3IEBA

Crystal structure of 3-keto-l-gulonate-6-phosphate decarboxylase from vibrio cholerae o1 biovar el tor str. n16961
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
213
structure length
213
Chain Sequence
TKPMIQIALDQTNLTDAVAVASNVASYVDVIEVGTILAFAEGMKAVSTLRHNHPNHILVCDMKTTDGGAILSRMAFEAGADWITVSAAAHIATIAACKKVADELNGEIQIEIYGNWTMQDAKAWVDLGITQAIYHRSRDAELAGIGWTTDDLDKMRQLSALGIELSITGGIVPEDIYLFEGIKTKTFIAGRALAGAEGQQTAAALREQIDRFW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of 3-keto-L-gulonate-6-phosphate decarboxylase from Vibrio cholerae O1 biovar El Tor str. N16961
rcsb
source organism Vibrio cholerae
molecule tags Biosynthetic protein
molecule keywords Hexulose-6-phosphate synthase SgbH
total genus 73
structure length 213
sequence length 213
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3iebA00
4PC8A 4MPQA 1G4EA 1OYCA 1TRDA 5J5DA 3P5YA 1JRCA 2FPYA 1TV8A 3W7GA 2ZRVA 4OV4A 3BVJA 4DF0A 2A6LA 3GB6A 5K9CA 2WNQA 2RH9A 1A5BA 1LP6A 1VS1A 3G0SA 2GPTA 2OT1A 1S5TA 2BTMA 1F6PA 4K7YA 4O10A 4K38A 4E0CA 3HOJA 3P8IA 3NQVA 4O57A 2VC6A 3N3MA 4H4IA 4K8HA 4JIPA 2CLLA 3DU0A 5D33A 3PG9A 2EKCA 3LHZA 3VFLA 3GAYA 3IIPA 1PHWA 3W9ZA 4N2YA 4IXHA 1H60A 4O28A 5DXXA 1PIIA 4AHOA 1JCXA 1GVQA 1QAPA 3FIGA 3L0NA 4O19A 1N8FA 1OG0A 1OYBA 2XN1A 4FNSA 2V5LA 3FYPA 2OMAA 4XWUA 5AYYA 4O52A 2XN0A 3PBUA 1O5XA 4ORMA 3DH7A 2Q8ZA 4BI6A 3L9CA 1Q6RA 4PFMA 3RLUA 4BFAA 2Y89A 5K3VA 3LCIA 3W85A 3EKZA 4EF9A 1Q6OA 4ONVA 1OYAA 4ZL1A 1QOQA 1H1YA 1YDNA 2ZA1A 2A7NA 4UTIA 4IX2A 3W88A 1LZOA 4D2JA 3MI3A 2HSAA 4Z0JA 2CLMA 2D73A 4WX2A 4GRSA 3OIXA 1KBIA 1XI3A 4YWIA 2H6RA 4AWSA 1K8XA 1YPFA 5A5WA 3O15A 5KTLA 2JKAA 1N55A 5LGZA 1GVOA 1SFLA 4AXKA 4OV9A 4TMCA 1M5WA 1SUXA 3MHFA 3P61A 2ABBA 4CQ8A 5C55A 1XXXA 2Y6ZA 3L0KA 3CTLA 3QYQA 1JUBA 