 3N9RA 1TPUA 2V5LA 1W3NA 4Z1CA 2HSAA 3R2GA 4M7SA 2V2DA 4LOCA 1NFBA 3P67A 3IVTA 3W22A 2P1FA 1OX4A 1UUMA 3PB0A 2ZDRA 1GTHA 1OF8A 4YCPA 4MUZA 1VH7A 1FWRA 1RVGA 3ATYA 4I7VA 1SZGA 2OMAA 4YL2A 3GK0A 4A21A 1GYNA 2ZRZA 4GBUA 4JX4A 1H7WA 3TQ0A 4O16A 3TNOA 1TTIA 5D33A 5K4XA 3NAVA 3LHYA 4ADSA 1EP1A 3BO9A 1A53A 3OVQA 2NUWA 2ZA1A 4Y8FA 2RDWA 4AHQA 2E1DA 3F03K 4HPXA 3QEZA 1I8JA 2A7NA 3R8RA 2W0UA 3B8DA 2V2HA 5AHIA 2PRLA 3HMJG 4UUIA 4LUJA 1EPXA 1ZENA 4JTKA 2DZUA 5KMYA 2ZA3A 2QR6A 4NJIA 1LCOA 3G22A 4NZJA 4EIVA 4X9SA 4I7WA 4AF0B 5FF3A 2V9DA 3KX6A 4N6FA 2HTMA 3NQCA 3L5MA 1H61A 1R46A 3RMJA 1MO0A 3UQNA 1OX6A 1A50A 1YADA 1XI3A 3DGRA 5J5RA 1C8VA 1QNVA 4DEFA 3W6YA 3G3DA 3TMQA 3SJ3A 1DL3A 8TIMA 1GOXA 3SW6A 2CU0A 4YXGA 3PBYA 1M6JA 3BGJA 3PAJA 1Z44A 5TQLA 5CSSA 1JULA 2QJIA 3PC0A 3T55A 1QPRA 3W73A 2BSLA 3C61A 4BWLA 1FCQA 1PCWA 5CSRA 2VFDA 4LU0A 2V81A 1CI1A 1FBAA 3P81A 1OFPA 3IIPA 1LP6A 3GIYA 4C1LA 1NAL1 4Y96A 5C5YA 3BG9A 3W1AA 4AVFA 1SZEA 3EX6A 1YPIA 2AAMA 4Z0JA 2C6QA 3G1XA 3ABQA 4S2CA 1MEHA 4MPQA 4UC5A 1YDOA 3Q58A 1DV7A 2WO5A 1FXQA 3OA3A 6TIMA 2OJPA 1JCJA 2B7NA 3IGSA 4MVAA 2E5BA 4BI6A 1H7PA 2ABAA 2J88A 1T96A 2NUXA 3G0UA 3TW6A 2X2GA 4DO5A 1GVFA 3CTLA 4QQ3A 3B0UX 4X2RA 2YGYA 1W54A 3P82A 3QFEA 1W1ZA 2DZSA 4DXVA 5D02A 4LVFA 1TRIA 3WK1A 5AFDA 3MHGA 5F4WA 3C2VA 4FIQA 1OX4B 4WX2A 2E5CA 4IMGA 3U2OA 3BGGA 5I3JA 3QZEA 1TRDA 4OE7A 3FYOA 1HO4A 4CQ8A 1R2SA 3CWOX 3L5LA 2HS6A 3NZ1A 4WOZA 3SSJA 4O28A 1TPVA 4CQAA 5BW6A 3RNDA 3I7RA 3NVTA 1L6YA 3SFKA 1QOQA 1FWTA 3O07A 4AEOA 1LOLA 2PC4A 4LC6A 2WNNA 3KVJA 3UXDA 1TPEA 5L9FA 1F73A 1O5XA 4IX2A 5CPOA 1W37A 1EA0A 3UY8A 3G1VA 2E5DA 1JRBA 2W79A 2ZTKA 4IWWA 3NQVA 3TKFA 4ZQOA 4GNJA 1X7FA 4LUIA 1SW3A 4GFSA 2ABBA 3E49A 4DO6A 2QAFA 3O6YX 2R94A 1GWJA 3BLEA 1H7RA 3DZ1A 1VCGA 2OX1A 5C2XA 1H5YA 1PCKA 2A7PA 1Q45A 3VCRA 5HUOA 3P8JA 5CG7A 4TMCA 4U4MA 5AHEA 1OFBA 1O5KA 2QCEA 4MFDA 2EPHA 1WV2A 3BV4A 1NEYA 3UWQA 4JTUA 3O15A 3CHVA 2EGZA 4IOTA 2FJKA 3GR7A 4LT9A 1QO2A 5E0KA 2YYUA 1V7YA 3TQVA 2JKAA 3B4UA 2C19A 3GKAA 3STFA 3T40A 3SGUA 4ZZ9A 3Q37A 4OBTA 4LS0A 2JBMA 3NPXA 1IXNA 1YXYA 5C55A 1KTCA 2NV2A 4PH6A 1GEQA 3FKRA 3M0ZA 5FF4A 3SY5A 5DLCA 3UWWA 2ZA2A 4B5NA 5CZ0A 4JIPA 3M9YA 3W1UA 3NPWA 4JR5A 3G1FA 3Q2DA 1KM1A 4CNPA 5GVJA 4K37A 4DBEA 3FS2A 4ZVJA 1QMLA 4QIUA 3PSVA 2VEPA 4GUGA 5BOOA 2PRHA 3EWYA 3W76A 1YLVA 3C2OA 1VPXA 3EB2A 3UXAA 5FI8A 4D2JA 5K3VA 3W23A 1ZAJA 4JTLA 2GQ8A 1OHLA 1OK4A 5F1VA 3CC1A 3S5YA 4FXRA 4JDBA 3I7SA 4HIBA 1XKYA 1PS9A 3W2NA 2RH9A 3ABRA 1QR7A 2XFWA 4JYDA 3IVSA 1IXPA 5KITA 2Q3OA 4WJEA 1WQ5A 3E02A 3ATZA 1FXPA 2GVJA 5AOUA 3DHDA 4UNKA 2QCCA 4GUFA 4UR8A 3QSRA 2QF7A 3LB0A 2V8ZA 1PHWA 2B7QA 3EWWA 3EKZA 1F74A 2A1YA 3EWZA 4M6PA 3BPWA 4P2VA 1TPWA 1ZHAA 3TIMA 5D2XA 5D05A 4RZ5A 3W7RA 3G0SA 4HNTA 4HN4A 1L6SA 4OWGA 1Q6LA 3IIZA 4UTMA 4BFAA 3KRZA 2DZVA 3W2JA 3LI1A 4PFMA 4GXMA 4JTGA 4UTTC 5T26A 2A6NA 1TYGA 3BW2A 3S8HA 3IGXA 3W2UA 2QKFA 3ZS4A 5L6UA 2QJHA 1F2JA 2YX0A 3ELFA 3LBCA 1TJPA 2VENA 4WY0A 2QAPA 5IBXC 1DJQA 2P0OA 3CM4A 1B4EA 1VHCA 4XWUA 1WXJA 2ZYFA 1UASA 3MHFA 3QQ1A 4MY9A 5EKYA 2EHHA 4KWWA 1TPDA 3LCGA 1ZAIA 5G4EA 3W7HA 1W0MA 1KV5A 2X16A 4L4MA 2ZQ0A 2NWRA 1IGSA 3Q94A 1SFJA 5I3FA 4O0ZA 4ADUA 4PODA 4A3UA 4UFHA 4DF1A 1G69A 3LOTA 1YTKA 1G7VA 2VC6A 4DELA 1EP3A 3N9SA 1DKWA 3O6CA 2JK2A 2NX9A 2Y89A 3BW3A 3I65A 1LOSA 1P1XA 2FPYA 2OT0A 4TU1A 2RDUA 5HWNA 2ZTJA 4N6EA 3W1RA 4NQ1A 4I9AA 3LHTA 1SSDA 1SZNA 5LNSA 2CZ5A 1MEIA 2O7SA 4FF7A 3LRLA 2HS8A 4MY1A 5HR7A 4XBSA 2A6LA 3DXIA 2Y7GA 1KW1A 4EVZA 3NQMA 3NL5A 4NNBA 1EX5A 5DY2A 3K30A 1BEUA 2EF9A 1P5BA 3BVJA 3G0XA 3OVRA 3VE9A 5DBTA 4GE8A 4JDYA 5AYYA 1FCVA 1EUNA 3G1SA 3RLVA 3B06A 4R7JA 3PUOA 3S1WA 1R47A 4ONVA 1UB3A 1ZY9A 1TCDA 1Q6RA 4JX6A 5SWUA 4O0KA 1XDLA 2QCMA 1O95A 1R30A 4IMCA 3N19B 1VLIA 3PULA 2WNZA 3SR7A 4CCDA 5F4SA 4CNNA 2VELA 4MZ1A 1GQNA 1XBYA 3P62A 1I2NA 2C14A 2BWGA 4ZQPA 3SI9A 1W5MA 4K36A 3W7DA 1W5PA 1S5TA 3S1VA 2DJXA 2F84A 4NJGA 1X8FA 5E1QA 3LCXA 2QUVA 2R14A 3CIXA 4WXZA 3GXPA 1XDMA 4UFKA 1SPQA 4GUJA 4HPJA 3TR2A 3GX9A 3LLDA 1UUOA 1NSJA 3S6DA 4NZFA 4WY0B 1A5CA 4AB4A 1Q3NA 1YTEA 4CNOA 4CQ9A 3TFCA 2YYTA 5CZJA 3P74A 4NX5A 3WK0A 5HR6A 3W87A 3LERA 3M5ZA 4MYAA 4R53A 4NU7A 4MJMA 3DI0A 1LOQA 4N02A 3EWXA 3BARA 4UTLA 5U4NA 1FCBA 1JJKA 3NGJA 4AAJA 4XKYA 1TTQA 5H2ZA 1KFLA 2QCLA 3QMRA 3MJYA 4HSOA 3W7KA 2ZRXA 4WUIA 4IX0A 4ALDA 2J6XA 4EWND 4WD0A 1R2RA 4K7YA 4TO8A 3P61A 1OFEA 5HMSA 1PHQA 3DFPA 4GJ1A 2CLEA 3TSBA 5H91A 3EX3A 1TPC1 3S1UA 5DY3A 4MYXA 3W7PA 3NZRA 2X1SA 2ZRUA 1QPQA 3IRDA 3PY2A 5AC7A 5CPNA 4YCOA 4DF0A 1GYLA 