3IEBA

Crystal structure of 3-keto-l-gulonate-6-phosphate decarboxylase from vibrio cholerae o1 biovar el tor str. n16961
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
213
structure length
213
Chain Sequence
TKPMIQIALDQTNLTDAVAVASNVASYVDVIEVGTILAFAEGMKAVSTLRHNHPNHILVCDMKTTDGGAILSRMAFEAGADWITVSAAAHIATIAACKKVADELNGEIQIEIYGNWTMQDAKAWVDLGITQAIYHRSRDAELAGIGWTTDDLDKMRQLSALGIELSITGGIVPEDIYLFEGIKTKTFIAGRALAGAEGQQTAAALREQIDRFW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of 3-keto-L-gulonate-6-phosphate decarboxylase from Vibrio cholerae O1 biovar El Tor str. N16961
rcsb
source organism Vibrio cholerae
molecule tags Biosynthetic protein
molecule keywords Hexulose-6-phosphate synthase SgbH
total genus 73
structure length 213
sequence length 213
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3iebA00
2EPHA 2NXIA 5HMSA 2V81A 2ISVA 3NOEA 2CZEA 4QQ3A 5ABTA 2J9ZA 3W22A 2Y7FA 2YGYA 4K7VA 1IXOA 3B03A 4Z1CA 1H1YA 2VFIA 4MZ1A 2E6DA 1LDCA 1EA0A 3KVLA 3P61A 4FX7A 2V5BA 3M1ZA 1KFEA 3P67A 1H63A 4RXFA 1YTKA 3DFOA 1JCNA 1VR6A 5BRBA 4E0CA 2ZTKA 5E93A 4EF8A 5D2WA 3NQEA 3DGRA 4WXYA 3MMTA 1DL3A 1XBVA 5CKSA 1GZGA 2F84A 3H55A 3NL6A 2ZRVA 1XM3A 1XI3A 1TB3A 3MBFA 3T7VA 3HG5A 1Z42A 2CZ5A 1ZFJA 4JIPA 5FEXA 1R2TA 4IOTA 1FCBA 4O8RA 5K3VA 1TQJA 4AWSA 3R5EA 2B0MA 4P61A 3SFKA 4HPJA 1G69A 5I3JA 1TTJA 4UTMA 1UBSA 1SO3A 1Y0EA 3UPBA 3THQA 1RQBA 3DENA 4FNUA 3LM7A 1JCMP 2TRSA 4QJ1A 3O06A 3ZR4A 4DPPA 1QOPA 1ZAIA 1VC4A 4OBTA 4MJZA 1EWEA 2NXGA 2V2CA 1F6PA 4JDBA 1KFCA 4RCXA 2E68A 1ADOA 3EB2A 1XBYA 1RZMA 4FO4A 3GXTA 1TO3A 2A85A 1GVSA 1QPOA 1BKSA 1D3GA 1VCFA 3PUEA 3OBKA 4P2VA 4FNSA 5K9CA 4S2BA 4UNLA 4JTIA 1GYNA 1DQXA 1UUMA 2F7FA 2JGQA 3P7YA 3QSTA 2RFGA 3GXNA 3MP3A 4XKYB 1ALDA 1L9WA 5BW6A 2OZ0A 3LLDA 4M7TA 4UTLA 5CZSA 2ZA2A 1H7OA 4GRSA 2C14A 3TMLA 3STCA 2QCMA 1M7OA 3ANYA 3TQ0A 1ZY9A 3TDFA 4PA8A 1TRIA 1DQWA 4KWWA 2YR1A 3NQMA 3TKFA 1IXPA 3NQGA 3FA5A 2GJNA 5KINA 5LZLA 4DF2A 3W1TA 1A50A 4J9JA 1CI1A 3B04A 2DZXA 4KWVA 1FWNA 3BVJA 3STEA 1ZJIA 5EBUA 5EMUA 1J4EA 2OX1A 5CPOA 4IWWA 2E6AA 3N19B 4ORIA 1MO0A 2TMDA 3A24A 2BXVA 3PS7A 4IGHA 3LRKA 4O57A 1FDJA 2AAMA 3FLUA 1JCLA 1TPEA 3E96A 3PWAA 4JYFA 5D04C 3SW6A 3W7DA 5FESA 2VEIA 3N9RA 4OV4A 5D32A 4AXKA 2CZFA 2B7NA 4JN6A 5LHEA 1QPNA 4Z1AA 1X6UA 4PEKA 3QC3A 3E9AA 4QNEA 3T40A 1IIHA 3U2OA 1SPQA 3CIXA 3ATZA 5AHEA 5FEWA 3TNOA 3TQVA 3LTYA 1JJKA 4PH6A 3GDRA 4HSOA 3W7EA 1G4SA 3B0VC 3C0JA 1VQTA 1OYBA 4IPIA 4JTJA 5LNRA 4AWTA 3QFEA 5D33A 4PC8A 3PG9A 3M5XA 3LI0A 3A5FA 1W3TA 1ICPA 3NL5A 1QR7A 3NQ2A 4NNBA 5AC8A 2NX1A 3NDOA 4YMZA 1XDLA 1GG1A 3P5ZA 3P5YA 3HGRA 1K8ZA 3M5VA 3G3DA 1JRCA 3F03K 3TAOA 4DO5A 4HSNA 1XUZA 1A5SA 4WZHA 3B05A 5C54A 4LTSA 4AVFA 3QJAA 5DCDA 2A1YA 4OV9A 1FWWA 2DZSA 3C6CA 4ZL1A 5T26A 2Y7EA 3TX9A 1H1ZA 3CWNA 4CNNA 5DN1A 2P10A 2YX0A 4PL1A 4MY8A 3G0XA 1B4KA 1XBXA 3CM4A 4WXZA 3EXTA 4HNVA 1LZOA 3ABOA 3HG2A 4ZQRA 2ZZ2A 3OA3A 5K9DA 1W5MA 1O94A 4OHQA 3W7OA 1OX6A 4IJBA 4N2YA 3WFAA 3TXZA 4MVAA 5LHFA 3ABQA 3BLEA 3I68A 2BSLA 3G1VA 1TPB1 4NVTA 5G2WA 1P4CA 4BFAA 1H51A 2CLOA 3CWOX 3W75A 3W76A 1MEWA 2E5BA 4DO4A 1GVRA 4B5NA 1T99A 2C1HA 3GXPA 3UWUA 4YCOA 2G95A 4ADSA 3U8GA 4LV4A 5CPLA 4Z08A 4WUIA 3EWWA 4FNPA 3W1MA 3MUXA 3PUDA 4LUIA 1C8VA 3ABRA 1SFLA 2YFOA 1F74A 5KSWA 4I7VA 1QDSA 4O50A 3SGZA 1P0KA 3BW3A 2GOUA 3C2RA 1H7RA 2XFWA 4MUZA 3A22A 1ME9A 3NEVA 4TMCA 5HUPA 4Y8FA 1P5BA 3B4UA 3G1AA 3OVQA 2CWNA 1G4TA 5L6UA 3NQ8A 4XUGA 4NU7A 4ORMA 4UTTA 5H91A 3GDKA 1KM5A 4O52A 2YW3A 1GVOA 4MOZA 3S5ZA 5LNWA 1H7XA 5FF7A 3W1LA 3G1SA 2Y7GA 5DXXA 1GTEA 1JUKA 3EWUA 2YDAA 3HPXA 3PC0A 5FEZA 1S5TA 4ZZ9A 1AK5A 5U4NA 2QCDA 4FEZA 4JNMA 1S5VA 2WOQA 2OCZA 3VE7A 3TC6A 3UPWA 3I7QA 2WNZA 4UFKA 1LBFA 2Z6JA 1K7EA 1TPWA 1H7NA 2O7QA 1FDZA 4EVZA 4MLRA 1W3IA 2H8XA 3M9YA 2ISWA 5KZDA 3MW7A 5HWMA 3LDVA 4UTTC 1YTDA 3HGSA 2DZUA 3W7CA 3P62A 2XN1A 3BW2A 1IF2A 2Y61A 3P74A 3QMTA 4ZVJA 4O11A 1NF0A 4KKXA 3W88A 5TBOA 1SW3A 2ZZ1A 3CT7A 1XKYA 1GYLA 3W85A 4JYEA 3S6DA 5FF4A 3Q37A 4TU1A 1WBHA 3M6YA 3C3NA 4Q33A 3NVTA 3W7MA 4KFOA 3NL3A 3NYZA 2QJIA 3C8FA 5DBUA 4N4QA 4WY0F 1TREA 5J5RA 3TFCA 3MP4A 3TCEA 2YPIA 4TIMA 3UWZA 2A5HA 4ZQOA 5HINA 3C4UA 1YXDA 5LGXA 4JEQA 4KFPA 4GUJA 4K7YA 4DXVA 3LHTA 2XN0A 1G7VA 3RLUA 3M44A 3LHYA 1WOBA 5AYZA 4U28A 1W3NA 4JX6A 3NNTA 3LCGA 3NPWA 3NQ7A 4LVGA 1EWDA 2V5LA 3MYOA 5MHBA 5DBTA 2B7QA 4UFJA 3TQKA 1WYIA 1VHCA 2FPTA 4MZYA 2NZLA 3GNNA 3W1QA 2EHHA 3E49A 4ADTA 5CSSA 3QMSA 1A5AA 2VEKA 4WD0A 1R46A 3C2VA 4RR4A 2E6FA 3B8DA 5DXYA 3NQDA 5AHLA 1I8JA 1A5BA 1OHLA 3W1NA 4GFSA 2UV8G 2GJLA 2QR6A 3TMQA 2X1TA 1BWLA 3EXSA 3TAKA 1U5JA 3NPXA 3TSDA 2QAPA 3W73A 1IGSA 4FNQA 3EKLA 4BI6A 1Z48A 4E38A 3DHDA 1GTHA 1N55A 1KM1A 4GUFA 4YLWA 4GXMA 2Y62A 5H2ZA 1V5XA 2HMCA 4Y96A 2J88A 2CLLA 5KZMA 1XL9A 1IXQA 1XUUA 5D2TA 2ZRZA 4NXKA 3L9CA 4RX0A 4AMAA 3SECA 1WOAA 2X1RA 2JKAA 5I3IA 3RU6A 3VNDA 5AOUA 5LNUA 1VYSX 3W86A 3ZFHA 2CLIA 3G22A 3W2KA 5BMXA 3ZWSA 4HNUA 4K8HA 4FB7A 3LCLA 3P84A 1HUVA 4X3ZA 4CCCA 1TSIA 4JTGA 1D3HA 1F05A 3W87A 2NV1A 3GVGA 1H50A 4GBUA 3S1VA 1EUAA 1YXCA 3M5YA 4JYDA 4M19A 3USBA 4AEOA 2V82A 1J5TA 3M43A 2X1UA 1FWRA 3LV5A 4WOQA 1JUEA 