2QCHA 5EA9A 3NZRA 5TBOA 5BNKA 3FOKA 4OQVA 4MLJA 5IBXA 3IIVA 1AL8A 4OU1A 3CM4A 2NLIA 1OX6A 1TPH1 2E5CA 4UTUA 4RV8A 3E02A 4AVFA 3W7EA 3FKRA 3TW6A 1I2PA 3O06A 3V1PA 1S3HA 4BF9A 1TIMA 3HG4A 4Z1CA 4A29A 3BLEA 3MHGA 4XKYB 3C52A 4AB4A 3TDFA 1KM2A 3M1ZA 1TO3A 4FXRA 2CFFA 3LCLA 3OVQA 1Y0EA 3W7NA 3VKJA 1SZNA 1JVNA 1PS9A 3N34A 1TPFA 4ZZ9A 1WBJA 3FA5A 3TE9A 2OZ0A 1YTKA 2X1TA 2W6RA 4M19A 3BGJA 1XUZA 2ZRUA 3G1XA 1Z44A 3SGZA 4HPXA 4GUJA 4RZ4A 4DO6A 1M7PA 3UWQA 1JR1A 3PUOA 2KZHA 1PVNA 2FPVA 3CC1A 4BWLA 1PHQA 2Y63A 4RZ5A 3V75A 1FXQA 4DF2A 4JTJA 4O1DA 3DFNA 3GR7A 4UIOA 5KSWA 1H7PA 4W9TA 3C2FA 3QF0A 3SI9A 3IGSA 2PRMA 4MIMA 5MHBA 1QPRA 5CPMA 4P61A 1IXPA 5D38A 3QPZA 1OFRA 3UYCA 2CW6A 4QAIA 2B7OA 3TK7A 3A9IA 5LNRA 4NT0A 1KFCA 4AWTA 3LCHA 1R2RA 3MBDA 4NXKA 3S5ZA 5TIMA 3MO7A 4JICA 4JTHA 5A8GA 4DQWA 3G1FA 3E9AA 1D3HA 3S6DA 3LI0A 2V2HA 2YX0A 3QH2A 5DCDA 1Q45A 1QNVA 2NWSA 3TC6A 1R2SA 2TYSA 4ADTA 1GOXA 3L21A 3GIYA 1J4EA 3GVGA 1KFEA 4JTIA 1DVJA 3A5FA 1EB3A 5DBUA 4IXXA 1H63A 1TYGA 2C18A 2X2GA 3A23A 4LY8A 3PF3A 3LRLA 3NGJA 1RQHA 2E5BA 4LTSA 2V82A 4C1LA 4O11A 1LLZA 3QC3A 5BMWA 4HPJA 1U5JA 3PBWA 4WY0A 3LDVA 3NOEA 2F7FA 3C0JA 1PL9A 1I2NA 3NAVA 2RHGA 1EWEA 3P60A 1LRQA 2Z6JA 3LCXA 2FLIA 3QRHA 1LRTA 1MXSA 3TNOA 4L4LA 4LVGA 4O1CA 1W5MA 1AW2A 4LU0A 4NJHA 2DZPA 5AHIA 1VCGA 1ZHAA 1AMKA 3TXZA 2RFGA 1JCLA 3N9SA 4MOZA 1R2TA 2J24A 2NX9A 1OFEA 4AAJA 4XUGA 4POCA 3L66A 4GWEA 3TKFA 1WA3A 1NAL1 1FWSA 1W5OA 4NXSA 3GNDA 3W07A 4LVBA 1HTIA 3NPXA 2A7RA 2DORA 2G96A 1QR7A 2GUUA 3KVJA 1TPC1 3PB2A 3QW3A 2V81A 2I9EA 3DKJA 3W83A 3SSJA 2ZZ3A 3VI2A 3G1AA 4FNUA 1SPQA 4FXSA 5F1UA 2VFIA 3EX1A 3ATYA 3W22A 1MEIA 4CCEA 4UXDA 3T40A 4MUZA 4O17A 4QJ1A 2ZZ2A 1W54A 4NJKA 2HS8A 5F2MA 4JTTA 1TPB1 5EMUA 3NL3A 4RCXA 3FFSA 3W86A 4O1BA 4UTMA 3A21A 3GDLA 