3P5YA 4GWEA 3VKJA 3W1XA 1Z48A 5LNUA 4IGHA 3G1AA 1OFAA 3OEXA 3ZFHA 4Y6GA 3T78A 3T4CA 1AW5A 4S1FA 3FOKA 4DPPA 4QSHA 2GPTA 3IIOA 3E96A 4Q33A 2RHGA 1D3GA 4E2DA 3QQ0A 2H3DA 3HPZA 2C13A 3TV8A 4K6AA 4MJZA 1N55A 4XQ6A 3UNDA 1SUXA 2G97A 2WNQA 3RFAA 3NQ7A 1ZFJA 2QUUA 2QCHA 2RFGA 5D04C 1G67A 1XUZA 5U7SA 1U83A 2Y7DA 2J27A 3O05A 1QCWA 1ME7A 3QW3A 3OVPA 1OX5A 3C2FA 2CLLA 3C3NA 4UMAA 1W5OA 4JGDA 2FB3A 3GDLA 2Z6IA 3QC3A 2WJZA 1JCMP 4UFLA 5LKYA 3NL6A 3W83A 4O54A 4IPJA 5CGQA 4DF2A 3MP4A 4BWLC 4CLMA 2GJNA 3ANYA 4E0CA 5AYZA 3L9CA 3W7EA 3LCFA 1QDSA 3TXVA 2TYSA 4QISA 3CEUA 4KKXA 3GR8A 4MLRA 3UZJA 2RDTA 2PRMA 4O53A 3OIXA 2DORA 1TTPA 4A2SA 2FQIA 1H7XA 4FNTA 3VE7A 3LLFA 3LCLA 3QPYA 1VGAA 3MI6A 3LV5A 1G7UA 2QCDA 2VEIA 4ZQRA 5KTLA 2A2IA 3NQ6A 3I6RA 4IXHA 2I9EA 3A5VA 4FX8A 2E68A 3HGSA 2FDSA 3UD6A 5IM51 5HNRA 3QF0A 1K8YA 1RQHA 3QRHA 4XKYB 1SQ7A 2ZRVA 4Q32A 3BG5A 5LGXA 2B0MA 1VZWA 1ZALA 4UIOA 2QUTA 4RK8A 5HQEA 5AC6A 3YPIA 3HPSA 2V30A 4AHOA 2FPVA 5EL1A 4BF9A 2DJLA 4PL2A 5AC8A 3DKLA 4A2RA 3LBMA 4DBDA 4AHPA 1SW0A 5G2HA 3EXTA 3H55A 3PM6A 1OABA 2ALDA 1OFOA 2J9ZA 3S0CA 1SO5A 5K9XA 1K03A 2P10A 3NL2A 2V0TA 1BWKA 3C2EA 2A0NA 1GZGA 1JR1A 4FHAA 3TA6A 3L68A 1FX6A 4KFNA 3B03A 4LVBA 3DFTA 1VYRA 3GDTA 1JRCA 4JTIA 5D2WA 3M1ZA 4O4VA 2DP3A 2EKCA 1WX0A 2Y6ZA 2Y62A 1KA9F 4M6QA 4RJEA 4FIRA 3QYQA 1H1YA 5D32A 2ZRYA 3E12A 4GC4A 1AK5A 5F4XA 3NO5A 4TR9A 4OU1A 4WOQA 3M6YA 4RR4A 1K7FA 3PG9A 4JTFA 4MIMA 1OFQA 4RCXA 5DCDA 1EP2A 3A22A 3CPRA 1EWDA 2C16A 3HG4A 5G5IA 4UTIA 2CZDA 1K8XA 3R12A 5FEPA 1QFEA 3TU9A 3P80A 5BNKA 2J24A 5AYXA 2YXGA 3LTSA 4WY0F 1LM1A 2TMDA 3W7CA 3NM1A 2JKPA 4K8EA 2NXIA 1GVSA 3PSWA 1UJPA 2VFEA 3PUEA 5HWJA 3EWUA 5D2YA 2C3ZA 3G3MA 3MYPA 1TMHA 2GOUA 3L0NA 1XL9A 2Y70A 5LZLA 1K8ZA 2Y85A 1NVMA 5DXXA 5AHMA 3N2XA 3TC6A 1OYBA 3HIJA 1HO1A 2CLIA 3CLMA 4JTTA 2Z1BA 4O4WA 3TUUA 1AL8A 2C1HA 1B57A 4OT7A 3W7NA 1SW7A 4UTHA 4LC8A 2FFCA 3INPA 4IPIA 4RV8A 1DQXA 5I3KA 7TIMA 3LI0A 1JQVA 1R2TA 1Q6OA 1A5BA 3DFQA 2YFOA 1W56A 4HNVA 2LLEA 2QCDB 5KINA 1S5WA 5G2IA 5EMUA 1SO4A 1E51A 3RK8A 1G4TA 2WPBA 2Z0IA 4JY9A 3OBKA 5F2LA 3UPBA 3C6CA 1ICSA 2CLFA 3PBUA 5BMWA 2AGKA 1KM3A 3NM3A 1UBSA 5G2WA 2A85A 2E6FA 4LVAA 1VCVA 4POCA 5D38A 3ABOA 1OFRA 1LRTA 4N4QA 3G8EA 4OGZA 3MI2A 3GVGA 5TBOA 4LY8A 3BK0A 1EEPA 2VOMA 2JGYA 2I14A 2NLIA 1GVQA 3RU6A 3HPXA 4ICNA 3KRSA 3W2KA 5KSWA 4ZQMA 4Z1DA 4GRSA 4FO4A 3NQGA 4FEZA 4JS3A 3W7GA 2F7FA 4L4LA 3IIXA 3KOFA 3STGA 1OVDA 3WJSA 4NT0A 2NZLA 2BX7A 3I7QA 3BW4A 2QDGA 3KAOA 1K02A 4ZMGA 3B04A 4Z1AA 1I2OA 1K3UA 1EB3A 3A24A 3CB8A 3DI1A 3DFOA 1I2PA 4KWVA 1FDYA 2C15A 3B05A 3DHFA 1WOAA 1SR9A 1OG0A 3FKKA 3QPZA 4UMCA 2A5HA 4M6VA 2FIQA 3KVLA 3TROA 2J9YA 4RX0A 4UTWC 5KZDA 2DZTA 5G1TA 3HF3A 2Y7FA 1KM0A 2X1RA 1RQBA 5BRBA 3FEMA 1FWWA 5KZEA 3W2LA 1PIIA 1RR2A 2QCNA 2V5BA 4NX0A 3KFTA 3C2RA 3HO8A 4DQWA 1SSGA 3NQAA 4NNCA 1RV8A 5DCEA 1BWLA 1D9EA 4OV9A 4UFJA 5D30A 3RLUA 1H51A 3A23A 3W3OA 4O57A 6ALDA 1DHPA 4M7TA 4OHQA 1EUAA 1YDVA 3TCEA 1GTEA 4JTSA 3G1YA 1WA3A 5HUPA 1K7EA 2BLEA 2NV1A 2ZCGA 3W84A 1C29A 3PB2A 1WOBA 1VCFA 4FNRA 4N9BA 5CPMA 2XN0A 3BLFA 4BR1A 3CU2A 3QMTA 5D2VA 3SGZA 1KM6A 2X1UA 3F1QA 1IIGA 1KFEA 2VEMA 1FWSA 5K7JA 1JUEA 3LXAA 4NNAA 3SIZA 3HBLA 4IQLA 3UPWA 4HNNA 4AH7A 1H1ZA 5HWMA 2CLKA 1LZOA 3UY7A 1J2WA 2CFFA 3M47A 3M7WA 5EYWA 3IVUA 1HG3A 2RKXA 4UTTA 1H62A 3IEBA 3UWZA 3ZR4A 3AO0A 3W1NA 4Y9AA 4K39A 2ZZ6A 1ML1A 1S5VA 3R5EA 3P84A 2GQAA 4N2YA 3MWAA 4O14A 3R89A 1D3HA 4NVTA 4Z1BA 5DCBA 5IBXA 3W1QA 1VHNA 4AWSA 2FTPA 3OHIA 1GG1A 1VLWA 2CW6A 1YDNA 5AHFA 3B0VC 1TB3A 3DFNA 4FXSA 4LTSA 1ICQA 2VXNA 3U8GA 1VQTA 4O15A 4O1DA 4BI5A 1JUKA 3DFSA 4HSNA 1AW1A 3FJ6A 4K8HA 5A8GA 3QH2A 4A22A 3IV3A 2Z2UA 2ISVA 4GUHA 3LHWA 4X22A 1VR6A 3BG3A 1U5JA 1EIXA 3GKFA 3TJLA 1KTBA 3O6DA 1XC4A 2ZZ2A 3EWBX 3W88A 2FPTA 3C0JA 3O8AA 3T7VA 1B3OA 1VRDA 2I1OA 3THQA 3HGOA 1G4EA 3HQ1A 2CLMA 1S3HA 1DOSA 1QOPA 3P8IA 3FA5A 4JNMA 2TPSA 3EEGA 4M19A 1XBXA 3C52A 3EXSA 4PCFA 1KFBA 1OFDA 2HMCA 4K38A 1JQXA 1HTIA 1Z42A 4I7UA 4PC8A 1DBTA 1TSIA 4OV4A 1I2RA 3GDMA 2ZBTA 5BMXA 3D0CA 4BI7A 1VJIA 3O06A 3TE9A 1LRNA 3W1PA 4JXCA 3TC7A 4IUOA 3PF3A 4E38A 3G18A 2QJGA 1XFBA 2KZHA 1Z41A 4J9JA 3TW7A 4MFEA 1F6KA 4O19A 1LBFA 4UNLA 1XUUA 1AMKA 4AXKA 3N3MA 1PVNA 2Y7EA 1OYCA 4JIQA 1GJPA 1VC4A 4RZ4A 3W7MA 2YDAA 3HGJA 2W6RA 3DAQA 3QJAA 3A21A 1TQJA 3NXFA 1BKSA 3QM3A 2OCZA 1WYIA 3B0PA 1YXDA 3W7LA 5AN7A 3ABSA 1KFJA 4IMEA 3V75A 4IMDA 3PVFA 3UWYA 2ZZ4A 2GUUA 3VI2A 2FB2A 4JICA 3MBDA 5LSMA 3A9IA 2VFHA 1TQXA 5K2ZA 3CQ0A 4N9DA 2E6DA 2NWSA 4ML9A 5G1YA 4UR7A 1F5ZA 1I45A 1GVRA 3CWNA 5CZSA 5LNRA 4MKNA 4TX9A 1ALDA 4O1CA 2V2CA 1GPWA 1PL9A 5AHNA 4E2BA 3UZ5A 4NXKA 3USBA 4CCEA 3S1XA 3STEA 3VNDA 4OQVA 3MUXA 3WK3A 3WJZA 3GNNA 1I2QA 2V82A 3KVMA 4JN6A 3GNDA 3W75A 2GVGA 3NA8A 5D2TA 4JTHA 2ZRWA 2OT1A 2JKEA 3WFAA 3L0GA 3W85A 3LTYA 1T8XA 4H6KA 3W07A 3NG3A 4ORIA 1XBVA 1KLZA 1TV8A 1OJXA 3NR0A 4RKAA 1SFLA 3C4UA 3TMLA 1A5SA 1ZJIA 2ZZ5A 5K4ZA 3RF9A 1SO3A 2YFNA 3L5AA 4XTDA 4JY8A 2ZZ3A 4FNUA 1TJRA 3TQKA 1XCFA 3E9AA 1XM3A 1FUYA 3G1DA 1O60A 1FCUA 3AJXA 4DO4A 3UYCA 1TO3A