1ZCOA 3Q94A 1YTEA 2A6NA 2G96A 3FKRA 5F2GA 3O63A 2NUYA 1OFEA 4YL2A 1W5NA 1PS9A 1K7FA 2X30A 5HWNA 2QCGA 4UTIA 2AQWA 2OJPA 5HULA 2QAFA 1I4NA 3W7PA 1LORA 1SSDA 4UFHA 5K9XA 1SR9A 1GVQA 4NNAA 3T4CA 3BG9A 4I7UA 2C3ZA 1KTNA 3O6DA 4NZFA 3IIOA 2GVLA 1M7PA 4GUHA 3LHVA 4JICA 3LBCA 1FDYA 2QEZA 3TW7A 4FX6M 4AF0A 3L2IA 3R2GA 3LXAA 1QCWA 4PODA 3RFAA 5DELA 3O07A 2WKJA 1W1ZA 3M41A 5I3FA 4QAIA 1KFKA 1QWGA 5BMWA 1GVFA 3SI9A 3F1QA 2J9YA 4DF1A 1OFAA 4RV8A 4O1AA 2FB2A 4UTWA 3PVFA 1AW2A 3SSJA 2H8ZA 4H3DA 4A2RA 3CU2A 4K36A 3S42A 4O1CA 3OVPA 1EB3A 1ONRA 1TV5A 1HTIA 3LGEA 5D2YA 3O6CA 4M6VA 1WV2A 3EWBX 1JCJA 3EKZA 2NX9A 5IM51 4JTLA 2CU0A 1VH7A 4UMCA 5CZTA 1K7XA 2A7PA 3IVSA 1SUXA 4HNNA 1KA9F 3BO9A 1SO6A 3LCIA 2E77A 3EX4A 4S1FA 3O1NA 3ZS4A 5LNVA 3O05A 3PBWA 5K4ZA 2X16A 2ZRXA 6TIMA 1Q6QA 3LCXA 4LRTA 2C16A 3KX6A 3TJLA 2HTMA 1KM3A 1I2PA 1OVDA 2B7PA 2E5DA 3CEPA 4OE7A 5CG7A 3RK8A 1VGAA 3HPZA 2HSAA 3BG5A 3WJXA 4LOCA 2DJXA 3FYOA 1DORA 1TMHA 1LP6A 5F4SA 3R12A 4N9BA 3B0UX 1YDVA 4A2SA 4XKYA 3TC7A 3FKKA 5F2MA 1UUOA 2J9XA 1YXYA 2A0NA 3Q2DA 2YZRA 4W9TA 3W2UA 4FNTA 2C15A 4WY0A 3HF3A 1S3HA 2GUUA 2E6YA 4O12A 5AB3A 2YCEA 3LX9A 3MHGA 4Q4KA 3IVUA 1FCVA 5HR7A 4DPQA 3IEBA 5SWUA 1TV8A 3Q58A 1EUNA 3TU9A 3L68A 4UMAA 5FF2A 1FY6A 3MJYA 3LCHA 4MFEA 2ZA3A 2FB3A 4JS3A 3IIVA 4NX0A 1YYAA 5G5IA 3GK0A 1XXXA 1C9DA 1B57A 1OYAA 3BG3A 2ZRYA 4LVBA 3IGSA 3W1RA 2G5WA 1HG3A 5FI8A 1O5KA 3P80A 1X7FA 5HWJA 3W74A 1QFEA 2GQ9A 1BEUA 2QCCA 2RHGA 4CQAA 1XFBA 3DKJA 3W1XA 4LRSA 1L2UA 4NZJA 3MP5A 1NEYA 1L6YA 3B0PA 1JCYA 4GC4A 4NJKA 3O6YX 1EP1A 1HFBA 4MY9A 2ZZ3A 1NAL1 1FCQA 2JK2A 3FEMA 4NT0A 1LBLA 1M5WA 2R8WA 3LHWA 2VFDA 1FCUA 2A21A 3P8JA 1VZWA 4MLJA 1RR2A 3L0NA 1XBZA 4UTUA 1L6SA 3QH2A 2BWGA 3BARA 3FOKA 1JQXA 4ONVA 4LY8A 3QPZA 2E1DA 3H53A 4IMDA 4GJ1A 4NQ1A 3PY2A 3FFSA 3O15A 3VI2A 3A21A 3WK3A 4MYXA 1RV8A 2PURA 3TSMA 5C55A 2B4GA 3TR2A 1H7WA 3G1XA 2OT1A 3W7HA 5J5DA 2ZRUA 3KFTA 1UB3A 2FPVA 2P0OA 3BLIA 3S9YA 3GYEA 2Q3RA 3FIGA 4IMEA 1MZHA 2RDTA 2RKXA 3KVKA 1P0NA 2WQPA 5G2IA 4DF0A 3HG4A 2PRLA 3TW6A 1P1XA 3FJLA 3QPYA 1PHQA 2GPTA 3C2OA 1WAUA 1TPUA 1KLYA 1KLZA 4U4MA 4UTHA 2VFEA 4FIRA 2WJZA 3E12A 3DHFA 4UMBA 2ZDRA 1JR1A 4D2JA 1AW1A 1E51A 3HPSA 1YDOA 3RMJA 3TFXA 3ZWTA 2VFHA 5D30A 3S1WA 4GUIA 3LLFA 2I14A 3NQ6A 4L4MA 3CPRA 2NUXA 2V2DA 1TTPA 3GDLA 4QNWA 4ALDA 5LSMA 1G67A 2PRHA 1THFD 3CB8A 3UXDA 5KTLA 1W5PA 1LLZA 4JTEA 3SJ3A 4K37A 1ZNNA 1KV5A 4GUGA 3EX1A 3KHJA 4NJHA 1FX6A 4I7WA 4WX2A 4XTIA 3QQ1A 3LOTA 1YDNA 2JBMA 3OG3A 3CC1A 2NWSA 4HKPA 4O53A 1MSSA 2RH9A 1FXQA 1IIGA 2C6QA 1SW7A 1PIIA 3W3OA 4Y6GA 2XN2A 1VJIA 4JR5A 4LVAA 1I2OA 4NUWA 4QSHA 3W7IA 2DU2A 1KFLA 3BGGA 2C13A 4MFDA 1DOSA 1VYRA 4N9EA 3IIPA 4FXSA 2P1FA 2WV8A 4X2RA 3N3MA 3W70A 1AMKA 4XQ6A 3THAA 1C29A 4R53A 3FYPA 2FIQA 3NM3A 1GG0A 3N14A 1AG1O 4ZMGA 2VOMA 5A8GA 2A2IA 2WPBA 4O0ZA 3H54A 3LCFA 3W83A 4LS2A 1LOLA 3WJWA 2Q3OA 4QM1A 3I7SA 3JS3A 1SFJA 1W8SA 2FFCA 4UFMA 4IX0A 3DU0A 2ZFAA 3EWXA 3W2MA 3FS2A 1YLVA 1YPFA 1JVNA 4FHAA 4IXXA 3QW4B 3V75A 3W2JA 4NX5A 7TIMA 1X8FA 1O4UA 4Y9AA 4NJGA 4XTDA 2ISSA 4ZQCA 1I2NA 3LHUA 4L4LA 1SU5A 3IV3A 5EYWA 2NV2A 3AO0A 4JTFA 4BR1A 2Z1BA 3W71A 1TJRA 4CQ8A 4R34A 1TTQA 3LCWA 3QZEA 3SGUA 4GNJA 2ZZ4A 2CLFA 3NZ1A 1J2WA 5CSRA 2QUUA 3PAJA 3DZ1A 3W7LA 1T0OA 2JGYA 1PL9A 2ZRWA 1LTDA 5AC6A 2R94A 1EX5A 3MI3A 2AGKA 4RZ6A 1KTBA 1LRNA 2NUWA 4O4WA 5CPMA 5F4XA 2DZVA 5BOOA 1IXNA 2ZZ6A 2V30A 3UY8A 3VCRA 2QUTA 5G1YA 1BWKA 3PB0A 4UC5A 4X22A 5LNSA 3GKFA 1LLWA 3PBYA 2O7SA 1SZGA 4AHQA 3L5MA 2DZWA 3W23A 1JULA 1O95A 1HL2A 3QW3A 4M6QA 5HR6A 4O16A 3YPIA 1F7BA 3BK0A 2QKFA 2A4AA 1Q6RA 3WJSA 4HN4A 2Q8ZA 3EEGA 3ABSA 1FQ0A 1WBJA 4CNPA 4LW7A 1OFOA 5D05A 5LKYA 4LC6A 3S0CA 2QDHA 1G6CA 2PC4A 3HOJA 3NZRA 4M7SA 2GVGA 2QUVA 3TIMA 1OFDA 3MHUA 3G18A 5D03A 5LGZA 2WSRA 3OVRA 4BI5A 5L9FA 4XWUA 3GR7A 2EGZA 5D2XA 4NJIA 1LRQA 1A53A 1Q6OA 2QCHA 3C2EA 2TPSA 1VRDA 4K38A 4LVFA 3NG3A 4LUJA 5CZJA 1OK6A 2QJGA 3KXQA 4GWEA 3ELFA 1K3UA 1W56A 5D2VA 2VELA 2ZTJA 5FF3A 3TA6A 1O60A 1OF6A 4O18A 4POCA 4O17A 5I3HA 3W1UA 3QYQA 5TIMA 5K2ZA 3DFSA 3VKJA 4FXRA 3RNDA 3GX9A 4RK8A 4IMGA 2R14A 4AHPA 1Z41A 3W7QA 4ADUA 5AC7A 4ML9A 3NPUA 1F76A 4ZQMA 3PF3A 3RF9A 3PR2A 1OFQA 3NQVA 3F4NA 3MI2A 1OFRA 3S5NA 3G1YA 3EX6A 4AF0B 3I65A 2ZZ5A 4C1KA 3G1FA 3N9SA 1D9EA 2VKZG 2V9DA 4CQ9A 3K30A 2VXNA 4LS1A 2I9EA 3SZ8A 3UNDA 1TCDA 4UFLA 5D02A 1TPDA 3GR8A 3QQ0A 1DJQA 3W07A 2GQ8A 1VCVA 3UWVA 1WDWA 4BWLA 1TPVA 3IRDA 4LS0A 3NGJA 4IXHA 4A22A 3MBDA 4EF9A 3IGUA 3DXIA 4Z0SA 3KOFA 3EWZA 3HMJG 3GLCA 1ICQA 2J6XA 3GDTA 3UQNA 1H7PA 3PULA 3OEXA 4WJEA 4LWWA 3D0CA 2RDUA 2ZQ0A 4G1KA 1ZHAA 3S5OA 1KBJA 3O16A 3HG3A 4MJMA 4TX9A 4UIOA 1SO5A 4JTKA 2NXHA 2OT0A 3T78A 1H60A 3B06A 1NVMA 3W7NA 1TYGA 3DFNA 1TJPA 1XC4A 3SR7A 4DO6A 3M47A 5DCBA 4PL2A 3S8HA 4UCGA 2QCNA 4YWIA 4UTWC 3HBLA 3S5YA 4JD4A 3L5LA 2YFNA 2J27A 3G0UA 4UNKA 2YSWA 3M16A 3TH6A 4DELA 2QCLA 4GE8A 2EKCA 3OHIA 1GOXA 3M5ZA 3TROA 2BLEA 2OMAA 2DZTA 4N6FA 3E02A 1KW1A 3I6RA 3N2XA 2A7RA 4MIMA 2NWRA 2TSYA 3V1PA 1HO4A 2H6RA 2Z2UA 5D37A 1BTMA 4O13A 3M0ZA 3QRHA 4UR7A 1Q3NA 4QIUA 5DY3A 3W7RA 3UWQA 3JR2A 2WNNA 3TV8A 1TPFA 2PE4A 4KFNA 1GT8A 2QDGA 3CQ0A 5AYXA 