2QCCA 5DLCA 4IJBA 3WK2A 4LWWA 3K30A 3KHJA 1IIHA 1EP1A 2E09A 4OGZA 3P81A 3G1VA 4Q33A 3S8HA 3O05A 3W74A 1KFLA 2FFCA 4MY8A 5K9DA 1SW0A 1NEYA 3PWAA 4GJ1A 5I3IA 2C16A 2YR1A 4IMGA 4MYXA 3TIMA 5LNSA 2AGKA 2VFDA 4J9JA 2DJLA 2QCFA 1EEPA 2ZTKA 5C6MA 3MYOA 1V7YA 1TCDA 1O94A 1H7NA 3PVFA 5D05A 1MEWA 3W7HA 3DFPA 1K3UA 5FEZA 4WY0F 3RLVA 2FPTA 5F1VA 1JCJA 4DF1A 3E0IA 3DAQA 3ZWTA 4JTKA 1QPOA 3C3NA 3TQVA 5EL1A 5EBUA 3LCGA 3G1SA 3LCFA 4U4MA 3W1NA 1LM1A 3LXCA 2ZZ6A 3SZ8A 1GVSA 1UBSA 3AO0A 1W37A 3G0XA 3M5VA 4JDBA 1K8ZA 3TJXA 1PV8A 3GX9A 1G67A 2VEIA 1G4PA 1VCVA 2W79A 3T55A 3UQNA 1L9WA 1VLWA 5L6UA 3FYOA 4OE7A 5G2IA 3E96A 2QEZA 3MBFA 2A6NA 4LV4A 3W7CA 4UMBA 2A4AA 4O53A 4JY8A 1V5XA 1DBTA 3MP3A 2R94A 4O1AA 3M44A 5F4WA 2DP3A 3LHVA 2BX7A 3I6RA 3LHUA 5G4WA 4IOTA 3BG5A 4NJJA 1ZNNA 1SO5A 3ZFHA 1NSJA 4N6FA 2DU2A 3TX9A 1XCFA 1KTCA 3R12A 2H90A 1TTIA 1W3TA 1JCYA 2YFNA 2P10A 3HGJA 3M6YA 3VCRA 3ABQA 2ZRZA 4CQ9A 3W1AA 3PY2A 2ZBTA 4NX0A 3FJLA 3EX6A 3QJAA 2GVGA 4JX5A 3NL5A 1DJNA 1ZALA 3H54A 3VNDA 4X2RA 2EHHA 3BW4A 3DFOA 1OFPA 3CU2A 3L68A 2WSQA 2CLEA 3OVPA 2ZRXA 1ML1A 3W73A 2R8WA 4O15A 2QCGA 1FWWA 2WSRA 2Y85A 3PUEA 1VYSX 3P67A 1ZAIA 3LRMA 4RXGA 4YCOA 1YDOA 4WOQA 3B05A 1M6JA 4L4MA 3FLUA 3PULA 2YGYA 3ZS4A 1K7XA 3L5MA 3O07A 3PAJA 2YYTA 4UFKA 2NXGA 1TPEA 5BRBA 5AHFA 4QM1A 1X6UA 1TQXA 2WQPA 3B8DA 3O6CA 3P82A 3BARA 1ZAJA 1XDLA 1B3OA 1L6WA 4UFIA 5GVJA 3QSTA 4NZFA 3GDMA 3DZ1A 3VE9A 3CIXA 2A2IA 3IIXA 5DN1A 4MKNA 1T8XA 1YXCA 4FX7A 3W2KA 2Y7GA 3M43A 3W75A 2QJHA 1K7FA 2Y7DA 1KLYA 1DQXA 2V0TA 5F4XA 3UWWA 1RQBA 3G24A 5ABTA 3C2RA 3T44A 1ONRA 3PSWA 4OHQA 1Q6QA 3I68A 5D09A 1JCNA 4YL2A 1FCVA 2XN2A 5G1YA 1X7FA 1BTMA 3DHFA 1ICQA 3E12A 3F4WA 4M7TA 4JN6A 1B4KA 1VR6A 4WY0B 1OF8A 3NO5A 2GQAA 2QCNA 3ABRA 1K03A 3KRSA 3QQ0A 2E6DA 1G7UA 5HNRA 