chains in the Genus database with same CATH superfamily
4PMYA 2P8BA 2HJPA 4W4QA 4IM4A 2WWCA 1LLWA 3GNRA 1E71M 5IDZA 2AKMA 3D46A 3QZAA 1JUBA 5F2IA 2OEMA 2GK1B 1W9VA 2ZUMA 2Y1HA 5E6ZA 3AWOA 1JF6A 3MO7A 1KBKA 4D6CA 5DO8A 3UT0A 3CV1A 2B7OA 2OPJA 4AC7C 2WBGA 3KHJA 4GUIA 1LQ2A 4DBUA 1TPFA 3NPUA 1THFD 4Q8QA 4RNIA 3P5ZA 1XQLA 3M5XA 2E0PA 2YL5A 3A13A 1Z8AA 7TAAA 2ZFAA 3S5ZA 4XZ9A 1OZQA 1VFMA 2YDRA 3ABZA 1IQ8A 3STCA 3S5NA 2FGBA 4A6GA 3IACA 5A6BA 1WP6A 4XIMA 4MG4A 4R3UA 4E8CA 3DX5A 4RLIA 4MLJA 1OQFA 1NJJA 4D6FA 2H8XA 5M17A 2H8ZA 3LX9A 4DX3A 1ZLPA 4PYSA 3RYSA 5REQA 1R0MA 2FTYA 3GXNA 5ECVA 3TXZA 1DWAM 4QNEA 1A47A 1ZTVA 2NXGA 3W7IA 4FX6M 4EXBA 1LYXA 2X41A 2CZEA 4RE0A 1UWSA 1XIBA 1PWMA 1PE1A 2VQTA 3L21A 4IPPA 1FP9A 4HPGA 3H4GA 4U3AA 4JPGA 3WQFA 2B81A 1JI1A 3OGSA 2ZZ1A 2CHRA 2YSWA 5AC4A 3EPMA 4DAIA 1BYAA 5HULA 2XN1A 5FL1A 3NZPA 3TSMA 4AD0A 2WV8A 1KM4A 1XR2A 2PURA 4L9XA 2FHFA 3A5FA 4YTSA 2PP0A 4IP5A 3WDQA 1JG9A 2DSKA 3W24A 1X6UA 1KTNA 5EBUA 4DWDA 4EWJA 1UR9A 1F76A 4JTJA 6TAAA 2NQ5A 1K7XA 1JFHA 4XO6A 2R8WA 2Z26A 3KM8A 3NQDA 1J2BA 4ZQNA 1C3FA 2ACUA 1BRLA 4FOUA 4L1XA 4LGXA 1K9TA 3M0JA 4L7ZA 2NUYA 3N2MA 3M44A 3OA5A 4LVGA 3TOPA 1MFUA 3BANA 4XSLA 1ZPTA 3U0HA 1TV2A 1G4SA 1V4YA 2Y63A 2GDVA 3T8LA 4H4IA 5KZ6A 1UZDA 3FCPA 2Y88A 1SU5A 1YDYA 4KEVA 3A9BA 4TTUA 3WH6A 2GJXA 4PUUA 4FNPA 4QLKA 4HA4A 1CTNA 3ARTA 2NVDA 1J4EA 4UCGA 3VVGA 4ZA0A 4NXSA 3VFLA 5D37A 3TC3A 4ORMA 3N73A 5DQPA 3BUVA 4G7EB 1ME8A 3NTYA 3UJ2A 4S2BA 2V3DA 1PTAA 3GDKA 2YZRA 1W8SA 1H1NA 3ZZ1A 1V08A 3MI3A 3DN5A 3GTHA 4L64A 3OZMA 5REQB 4ENLA 3E5BA 3VAVA 4A8RA 2ASHA 3MW7A 4OVXA 1LTDA 3P7YA 4HU4A 4Q4OA 3VGEA 2A4AA 4LYQA 4YS1A 2YXXA 1J6OA 3LDVA 2B4GA 2UV8G 3LGEA 1H4PA 5BYWA 1OT2A 4PBFA 1YE4A 5FEZA 1KBIA 3ZJ8A 4AD4A 4C7FA 4NZ5A 1XGZA 3H7UA 3S5OA 1JCNA 1NF7A 2YR1A 3AIVA 1FQ0A 3L65A 4F4RA 2CETA 4I6KA 1QPNA 5AHLA 3BMVA 3VD7A 3W2MA 3NNTA 4MZ8A 3ARQA 4MWAD 5I24A 1ZCOA 2HXUA 3KL5A 1TV5A 1P1MA 4UBPC 3R94A 3T0BA 1W1PA 1WDWA 5E93A 2HV5A 5FEWA 4YWIA 2QMJA 3O1NA 1BRLB 3N18A 2ZVRA 4IJRA 4LUYA 3SUWA 1T6MA 4RXGA 1W31A 2DZPA 3BAWA 4ZL1A 1WXYA 3CIWA 1UIOA 3PZVA 4EP8C 4C6OA 1QUMA 1O94A 3REQA 1R7AA 1RHCA 1N7KA 3OYXA 4F8XA 3UXIA 3GTFA 2NSOA 5CJ5A 1EO7A 1VYSX 3FN9A 3EB3A 1MXSA 5A6LA 1WZKA 3CAVA 3W9ZA 4DBWA 1S39A 4AWUA 3A3WA 4W9TA 3KWSA 4CCCA 5EPDA 1CXIA 4QAWA 4RE2A 4TMBA 4XUGA 1US2A 3OP2A 4WDXA 1QO5A 4U2ZA 1S5NA 2I17A 4PB5A 3V0SA 2H6RA 4B2DD 1KFCA 1FOBA 1N8WA 1FKWA 1QAPA 2JQXA 4PCSA 5E5CA 1NQ6A 3TSDA 1JZ3A 4I9TA 4AYGA 3DG3A 1DQWA 2PDFA 1YTDA 4LBUA 2QCGA 3BJFA 1ONRA 4R88A 4FLSA 3W7QA 2BB0A 2PLJA 1TFVA 3TZFA 3LQLA 4DYKA 1UMYA 3EX1A 1ENUA 1H7NA 4M82A 3NOEA 3PBWA 1DYSA 1FTXA 1QI2A 3TJXA 2AL2A 3E2RA 1RP9A 3H2EA 1NDZA 2H90A 3S9YA 4RZ6A 2G37A 1AH3A 3L0KA 3NQFA 5JXQA 4M24A 3TX9A 4PUKA 3SAZA 4YHEA 3H6OA 2PTDA 3SN0A 5DXYA 5CLWA 1Q8JA 3EAUA 2JIEA 3QXBA 1G6CA 5FL0A 3PBVA 2YL6A 1YXCA 3BOFA 1XISA 2Y5EA 4JQ3A 2A3HA 2FH6A 4EXAA 1AZ2A 3QOMA 4UOQA 3W81A 1ZJAA 3UZZA 4DZ5A 3SBFA 2CNCA 3UJEA 3C8FA 2OYMA 5DX7A 4HHLA 5G4WA 4MDPA 1J6PA 2ZX6A 4HCHA 2WHLA 3REQB 1NDVA 5LA1A 3H8AA 2ISFA 4F0SA 1IXOA 4H9UA 3DGBA 4XTIA 3AXHA 3ZJ6A 4QJ5B 2OOGA 1XP3A 5D03A 2HWGA 1BYDA 5EMYA 3CQJA 4UXDA 3M6DA 1GONA 1XLAA 3CT2A 4H9VA 1TPUA 1E6QM 3TN4A 4LOCA 3IVTA 3KBVA 2QVNA 3E38A 1Q2RA 1GQIA 5CLTA 3WD2A 2VNCA 1N8IA 4QLLA 4E4FA 1I0DA 3K8KA 2OMAA 1ECEA 2WCAA 3CQHA 4YL2A 4YVXA 4RDZA 1Q65A 2ZRZA 3M07A 4GBUA 3TQ0A 2A3EA 1TTIA 3BMWA 5FJJA 2DUAA 3NAVA 3BO9A 2J7FA 1A53A 3WLHA 2ZA1A 1JZ5A 2RDWA 4AHQA 2C79A 3R8RA 2DQWA 2IQ0A 3K4WA 1UA3A 1ODUA 3ITLA 4LUJA 4F40A 1ZENA 3D3FA 2PI6A 2DZUA 2PDKA 1UR8A 4NJIA 3MDUA 1YEYA 3M0MA 1IT8A 1LCOA 3URNA 1R7OA 2AL2B 3K1DA 1XW8A 4X9SA 5FF3A 1XX1A 4ZB2A 2FGLA 1H61A 1R46A 1OX6A 1A50A 1YADA 3TW9A 1CXKA 3E2VA 1W9XA 3JUGA 4EAMA 4W7UA 2PWFA 3SJ3A 1OCBA 5HQLA 2JALA 1PBGA 2CIPA 1M6JA 3TLLA 4IIEA 3PAJA 1Z44A 3QY7A 5T9BG 3T55A 3MDWA 4DIAA 1BGGA 1FCQA 1PCWA 4BWLA 2VFDA 4LU0A 1IEWA 3HMCA 4J27A 1CI1A 2QPXA 3NDZA 1K4GA 4OUEA 7PTDA 2BP1A 4DLMA 4QJ4B 1HP4A 4PTMA 1A49A 4I8YA 2VCBA 4NYYA 4PRWA 