4ICNA 2E5CA 1EP2A 1RVGA 1M6JA 1MEHA 3LXBA 4CCEA 1TRDA 2CLHA 2X2GA 3IVTA 1ME7A 2Y85A 3G1DA 2QCEA 1QNVA 1EP3A 3F4WA 4JTSA 1KFJA 3BV4A 3W6YA 1GPWA 3KRSA 4LVDA 1TQXA 3UY7A 4TO8A 3DFTA 2W0UA 1DV7A 2KZHA 4FIQA 1TV7A 5BNKA 3TUUA 1TPH1 4M6PA 5HUOA 4AAJA 4H6KA 3LBMA 3G8EA 4LV9A 1OX4B 1FWSA 5AHNA 1SW0A 1PCKA 3HO8A 4RKAA 3LRLA 3RLVA 1YPIA 5A5WA 3WK0A 5AFDA 1N7KA 1R2SA 3W1PA 3W2LA 3NO5A 1FUYA 1F2JA 2RDWA 1UJPA 2DZPA 1QOQA 1EIXA 3DKLA 1LYXA 2ZA1A 5EA9A 2A7NA 3DH7A 1G7UA 1O5XA 5HQEA 3DI1A 1B9BA 1K02A 1F73A 3CTLA 4EOUA 2Y7DA 2HS6A 2FLIA 1VYPX 1KBIA 1W5QA 4O19A 3HGJA 4DQWA 4OU1A 1GWJA 5D09A 3I7RA 4K39A 4XBSA 3QSRA 3ATYA 4R33A 4AHOA 1CX9A 3W7GA 3OIXA 1OJXA 4HNTA 5AHFA 3MYPA 5I3KA 4O1BA 1H5YA 4Z1DA 4HPXA 3NAVA 3FJ6A 3PBUA 2CW6A 3BPWA 1R30A 4O4VA 3CLMA 4NNCA 1R47A 3L65A 5EPDA 1DKWA 4XZ9A 3MO7A 1HO1A 2QCDB 1CW2A 2QJHA 3C56A 2FPYA 1FBAA 4UR8A 2BX7A 2X1SA 4LC8A 1UCWA 4RZ5A 4N02A 4EIVA 3DFPA 3N34A 4AB4A 4N6EA 3T55A 3IGXA 2ALDA 3P8IA 4O15A 1AL7A 5FEPA 3LB0A 4OGZA 1R2RA 2WNQA 1TPC1 2NX3A 3QEZA 4S2CA 3GAKA 3L21A 2H3BA 3L0KA 3T44A 2ZZ7A 3MI6A 1SZEA 4K8EA 5U7SA 3TK7A 3LTPA 2IQTA 4WOZA 1OF8A 3IIXA 4WQ6A 1ZALA 1OFBA 4MPQA 5AHMA 1W37A 5EKYA 5F2IA 2V8ZA 3STFA 4CCDA 2Y70A 2G97A 4JDYA 2QF7A 4A3UA 3P81A 1RD5A 2ATMA 1GJPA 3VE9A 4N9DA 1SQ7A 1X1OA 4PFMA 2BZNA 1QO2A 2D73A 3BLFA 1VHNA 1XCFA 3UWWA 3G8RA 4LT9A 2EF9A 4YXGA 4BI7A 1OFPA 4JTHA 4RJEA 3GKAA 3HJZA 5IBXA 1W5OA 4AWUA 1VS1A 4A21A 3WK1A 2JKPA 1UASA 2ZYFA 4MZ8A 4O0KA 2YYTA 3W1AA 1JUBA 5EL1A 4JTUA 5F4WA 4RZ4A 2C18A 1TTIA 1I2RA 5CZ0A 1OX5A 2W79A 3GDMA 1Q45A 2EAWA 1Z44A 1RQEA 2E09A 1I45A 1KM4A 2VENA 3LV6A 3WK2A 1VLIA 2V0TA 3O8AA 1DHPA 2V2HA 3SIZA 1KFBA 4IMFA 1RPXA 1ZAJA 3TXVA 2ATSA 1WA3A 3W72A 3DAQA 4DEFA 2CLKA 2H3DA 2CFFA 1G4EA 1JCXA 1LOSA 2YYUA 3NXFA 2CZDA 1F5ZA 1LM1A 1ZENA 5K7JA 4XBKA 4R7JA 2Z6IA 1QAPA 3STGA 2YW4A 4IMCA 1NSJA 3NQCA 1S5WA 3P82A 1SSGA 3PG8A 3WJYA 5DLCA 3DI0A 3KVMA 3G24A 4JX5A 4ZQNA 1AW5A 4JGDA 1U83A 5FF0A 3CEUA 4CNOA 1NFBA 1V7YA 2CLEA 3U6WA 2B7OA 2WSQA 4O14A 5CGQA 5G4WA 6ALDA 3UZ5A 4OWGA 4UXDA 1VCGA 3C52A 5C2XA 3LERA 1QO5A 1K03A 2GVJA 1OG0A 2CLMA 4N4PA 4LNYA 1Q6LA 1LROA 3LTSA 4JY8A 1MEIA 3LXCA 5AN7A 3IIZA 4HIBA 1OABA 1ZAHA 1YADA 3INPA 5E0KA 1JQVA 5G1TA 3NPVA 4FF7A 4UTKA 4DBDA 1AL8A 3E0IA 3SY5A 4PCFA 5AYYA 1DBTA 1K8XA 3JRKA 5KITA 1XDMA 1B3OA 4HT3A 3DFQA 4ZQPA 5C5YA 3LHZA 2J24A 3S1XA 2YXGA 3QF0A 2Y88A 4E2BA 4A29A 1LOQA 3CIWA 4OQVA 4MKNA 4Y90A 3HQ1A 3C61A 3EWYA 3A5VA 4RLIA 1SZFA 4YCPA 1F6KA 1LBMA 1JRBA 3BGJA 3HIJA 1KTCA 4UUIA 3A9IA 3N2MA 4O10A 3R13A 2W6RA 3PM6A 3NL2A 5DY2A 1T8XA 4DBEA 2Y63A 4TR9A 2FDSA 1KV8A 5C6MA 1I2QA 2Q8LA 4NJJA 4IUOA 3TSBA 5K4XA 4BWLC 2VEMA 3MWAA 1PV8A 3W84A 3PSVA 1GEQA 1K8YA 1FXPA 1WXJA 5IBXC 4K6AA 4UTJA 3GZ3A 1H61A 1SO4A 3UD6A 1N8FA 1DJNA 2GQAA 2LLEA 1X1ZA 4PTNA 3W2NA 3G1HA 2ABBA 4WY0B 3MHFA 4IX2A 2JKEA 5G4EA 2FQIA 3PUOA 1PCWA 1OYCA 2QCFA 4BF9A 2Y89A 4O54A 3GIYA 1RQHA 2PCQA 4TMBA 3WJZA 5EY5A 3NQAA 2A6LA 3QM3A 4CLMA 1QMLA 1WX0A 3L67A 2VFGA 3M7WA 3GAYA 3G3MA 3NA8A 5G2HA 1MXSA 3C2FA 1T96A 4Z1BA 5KZEA 3W7JA 3GNDA 2VC6A 3R8RA 3R89A 1EEPA 4QITA 1A5CA 3L5AA 1L6WA 3KVJA 3PSWA 2FTPA 3EX2A 3QMRA 3W7KA 4BK9A 4LU0A 2PRMA 3NR0A 3DBPA 4Q32A 3L66A 2TYSA 5F1UA 4N9CA 3KRZA 3LRMA 3L0GA 2NLIA 4JX4A 3EXRA 3N73A 3W9ZA 8TIMA 3NM1A 1KM0A 5AHIA 3UXAA 2DP3A 1ME8A 4M5PA 4O28A 3AJXA 1PE1A 4JY9A 3UZJA 4OT7A 4IQLA 1W0MA 1EPXA 2WO5A 5HJLA 4O1DA 5F1VA 3KRUA 3A23A 2HS8A 3BW4A 3UWYA 2R91A 3PBVA 4EWND 4JIQA 5DCEA 3S1UA 1FWTA 1VLWA 4JTTA 4Z0JA 2ABAA 2ZBTA 3UYCA 5KMYA 4HHPA 5F2LA 4E2DA 1LCOA 1W54A 3NQFA 4X9SA 4C1LA 5I3GA 4FNRA 2VEPA 2ZCGA 1H62A 1TIMA 2DJLA 1PVNA 5TQLA 2C0AA 2WSYA 4IPJA 2Z0IA 1LRTA 2Y6ZA 1OX4A 4RXGA 2BTMA 5GVJA 2I1OA 5D38A 3CHVA 3HB9A 5E1QA 4AH7A 1QPQA 1KM6A 1OK4A 2H90A 1ICSA 2C19A 1GQNA 5CPNA 3TE9A 3PB2A 1WQ5A 3GB6A 1PHWA 4JXCA 1VPXA 2DORA 1ML1A 4UFIA 1B4EA 1DVJA 1NF7A 2VFFA 1G4PA 4MY1A 4H4IA 3EX3A 3LI1A 5HNRA 4MYAA 1SZNA 3P60A 1W31A 4QISA 2FJKA 3KAOA 3VFLA 3HGOA 1QPRA 4FX8A 3G0SA 4I9AA 1KM2A 3TJXA 4NXSA
chains in the Genus database with same CATH superfamily
4I6KA 2EPHA 4LNCA 1BGAA 1E5JA 3ARYA 2Z26A 3SQLA 1ZBVA 3VMNA 2V81A 5ECUA 3NOEA 5ABTA 2J9ZA 3N1AA 4FLQA 1XGZA 5I7GA 4K7VA 3B03A 2PLJA 1UW9A 1XYFA 1E4IA 3CK5A 5HDRA 1EGVA 1EA0A 2Z1WA 3GVVA 1V6TA 1KFEA 3P67A 1H63A 1JCNA 4E0CA 5E93A 1HZYA 3NQEA 2PTXA 2ZX7A 3WQ6A 4B9YA 1IWPA 2OQHA 2HEJA 1DL3A 1U5VA 1GQJA 2P53A 2VCCA 3U2EA 1GONA 3TYEA 3B97A 3OLDA 1ZBKA 1TMLA 1JPDX 3CH9A 1XICA 3T05A 2CZ5A 1OCQA 4JIPA 3RR4A 1VD6A 1K6WA 3OP2A 2B0MA 2O56A 2WXDM 2CHRA 1UBSA 4P8UA 4PUWA 4DWSA 1SO3A 3IJDA 3TJIA 1Y0EA 3THQA 1XR2A 4LBRA 2VRJA 3DENA 4FNUA 2PDMA 3LM7A 4D6JA 4QJ1A 4DPPA 4RUBA 4MJZA 1KO0A 2V2CA 4ML4A 1NOWA 4DY1A 2ZX9A 4XD6A 1H11A 3WNPA 1P48A 3TJ4A 4GIEA 1V93A 4C1NA 1O12A 3EOEA 3K2GA 2CEQA 2A85A 1GVSA 1QPOA 1BKSA 1DE5A 4P2VA 4B9ZA 2Y5EA 1Q63A 2J8GA 1V6VA 1KKRA 1UUMA 3QSTA 2MUCA 1EJUC 2XINA 3GXNA 1POJA 4PRRA 4CD5A 3VM5A 3COTA 4XKYB 2Z28A 1L9WA 3LLDA 4INFA 4M7TA 3GNOA 4HCHA 1ZL1A 1VFOA 1M7OA 2D2HA 4Q4PA 1ZY9A 1TRIA 1TZ9A 2VTFA 1BHGA 3TQPA 4A3HA 2GJNA 3WLKX 2WMKA 3TTQA 5KINA 4HYRA 5LZLA 1ZS2A 4AD4A 1M7JA 