3NR0A 4LNYA 1GTEA 4YLWA 5DELA 1CW2A 1IF2A 3QZEA 3IV3A 4KFOA 4N02A 6TIMA 1YTDA 3FKKA 2QCDA 1H1ZA 4Y9AA 2ZZ5A 4LT9A 1M7OA 5CZTA 1IXQA 3Q2DA 1D9EA 3RK8A 3OBKA 3MYPA 1XC4A 1G6CA 4UUIA 3EXSA 1YADA 3PUDA 3HIJA 2JBMA 1H50A 3CIWA 3SY5A 1RD5A 1KV5A 3NQDA 2GOUA 5BOOA 1W5PA 1X8FA 2WOQA 1VYPX 1XBYA 3B0PA 4JS3A 5FEPA 4EWND 1O60A 5CKSA 3HMJG 4PL1A 3W87A 3LBCA 3Q58A 3DENA 3TMLA 1EUAA 4O50A 3UWUA 4LC6A 5IM51 3NQ8A 3OEXA 3HJZA 5C54A 3W7IA 3CLMA 3Q94A 1TJPA 3MI6A 1TV7A 3I7RA 5F2IA 1HG3A 3W7JA 2VEMA 4UTWA 4TX9A 3L5LA 2E6AA 3NPWA 1GVFA 1K7EA 3LGEA 1SSGA 3FEMA 3JS3A 3IRDA 3UNDA 1VQTA 2Z1BA 2Y7EA 1H7RA 3NQEA 2WKJA 5K9XA 2YCEA 4FEZA 1OABA 4GUHA 1SU5A 5D30A 4A2SA 5AC8A 4TU1A 4UMCA 4A2RA 1T0OA 2Y70A 4Y8FA 5SWUA 2UV8G 4MJMA 5D04C 4S1FA 2NZLA 1WX0A 4E2BA 1TQJA 1JJKA 3Q37A 4GUGA 2WV8A 5FESA 4JEQA 4JTUA 1FUYA 1OFDA 3C61A 4O0ZA 1YPIA 5DCBA 1DV7A 3U8GA 3NZ1A 4ML9A 4O13A 5D2YA 1H51A 5LHEA 1E51A 4ICNA 3NQAA 3PM6A 3IVSA 1TPDA 2FTPA 3GKFA 4HNVA 1K02A 5G2HA 1W31A 1YDVA 2V30A 1GQNA 2YXGA 3N14A 3NQ6A 4QITA 3C2VA 3DI0A 2Z0IA 3O16A 4ALDA 1GTHA 4CNNA 4LS2A 5CG7A 4QQ3A 4UR8A 1KA9F 1KM1A 2X16A 3NQGA 2GJLA 3P80A 1L6SA 3R89A 4WZHA 1ZAHA 4XQ6A 4RXFA 1GJPA 3RMJA 4DPQA 3TMQA 3BG9A 2I14A 1UJPA 5CGQA 2QKFA 2GVLA 1SW7A 2V8ZA 1N7KA 1TV5A 3HG5A 3DFTA 3G1DA 3L0GA 1KM5A 1ZENA 3DFSA 3KOFA 4BWLC 1BKSA 1O95A 3L5AA 5AHLA 3S5YA 1UB3A 5KMYA 3M0ZA 3BG3A 1GVRA 3W72A 3ZWSA 1DHPA 1OVDA 1I45A 1QPNA 1FWNA 4X22A 4DELA 3HQ1A 1LLWA 2Q8LA 1I4NA 3WK0A 4U28A 1FBAA 1EX5A 3P7YA 3SGUA 5KZEA 3GDRA 4B5NA 1XM3A 2VELA 1T96A 2LLEA 4NZJA 2TSYA 3U6WA 4IMCA 3NL6A 3T7VA 1OFAA 1GT8A 3M41A 2HS6A 4ZQOA 4ADUA 1GWJA 2CLIA 3HG3A 4AWUA 1OX4B 3QMSA 2YPIA 5HMSA 5CSSA 4AEOA 1YLVA 1G4TA 3G8RA 4XKYA 4UC5A 2J9ZA 1CI1A 1Z42A 4DEFA 5D2WA 1SO3A 3EB2A 4IMEA 4UFJA 2J88A 5AYXA 1F6KA 