1YPIA 3UZXA 2AAMA 1M04A 3GTXA 4DZAA 1MEHA 3Q58A 4NAFA 4FMVA 2J8FA 2ZUUA 6TIMA 4GX8A 3GZAA 2OJPA 3V5OA 1B3VA 1HXJA 3OGVA 1UKQA 4BI6A 5FJOA 2XPKA 2J88A 1FFRA 5E9AA 2X2GA 4QQ3A 2ZICA 4RDVA 2BHZA 4XAGA 1M41A 1JF5A 4DXVA 5D02A 5AFDA 1TRIA 4K3ZA 4LUTA 2WSPA 4FIQA 2ZVIA 3TOYA 2XHYA 4GD0A 3U2OA 2D20A 3TVAA 1JDFA 3QZEA 4HK5A 3FYOA 3SEPA 3UR5A 3E0LA 1R2SA 4LNCA 2PDHA 2POTA 2HS6A 4GXPA 3IARA 3DHPA 4WOZA 3KZPA 3MCNA 1TZ7A 4CQAA 1XJBA 3I7RA 1HW6A 1EH9A 4QEHA 1FWTA 3O07A 4AEOA 1HGYA 3UXDA 4IPNB 4K2SA 5L9FA 4AXNA 2BVTA 1W37A 4JN8A 5LXEA 4IGSA 2AMXA 4DYJA 1U1JA 4PUJA 1JRBA 2ZTKA 3SRDA 3USZA 2O0TA 2YL9A 4XD4A 3EOUA 4GFSA 3BZGA 2PZNA 1GWJA 4V27A 5I06A 3GG7A 2VJXA 2OO6A 3BLEA 1H7RA 3DZ1A 1V0KA 4MJ4A 1UA7A 1PJ9A 5HUOA 3FJ4A 4U4MA 5AHEA 4GIYA 1K6AA 3DG6A 3CH0A 1QT1A 3BV4A 2HXTA 1EJWC 2P3EA 3CHVA 5EBAA 4B9ZA 2VO5A 1PTGA 3SUVA 1DE5A 3C86A 3GR7A 4CNSA 2I7GA 1TE1A 1V7YA 3B4UA 4HCLA 3ZJ7A 2C19A 3STFA 3SCTA 3SGUA 4OBTA 1VBGA 2FVKA 4L61A 1K70A 3VNYA 4HP5A 3LNMA 1MW0A 2XISA 3VOCA 4OJYA 4DJFD 4NAFB 2I5GA 3SY5A 1NU5A 1DTNA 2ZA2A 4B5NA 2Y8VA 4JR5A 3G1FA 4H01A 4CNPA 5GVJA 4DBEA 3GHSA 4H9TA 5EMLA 4LUTB 3WLJA 3QHNA 4H83A 5BOOA 1DIDA 1BSIA 1F3TA 3H7VA 3KP1A 4DWSC 1QBBA 3C2OA 1SVDA 1SFSA 3UXLA 5K3VA 1XH0A 1E0TA 1OHLA 1OK4A 3CZGA 4GZEA 3Q67A 1WAWA 4JDBA 4ZGYA 4R9OA 3R0UA 4ZB5A 4Y9PA 5EMKA 2YCKX 1XGEA 4GIAA 1D3CA 3EA3A 4JYDA 4S3CA 1IXPA 3T0DA 2R6OA 2EPNA 3E02A 4OTKA 4UNKA 1V3JA 1RJRA 4XAPA 2E28A 1XSKA 2V5CA 1E9YB 4PB3A 3VK5A 2BOEX 3EKZA 1F74A 4MHBA 1VIWA 1ADSA 3ENLA 5D05A 2V38A 3WENA 1IZCA 1L8PA 2JEPA 4XB3A 3W2JA 3B3DA 1W1VA 5C9XA 4C1NA 3N15A 4GXMA 3F7JA 5FAJA 2BY3A 3AQUA 3CV2A 2EG7A 1TYGA 4M1BA 1QHZA 4EPKA 2Z4GA 3IGXA 1SR0A 2QKFA 3ZS4A 5L6UA 1F2JA 1KCKA 3QV7A 2ALRA 1U2YA 3PPFA 1RCQA 4WY0A 4C5ZA 3T9PA 1B4EA 1WXJA 1LG2A 3MHFA 4MY9A 2EHHA 1FH9A 1K9EA 1F6YA 3WLPA 1CPUA 4PMJA 3LCGA 3VGDA 3AIBA 4J2MA 2IPWA 1W3JA 1FHDA 2J66A 4CKQA 1IGSA 3GIPA 1CLVA 3KCLA 4PODA 1JNDA 4A3UA 3KS6A 4FZIA 4UFHA 2OO0A 4AZBA 4DF1A 3LOTA 2Q8XA 4S23A 4GX9A 2VM8A 1EP3A 5FJIA 3O6CA 1KGXA 7ODCA 3BW3A 2FPYA 3L7RA 2ZTJA 4I5RA 1QATA 1IE7C 1NQKA 4N6EA 1O66A 4AZHA 2BBFA 2WPGA 4U10A 5HNTA 4CD4A 4H2HA 4RW3A 3FNDA 4MY1A 5HR7A 1TWIA 3NURA 4IUGA 2A6LA 6ENLA 3I3DA 2JF7A 4LF2A 3NQMA 4NNBA 4QDWA 3RM8A 5FAGA 2G4JA 2QLYA 3VE9A 5HXMA 2O92A 1KXVA 1ZBVA 4W89A 1HVXA 2V5KA 1Q6DA 3VA8A 4JTCA 2BY1A 3S1WA 3AUJA 4Y9NA 1Q6RA 3PZMA 5SWUA 4O0KA 1EC8A 5D4YA 2J8TA 2WNZA 4CCDA 2IUZA 4CNNA 2VD9A 4KH2A 4GISA 1GQNA 3SCVA 3P62A 4GZJA 1I2NA 2W92A 2DT0A 3GQYA 1B2YA 4UZUA 5GNZA 4C1NB 2YCLA 4MNJA 5HJYA 1W5PA 2WWDA 4Q4MA 2DPEA 3WNMA 2DJXA 2F84A 3SURA 3W27A 4QDMA 2QZRA 4TV5A 3LCXA 5E1QA 1E1CA 3ZM8A 2R14A 1L6GA 3CIXA 3BLPX 3GXPA 1XDMA 4UFKA 1CGWA 3TR2A 4HU3A 1S1RA 3KOZA 4WY0B 1CGUA 4AB4A 1Q3NA 3GG8A 1HIZA 1T5AA 3FW6A 3THUA 1VJSA 5MKGA 1ITXA 1HJQA 1K4HA 4R53A 3CL6A 2POZA 3EWXA 3BARA 5U4NA 2PPGA 1FCBA 1JJKA 4YTTA 3NGJA 3WF0A 3W25A 4AAJA 5D9OA 1KFLA 2QCLA 3SRFA 1QWKA 3QMRA 1KRBC 4ICCX 2HE5A 4XZIA 1IZJA 1V6YA 4WUIA 4EWND 1FHVA 2ISDA 4AZ5A 4K7YA 1NDYA 4BQ4A 4I5XA 3DFPA 3TSBA 2CLEA 5H91A 3MUCA 3S1UA 2XGBA 2BG5A 4XKMA 4ZFMA 3IRDA 5AC7A 1G01A 2YIHA 4GVFA 2V69A 1GYLA 4GWEA 4CCZA 3DESA 5JVLA 3VIGA 2YJQA 3G1AA 3FYYA 1AW5A 4QSHA 1SMAA 3GFYA 3ARUA 4Q33A 3GH5A 4JTDA 4E2DA 4MGGA 3KOYA 3G6LA 1UQZA 4LFYA 3U9IA 4Q6JA 3UNDA 1SUXA 1UWRA 1R86A 4NILA 2QCHA 3MJMA 1PIGA 1XUZA 3TN6A 3O05A 1KFWA 3FXGA 2BMBA 3OVPA 1OX5A 3C2FA 3APTA 2R9RA 3C3NA 1S2WA 1PZ2A 2CBVA 4D1JA 3I3EA 1J10A 1GYMA 1OY0A 1VEOA 3NL6A 3KBWA 2A79A 1RXOB 3MP4A 4JTRA 2YCLB 4H9YA 5AYZA 4JHZA 4CD6A 4I8DA 1E1CB 2ODOA 3B8UA 3GBDA 4MLRA 3H2AA 3PZQA 4TV6A 3NZQA 3UFYA 3BICA 3RU8X 3LCLA 1IEVA 3MI6A 3LV5A 1G7UA 5MKGB 3WF2A 1W9UA 4GINA 3QRHA 3H70A 3MVIA 3VIOA 1X8CA 1R8LA 3HPSA 2FVLA 1GGOA 2FPVA 4E5TA 3WDJA 3H55A 2ZC8A 3OO2A 2PWUA 1OABA 1OFOA 2J9ZA 3S0CA 4L6HA 5IHRA 3G6MA 4AUBA 2P10A 1TE6A 4LAUA 3C2EA 2A0NA 2J8GA 3R4IA 3RN6A 4DJEC 4FHAA 4CN1A 3B9EA 3ITVA 4D6HA 3B03A 2QF8A 3T2OA 1HNYA 3M1ZA 2DQXA 3VGGA 3LENA 2F8QA 2R1PA 2Y62A 1KA9F 5XIAA 3AS2A 2AAAA 3CHDA 4XZLX 3M6YA 4RR4A 4JTFA 4RCXA 3T6CA 1EP2A 5IOBA 4J4KA 3A22A 4L4OA 2REQA 2PLCA 1MYRA 3L23A 1QNQA 1SM9A 1WZMA 2W4XA 3LTSA 4AY8A 3CQIA 1TWZA 3W6MA 4B5WA 1VPQA 1FWJC 2JKPA 1JAEA 3RMEA 4K8EA 1LQ0A 4C6JA 3T1GA 1GVSA 3EWUA 2XZ9A 1Q6CA 4RDWA 2VL4A 3TTSA 2GOUA 3C0LA 4OOUA 1XL9A 2Y70A 1K8ZA 1NVMA 2PDYA 1DWFM 3TONA 2Z1BA 4O4WA 3TUUA 1REQA 1U30A 2FVMA 2VZTA 1DJIA 4J3WA 1AH4A 4OT7A 4LC8A 4RV8A 1DQXA 5AC5A 2VZSA 1XF0A 1JQVA 2MNRA 1KGUA 4IG2A 1R9YA 1XLBA 1OGBA 4JTQA 4URIA 