3ZJKA 1K6AA 1XLKA 1J4EA 2J74A 3N19B 2G41A 2W66A 1PEZA 4ORIA 2QW5A 3PS7A 4IGHA 4S3JA 4LJ3A 2AAMA 4TVUA 3RO8A 4JYFA 1J0ZA 3D47A 1EXPA 1I9CB 5XINA 4M1RA 3KRBA 3SRHA 4OV4A 4O8AA 2F38A 2OVLA 5D32A 2G4JA 3AMGA 3E9AA 1ISZA 1FFRA 3TNOA 3MSRA 1Q7QA 4QJ4B 1Z7AA 4ES4A 1JJKA 3C0QA 3KS6A 3EOSA 3GBDA 3SUSA 3ENLA 1EHNA 3C0JA 1UKTA 2PI6A 3AIUA 4URIA 3QFEA 4PC8A 3M5XA 3LI0A 4JNZA 5M1TA 3RILA 4UR9A 3ARRA 2ASHA 3GG0A 1J6OA 3P5ZA 3CV1A 1HT6A 3U4FA 3SUVA 3HGRA 1CB2A 3F03K 5KETA 3THDA 3L4UA 1GOKA 4AVFA 1P6CA 4GZ7A 4Y2WA 4OV9A 1FWWA 2V3EA 4DNHA 2PLMA 1UOKA 2P10A 4QDPA 5IDIA 3UJSA 5FD0A 4DWSD 1S39A 4WKFA 3ARTA 1TMQA 4WXZA 4HNVA 3DYPA 1WB0A 3ABOA 4J35A 3UESA 1DYSA 3OA3A 3MKKA 5I00A 2BHYA 1O94A 4OHQA 3DN5A 3L4VA 3MCMA 3I68A 3BLEA 4MGGA 1UYQA 1GW1A 1FH8A 4MAZA 1TV2A 4ZB5A 1EJTC 1OGBA 1TPB1 4OVXA 4BFAA 2CLOA 3GTNA 1MEWA 4V15A 2E5BA 4DO4A 1T99A 1EBGA 3GXPA 4ADSA 4LV4A 4PMJA 4Z08A 1VBUA 2NQLA 4KEMA 4PR4A 4H83A 4LUIA 4GHRA 2DSVA 5I03A 2YFOA 1V3MA 2ZX8A 1ZBWA 2YA1A 4I7VA 2PWGA 1QDSA 4FMVA 1JIBA 3ZIZA 1UZ1A 4R5EA 1I60A 2CERA 1S1PA 3WF4A 2YB4A 5CJ5A 4DM1A 1P5BA 5HBFA 1HGWA 4XUGA 3WH5A 5H91A 1A5LC 2YA2A 1HF6A 5CPQA 3W1LA 4QP0A 3OLEA 3TN4A 2VL4A 4HBKA 2YDAA 3PC0A 1S5TA 1LT8A 3UVIA 4JKMA 3VZXA 4DRSA 1S5VA 2ZUWA 1SM9A 4IFKA 4LUYA 2E3ZA 1LBFA 4IP4A 1H7NA 1GJUA 2EJ1A 3M9YA 1JYVA 5KZDA 5HWMA 2XH2A 1UR2A 1YTDA 2DZUA 3WG6A 2XN1A 3RGTA 3QMTA 2F9RA 2QIIA 2PDBA 2HE5A 4KKXA 3VNIA 1SGJA 3GIPA 4MKVA 1MQQA 1OC5A 5ABEA 3W85A 4JYEA 3WMCA 4PSPA 4QLKA 1YHTA 3C3NA 3W7MA 1BG9A 2DZAA 3N2BA 2PBOA 1W1A1 4I8YA 3KBMA 3C8FA 1R87A 1XYMA 2ZVRA 3MP4A 5E5CA 2DSZA 3MB9A 4WR3A 4WHBA 1PTGA 3UWZA 1E3XA 1OEPA 1G1YA 3Q4DA 2YDQA 3AC0A 3L2MA 4X0VA 4ZQOA 3B8SA 5HINA 1CGTA 2VC9A 5REQB 5HOSA 4J3UA 1Y7VA 1F61A 1K4GA 4HNCA 3WQPA 4U5IA 3ARPA 4J3TA 3WLMA 1XH0A 4DXVA 3PP7A 1WDDA 4GX9A 3IV8A 1WOBA 4M56A 2P3EA 4JX6A 1FWEC 3MO4A 3NPWA 3NQ7A 5A6TC 4LVGA 1UPMB 4B5SA 4QTGA 3A47A 1EWDA 3MYOA 5DBTA 2B7QA 3O0FA 4D71A 3SQSA 3MZNA 1E43A 4B16A 5C9XA 4RDZA 1EZ2A 1E73M 2NSXA 2FVLA 3HN3A 2EHHA 4V1YA 4AEFA 4HU3A 3MMWA 1REQB 3B8DA 1A5BA 5CLTA 4MB4A 5H8MA 1BWLA 3WL1A 1V0NA 3NPXA 3NTYA 4W85A 4NHVA 3M0VA 1KM1A 3WELA 3AU6A 4Y96A 3E0WA 2CLLA 2PP1A 3ONCA 1YNYA 5D2TA 4NILA 3IPWA 1A0CA 1XG4A 5A6BA 3E2RA 3JUGA 1CNVA 1G01A 2EPMX 3RU6A 5AOUA 4GZEA 1VYSX 4V1XA 2Y4SA 4RDWA 3G1RA 2CLIA 1P7TA 3TNBA 1PKLA 1WKEA 3ABXA 1KXVA 1CB7B 2UY3A 1U1UA 3P84A 4CCCA 4A3RA 2GFTA 5EFFA 4BEUA 4NZCA 4ATDA 1AJ0A 2W4XA 4XZBA 3BANA 2G4FA 1JUEA 1UKSA 4EACA 2G96A 3FKRA 3O63A 1JNEA 3W38A 2DDXA 4YL2A 1FWBC 4FXFA 5J04A 2VVNA 2J8FA 1X39A 4US5A 3KW3A 4ICMA 1XKJA 4FPSA 4UFHA 5K9XA 1GVQA 4MADA 3T4CA 3BG9A 4P8XA 4GVGA 2C3ZA 2V67A 2X42A 4IFRA 1W3LA 2Y5JA 3GXIA 1NP0A 3VNLA 4AF0A 3LXAA 3E0VA 4PODA 3O07A 2PTWA 3H7RA 1W1ZA 3M41A 1LQAA 3AXMA 1A3HA 5BMWA 2J9YA 3WKZA 2FB2A 4UTWA 4HZ6A 3SSJA 3PZ9A 3CU2A 4K36A 3S42A 3OVPA 1EB3A 1TV5A 1HTIA 1A5OC 2FZBA 3O6CA 4PMQA 3EWBX 1OADA 3U0HA 1W9DM 4LFYA 2PWHA 1L6GA 2C71A 2NX9A 1VH7A 3RITA 1UROA 3EPOA 2QMKA 1C8YA 4HNNA 4D6IA 1KA9F 1NQKA 1SO6A 2VGFA 2OWXA 1E6ZA 3O1NA 3ZS4A 3O05A 3PBWA 5K4ZA 4C5ZA 4Y9OA 3VNYA 2ZRXA 5I77A 1XLGA 3LCXA 3AS2A 1SMAA 2C16A 3MUIA 3R4IA 1KM3A 4OE7A 2REQA 1VGAA 2EBNA 3HPZA 1S2VA 1QI3A 1W3HA 2BV9A 2YA0A 1M01A 4LOCA 1I75A 1H0IA 3WZ0E 3VO0A 1DORA 3W02A 2J4GA 2VC7A 2BMBA 5F4SA 2OSWA 2PODA 1RA0A 1ESWA 3B0UX 4ACZA 2WYSA 3TC7A 1CZ1A 2ZIDA 5F2MA 4XUYA 1MNSA 1BG4A 3CPUA 4W9TA 1OT2A 4WY0A 2OR2A 1A5KC 4CQCA 2GUUA 3LPFA 4O12A 4JNYA 3LX9A 3ZT7A 1M3UA 2DY3A 3PZTA 1EUNA 3TU9A 4FOKA 1OBAA 1EC7A 3VNKA 2GGHA 4OBSA 2FB3A 2V3GA 4NX0A 4H8VA 2VVSA 2X7VA 3GK0A 3V3WA 1GORA 3QY7A 1C9DA 2XIBA 3BG3A 2ZRYA 1KD0A 4LVBA 2G5WA 5FI8A 2VMFA 3P80A 2GQ9A 2RHGA 1XFBA 2E9MA 4H9YA 1NEYA 3B0PA 4AEEA 3FXGA 1HFBA 4JOMA 3SFWA 1XLHA 4G6CA 1DTUA 3FEMA 1FKWA 4P5UA 1CXHA 3JVAA 1L8PA 1VZWA 1JI1A 3L0NA 4YYFA 3H2AA 4WF7A 2GQ3A 4GJ1A 1W1VA 3FFSA 3QPEA 4WCJA 3A21A 4NAFB 3WK3A 1VKFA 3R8GA 1PYFA 4XAFA 2B4GA 2BOEX 2HQAA 3TR2A 3H2FA 1E55A 2FPVA 3BLIA 4V33A 5BWAA 4HK5A 2HPMA 1K9TA 1JI2A 4DF0A 2EG7A 4C6JA 3TEVA 3FJLA 2GPTA 1ZCCA 3MKCA 1KLZA 3MKVA 2VFEA 4FIRA 2WJZA 3E12A 2O92A 3CYJA 3DHFA 2WVUA 2VZUA 2ZDRA 4Q4QA 1JR1A 1AW1A 1YDOA 3V1HA 2V38A 2VFHA 3EOLA 3GVQA 3CPRA 5A8QA 5BCAA 2W5FA 2YLLA 4E3VA 1THFD 3UXDA 1RA5A 3LY0A 1LLZA 3GW0A 3SN1A 1W9PA 1KV5A 1V0KA 3N15A 3OG3A 4LUTB 2VNCA 1H5VA 1MSSA 2HXTA 1FXQA 1IIGA 3W3OA 2OEKA 4Y6GA 5A8OA 3SRDA 4MFDA 1DOSA 1VYRA 2PEVA 4P7OA 4J3XA 2ZX5A 3N3MA 4GIAA 1R3RA 5C2GA 1Q7ZA 2R1MA 4R53A 3TYUA 1YIXA 1EJXC 4C91A 5A8GA 2WPBA 3LCFA 2BY2A 3SADA 4DI9A 1UH2A 2Q3OA 3I7SA 4PE8A 4UFMA 1W8SA 4QG9A 3CH0A 4C6QA 2V5KA 1YLVA 1ZU8A 1RK6A 3QW4B 5IDZA 5I3DA 4NX5A 1X8FA 4M3PA 4UQBA 1O4UA 2Z27A 4H7ZA 4MMWA 1FA2A 4XTDA 5JUVA 4AD3A 2ISSA 5GJPA 1I2NA 5B80A 1QWKA 4PCPA 4RE0A 4FR1A 1DJGA 3UXIA 4BR1A 2Z1BA 4LB4A 3LCWA 3UF9A 4GNJA 4F4RA 4EK7A 3W7LA 1T0OA 3PHAA 3VNJA 2PU0A 1PL9A 3M4HA 3VMPA 3AXIA 1LTDA 4GISA 2R94A 2X41A 4D8LA 3MI3A 1V03A 4W86A 1EHAA 1N8IA 2AGKA 2OGYA 1LRNA 1EJVC 5BOOA 1AZ2A 2IUZA 2V30A 5G1YA 4X22A 1S2TA 4B3LA 1UOZA 4H9ZA 1BYCA 1CIUA 4F0MA 1EL3A 3PBYA 3GQYA 4JTCA 1SZGA 1YNQA 4OUEA 1JULA 3MSYA 