1FDJA 1NF7A 3EX4A 4FNQA 2FQIA 4MZ1A 1XKYA 4LVFA 3W71A 3C2OA 1I8JA 4N9BA 5FEWA 4QIUA 3FJ6A 1KFJA 2ATMA 2J27A 1LTDA 4LS1A 1Z41A 2FJKA 3UXAA 1UCWA 2HTMA 4O16A 3O1NA 4O0KA 4JYDA 4ZQMA 3W7RA 4I7WA 1WQ5A 1H62A 1QWGA 4ORIA 4TMBA 5E1QA 3UD6A 2NX1A 5D2XA 2VOMA 2C1HA 2R91A 2IQTA 2OX1A 4MZ8A 3UWVA 2A85A 1LYXA 2VXNA 2DZWA 1BWKA 3YPIA 3S9YA 5F4SA 1LRNA 4CNPA 3W2LA 3WK3A 1G7VA 4N4PA 4A3UA 3DXIA 3HO8A 2CZEA 4JNMA 5HR6A 1I2OA 1YYAA 5AHMA 4WXZA 3IVUA 5LKYA 3STCA 1TMHA 2JK2A 4H3DA 5HINA 4PTNA 3S0CA 4ZMGA 4JY9A 3W7OA 2J6XA 4GUFA 1FDZA 4Z1DA 3S1UA 3STFA 3GNNA 3C6CA 3W6YA 5I3JA 4DO4A 2H3BA 5D32A 1VC4A 4S2CA 1DL3A 4RLIA 2A5HA 3TC7A 4R34A 4RR4A 4DO5A 1R46A 2B7PA 1W5NA 3PS7A 3D0CA 4UTTA 3W7PA 4UTHA 5I3HA 2VFFA 3PSVA 1X1ZA 4NNBA 5EPDA 3QM3A 1VGAA 3G1YA 3ANYA 3R2GA 3H53A 1XDMA 3DFQA 1W0MA 1LBMA 2CLFA 3G1HA 4N9DA 2YDAA 4GC4A 5HUOA 3W23A 4O14A 2GQ8A 4LRSA 3W2NA 2NXHA 3LLDA 2EF9A 5F2LA 5D03A 4IUOA 1F2JA 1MEHA 1THFD 5FF3A 4MYAA 1DKWA 2ZQ0A 1TTQA 1LBFA 1W3IA 4IGHA 3TA6A 4JD4A 3W1RA 2CZ5A 2WO5A 3B4UA 3MW7A 3LERA 3DHDA 2QCMA 3A5VA 1OJXA 2NUWA 4DXVA 4E2DA 3LTYA 5DY2A 1LBLA 4XTDA 4K8EA 1EP3A 2ZFAA 3GLCA 3OHIA 2AAMA 4KKXA 2X1SA 4FIRA 3LTPA 3MUXA 2QAFA 2O7SA 3TFCA 1W5QA 1WBHA 4FF7A 2NV1A 3W1QA 1JQVA 2V9DA 3SIZA 3QSRA 5HWNA 3INPA 3LX9A 3BW3A 4Y6GA 3KVLA 2RKXA 4HT3A 3TAKA 1JQXA 2V5BA 5AOUA 1XUUA 2X1UA 2NWRA 3BW2A 1QPQA 2NXIA 1K8YA 1AW1A 1WXJA 4AH7A 7TIMA 1XFBA 4O8RA 3B03A 3EWZA 3W70A 1C29A 4UFHA 2ZZ4A 4HKPA 3LV6A 1KW1A 1HO1A 4WQ6A 4MY1A 3IEBA 3CEUA 2AQWA 4FIQA 3G3MA 2V2CA 4NUWA 1TPWA 3BGGA 4Y90A 3MP5A 1P0KA 4JTLA 3KVMA 1ME8A 2QCEA 4ZVJA 4CQAA 4OT7A 3P8JA 3HGRA 3CWOX 1XBVA 4IPJA 1YTEA 3MJYA 2BXVA 4OBTA 5IBXC 3EX3A 4IPIA 1L2UA 3L2IA 5HR7A 2E6YA 2YYUA 4YCPA 2NUYA 2Q3OA 3HPZA 2ZDRA 2H8ZA 3CB8A 4NNAA 1SFJA 1MZHA 1AL7A 