1E56A 5EMUA 5G2IA 1E51A 1G4TA 2WPBA 1ZZMA 3OLDA 4HN8A 2RAGA 5FJTA 4US5D 2CLFA 1E0XA 1MQRA 3NM3A 3BE7A 4CNTA 4LVAA 3B8IA 3ABOA 1S46A 1O5RA 3AICA 5TBOA 2D1ZA 4LY8A 2VOMA 1G5AA 1J01A 4I5UA 1VEPA 4Z1DA 5HK4A 5H8UA 4FEZA 2F7FA 2E25A 3KOFA 3WJSA 4OBSA 2BX7A 2NW0A 5I23A 4G9PA 1TG7A 2X7WA 1OB0A 3BW4A 1BXNA 2QDGA 3KAOA 4ZMGA 2EBNA 4YVPA 4WHBA 5HMDA 3DI1A 3OZYA 2BOFX 3DFOA 1I2PA 4XIAA 3AOFA 1SR9A 4HA0A 4INFA 3C5QA 4M6VA 3U4FA 2REQB 2FZ9A 4B4HA 4IISA 1IEXA 3TROA 3IANA 5G1TA 2DH2A 4DWSA 2X1RA 1BGAA 2Z28A 3W6LA 2VWSA 1PIIA 4NX0A 3C2RA 4A35A 3VX1A 1BWLA 3E0VA 5D30A 3RLUA 3OBAA 3C2YA 4OHQA 1E6XM 2GOKA 5LA2A 4OUIA 1GTEA 2OZTA 4KEUA 1K7EA 2BLEA 5LIXX 1NH6A 1REQB 3H21A 1C29A 1WOBA 4FNRA 3QMTA 3SGZA 3NDYA 2X1UA 1EBHA 4R7OA 3SCPA 1FWSA 5K7JA 1JUEA 3LXAA 4XX6A 3SIZA 3RR4A 4IQLA 2V5DA 4HNNA 1H1ZA 2CLKA 2DW6A 2UY2A 1LZOA 3MS8A 1M1BA 2DH3A 2FKPA 3R0KA 2X8RA 1H62A 1VIZA 5BWAA 3ZR4A 4MADA 1XLMA 3AO0A 1XIIA 2FJUB 2J77A 4U31A 4K39A 2ZZ6A 4XVDA 4JFUA 2GQAA 1POJA 2JIWA 2XIMA 4Z1BA 3PZ9A 5DCBA 4GY1A 3RLGA 3W1QA 1UP2A 3OHIA 3QR1A 3QVQA 4R5EA 3VMNA 1CECA 4HQVA 4IH3A 3AMGA 5AHFA 3L4ZA 4LCSA 3ZSSA 4LTSA 2F6KA 2VXNA 4IL2A 4AD2A 4D8ZA 4PMNA 2EEXA 1H3GA 3UJSA 4ZCWA 3VGHA 4B5VA 4H8VA 1AW1A 4K8HA 1XRVA 1BD0A 4MNKA 5GPRA 2ISVA 3CZ8A 4GUHA 4X22A 3O3RA 2JF6A 2BFGA 1EGVA 3O6DA 4F3HA 2IKGA 4FXFA 3EDFA 1V6WA 3CZJA 3EWBX 2VR2A 3W88A 5LIYX 1OCNA 4DWSB 3RAOA 3S2NA 2R82A 3C0JA 3T2QA 3THQA 3ORWA 1JYNA 1G4EA 3ALGA 4XAFA 4B16A 4JNMA 5CZKA 3EEGA 1VBHA 3O0KA 2VMFA 4NRRA 2FTWA 1MUWA 3OJGA 4FK9A 1X98A 1XYBA 1KFBA 2GGJA 1OFDA 1B0IA 1HQTA 4K38A 2HVOA 1HTIA 4PC8A 4OV4A 3IWPA 3SFWA 5HPCA 2ZBTA 3IJLA 5BMXA 3VNJA 1GQKA 4Q7NA 3WUGA 1FRBA 5BXPA 1VJIA 5CH9A 1LRNA 4Z2LA 4JXCA 1JCTA 3UF9A 1D7FA 4P8UA 1Z41A 1J0KA 3U2EA 3NEHA 3GIQA 4H1ZA 4UNLA 1XUUA 1C91A 1PVNA 2Y7EA 1U33A 4JIQA 3W7MA 5HAOA 2QIWA 3QKEA 3RHGA 3HGJA 4NG3A 5AVHA 3QJAA 4PUEA 4PUNA 3IAQA 2PTZA 4J28A 1D7KA 3WF1A 4AC1X 3B0PA 3KLKA 1GW1A 3V75A 3VI2A 5FCZA 3MBDA 4WKAA 1A5LC 1TQXA 4YVVA 1WKFA 1BQGA 4N9DA 2E6DA 4GI9A 1XH1A 1I45A 3SB0A 5LNRA 3HPFA 4BF7A 1BLIA 5AHNA 4E2BA 4J3UA 3T8QA 4CCEA 5E0FA 3STEA 3VNDA 4PMDA 3MUXA 1E3ZA 1I2QA 2V82A 3LS9A 3UR2A 2TODA 1XWYA 1QW9A 1B90A 3ARXA 1U1HA 2XDFA 2XIQA 3OOQA 3CUFA 4QROA 1TVNA 2JKEA 1JAKA 3WFAA 4W5ZA 4NI3A 1YHTA 1DWHM 3F5LA 4ZENA 1UR1A 3W85A 1TELA 4NAEA 1TV8A 1SFLA 3C4UA 3RF9A 2PDCA 1SO3A 3CL7A 3ITGA 3L5AA 2OQLA 4XTDA 3F4CA 4LALA 4FNUA 2PDQA 2V63A 3NUKA 3JU2A 4QQUA 3SUTA 1B31A 3AJXA 2PP1A 4W86A 4YMZA 2E77A 2WLZA 1V93A 3SO7A 3S2JA 3UEQA 2P0IA 4R85A 1F4AA 3A4WA 4H6QA 4ILSA 1P4CA 6A3HA 4AEFA 1LJYA 3PWIA 4M5PA 1MRAA 2Z1XA 2PTXA 3BCFA 3CO8A 1W3KA 4Y9MA 2GGIA 2O9PA 3NQ8A 1UUQA 2BGSA 1BVWA 5FJPA 3T05A 2Z1VA 3WBAA 4O1BA 1T99A 1WB0A 2IW0A 4B5SA 2BXZA 4O50A 5C54A 1TTJA 3WQPA 2OG9A 1BHGA 2NXHA 2G96A 3H24A 2O4QA 2E09A 2QCFA 2QS8A 3CNYA 1TX2A 4N4PA 3EPNA 2AQWA 5CZTA 3JR2A 2OFJA 1Y0EA 3E0IA 4AW7A 1ZCCA 2E6YA 3ICJA 4RL3A 5K9CA 5LIKX 3N14A 4Q8OA 3WJYA 1EQCA 3DERA 4MOZA 1XXXA 4YYCA 2BZNA 2EXOA 5BWFA 5CGMA 1RA0A 3KCOA 4AZ7A 3LD5A 1XYMA 4ERIA 5LA0A 3N2OA 3GB6A 4L5ZA 1KM5A 3WEZA 3EEZA 1EWEA 3S83A 2IXUA 4I3GA 4O52A 4DJEA 4JYEA 2GVLA 5EY5A 2JFEX 2OZ0A 2DVXA 3GNPA 2FLIA 2O56A 1MEWA 2FGZA 1ODZA 1M65A 1Z69A 3LXBA 3POHA 2A21A 2W66A 2GVEA 3NSXA 4HPNA 4V1XA 3L4XA 4GMEA 2C0AA 4H19A 4F79A 1HJXA 2PDPA 2Z24A 3RO8A 3UYIA 2W91A 3LHVA 3DENA 4NJKA 1GVOA 4B15A 4JQ2A 3W1MA 3UPMA 2WKJA 1P43A 1V3MA 3CPGA 1AODA 1IWBA 4M6UA 4GKTA 4O17A 3BJSA 2R1KA 1V3LA 1W3IA 1AL7A 1BFNA 4KW2A 1RPXA 1WAUA 5A6SA 4M1RA 1GKQA 1K8CA 1VENA 1EXBA 3I10A 2QVHA 3A4AA 2YPIA 3AS1A 3UR7A 4PBGA 2QNEA 4H8NA 5EFDA 5CQ1A 1V5XA 4XD6A 1EXPA 3IGUA 5CKSA 1CGYA 1O68A 2PWGA 1AW2A 3M16A 1QHPA 3WNOA 3QV8A 2PDBA 1IZKA 2OWWA 2HDJA 4MJ2A 3W70A 1MDRA 3M41A 4QR6A 2NQZA 3WL1A 3LPOA 1XSIA 3G1HA 4MKSA 1W2PA 1M5WA 3MUZ1 3NQEA 1EBGA 5FESA 2GUBA 4QG6A 1C90A 2J7GA 4Q4KA 3VU2A 1W9PA 3LCIA 4QFUA 3GXTA 1CENA 1HUVA 2VQUA 3BSHA 4LJ3A 3VGFA 3LM7A 4GIEA 4J3TA 3WLQA 3KRUA 3N2BA 1YPFA 3L2IA 5CBJA 2QEZA 3DUGA 3UA4A 1G9HA 1TV4A 1ZL1A 3WD4A 1L8NA 1AMYA 5CPQA 1H60A 1RVKA 4Y90A 1UWAA 5JBFA 3TH6A 2WJFA 3URQA 4LCQA 5D09A 4O11A 3MSRA 4UTFA 5TF0A 1QI5A 3ARPA 4Z08A 4IXXA 4JQAA 2VEGA 2VR4A 4FI4A 3PR2A 3ME3A 2ATSA 2DT2A 2G3NA 4P7NA 4FX7A 3DKJA 4O8RA 2NVCA 1FH7A 4B3LA 2Z7GA 4F2TA 2A7RA 5HINA 3KBSA 3WBXA 4LYPA 3AMDA 3NL3A 3SDOA 3T44A 2YCEA 5FIPA 1H7OA 1KQZA 3QYSA 5AB3A 5JQ9A 1FWNA 2WANA 4LW7A 4HNUA 1I4NA 4GQQA 4A3RA 3WLNA 5BOEA 5A6MA 1JPDX 3IS4A 4OFCA 2C71A 3HOJA 4GABA 4AIUA 7CGTA 1PX4A 3FLUA 5FF2A 1TPH1 