5GQBA 5AVHA 4G7FA 1VIWA 2QMJA 2YCIX 1HJQA 2C1GA 1IZKA 2QKFA 2IQDA 4HN4A 2Q8ZA 2GGIA 1FQ0A 2XM1A 1WBJA 3XIMA 4CNPA 3U7VA 3FJ4A 3ZJ8A 3QTGA 4ZO6A 2PC4A 1FWIC 2GSHA 1OD8A 3TIMA 1OFDA 3G18A 3FK4A 2P3ZA 3KM8A 4I90A 5HATA 2WSRA 3OVRA 3USZA 2VYOA 4Y8EA 2EEXA 2EGZA 3V5OA 1LRQA 2TPSA 1VRDA 3KZPA 1HJXA 4GQGA 3W81A 1OG6A 3NG3A 5GNZA 1F3EA 1OK6A 2QJGA 4IIEA 1K3UA 1PPIA 1W56A 1Y5XA 2VELA 2ZTJA 1Q6DA 4O18A 3QYQA 3E0FA 3KE0A 3IJIA 3KBWA 3VKJA 2A3CA 4IMGA 3SY8A 1XJBA 4PZVA 3NPUA 3UR7A 1OFQA 3T0CA 3MI2A 1OFRA 3EBVA 4TV6A 3G1YA 1MDRA 1JYWA 2POTA 5I0DA 4C1KA 1D9EA 1TIWA 2VKZG 2HVOA 4C6MA 4CQ9A 3GTXA 3A4JA 1NWUA 4CNUA 2GGEA 5CCZA 3UNDA 4H6QA 1WDSA 3N2TA 4G8TA 1GKRA 3QQ0A 2A3EA 2IPWA 1VCVA 1LT7A 1ISXA 5BOEA 3OBAA 4B3KA 3NVDA 4QDMA 4GQBA 2GDVA 4MB3A 3GDTA 5BRQA 1A5NC 4Q4MA 4WJEA 5BZAA 3T6CA 4G1KA 1KRMA 3WH9A 3S5OA 5A6BD 1CGYA 3UETA 3O16A 3B8VA 4UIOA 4JTKA 4S3KA 2OT0A 3BOXA 3K13A 1TYGA 3DFNA 1TJPA 4IPPA 4UOZA 4DO6A 1U1HA 5CBBA 1XINA 2QCNA 2DSUA 3S5YA 1R0MA 2OSXA 4JD4A 5E09A 2EPLX 2X7WA 2DZTA 3UZWA 3V1PA 4MIMA 3KBVA 4FF5A 2Z2UA 4O13A 3M0ZA 2V5JA 4IL2A 3U2ZA 2ZKMX 5HAOA 3AWOA 2Q01A 3JR2A 1TPFA 3NQBA 1K9FA 5ABFA 1EP2A 1M6JA 4KCTA 1R3WA 4FAMA 1LWJA 1NFPA 1TWIA 2CLHA 3NIYA 1MXDA 3G1DA 1KGWA 1EP3A 4JTSA 1KFJA 2J6VA 3KRSA 3UY7A 3EEZA 1PKNA 1TV7A 3TUUA 4AAJA 3LN3A 3GHSA 1UZHA 3G8EA 3MWCA 1YX1A 4LV9A 1E9ZB 1SW0A 2INFA 4XZNX 1GZJA 2INEA 1GNXA 3H4GA 4GC3A 1QOQA 3N9KA 1E56A 1Q2RA 3WMSA 5EFDA 4MNKA 4PB4A 4DJEC 4ZENA 1XGEA 2Y7DA 5CC6A 2FLIA 1KBIA 4O19A 1BF2A 1IEQA 3NSXA 2QDDA 3ARVA 5IHSA 2C91A 4AHOA 3W7GA 1VPYA 2ZUTA 4Z1DA 2J7FA 1WDPA 4H7VA 3CV7A 4HPXA 3PBUA 2JFEX 3BPWA 1EH9A 3RM8A 3S47A 3WF2A 4HCLA 3WDHA 4P8VA 1J01A 1R47A 5EPDA 2EG8A 2QCDB 1CW2A 1E5NA 2WM1A 2BX7A 3L2LA 1UCWA 4N02A 2E8YA 3RU8X 3KOXA 3QHOA 4O15A 1EFZA 3MMDA 1EXBA 3HU7A 3WO8A 4OGZA 4XX6A 3TYAA 4HTYA 4H2CA 2WMJA 2ZZ7A 5U7SA 3TK7A 1OF8A 3IIXA 2CESA 4AU0A 1ZALA 2WMIA 4MPQA 2OB3A 2VR4A 3S2NA 3STFA 2IXUA 4JQ1A 2QF7A 1KQYA 1TVLA 1GJPA 1AMYA 1BVWA 3N6HA 1SQ7A 3JZEA 1IZCA 1QO2A 2D0GA 1VHNA 1XYBA 3UWWA 3G8RA 4LT9A 1QI4A 4KERA 3BMXA 5C2CA 1VS1A 2OLHA 3OTRA 3WK1A 1UASA 3SY1A 1O5QA 1JUBA 1AH4A 2OTDA 4B5UA 4MG4A 1TZZA 1TKKA 1S5NA 1TTIA 2WHJA 3G6MA 1W9UA 3BAKA 2EAWA 1Z44A 2J7EA 4GY0A 1TWZA 4DJFD 2V0TA 3QY6A 4BY3A 3SIZA 4OTKA 1OQFA 1RPXA 3CAKA 1T8QA 1L2QA 1WA3A 4HHHA 3DAQA 1ZP4A 1N8WA 1LM1A 1ZENA 4RE4A 4OOZA 1AH0A 3FA3A 3STGA 1S5WA 2REQB 2QPXA 1RBLA 1SSGA 3RIKA 3G24A 1A47A 3REQA 4CNOA 3RYSA 2HJPA 4MF4A 1GKPA 5CGQA 5G4WA 3UZ5A 5J8LA 2CLMA 4QLJA 2QULA 2VEGA 3WD4A 3UU0A 3DERA 3IIZA 4HIBA 2CIPA 1I6NA 2WVSA 1NOFA 1JQVA 3NPVA 4FF7A 3ALGA 3W00A 1AFSA 3AICA 5D9NA 1DBTA 5GPRA 5E6ZA 2G50A 1NWSA 1EEXA 3PZNA 5C5YA 3WNNA 3KP1A 5M03A 4J28A 3WQ4A 3IAPA 4WEVX 4EXQA 3QF0A 3S3GA 4PTMA 3CIWA 4MKNA 2ODOA 3PTDA 3VZYA 4GO8A 2VI0A 3C61A 1BF6A 4RLIA 2ZADA 1AJ2A 1A3WA 1F6KA 3UZYA 3OB8A 3SCVA 1LBMA 4DWSC 1XRSA 3BGJA 4UUIA 3GBEA 4NYUA 4CVUA 1T8XA 1LG2A 1SJCA 4DBEA 2Y63A 2E4TA 3WENA 2QF8A 1MW1A 5C6MA 4H2HA 3PPHA 3V0SA 4NJJA 4BWLC 4XVEA 1ITXA 2PDJA 3PSVA 3WD0A 1M41A 2UY4A 2C7FA 1K8YA 5IBXC 4GYFA 1PZ0A 2QGHA 3QYSA 5CAKA 3GZ3A 4B3ZA 1H61A 3QKEA 4KRZA 3ZVIA 1N82A 2PPGA 3UD6A 1DJNA 1UD3A 3H4XA 3UG3A 2DVTA 1X1ZA 3OBEA 2ABBA 3PUOA 3HQOA 4I6VA 2OYLA 1QHOA 1IHIA 2Y89A 3QV8A 5KEZA 4TMBA 2PCQA 1FHDA 2FZDA 1R7AA 2D2JA 1JEZA 2A6LA 4U5KA 4DJDD 1WXYA 1CT5A 2PTDA 3ZM8A 4CLMA 4AD1A 4XSLA 3G3MA 1EJWC 1US2A 1DWGM 2V68A 3WN6A 1B3VA 1V51A 1XFCA 3R89A 2EPNA 4QITA 1L6WA 3OG2A 2HCVA 2ZVIA 1GKQA 2PRMA 4LSBA 5HA7A 2D3LA 4HCDA 5D8ZA 3ZLGA 3VIFA 4IHCA 3TC3A 1YBQA 1ZGDA 4WGHA 3VIGA 3UXAA 1O5RA 1EF3A 1BVNP 1JAEA 1ME8A 1C9WA 1Q4NX 5LIWX 2V6AA 3UVAA 5FCZA 3UZJA 4OT7A 1JD9A 4EAMA 1EPXA 5HJLA 3UXLA 4KGJA 3PNUA 3URBA 5DCEA 3GU2A 1OINA 4JTTA 4RW5A 5KMYA 3NQFA 4C1LA 1B54A 3W25A 2PMQA 1QNSA 1O1ZA 4QEHA 2FFIA 1MWOA 2VZOA 3EZ4A 3S46A 2I1OA 4CU8A 2ON3A 3BDKA 4AH7A 3NSMA 2H90A 3AU2A 1ICSA 1DEDA 1GQNA 3GB6A 4B4FA 4UFIA 2C1IA 1DVJA 3WBYA 3AQUA 4F0LA 1BD0A 4JZ5A 3NUKA 4XB3A 4ZTXA 3VVGA 4GKLA 5HNRA 3KLLA 1SZNA 4MYAA 4DJED 3QLDA 3P60A 5HNNA 3KAOA 3VFLA 4CU6A 4W5UA 4L61A 5BROA 3BCDA 4I9AA 3TJXA 4NXSA 1HKWA 6REQA 5HMSA 2ISVA 2CZEA 2HE8A 1YPXA 4EKJA 2Y7FA 1IXOA 3WUBA 4W87A 2PBGA 4Z1CA 1LDCA 4B2DD 1R3QA 4AZBA 4DBWA 3QGVA 3M1ZA 2GGJA 4GXWA 1DIDA 1W91A 1MFVA 2ZTKA 3UW6A 1EA9C 4EF8A 3H8AA 3OQ8A 5FJPA 3AUOA 3M7SA 2BVDA 4M80A 4DUOA 1I0BA 4QE5A 4WXYA 3MMTA 4B5VA 4GXPA 3W37A 4KWSA 3ARXA 5CKSA 4KEUA 2ACUA 1GZGA 4HP5A 3NL6A 3QV6A 1Q4WA 4V2XA 3QR1A 3MBFA 2E28A 3TA9A 2WJDA 5HQMA 4QFUA 3SN0A 1VBJA 1VP5A 3WQOA 4O8RA 4YVPA 4IGSA 2DIJA 3L4TA 4HPJA 1O6IA 2R6OA 4YTUA 1UWUA 3K8KA 3S2CA 2PGEA 3UPBA 1RQBA 4GX8A 4OZOA 1JG9A 3O06A 3B0XA 1ZAIA 4OBTA 3II1A 1EWEA 2XGIA 4IG2A 1R7OA 4XZHA 4JDBA 1KFCA 2FTWA 4RCXA 3LPOA 1ADOA 2Q8XA 3EB2A 1XQLA 4J27A 4EPEC 5T9CE 5I5RA 1XLLA 3UA4A 3RRXA 4D72A 2DGAA 3MPGA 1VCFA 1WKYA 3PUEA 1FH7A 4S2BA 4Y7EA 1UWIA 3GWQA 3APGA 1TFVA 3DYOA 1XDJA 2HBXA 4W7UA 3KP0A 4UTLA 5CZSA 2ZA2A 2QLYA 3GYCA 4ZE5A 3B9DA 3WBEA 3QFWA 1ONXA 3MZ2A 3TDFA 5I02A 1DQWA 3AWNA 1IXPA 3NQGA 3FA5A 1DJYA 1QOXA 4RNHA 3B8WA 3WH8A 3CAQA 4MHBA 4DF2A 3PPCA 1A50A 