2OCZA 4GUIA 5CZJA 4JXCA 1P4CA 2ZA2A 4CLMA 4AF0A 3LM7A 1ZFJA 3NEVA 2I1OA 1H7WA 4FNRA 3NNTA 5K4XA 3I65A 4WUIA 3BK0A 1WAUA 4QNWA 4XTIA 5AB3A 3KX6A 3WJZA 3W3OA 1JUKA 3W1MA 2J9XA 3LBMA 4NNCA 4EIVA 1S5WA 1EA0A 5HULA 4EVZA 4YMZA 5HJLA 1AK5A 3NQ7A 2C14A 2DZTA 2A1YA 2E6FA 3OA3A 4UFLA 4PH6A 3U2OA 1LOSA 3MP4A 1GG0A 3GXTA 4JIQA 3NQ2A 3GDTA 5U4NA 3EEGA 3TFXA 3TQ0A 1JCMP 4HHPA 4GBUA 2VKZG 2Y7FA 3UZJA 1QFEA 5CSRA 3UZ5A 1SO6A 3NA8A 4KFNA 1NFBA 1FCQA 3HPSA 3USBA 1DORA 3W7DA 1KBJA 1KFBA 2Z6IA 4GFSA 1H61A 1SR9A 3RF9A 4FX6M 5L9FA 3GDKA 1RPXA 5AFDA 2DJXA 4JX6A 3NG3A 4UTJA 3NPVA 2ISSA 5LHFA 4IMFA 4AHPA 1KM6A 5I3KA 3LXAA 3W1LA 1J5TA 3W7MA 1LROA 3CHVA 1VRDA 3H55A 5C5YA 1OF6A 4AMAA 2OT0A 3VE7A 4HSNA 8TIMA 5KINA 2B7NA 4ADSA 2WJZA 4X9SA 1CX9A 1TREA 1WDWA 3F4NA 1LCOA 2PRLA 3P74A 2QDGA 1KV8A 3QW4B 2E77A 1SSDA 3PB0A 3EWXA 2Y88A 5G2WA 2C13A 3HBLA 4Y96A 5K2ZA 4JTSA 1VJIA 2NUXA 3G3DA 2Z2UA 1FDYA 3CEPA 2QUVA 3JRKA 2RDUA 1VH7A 3MWAA 3QMTA 3HGOA 2C15A 1EP2A 3S1VA 2G5WA 1IGSA 3ABSA 5AN7A 4MJZA 4OWGA 1PCKA 1SQ7A 5FI8A 3GXNA 2CLOA 3TV8A 4LVAA 1PE1A 2E1DA 2PE4A 1JUEA 1QOPA 2E5DA 2QJIA 4KWWA 2A7PA 2CWNA 3IVTA 1JRBA 4LUJA 1I2QA 1B9BA 3B06A 3TAOA 1TPUA 3TCEA 2DZVA 3HF3A 4I7VA 5C2XA 1GYNA 3S5NA 1O4UA 4M6VA 3TQKA 4M6PA 3O6YX 4UFMA 3TH6A 2VFGA 4NJIA 1FQ0A 1IIGA 2CLKA 4EOUA 1F05A 3GYEA 4R33A 1HFBA 2ZA3A 4UNKA 4ZQRA 3NQCA 4HSOA 4HIBA 3EWUA 5FF7A 4O54A 2TRSA 4LOCA 1EUNA 1SZGA 3THAA 5HWJA 5HWMA 4AHQA 1BEUA 2Q3RA 4CCCA 3TUUA 3EWWA 4FO4A 4M7SA 3TJLA 2JGYA 3L65A 1C9DA 3NDOA 4IWWA 5J5RA 1WYIA 2X30A 1P0NA 1MO0A 2VFHA 2ZZ1A 3LHTA 3SFKA 1F5ZA 3HPXA 2FB2A 4WOZA 3LRKA 5I3GA 3BLIA 2YFOA 3R5EA 4PCFA 4NU7A 4JGDA 4QNEA 1S5VA 3TSBA 1TSIA 4Z0SA 1FCBA 3BLFA 3EWBX 3LLFA 3IGXA 3SECA 3UPWA 4LRTA 2C6QA 2YW4A 1EIXA 3M5ZA 3M5YA 3EXTA 1A5SA 4Z1BA 4LUIA 