3U7BA 3NIYA 3RUBL 3LG3A 3ZXWA 3CYVA 4G1KA 2WVVA 3V1PA 2J78A 4WQ6A 3W82A 1VFTA 5LNVA 1OF6A 2HROA 3OG2A 1BXCA 2GJPA 1JD9A 2GQ9A 5DBUA 4FS9A 5G1MA 1LLZA 4LWWA 3OPSA 1P0DA 3ZVHA 1XBZA 1LRQA 2XU2A 3IUHA 1J18A 2Y24A 1GKRA 4J35A 4IJBA 5A69A 2Z6JA 3ZOAA 3IJQA 3WK2A 1HL2A 1IEQA 3M7SA 2QDHA 1FP8A 3GHTA 1VBRA 2VVNA 4JEQA 3NCOA 2GUYA 8CGTA 1EJTC 1HFBA 1LDCA 4AF0A 4Q4SA 3ISIX 1Y65A 1TUFA 3BDKA 2WVUA 1L2UA 3HQPA 4UTJA 1GG0A 3D6NA 2QV4A 3JRKA 3MMTA 4WZHA 4BKNA 3DCPA 5FF0A 1R9ZA 3LHZA 4HHPA 1VYPX 3M0VA 3CT7A 4ZQCA 3GFZA 3TYCA 3HJEA 3MA8A 2F6UA 3NDOA 3W71A 3UETA 1RQEA 3KCJA 5HPOA 3K8MA 4LS1A 2DIJA 4U5KA 2ATMA 2DZAA 2VFIA 4MY8A 4ZSTA 2QT3A 3CWHA 1IGWA 3EOOA 1LWIA 4LQ1A 3W86A 2PGRA 3FYPA 3RJXA 1KD0A 5CPLA 3VGBA 3WEMA 1K77A 1XRSA 4S39A 5K9DA 1RAKA 3GU9A 1MNZA 3ARWA 3WLOA 3NQ2A 5I7GA 3UJRA 3CV7A 1GOIA 1TWSA 2P8CA 1UWIA 3GE7A 4UB9A 3S3GA 4EXQA 3KBJA 2WVVB 4KF1A 2UWFA 2VRQA 4FP1A 4Z1CA 4DJDD 3F2DA 3BTNA 1G94A 2XH0A 1NFBA 2X05A 2HPMA 1UUMA 4ZTYA 2ZDRA 3K4AA 1OF8A 3T0TA 4MUZA 3WG6A 1SZGA 3ZVHB 3GK0A 2PDLA 5I2UA 4DUVA 1S5MA 4GK8A 1H7WA 3N1AA 4ADSA 3ECQA 4Y8FA 4L65A 4HPXA 3KEHA 1I8JA 3VZYA 2A7NA 2VX5A 4PCNA 2W0UA 3OW1A 2V2HA 1VAHA 3A47A 2OGYA 3HMJG 4Q7BA 3AMKA 2XVKA 3MUAA 4F0MA 4KRUA 3S9ZA 2D22A 1ESWA 3T09A 5KMYA 1C7TA 4H9ZA 4PSRA 2NQ9A 3G22A 2RDXA 1WZAA 4GGBA 1DTUA 2J13A 4I7WA 4AF0B 2QJNA 2OKTA 2V9DA 2GDQA 3NSMA 4N6FA 2WSKA 5GNYA 3NQCA 3WNKA 3RMJA 2PWEA 3UQNA 1ZUAX 3OODA 3H4XA 2J25A 4HU8A 1C8VA 1QNVA 3E6EA 1DWIM 4DEFA 3TMQA 4LBRA 1DL3A 2PDWA 3EA2A 1GOXA 4C6IA 2CU0A 4UQDA 1FWEC 4LSBA 1WDSA 3R8GA 5TQLA 5CSSA 3P93A 1EHNA 3PC0A 3W73A 1QPRA 2BSLA 4WVXA 1LL7A 2INZA 1UROA 2BVYA 3IIPA 3GTNA 1XD0A 3PBMA 3NSNA 4Y96A 1ZGDA 3BG9A 3W1AA 4AVFA 1TX0A 1SZEA 4KGJA 3EX6A 4FXJA 2QGYA 2DGAA 3C0QA 2PSNA 4CEXC 4Z0JA 2C6QA 1E6NA 3UGRA 3ABQA 4ACYA 5IDIA 3RGTA 1YKWA 1XLDA 1JCJA 3IGSA 4TUFA 3P2VA 1MW3A 4I6VA 2PU1A 4MAVA 3B8WA 1CB2A 2ABAA 4JL2A 5E6YA 1T96A 2YZ5A 2VR5A 1CYGA 4F0RA 1H49A 3TW6A 3KTCA 2DDXA 5GJPA 2YGYA 3VNZA 2G0WA 3PBGA 4LVFA 1UQYA 6XIAA 3BGGA 4P7OA 3AISA 2Q09A 2IKJA 1HKIA 1J0IA 3P0XA 4OE7A 3CASA 3NJ3A 4PUWA 4HZ8A 1EA9C 4CQ8A 3PZUA 4CEUC 1QASA 3VYLA 3ZSTA 2VRKA 3SSJA 4O28A 1PDYA 3EWCA 1L6YA 1QOQA 1E70M 3O2LA 3I4KA 3T42A 3ZVIA 4DO7A 2PC4A 3HQNA 4A4AA 1EKOA 1O5XA 5CPOA 1RA5A 2OX4A 3G1VA 2E5DA 4ZQOA 5AECA 3UG3A 3PNZA 4JIIX 2XUCA 1QPKA 1KXHA 9CGTA 1ISXA 4XAZA 5A2CA 2OX1A 5CEWA 5C2XA 1EF3A 4QX4A 3NGFA 4TTGA 3FHQA 3SUSA 1H41A 4D9PA 3AAMA 2XVLA 1OFBA 1EDQA 4MFDA 6CGTA 3FXYA 3A64A 1NEYA 3O15A 4GJIA 5I09A 3ZYZA 4IOTA 3PFRA 1JYVA 2FJKA 1M53A 3E1F1 4LT9A 5E0KA 2VCCA 1GZJA 3QLDA 3TQVA 2JKAA 4FLQA 3T40A 4NSBA 3NPXA 4AY1A 1IXNA 3KWXA 5C55A 1Q6EA 4TOQA 3CUXA 4PH6A 2VGIA 1GEQA 4DY1A 3ZMRA 2WQDA 3M0ZA 1CB7B 3AS3A 3UWWA 1EDTA 3WH5A 1S2UA 1Q4NX 3W1UA 1GJWA 3PJTA 4E3TA 3FAWA 3Q2DA 1KM1A 3GC2A 4PRTA 2VOTA 2PWVA 3PZIA 1KWGA 1QMLA 4QIUA 4GUGA 4PUDA 5CAKA 4S3FA 3EWYA 1W1B1 4AQLA 4ZB0A 4WSHA 1W9DM 2Y5SA 1VPXA 3EB2A 5FI8A 4DVOA 2GQ8A 1B3WA 3E5PA 2GL5A 3I7SA 1XKYA 4PTVA 3ABRA 8A3HA 2BHUA 1WDPA 2D24A 3IVSA 3GHRA 4WKHA 5ABGA 3ATZA 4GHRA 1OSEA 2QCCA 4GUFA 5D8WA 2VC9A 3QSRA 4PTXA 3PFMA 1MQPA 1PHWA 2B7QA 3B0XA 1OG6A 2WC7A 4WEVX 1W1YA 4P2VA 3AALA 4M6PA 3V35A 4NYUA 3M0XA 4XBJA 3VIMA 1I9CB 4PMRA 1Q6LA 2WLYA 3IIZA 4UTMA 4BFAA 3U57A 4PFMA 4DM1A 2ZE3A 1FWHC 4UTTC 5T26A 5HMFA 1V02A 1KWKA 1NFGA 2O4MA 3U4AA 3VKBA 1KBBA 4D8AA 3G2GA 5EMMA 1PZ0A 2YX0A 1LWJA 1TJPA 5H8PA 3DHUA 4RNJA 3DEQA 4ERGA 2DSZA 4QGCA 2HRWA 2I5QA 3OLGA 3AI0A 3VDCA 1VFLA 1UASA 1NWTA 2MUCA 4HGXA 5G4EA 1G1YA 3BMXA 1W0MA 3BCDA 3UCQA 5E0CA 2ZQ0A 4MNLA 1LT8A 4IQJA 5I3FA 4O0ZA 1VJZA 4HK6A 4AVNA 1KR1A 1OGSA 5H1WA 1YTKA 4V15A 3W00A 3F5KA 2JK2A 2Y89A 3XIMA 1P1XA 4TU1A 1AVAA 3QGKC 1S2CA 1JZ8A 3LHTA 4AMCA 4ZO6A 2CZ5A 1MEIA 4LB3A 2YDSA 5DMYA 3LRLA 2HNHA 3Q45A 2IS7A 5BU9A 2I9UA 3QN3A 2YBVA 4L6OA 1RLCL 1KW1A 2ON3A 1EX5A 2WM1A 4Q4QA 5DY2A 3MKKA 5GQBA 1P5BA 2D2GA 5AVNA 2ZADA 4ECLA 1EUNA 3G1SA 3RLVA 3B06A 4R7JA 3PUOA 4C7DA 4ONVA 3TTEA 2Q71A 1E43A 4JX6A 1RLDA 3PHAA 1GW9A 1Q66A 1R30A 4IMCA 1B3ZA 3PULA 4QE5A 2F6XA 2VZUA 5F4SA 2R24A 1M03A 2PA6A 3VPLA 1T41A 3B97A 3VMOA 4C60A 3SIMA 1OADA 2C14A 4ZQPA 4XUYA 3PZNA 3N4EA 1I6NA 2P53A 4S3BA 1O1HA 4FF5A 1NM9A 3WLSA 4G1NA 1AZ1A 1N2VA 2XGZA 3CTTA 4W88A 5FSDC 3B9NA 2WVSA 4EX4A 3HV9A 1SPQA 5T91A 4AFYA 1NSJA 4AISA 1HKJA 1P0EA 4IPLA 5I02A 5HMEA 2YYTA 1ITUA 3P74A 2VDHA 4MDOA 2I57A 4HCDA 3W87A 3M5ZA 4BHYA 4NU7A 3DI0A 4ZO9A 1LOQA 2PGFA 4UTLA 4XKYA 3U2ZA 2CLPA 3MJYA 1RD6A 2ZRXA 1GZ1A 3EBVA 4ALDA 3VDAA 1W1IE 2J6XA 1JDEA 1R2RA 