1WCGA 4JCLA 4K8GA 4Q8NA 3AHTA 4ASTA 2VR5A 3FGCA 1S3TC 2O4QA 2OX1A 1BSLA 2NW0A 5LIUX 4GH3A 4U3CA 4Z2GA 1SVDA 2P8BA 1Q2SA 3VGBA 1LF1A 2TMDA 2BXVA 3RDKA 1QU4A 3FLUA 1R3SA 3PWAA 1CENA 3U2CA 2IS7A 4XAGA 4EWJA 2OYKA 4LCSA 3N9RA 4DBUA 4AXKA 2B7NA 1UA3A 5LHEA 2XSAA 4J4KA 4QNEA 3T0TA 1XLIA 1IIHA 3CZKA 3CIXA 5AHEA 3TQVA 3N29A 4PH6A 3GDRA 4HSOA 2QYGA 3U9IA 2G3IA 3AALA 1HKVA 4QX4A 1VQTA 1GOWA 2J66A 2YKKA 5LNRA 4AWTA 3WNLA 3ITGA 3A5FA 4L65A 3KDNA 9RUBA 3NQ2A 4S3FA 1RK5A 4FP1A 2NX1A 4YMZA 1V02A 3ZR6A 2BY3A 4JN8A 2AL2A 3P5YA 1B5TA 3M5VA 4H01A 3BURA 4DO5A 4TQTA 5C54A 3B05A 3BMVA 4LTSA 1JZ3A 3QJAA 5DCDA 2BP1A 1FKXA 5A2CA 3R0KA 2A1YA 5T26A 2Y7EA 4Q22A 3CWNA 4CNNA 5DN1A 4CN6A 1IQ8A 5AYBA 4JAWA 2V5DA 4HK7A 1UKOA 4NSBA 3UG8A 4PL1A 2PDNA 1AQFA 3G0XA 1TUXA 1XHGA 1ZB5A 3CXOA 4HZMA 4W84A 4G2DA 3HG2A 3GFYA 3IJ6A 4LAOA 2KX9A 3RX2A 5AKQA 2YL8A 3WFAA 3ABQA 3T09A 4WSHA 1QRQA 4G56A 4GI9A 1H51A 2ISFA 3PFRA 3W75A 1GVRA 1XP3A 1VEMA 2EO7A 3UWUA 2G95A 3EWWA 4FNPA 3QKZA 3MUXA 3U5UA 1R85A 1A0DA 1QJWA 3FEQA 3MUAA 3ZOAA 3B9AA 3HV8A 5KSWA 3QTPA 4ATWA 4CU7A 1P0KA 4HOXA 3BW3A 2P76A 2GOUA 3KWSA 5LYRA 1JXJA 2WZMA 5D4YA 3G1AA 2HVMA 1V3HA 1F07A 1W9XA 2CWNA 1G4TA 3CQHA 4EXAA 2GJXB 2XWEA 4ORMA 4DWSB 1VBHA 4UTTA 3GDKA 1B30A 4MOZA 2XZ7A 1IT7A 2XVGA 4PMYA 1VFHA 3A3XA 1H7XA 5FF7A 5BYWA 2Y7GA 5DXXA 3EWUA 3G77A 3L4XA 5MKGB 4W7VA 1KNWA 4LAKA 1UWAA 4IQDA 4US5D 3VE7A 1KRCC 4S3BA 3T0BA 4UFKA 1E71M 1K7EA 1UD8A 2Z6JA 1TPWA 1XISA 1W3IA 4GZIA 2ISWA 3CUZA 5PTDA 3LDVA 4UTTC 1OZQA 3P62A 4F0KA 4R7WA 3BW2A 5H1WA 4ZVJA 4O11A 1NF0A 1E4NA 3WLRA 3VFCA 4I3GA 3W88A 4FXJA 1UR9A 1SW3A 3KHDA 3TN6A 1MW3A 1RJPA 1XKYA 4Z42C 2CPUA 4AY8A 4JQ3A 4X2PA 3S6DA 2YB1A 2GGGA 3R8HA 3M6YA 1VEPA 5GJNA 4A3QA 5E9AA 5I79A 2Y2WA 3NL3A 1ADSA 3AZTA 5DBUA 4H1ZA 4L6HA 2WKGA 2Y1HA 4GCAA 1VJZA 4XIAA 4TIMA 3BLDA 2XGZA 5LGXA 3W4RA 2O9RA 1GHSA 4GBDA 4JEQA 3S4TA 4DJDA 4H8UA 1W9BM 3OLGA 4K7YA 2RJGA 3PNZA 3LHTA 4IF2A 5C9ZA 1NDVA 2A3AA 3OZMA 4PEEA 2NQJA 4U28A 4PCSA 5CPTA 4QJ3B 3BSHA 2CITA 3AMLA 4L1XA 3WBAA 1QNQA 1TCMA 3H23A 4BF5A 6CGTA 4XKMA 1WYIA 3O6AA 3TTOA 2OPJA 3FHAA 3BAWA 2YCLB 4CD6A 2QJJA 1UD5A 3ES7A 3GNNA 3E49A 3R94A 4ADTA 4F79A 5CSSA 3H2OA 4WD0A 3OZOA 1R46A 4RR4A 5DXYA 2E6FA 2PD5A 3WF1A 3NQDA 5LIYX 5AHLA 1I8JA 1Y65A 5AZ0A 2QR6A 2X1TA 3EXSA 4AWEA 1XS2A 3TAKA 4C6PA 2Z7KA 2ZC1A 4LANA 5FJRA 3W73A 1A4MA 4BI6A 3VDHA 4HD5A 1Z48A 4E38A 2JE8A 1GTHA 1N55A 3AYTA 4GUFA 3A3WA 4GXMA 2Y62A 5H2ZA 1V5XA 1RXOB 4HNLA 2HMCA 3GM8A 5DMMA 3IRSA 2XFYA 3H2MA 4RX0A 1TE1A 1BGGA 5I3IA 4O1FA 3VNDA 1D3CA 2VP8A 2WMIB 5CLWA 3W86A 1TX0A 3CLWA 5BMXA 4PUEA 4OECA 2CC0A 4F8XA 3OA5A 4HNUA 3SM0A 5HK4A 3PJUA 2J7HA 3LCLA 3TYCA 1HUVA 1EPVA 5EMKA 1D3HA 3CV2A 3VX0A 4AZIA 1LG1A 2DFAA 2DVXA 3M5YA 3VKCA 3QGKC 4F2UA 4DZAA 3M43A 3ID7A 4X63A 4WOQA 1FWRA 3LV5A 3FAXA 3Q94A 1YTEA 3CQIA 2A6NA 1QW9A 4E4UA 1WO2A 4ZODA 3UJEA 5F2GA 1XIGA 1HJSA 2YBTA 2NUYA 3VXGA 4GD0A 1E1CA 4PUUA 1K7FA 2X30A 5HWNA 2OOGA 4BJHA 3BQ6A 1EO7A 2AQWA 2OJPA 3FAWA 3W7PA 1C90A 1LORA 3WNMA 2OEJA 3WLIA 2NVAA 4AC7C 1V4YA 1IT0A 2Z2AA 3IIOA 1M7PA 4ZEPA 4WGXA 4FLSA 4FLOA 4FX6M 7A3HA 3FX4A 3F5JA 5DELA 5I3FA 2Z1KA 3M0YA 3MTWA 4QAIA 2Q6ZA 1FWDC 3SI9A 3UR5A 4RV8A 3JW7A 4O1AA 1J10A 4DVOA 4I5XA 1YEYA 1C7TA 1R9YA 1OB0A 2XSBA 3PVFA 2H8ZA 2FZ9A 1N2VA 2F2HA 2XIQA 5FKYA 9XIAA 1DWJM 4MJ2A 1ONRA 5I06A 2J47A 2ZUVA 4BA0A 1WXZA 2VJXA 1KCXA 3TP4A 1BXBA 2CU0A 4ACZB 4UMCA 1TWSA 1TUFA 4N42A 2PDYA 1WZMA 5AZ1A 4HA1A 5FL1A 5CZTA 3KL5A 4IGNA 2XGBA 3LCIA 1W8GA 3WQCA 1TZ7A 4LYQA 4UNIA 1V6UA 1Z32X 2X16A 6TIMA 4LRTA 4Q8QA 2X0YA 4Z2IA 3CEPA 1I2PA 3K5XA 5CC7A 3WYZA 7ODCA 2WB5A 2J7GA 2XJ7A 3BG5A 3NURA 3SUTA 2EPKX 4PTXA 1ONEA 4LQ1A 1J0JA 1TMHA 1LP6A 2OQLA 4N9BA 1QBBA 4XKYA 4R7OA 1RH9A 1PX3A 2A0NA 3CYVA 1E1EA 1A3XA 1YE6A 3W2UA 4FNTA 3QQWA 3RR1A 2C15A 4MB1A 4CNSA 1UIPA 1E70M 3H2CA 1ISYA 4H00A 3CIVA 2JEQA 4X0NA 4Q4KA 3VOHA 1FCVA 5HR7A 3EDKA 4DZHA 1C91A 2CKSA 3W0KA 1AA1B 1XIFA 3LCHA 1QUMA 1YDYA 2WVTA 4JS3A 4J3WA 3KUMA 1XD0A 1XXXA 1JYNA 1QW8A 3DC0A 1HG3A 4DNMA 1EDTA 4GO9A 2FGLA 2HNEA 1GOMA 1PIGA 1R9ZA 3GFXA 3S9ZA 4LRSA 5BU6A 1VRXA 3MCNA 5IOBA 1XIHA 1JCYA 4PYSA 4GC4A 4KRUA 2CLPA 4G7EA 4MKSA 4MY9A 1TVPA 4H9XA 2PTYA 2ZZ3A 1NAL1 4QXIA 7TAAA 4NT0A 3A4AA 1LBLA 2VHLA 1T5AA 1FCUA 3P8JA 4Q6JA 3EA1A 1CBGA 2PU1A 1RR2A 4HNOA 2JF6A 1XBZA 3B9OA 4NRRA 2BWGA 3FOKA 4A8NA 3T2QA 4NZ5A 4ONVA 1V77A 1DJIA 5MKGA 4NP7A 2GK1B 1JZ7A 2D0FA 1R86A 2PURA 3IAQA 5C55A 4I5UA 4WDWA 5EB8A 2OT1A 8A3HA 4K1WA 5J5DA 2NLYA 3KFTA 4RNJA 2QIWA 1QVBA 1V7AA 3S9YA 3UBPC 2Q3RA 3O2LA 4BS0A 4Q7IA 2A3BA 2RKXA 1X98A 2WQPA 1CXEA 4A4AA 1P1XA 1PHQA 3QPYA 4DB7A 3C2OA 1JYXA 1CXFA 4I9MA 1EC8A 2WLYA 4UTHA 3T08A 4JTQA 4D2JA 4J40A 4CCZA 5D30A 3T81A 2ZXAA 3S1WA 4NI3A 2I14A 3NQ6A 4XD4A 4L4MA 2NUXA 2V2DA 4GVFA 3A4WA 4RW3A 3AI0A 5LSMA 4JQ2A 4QCEA 1G67A 2GJPA 3RPDA 2JIWA 3K1GA 1NM9A 2IPJA 3RHGA 4ACYA 2XFRA 4AZ7A 1SFSA 1FX6A 4XTIA 4ROPA 2JBMA 1BXCA 3ARZA 3AOFA 3CC1A 2NWSA 3GE7A 3PBMA 2FH6A 1OZMA 4Q7BA 4E8DA 3RM9A 2C6QA 1K77A 1PBGA 1PIFA 1PIIA 4KETA 1VJIA 1RLDA 3VAVA 1Y5WA 3W7IA 1K70A 3ZZ1A 1UWRA 3GG7A 1KFLA 4AZCB 1ECQA 4GVHA 1B3YA 4GA8A 2P1FA 1MI3A 3W70A 