1PUDA 3WMBA 4TO8A 3P61A 3TWBA 3CGTA 4E6MA 1PHQA 1A3HA 3EX3A 4MYXA 1PZ1A 3NZRA 2P88A 2WKLA 4YCOA 4DF0A 3VKJA 3P5YA 3W1XA 1Z48A 4IGHA 4GH3A 2ACSA 3GXMA 4LF1A 3T78A 1R3VA 4YYFA 3FOKA 4RDYA 1XIEA 4HTYA 1E9ZB 1CXLA 1WPCA 1N55A 4XQ6A 2ZWYA 1RY8A 4OBRA 2WNQA 3TYAA 1VPYA 3P14A 1ZFJA 3PPCA 3GYCA 1J0HA 4MWAC 1AH0A 1G67A 2OOFA 5U7SA 3VZZA 4A3QA 2Y7DA 2J27A 3SY8A 5PTDA 1QCWA 1ME7A 1MW2A 1W5OA 4JGDA 3URBA 5DMNA 3RJYA 3QC3A 1JCMP 5LKYA 1C8YA 2WCSA 3MU7A 5CGQA 4BWLC 2GSHA 2V5JA 4JFVA 3V5CA 4PTDA 3MMDA 3BC9A 2J74A 1SMDA 1BSLA 1UKSA 3VIKA 4YU1A 3QGAC 3W7EA 2TYSA 4QISA 3CEUA 4ZO7A 4PCPA 4HVXA 1TTPA 1C7SA 4A2SA 3OIHA 2PDJA 4JCLA 2FQIA 1H7XA 4FNTA 3VE7A 4W8BA 3LLFA 3KZSA 2EPLX 1YRRA 1EC7A 2DIEA 4ZQRA 4TX8A 3A5VA 4FX8A 5C9RA 2E9MA 2CWXA 1HKMA 3M0IA 3V4BA 4HNOA 3ZQ9A 5C0QA 4X0NA 1OBAA 4XKYB 4Q32A 4BF5A 5HJXA 5LGXA 2B0MA 3B8SA 1ZALA 3LGDA 4UIOA 3WDHA 1UMLA 2YA1A 4C6EA 5EGRA 3YPIA 1ZBWA 4AHOA 3BGAA 4GY7A 2PZ0A 2DJLA 3BAKA 5AC8A 3DKLA 4GYJA 3LBMA 4QG9A 5G2HA 3V5FA 3CO4A 2XWEA 5K9XA 3K46A 4NHVA 1I60A 4H41A 4EK7A 2VRJA 2YDQA 1V6UA 2XFFA 2BV9A 1FX6A 4LVBA 3VNKA 4FR1A 3N3TA 1EJUC 4G7EA 4O4VA 2DP3A 1F3WA 3DBNA 3W38A 2Y6ZA 4M6QA 5CC6A 2ZRYA 3E12A 1AK5A 3AXMA 5M2FX 4WOQA 1V3IA 3PG9A 4IIHA 1L0PA 1OIMA 1GOKA 4G7FA 5ABEA 2AOSA 3U2CA 1EWDA 4GFIA 2WMGA 3UR8A 5FEPA 1QFEA 1EYEA 3P80A 3EMZA 4BY3A 2R1LA 5HDRA 1LM1A 2TMDA 3NM1A 3CIVA 3L4YA 4KWSA 1LF1A 3OBEA 3O7UA 5CSYA 2NXIA 1UP0A 3SCOA 3G3MA 1TMHA 2YCJA 3L0NA 3HU7A 5LZLA 3TP4A 5DXXA 3GC4A 3N2XA 4KWUA 2C1IA 1HO1A 1BYBA 2G4FA 2W67A 3WQCA 2F61A 4QSFA 4YTQA 2WHJA 2QDDA 4UTHA 3ZT7A 3MUIA 5I3KA 1W9BM 3ZR6A 4RW5A 3V0TA 1TZ9A 2YFOA 2FMNA 1Q4WA 4G8TA 3CUHA 5JH2A 1XKJA 5KINA 4U2YA 1NELA 4ATDA 1GOOA 3WMCA 2ZUSA 4JY9A 3OBKA 5F2LA 4WR3A 2WKGA 3LK6A 3UPBA 3C6CA 2OEKA 1KR0A 3CMGA 4NZ4A 1W3HA 4Y9OA 4PN2A 1UH4A 4PULA 1KM3A 5G2WA 1JZ7A 2A85A 4ACZA 3MO4A 2YCIX 5FSEC 2AKZA 1LRTA 4N4QA 3G8EA 5AYBA 4Y8EA 3GUWA 1RP8A 1GVQA 3NYDA 3KRSA 3W01A 2DSVA 4GRSA 5IRPA 3FVMA 3ID7A 3MMWA 1C8XA 4FO4A 3NQGA 3DFHA 1J8VA 1DE6A 3QR0A 3W7GA 2ZX7A 3CAQA 4H6EA 3L12A 3N2CA 3OLIA 1H09A 4J40A 4PMVA 3I7QA 5LXXA 2HNEA 3N11A 2C0HA 2F9RA 5DF0A 4WF7A 4QP0A 4NKCA 4Z1AA 3CB8A 3SCQA 5BU6A 2C15A 3W26A 3B05A 3RM4A 1OG0A 4R7WA 4B90A 3FKKA 3QPZA 4UMCA 4PMZA 2OR2A 2FIQA 1AQ0A 1X96A 3FK4A 3KVLA 4RX0A 3I6EA 2DZTA 4GI6A 3MCMA 1BVNP 3HF3A 2Y7FA 1E5JA 1RK6A 3FEMA 3AU6A 5KZEA 1E72M 3VILA 2QCNA 1BAGA 3H2FA 4F48A 1H51A 3A23A 4RUBA 3W3OA 3OU8A 2DZBA 3GU2A 4JKKA 2QW5A 1KRCC 1CXEA 5JIPA 4JTSA 3M64A 2VGGA 2NV1A 2ZCGA 3PB2A 3CYJA 1UD3A 5CPMA 2XN0A 4GY0A 4BR1A 3CU2A 1KCZA 1KM6A 3VNLA 2RUSA 3PJUA 4KEZA 2Q02A 4NNAA 4KS0A 4AH7A 3KL0A 5HWMA 3H2MA 2BNJA 4M0XA 3BOXA 1XYZA 2OU4A 1M3UA 3UY7A 1J2WA 2CFFA 4MWAE 1OD0A 1B54A 3N6QA 5EYWA 1M7JA 4D6EA 4UTTA 4ACZB 1WUEA 3AYRA 2QQ6A 2WXDM 1ML1A 1S5VA 4EPBC 1D3HA 5HNUA 2W27A 3PZOA 3CUZA 4ROPA 1VHNA 2H9AA 4TXEA 1GG1A 3EMCA 1IT0A 1CGTA 3WBYA 4MAZA 3DFNA 2XG9A 4FXSA 1POKA 4REQA 1KCLA 3VO0A 4XZNX 2XM2A 2E9BA 4LBSA 3EDKA 2BY0A 3DFSA 4HSNA 3FJ6A 4FALA 5A8GA 3QH2A 3VMPA 5BRPA 4A8NA 3LHWA 3BG3A 2UY3A 1E1EA 3TJLA 3CHCA 1A0CA 5JBDA 5JU6A 1XC4A 5T8GA 3CH9A 3DC8A 1YNYA 3SADA 1B3OA 2C1GA 3HGOA 3ZT6A 1S3HA 1QOPA 3IK2A 4PR4A 4M19A 3SSZA 2W61A 1X7IA 1XBXA 3EXSA 3DDMA 2XVPA 4PMQA 4PCFA 1UIPA 1JQXA 3WUBA 1Z42A 1TSIA 2QJJA 3D0CA 1GOMA 3TE9A 3WLMA 3NO3A 5C9WA 1JPMA 4Z42C 3EDDA 3W1PA 2P50A 4FPSA 4DJFC 4XVEA 3PTMA 5DANA 3WL0A 3AROA 2QJGA 1KXTA 1XFBA 1LQAA 3UESA 1PKYA 3TW7A 1F6KA 3MTWA 3WF3A 1OYCA 1VC4A 3UVAA 2YBTA 3PTDA 2UY4A 3DAQA 3R6IA 3LNPA 3LGGA 1BKSA 4B9YA 3QM3A 4PSPA 1WYIA 4P8WA 1GOQA 3CZEA 3RDKA 2J6VA 1KFJA 5M03A 4IMDA 3UWYA 2FB2A 3JZUA 4JICA 3A9IA 4GVHA 4QCEA 3GTIA 2H9AB 5K2ZA 1PKMA 1XLIA 2WBKA 5G1YA 1ZP3A 4QJ3B 1BYCA 3SM0A 1RJPA 1JGIA 4HJWA 1R38A 1Z7AA 3CWNA 4ZR8A 5C8BB 4MKNA 4REQB 4H04A 4TX9A 3NO1A 1XD1A 1GPWA 3AXKA 4RNHA 3EDEA 2OGJA 3UZ5A 4NXKA 1XQKA 3PZTA 3CAKA 3GNDA 3W75A 4BA0A 4B92A 4LAMA 4QCFA 3VIHA 5D2TA 4M81A 3LZ3A 2PDXA 2FDMA 3GG1A 1UHVA 1JZ6A 2CCRA 3ES8A 1T8XA 2CXEA 4H6KA 3GVQA 2WZTA 3IRSA 3NG3A 1XBVA 4QEEA 1OJXA 3TMLA 1ZJIA 3KS5A 4QG8A 1AD4A 3QLLA 4F0HA 2PBOA 1YE6A 5CPSA 4V28A 4JY8A 4UCFA 1O12A 1TJRA 4NI8A 3ANVA 3TQKA 1XCFA 4ZSUA 5M1TA 4KEMA 1FCUA 3R11A 3UYCA 1BG4A 1TO3A 2DUZA 3VIJA 2BASA 1TV3A 1AFSA 4UMBA 3V1HA 4MWAA 4O1AA 5ABTA 4JAWA 3SQLA 3KBNA 3G5EA 4QE1A 4HZ6A 1IXQA 1EL3A 1T0OA 3LXCA 3W53A 4EF8A 3KLLA 1Y5WA 1FY6A 4GGHA 4UTKA 4HOWA 4QAIA 2E6AA 5KZMA 1BVZA 1B4KA 3DIPA 1F07A 3V18A 3IJ7A 3R10A 5A8OA 3MP3A 1OINA 4HYVA 1J12A 4F9DA 1V8EA 3MY9A 3PS7A 