3UCCA 2WANA 1S5MA 4IFOA 4XQ6A 3THAA 3M07A 2FIQA 3QR3A 1NARA 3T4WA 4H04A 1GG0A 3N14A 4D6CA 3VILA 5LXXA 1RBAA 4ZMGA 5C8BB 2VOMA 3AYSA 2A2IA 4O0ZA 3H54A 4DXXA 1SFJA 1QTWA 4QG6A 1OC6A 4GINA 4CKQA 3EWXA 3FS2A 4Z17A 3QLLA 4FHAA 4IXXA 4W8BA 3ORWA 4LAUA 3FVMA 4NJGA 4ZQCA 4BCEA 1JAKA 4GACA 1SU5A 4MWAC 1X96A 4H6EA 4JFWA 4JTFA 5RUBA 3VDAA 2ACQA 4JHZA 4R34A 1XSJA 4PMUA 3SCNA 3QZEA 4XZWA 1EKOA 2ZZ4A 4JHOA 1XC6A 5CSRA 1IEXA 2JGYA 2EJAA 2PWUA 3ITOA 1UQYA 5JIPA 1EX5A 1E0UA 2NUWA 1SZRA 3L12A 5F4XA 2FTYA 1XIIA 4KEZA 1JGMA 3ABZA 2QUTA 2NSOA 1BWKA 3P0XA 1JDAA 4UC5A 5LNSA 1LLWA 8XIMA 3ZQ9A 3D6NA 1O66A 3HZ3A 4M6QA 3YPIA 2RGLA 3A13A 1L8NA 4CUCA 2X05A 4AC1X 4LPCA 4ZXOA 5D05A 3S0CA 2QDHA 1G6CA 4PB5A 3NZRA 1VFMA 4L6DA 4M7SA 4KPLA 4M51A 2CZVA 2NV9A 6TAAA 2QUVA 2WNWA 5D03A 2ISDA 1XRVA 4BI5A 4XWUA 3GR7A 4KRTA 5E70A 1EIBA 4DJEA 3C2EA 3ONBA 4CEXC 4LVFA 3IUIA 2F2KA 3VMOA 2NQ5A 4AD2A 2VM8A 1V0MA 5TIMA 5K2ZA 4RV3A 3WQFA 4FXRA 5B7YA 3H7UA 1Y5VA 4L80A 1R5YA 2O9PA 3SCTA 1YRRA 5TD4A 2W9MA 4ML9A 1F76A 3RF9A 3OGRA 4AX6A 4E3TA 5FJOA 3I65A 4M82A 3G1FA 3UJFA 1LL6A 4AVNA 3CV6A 4AD5A 2QGYA 3SZ8A 2VR2A 1KXQA 1E0WA 1TPDA 1XIDA 5BXTA 4EAYA 1DJQA 2GQ8A 3UWVA 3NGJA 1M53A 4A22A 4Z0SA 3HMJG 3GLCA 3UQNA 3OEXA 3AJ7A 4U2ZA 2Z29A 3TLQA 1KBJA 1L0PA 3HG3A 4M0XA 4TX9A 1SO5A 2NXHA 4TTUA 2X2YA 3W7NA 1XC4A 3M47A 3A4XA 4PL2A 3C8NA 1HJWA 4UCGA 3VKBA 4E8GA 3V0UA 3AZRA 3OQEA 1KXHA 4PN2A 2WVVA 5JIWA 3EMZA 3GW3A 1Z3NA 2HROA 3GTHA 3M16A 4HJWA 4DELA 3WQGA 2QCLA 4GE8A 3U48A 3M5ZA 1RY8A 3TROA 2BLEA 2OMAA 2PF0A 3E02A 4C6DA 2TSYA 2D69A 5D37A 4QE4A 1MUMA 3W7RA 1GW9A 3UWQA 1DHKA 2WNNA 4HMNA 4DO7A 1GT8A 2QDGA 2FH8A 5AYXA 2E5CA 1RVGA 4UZSA 1MEHA 3LXBA 4CCEA 1TRDA 2VRKA 2X2GA 4XAYA 3IVTA 4GJIA 4BEQA 1ODUA 2W61A 1C92A 2W62A 4OKDA 3F4WA 4P7RA 5TAOA 4LVDA 4ZO9A 2CWXA 2W0UA 4A35A 3V5FA 1ZZMA 1J0IA 2VGBA 1OX4B 3DG7A 3P6LA 1WDRA 2BY0A 4I5RA 4JL1A 3LRLA 2W92A 2YCLA 2PUZA 3RLVA 1YPIA 3WK0A 5FAJA 5AFDA 3W2LA 3HTWA 5CG0A 2RDWA 4I9TA 1UJPA 2DZPA 2HWGA 4IMAA 1EIXA 3DH7A 1G7UA 4LB3A 4ECLA 1K02A 4GY7A 1QNOA 3CTLA 2FVKA 2PZNA 5HJXA 4AISA 4HPHA 5H8UA 1W5QA 1HKMA 3R79A 3VUPA 4OU1A 1P0DA 5EMMA 1FVPA 3WDPP 4K39A 4XBSA 4R33A 1CX9A 3OIXA 4P7NA 5I3KA 1H5YA 3F4DA 3NAVA 3TYBA 5AY7A 3U5YA 1A0EA 1FWGC 1R30A 2GOKA 4AIBA 3CLMA 3L65A 1DKWA 1BRLB 1E15A 2BXYA 3MO7A 2FPYA 3F4CA 4LC8A 4EIVA 4AB4A 4PUMA 3VIPA 4DJFC 5CBIA 2J62A 4FSAA 1DJHA 3P8IA 4Q4RA 4JIEA 4QR6A 3ZSSA 2WNQA 1TPC1 2NX3A 3IACA 5AECA 3L21A 4MWAB 2H3BA 3GDBA 4K8EA 1SZEA 4WOZA 1M7XA 3E2SA 1L6FA 4WQ6A 4QLLA 5AHMA 1T41A 4BQ4A 1W37A 3LU2A 1KR1A 4CCDA 7XIMA 2Y70A 4AZ6A 4YTRA 1V02E 3WLNA 2VOTA 4N9DA 2P88A 4R88A 1X1OA 1AQ0A 4PFMA 1LQ0A 2BZNA 2Y8UA 4ZSUA 3CUIA 3WSUA 4YHEA 3LZ5A 3LPGA 2EF9A 4YXGA 4BI7A 3TVAA 4LCQA 5IBXA 3CUGA 4AWUA 1OY0A 4XV0A 3ITYA 4A21A 4Q4SA 1PXGA 4L5ZA 4MZ8A 2YYTA 3ISIX 3WLLA 3K4AA 4JTUA 5REQA 3ANUA 2C18A 4HYVA 1I2RA 1QHPA 4IP5A 5CZ0A 1MXGA 5A2AA 1FWJC 4MWAA 3RM4A 1AD1A 4DYEA 1KM4A 1F8MA 1XYCA 2VENA 3LV6A 3O8AA 4H9VA 4HN8A 4QG8A 2V2HA 3VDGA 4B90A 4H8NA 4IMFA 4AIUA 3BLPX 1ZAJA 3W72A 5CSUA 1XLDA 2QT3A 3IK2A 2CLKA 3I4EA 5C9RA 3M6DA 3SCSA 2CFFA 1G4EA 1JCXA 3NXFA 5K7JA 3SBFA 1VFUA 4R7JA 4OOUA 3P82A 4UB9A 3PG8A 3WJYA 3OZYA 4AD0A 5HMFA 1XIEA 1GPFA 2PF8A 4JX5A 1B0IA 3E6EA 1KBKA 1V7YA 5BOFA 2BVWA 3U6WA 2WSQA 4F40A 4YVVA 4C6OA 3E0LA 1M03A 3RPMA 3B0YA 1HVQA 5C2XA 3VC6A 2GVJA 3TONA 1OG0A 4N4PA 2VUNA 1Q6LA 2PDCA 3LTSA 4M81A 5JH2A 3WUGA 2J79A 3LXCA 2XVNA 2DIKA 1AODA 3EAUA 1ZAHA 4DZIA 3OZPA 1QNRA 3CAVA 1RCOB 4UTKA 4DBDA 1K9EA 1AL8A 3E0IA 3SY5A 3D3AA 5A6MA 3JRKA 4UWMA 1B3OA 4AYGA 3DFQA 2DW7A 1IEWA 3R7MA 4BQ2A 3LHZA 2AOSA 2J24A 3AHYA 4TVCA 2R1NA 1D7KA 3F4VA 3FSUA 3GRIA 3KTCA 1UC4A 4OQVA 2YL5A 3VTRA 3ZVHA 3LG3A 4YIWA 3IJQA 3WBWA 1X38A 4PRTA 1SZFA 1UG6A 2FHCA 3WQ5A 3HIJA 2IXVA 1R8LA 3K4WA 2YDSA 3N2MA 3UT0A 3H22A 3ZLHA 1UC5A 3IGHX 5K4XA 1DWAM 2XYLA 5HJYA 1PV8A 3B4YA 1GEQA 3N4AA 1KCKA 1FXPA 3BXWA 4K6AA 1E6SM 2BASA 3M0MA 1JPKA 4ZBCA 2GQAA 1GGOA 2WMHA 4WJ8A 3S2JA 4G9PA 3KBSA 2JKEA 1PCWA 1HX0A 5HPOA 1W2VA 1OYCA 1RLCL 5GNXA 3UJRA 3PTKA 2PGRA 3ERPA 3VOCA 1S1RA 3VOFA 3KL3A 1J96A 1QMLA 1QNPA 3L67A 5A1AA 3GAYA 1BSIA 2CBIA 3C2FA 3T2PA 1DWFM 3LSBA 3GD6A 4C7GA 3L5AA 3KVJA 4PUDA 3ZSTA 3EX2A 3NR0A 3SCRA 3DBPA 3UWEA 4D6FA 1UMYA 2TYSA 5F1UA 1E1FA 3L0GA 4JX4A 3EXRA 3NM1A 5AHIA 1J12A 2WM0A 4M5PA 2WC7A 3AJXA 1PE1A 4WSKA 2PDQA 4PRWA 5A95A 4F66A 1GVIA 3NFUA 4C60A 1HVXA 3L7RA 1R3VA 3VKKA 3CNYA 1PZ3A 3BW4A 3KEHA 3UWYA 2R91A 4EWND 3S1UA 4KCWA 1O7AA 1SR0A 2XVLA 2XDFA 4C6IA 1LCOA 4ROQA 3MDWA 3PZVA 4WVXA 2ZCGA 5TQLA 1KRAC 5ABHA 2C0AA 4QJ5B 1B3WA 2WSYA 4IPJA 1LRTA 3WQEA 1OX4A 4RXGA 3WLQA 1JF5A 4EP8C 1WUEA 5GVJA 3TTSA 3CHVA 1UWSA 5E1QA 4FZIA 2PLKA 1X6LA 4PMRA 2OLSA 2EQDA 1KM6A 1J2BA 1IGWA 2C19A 5I6SA 5E9XA 3DBNA 1WQ5A 2BXZA 4JXCA 1VPXA 2GVYA 2ZICA 1OM0A 2E25A 1XIBA 1B4EA 2VFFA 1D2KA 1NY1A 1J18A 4YNGA 3OO2A 2D0HA 3LI1A 1RBOB 5A3HA 1EOMA 2VZSA 3R0DA 4DYJA 3KTSA 4XZMX 4GABA 3R0UA 2BFGA 4V27A 1RPKA 2CHOA 3MVTA 1JZ6A 1JDEA 1VJSA 2D23A 3LQGA 7ENLA 1DJZA 4JFVA 3WUFA 1KM2A 3VD9A 4Y9MA 2NXIA 2HISA 3HA1A 3WLHA 2G0WA 4J5NA 1G9HA 5DMYA 4QQ3A 4RDYA 2ONEA 4HYWA 