4KFOA 3QSTA 3FDKA 2VUNA 3ZWSA 4HT3A 5T9CE 1UD8A 5C6MA 4S3GA 4D71A 3UA3A 3UBPC 4F9JA 1E55A 4WRHA 4XBKA 3R58A 1UH2A 1ZS2A 3GDRA 4B2DA 3SZ8A 1DP0A 3ZR5A 1M7OA 5TNVA 1WKDA 3FGCA 3GVVA 1FWAC 1G4PA 4UFMA 3GM8A 1PO9A 3Q4DA 1DPMA 1U22A 1OEPA 2DZXA 1GHRA 3H2CA 4MSSA 2CHNA 3A12A 4C65A 2E9LA 1B3YA 1KRAC 2OXNA 4PL1A 1LUCA 2VFGA 3GVWA 3WMLA 1QBAA 1EJ7L 1ZJHA 1H50A 1YMYA 1ZAHA 2ACRA 4OECA 2J9XA 4U5IA 3KDNA 5J04A 4W84A 4NY2A 4EOUA 2O7QA 3LZ5A 5FEXA 4DUWA 4JTEA 1OK6A 3WNNA 1CLXA 4MWAB 3P60A 2VUYA 3DFYA 3K13A 1TJ2A 4FR6A 1W8GA 3IJ9A 4X3ZA 1RSCA 4JFSA 4AIBA 4IIBA 2VZVA 4S3AA 1P48A 3RX2A 4BK9A 2CLOA 3DOPA 1ZBCA 1CGVA 3G77A 5F7UA 4GG9A 2CLHA 3BXWA 2CBJA 2P5NA 4FA3A 2HQAA 2Q8ZA 3W1LA 4P61A 5B7ZA 2WCGA 3HJZA 1TIWA 2HISA 3H53A 1L9WA 1Q6GA 2XH2A 3MANA 4MZYA 4MB5A 1ICPA 4XK2A 5BZAA 3KXQA 4XZHA 4P7RA 3GLCA 4O1FA 3CHFA 1LBMA 5C2CA 5TD4A 2BTMA 2G3FA 4H00A 4EPEC 6REQA 1N8FA 1QW8A 1KKOA 3MT1A 3GVRA 1TJ0A 1DIKA 1H0IA 5LHFA 3VOIA 1I1XA 2X09A 2KX9A 3WMSA 3AUOA 1MRQA 3GAKA 3STPA 2L5HA 2TSYA 2HBVA 3NYZA 3IIVA 1IV8A 3B4YA 3FGCB 4AWTA 5LNWA 1S1PA 3GRIA 4AMAA 3W7JA 1WKEA 4QNWA 1QJWA 2RJHA 3O63A 4YWSA 5J5DA 4WJ8A 2WOQA 2D23A 1L6FA 4UQEA 3TAKA 3WJWA 5I3DA 2G8ZA 3HG3A 1WDRA 3TN3A 2XSAA 4KMQA 4LNYA 4PUMA 1LUCB 3UCDA 2Z29A 4HOXA 3UWVA 1VS1A 3FA4A 3KVKA 2PLMA 1F05A 3BAIA 3WQVA 1JDCA 2E4TA 4S3DA 3CUGA 4FNQA 4MM1A 1UPPA 4E4PA 5D9MA 2DV0A 1IIHA 1FWDC 1EOMA 1RD5A 2CWNA 4GCAA 1JDAA 1KFKA 4GQGA 3W1TA 3U6WA 2VDIA 2UZ9A 3CXOA 4Q4PA 2GJLA 2XYLA 4FNSA 1XIDA 2PDIA 1RZMA 2F2KA 4NJJA 4ICMA 1VP5A 3WIJA 1HX0A 3F4WA 1OGGA 1XRFA 4N7QA 1HJSA 1F6PA 4QHRA 1FFQA 1WCGA 4ERAA 3RXZA 3HGRA 5A6BD 6REQB 3SECA 3GHUA 1FDZA 1UWQA 4BZYA 4PA8A 1P0BA 4TVUA 2WQPA 4JD4A 4L1WA 1LROA 2E67A 1OC6A 2QMKA 2VX6A 3WD0A 3LRMA 2ICSA 4DPQA 4Z2KA 3WQOA 4DXXA 4LV4A 3BQ6A 4UQ9A 2G95A 1Z9AA 3NPVA 4DN1A 2J7DA 1QK2A 5MHBA 3RILA 3AMCA 1Q13A 2YW4A 4LB4A 1GT8A 1H0GA 5LGZA 4EPDC 1GJUA 1Q6FA 3LTPA 3WJXA 2Y8KA 5BXTA 2ESCA 4IMAA 5DELA 3R13A 5XINA 3J7HA 3MCOA 3N2TA 4UFIA 4C91A 3SCSA 4XISA 1FVPA 3EGJA 4KGLA 1GQLA 1XIGA 4KFPA 3S2LA 1KNWA 2W5FA 1DIEA 3EOLA 4Q8MA 4HZ7A 3W74A 2X1TA 3HM7A 5LHEA 3C56A 1UD2A 4F2UA 2R1MA 1NF0A 1VBUA 3L66A 2ZZ7A 3T4WA 3UZYA 5EB8A 4D1IA 4MF4A 4BS0A 1UP3A 4IMFA 5ABHA 1XYAA 1F8IA 4Q3MA 1TV7A 1D2KA 1UR4A 1FDJA 1FHUA 3MYOA 3UWUA 4V2XA 4TX6A 3TLQA 4K1GA 2WJDA 4ADTA 3OHMB 5ECUA 2W62A 4Q8PA 3NFUA 4Q8UA 1XINA 4MNMA 2QUNA 4CUCA 1JVNA 3N6JA 4AZIA 4DJFA 4N9EA 3VCNA 3UVIA 4NJHA 2D73A 1RBLA 2YW3A 3M0HA 3L4WA 5F2MA 1MXGA 3M5YA 1L6WA 4OKDA 2GGHA 3N9RA 3UZWA 1B5TA 2V5LA 1W3NA 2EKGA 2HSAA 4M7SA 1EO5A 3S2MA 5E70A 5FJRA 3W22A 1PB0A 4L1GA 3ATYA 1RVGA 4I7VA 3WDIA 4BQ3A 3PJXA 3RM9A 4Q4RA 1FWGC 3QHMA 2J79A 2WHKA 2Y8UA 3BL3A 4JX4A 1WDQA 4RPPA 3MWCA 3TNOA 1C92A 3LHYA 4RPQA 2O9OA 2X0SA 3OVQA 1M7XA 3TEVA 4ZXLA 3QEZA 2ZE0A 3IJIA 3B8DA 2PRLA 5M5DA 4KBXA 4YTRA 4UUIA 5C7VA 4UWMA 5KEZA 4GYPC 4JTKA 4NL1A 4N0RA 2WZEA 5A8NA 2XINA 2QR6A 3THDA 4JFTA 4M80A 4EIVA 4GVGA 3KX6A 4HTBA 2HTMA 1K6WA 1QI3A 1V0LA 1UD6A 3TYBA 3QBUA 1XI3A 3DGRA 5J5RA 2AQOA 2D3LA 1XDJA 3S5SA 2ACQA 3W6YA 3G3DA 5CBIA 4CD7A 4JCMA 2YKKA 3VKDA 2FFIA 1HJWA 3WYZA 3SW6A 4YXGA 1WNOA 2JE8A 3PBYA 3P3BA 3CV6A 3BGJA 1CNVA 1VEMA 3DC0A 5A1AA 1B3XA 3C61A 2G41A 1P7TB 2V81A 1FBAA 3P81A 1OFPA 3TTQA 2OQHA 3GIYA 1OZMA 2NQJA 1NAL1 3VNIA 1V7AA 3EOSA 4XD5A 3SQSA 4KIEA 5C5YA 2OYKA 1CXHA 5AZ0A 3ONBA 4HMDA 1HJUA 4S2CA 4YJ5A 1DV7A 5I5RA 2ZX5A 3AYTA 1FXQA 3OA3A 3VKCA 1RJQA 3AHVA 2NUXA 3G0UA 4HHMA 4DO5A 3CTLA 3B0UX 4AEEA 4X2RA 1W1ZA 2DZSA 2WMFA 3WK1A 3MHGA 3C2VA 3VKAA 4KRTA 4WX2A 2E5CA 1ZJBA 4KESA 4ASTA 4FOJA 2OKOA 1NP0A 5I3JA 1XLKA 3EYPA 1TRDA 1I1WA 1OC7A 4HMCA 2OYLA 3UERA 3Q65A 4PTWA 1DXEA 3R1ZA 3CWOX 4GI8A 3HURA 7ENLA 3N9KA 1TPVA 4GIRA 5BW6A 2I56A 3D5HA 1GQJA 4IFOA 1MUCA 3NVTA 3SFKA 3AXIA 1A0DA 3TWAA 1LOLA 1GK8A 3KVJA 1T7LA 1TPEA 2ZXAA 4CVUA 4IX2A 2OB3A 3UY8A 2VX7A 2OSYA 1CDGA 3E0FA 3ONCA 4LUIA 1SW3A 2ABBA 3D47A 3E49A 4DO6A 4Z1YA 2R94A 3F2BA 4RV3A 3OTRA 1US3A 4AVOA 1YBQA 2HVNA 1XYFA 4CQCA 4RNFA 1XCXA 3PNUA 1PCKA 2A7PA 1QNRA 1Q45A 3FV9A 2HBXA 3VCRA 4LAZA 3VD9A 3P8JA 5CG7A 3DYOA 3WDRA 4GO8A 5RUBA 1UD4A 4GPNA 1ONEA 2NT1A 4BCEA 2E40A 3SGGA 2GLKA 9RUBA 3CAWA 4XO7A 1E0UA 3M46A 2J7BA 3UG8A 2HPIA 3I6TA 2EGZA 1VFFA 2WMHA 1QO2A 4WDWA 4QRNA 2YYUA 3ARSA 3LEPA 3V7PA 4Q8TA 2ZIDA 3CMFA 3Q37A 4IIGA 2JBMA 2HK1A 2GFTA 2EG6A 1UH3A 1KTCA 4XG1A 2E8YA 3DECA 3BH4A 3OLEA 2AMGA 3R79A 5KETA 3N12A 3FKRA 5AZ1A 2HVMA 3S1GA 5DLCA 2GSEA 4IL0A 5CZ0A 4AZ6A 3WZ0E 3RX3A 3CJPA 2GZXA 1NTHA 3PSVA 2VEPA 3W0KA 2PRHA 3IV8A 2VWTA 4NZ1A