2XIIA 2YGYA 2R1LA 1U22A 4LYKA 1PKMA 3F7JA 1H1YA 1DXEA 2E6DA 3KVLA 4LUSA 3BJTA 2FMNA 3RUBL 2V5BA 5JMUA 1XH1A 3I3EA 1F4AA 1YTKA 3DFOA 1M9HA 5C70A 2HBVA 1VR6A 1BYAA 5D2WA 3SGGA 3SURA 2ZUNA 3R11A 2E0PA 3DGRA 1DP0A 2DT3A 4GOAA 2XU2A 3N3TA 5I09A 4IQJA 1QHZA 2VDHA 1XBVA 2ZXDA 2WMGA 3T42A 3T1GA 1EDGA 2CHNA 1XCXA 5DEZA 1XM3A 4AZ5A 2J25A 1XI3A 4PMXA 1TB3A 4KQNA 3T7VA 3FDGA 3EMCA 1Z42A 3GO2A 5FEXA 1FCBA 4BKNA 4AWSA 3R5EA 1G69A 4UTMA 3VDBA 1GJWA 4KCVA 1PJ9A 2E7FA 4YN5A 1EYWA 1JCMP 2TRSA 3ZR4A 3SB0A 1E9IA 4IL0A 3WNOA 1BVZA 3QR0A 1KBBA 2E68A 4ZO7A 2B81A 1RZMA 4FO4A 4P7LA 1M68A 4R85A 3SEPA 2R1PA 1D3GA 2WW5A 1SJBA 4WKAA 1EGMA 5HQLA 1QI0A 3OBKA 2R82A 5K9CA 3HURA 4JTIA 1UP0A 3UERA 2NT1A 1GYNA 3QV9A 1DQXA 5T91A 2F7FA 2JGQA 4PTVA 5H8PA 2RFGA 2VEFA 1JCTA 1ZRQA 9XIMA 2PGWA 4GRSA 2C14A 2VX4A 2V3FA 3TMLA 5DRIA 2QCMA 3TQ0A 4OIFA 4NF7A 4KWWA 2YR1A 3NQMA 4GMEA 3TKFA 5TNVA 2QUNA 2V63A 2PWFA 2OU4A 2FMOA 2Y0FA 3N6JA 4LALA 1R3YA 3RMEA 1XRFA 3B04A 3EA2A 4J3ZA 3GNXA 2QXWA 3CL8A 4KWVA 4YJ5A 3AIQA 3BVJA 1ZJIA 5EBUA 1X7IA 4Q3MA 3OIHA 1UR3M 1XV8A 2H9AB 3QC0A 3A24A 1V3LA 1FDJA 3OPSA 4TOQA 4I8DA 4L1GA 1TPEA 2DPEA 4H9TA 2ACSA 3W7DA 2DUZA 5FESA 2VEIA 3N6QA 1X1NA 1BQGA 1V79A 4JN6A 4UQCA 1QPNA 3CT2A 1X6UA 4PEKA 3QC3A 3T40A 2VWSA 1SPQA 1VFSA 5FEWA 2CKRA 1CYGA 2XISA 1YQ2A 2VCAA 4GYKA 2AAAA 3N04A 3W7EA 1GZ1A 1E0VA 1OYBA 1P6BA 2AKMA 3GU9A 3BAJA 4IPIA 5D33A 1KR0A 2YXXA 3VIMA 4GNKB 1ICPA 3EWCA 1QR7A 3NDOA 4FS9A 4HJFA 1DQUA 2RUSA 1TX2A 3LENA 2VO5A 3G3DA 1JRCA 4PCNA 3W27A 4WZHA 2Z25A 3R10A 2A3HA 1WE5A 3TZNA 2OO0A 1UP2A 2QS8A 1GCYA 4JQAA 3C6CA 3TX9A 2YX0A 1PYMA 5JVLA 1BLIA 4PFHA 1B31A 4REQA 2A79A 3CMGA 4MY8A 2PGFA 1B4KA 2PDWA 3EXTA 2PFHA 3U4AA 1LZOA 2C0HA 4ZQRA 2PDLA 5K9DA 2BHUA 3N2CA 2YIHA 1OX6A 4IJBA 4OUIA 5LHFA 3TXZA 4LY4A 3CHCA 3G1VA 4LH8A 4ZOBA 5G2WA 3EOOA 3W76A 4G7EB 2UBPC 3LNMA 1OWQA 4A6GA 4YCOA 1XF0A 3TWBA 4WUIA 4P8WA 2OWWA 1C8VA 3ABRA 3GTIA 1T6MA 1SFLA 2JIEA 4K1GA 1F74A 2XIJA 3RRAA 3M0XA 5CGMA 4EPKA 1Q65A 1BKHA 1UKQA 5JU6A 2XFWA 1OT1A 3LA4A 4MUZA 3A22A 4BZYA 1ME9A 1FHUA 3CBWA 2I5GA 4HU4A 5HUPA 4NZ3A 3B4UA 3OVQA 2EKGA 3KBNA 1CDGA 3SCQA 5L6UA 2HNHA 3NQ8A 4U3AA 3NWRA 1E6QM 3WD2A 4NU7A 2BBFA 3XISA 4O52A 3V7PA 5EU9A 1GVOA 4HTBA 3GU1A 5LNWA 3H12A 7PTDA 3HPXA 5FEZA 1AK5A 1MQRA 3KOZA 1MRQA 3VIOA 2QCDA 4FEZA 4MWAD 3OGSA 3RCNA 4IZGA 2PZ0A 2WOQA 2OCZA 2XUCA 3TC6A 3I7QA 3PJWA 2WNZA 1S2WA 2O7QA 4GI8A 4X9YA 4EVZA 1J6PA 1FWAC 3W7CA 3HGSA 1KBLA 1MW0A 3MV01 2BVTA 6PTDA 3P74A 3WIJA 4DZ5A 3BWWA 5FA5A 2PD9A 3IJ7A 3BH4A 5TBOA 3B40A 2GWGA 3CT7A 3BV7A 4GLEA 1GYLA 4KMQA 3WEMA 5FF4A 4R27A 3Q37A 3VDCA 1P1MA 3EDFA 2XG9A 3IANA 3BLKA 3GC4A 4DBSA 1QBAA 2OG9A 3A6OA 4XO7A 2I7GA 5J5RA 2G3MA 5CBJA 3TFCA 3CHDA 3CZLA 2PB1A 4DAFA 1GOIA 2YPIA 5FACA 4GCXA 3F2CA 3WLPA 4ZXLA 3WDQA 3M0LA 3BICA 1YXDA 1JZ8A 4ZB0A 2QNEA 3MA8A 2TAAA 3FA4A 3AXKA 3TW9A 3BAYA 4GUJA 1UWQA 5HXMA 3PTMA 3ECQA 3ALFA 3OOQA 2DUXA 1G7VA 3RLUA 1E0XA 3M44A 3LHYA 2IMRA 5AC4A 2PWEA 5FL0A 4E5TA 3SCUA 3OGVA 5E0FA 3H2NA 2V5LA 2J7DA 5MHBA 4UFJA 1EJ7L 3TQKA 3KCJA 3I3BA 1VHCA 4C6BA 3V5CA 1XYZA 4RE3A 2O9TA 4DJFA 4MZYA 3E2QA 1OCNA 3G2GA 2DIEA 1QI2A 3RXZA 1O1HA 2ACRA 1FHVA 3QMSA 3TLLA 3OHMB 3C2VA 3S6TA 2QZRA 3W1NA 4Z2KA 4GFSA 3JU2A 3GG1A 2GJLA 3LYEA 3WLSA 1U5JA 4L9ZA 3BLOA 5A8MA 1WNOA 3IARA 1XLMA 4RPPA 2ZWYA 5D9PA 5KZMA 3GNPA 1XUUA 4GNVA 1FWCC 2ZRZA 4NXKA 1XSKA 3AIBA 4Q8UA 4GI6A 1HKJA 1VIZA 1WOAA 3EPMA 2X1RA 4IJRA 2JKAA 2VC5A 4PTWA 3DFHA 3FDKA 2WBGA 3G22A 5I24A 2Z7GA 3E5PA 3QOMA 4K8HA 1DIOA 1TSIA 2OODA 3F2BA 3BMWA 1F05A 3W87A 3VD7A 3DG6A 3GVGA 1H50A 4GBUA 1EUAA 3N18A 3MSDA 3R43A 4AEOA 2X1UA 2W27A 4KIEA 2WHMA 2Z1SA 3RCYA 4D6GA 1PWMA 3LM3A 2GJRA 5FIPA 5AC5A 4DLFA 2ZUSA 2D22A 1E9LA 3VPLA 1EYEA 1W5NA 1PS9A 3A3HA 4GZJA 2QCGA 4KWUA 1E3ZA 1BPLB 5CJMA 5HULA 3A9BA 3BSGA 1SSDA 1V3IA 4EPBC 4NNAA 2BGNE 4Y9PA 3S6OA 4V28A 3PFMA 3GHRA 2BNJA 3O6DA 4NZFA 3LMZA 2DSKA 4GUHA 5CC3A 4JICA 1NELA 3LBCA 1FDYA 2QEZA 3TW7A 5HMEA 4HK6A 4KW2A 3R2GA 3RFAA 3CPGA 2WKJA 3N17A 4ZCWA 1KFKA 1QWGA 2XSXA 2ZOXA 1OFAA 3AMCA 1Q13A 3N11A 3O7UA 5BWFA 1IYXA 5BRPA 4HQVA 2PDGA 1A5MC 3AMDA 1NDZA 4M6VA 1WV2A 3WL0A 4IPNB 4XD3A 5IM51 1GYMA 1CECA 1ITQA 1SUXA 2IKIA 3BO9A 4PMVA 2YCKX 1XRTA 5DT5A 3EX4A 4S1FA 5LNVA 2OKOA 4L56A 1Q6QA 1CWYA 2DW6A 2XFFA 1WKFA 1OVDA 2ZXQA 4W4QA 2Y5SA 2BDQA 2HSAA 4AVOA 3R1ZA 1DE6A 3WJXA 1AJZA 3CGTA 4HMCA 2DJXA 4AYSA 3QY8A 2Q09A 1VPQA 4AY1A 1NFGA 1YDVA 1ZP3A 3OVGA 4A2SA 4IIGA 4BQ3A 2J9XA 1YXYA 4YPJA 3WFZA 2YZRA 3WQVA 1JFXA 3KL0A 7CGTA 1YMYA 3V18A 1BQCA 5T9BG 3CL7A 3MHGA 3IVUA 1KRBC 4DPQA 3IEBA 3Q58A 1M04A 4C5YA 4YTQA 3MJYA 3AAMA 4Q4OA 1MFUA 1WKDA 3GS6A 4LXFA 3QGAC 3V35A 1YYAA 5G5IA 1LQ2A 1Q85A 1B57A 1OYAA 4DUWA 3IGSA 1CTNA 1U5HA 3TCSA 1A49A 1F3TA 3DIPA 1X7FA 2ZX6A 5HWJA 3W74A 3C5QA 1BEUA 3DKJA 1L2UA 4NZJA 4AMCA 3AIWA 1L6YA 3ZT6A 2XHYA 2D3NA 2YCJA 4UQAA 4HA0A 3DC8A 3U57A 4IISA 2VD8A 1FCQA 4IIDA 1H3GA 3TR9A 2W67A 4WDTA 4GQRA 1POKA 3CWHA 2BODX 2A21A 3CQKA 2Y8VA 4KT2A 1J0KA 1PTAA 4MWAE 4UTUA 3QH2A 3S2MA 1RCQA 3BARA 3B9EA 4ZOEA 2ALRA 3W53A 3PZOA 1JQXA 7REQA 4LY8A 3QPZA 2Y8KA 2E1DA 3H53A 4NQ1A 3GSMA 3PY2A 1NWTA 2QQ6A 3O15A