3CWNA 5G1TA 2QAPA 3S1XA 4DPPA 2NX3A 1VZWA 3E49A 2C0AA 1B4EA 1T99A 1TPVA 1VHCA 3LHYA 3NQMA 2Y61A 3HGSA 3QPYA 1NVMA 3NXFA 3M47A 4A22A 4JYFA 1OHLA 2QJGA 3A24A 1Z48A 3JR2A 3NVTA 5LNUA 3THQA 3IGUA 3W1PA 1I2RA 4YXGA 2V2DA 4A21A 4GXMA 3GR8A 4MVAA 3BV4A 1C8VA 3PG8A 5D2VA 3ABOA 2B4GA 3BPWA 4HN4A 3KRZA 3WK1A 1TRIA 2E68A 5DCEA 1UUOA 4S2BA 4MY9A 1O5KA 4K37A 4O4VA 3C2EA 3CT7A 3FS2A 3B0UX 1HL2A 1WOBA 1VHNA 2PC4A 1P1XA 3P84A 4E38A 1Q6LA 4LV9A 2C3ZA 1J2WA 2WPBA 3QFEA 3UY8A 3UY7A 4UNLA 1F73A 2FIQA 5D02A 1DOSA 1PCWA 1NF0A 3DI1A 1KTNA 5AHNA 1ZY9A 1OFBA 3M9YA 3WJXA 1JULA 2CZDA 1TTPA 5EY5A 2ABAA 5EYWA 3O8AA 3QMRA 3PR2A 4KFPA 3HB9A 3C56A 1UUMA 3NM1A 5LZLA 4QSHA 3T78A 4NX5A 5T26A 3EXRA 5FF2A 4M6QA 1KLZA 1SO4A 1ME7A 4K36A 2FDSA 4N9EA 4EF8A 4FX8A 4NVTA 3IIOA 1A5AA 1F74A 1FXPA 4Z08A 1YXDA 1W3NA 2WNZA 2G95A 2QCDB 3G0UA 2ATSA 3NL2A 3OVRA 1FWRA 3SW6A 1GYLA 1F7BA 4BR1A 2CU0A 4BK9A 3I7SA 3MHUA 2EPHA 4N6EA 2NV2A 4LW7A 4RX0A 4JTGA 2A21A 4RZ6A 4XBSA 2EGZA 3LXBA 5TQLA 1FWTA 1W8SA 4HNNA 2ZCGA 1P5BA 1KFKA 4KWVA 2CZFA 1KM3A 3S42A 3W1UA 3UPBA 2C19A 3M7WA 3NM3A 1ALDA 3HG2A 4N4QA 1KM0A 4JR5A 3TSDA 1QMLA 2YZRA 1VCFA 5BW6A 3NYZA 3KFTA 3R8RA 3WJWA 5LNWA 2DZXA 2PCQA 4XZ9A 3KXQA 3N9RA 3NPUA 4IMDA 4WXYA 5DY3A 1QO5A 5CPLA 3N2MA 4UTKA 2X1RA 4UMAA 2R14A 3QQ1A 1H7OA 1AW5A 4RK8A 4BI5A 1OK4A 4IQLA 2P1FA 3G22A 4TR9A 4RJEA 3O63A 5CZSA 1F76A 1ZJIA 2QDHA 1SZFA 4GNJA 1LDCA 5E0KA 3STEA 1L6YA 4I9AA 4Q4KA 3SR7A 3TR2A 3OG3A 3W2JA 4UTTC 5U7SA 3W7QA 1OX4A 2GJNA 2RDTA 5DXYA 1H7XA 3P62A 3LTSA 4HNTA 1ZCOA 2BSLA 3W7KA 2JKPA 4NQ1A 3W1XA 2ZRYA 3P5ZA 4X3ZA 1W56A 3N19B 2Y62A 3TXVA 4O4WA 4RKAA 2BZNA 1D3GA 3EKLA 5AC6A 4Z1AA 1ICPA 1LOLA 1IXOA 1YXYA 4O12A 1QCWA 5CPNA 2GQ9A 4JYEA 5HQEA 3RU6A 2H3DA 2W0UA 4UTWC 3L67A 4AF0B 1DQWA 1DJQA 1OFOA 2DZSA 3B04A 3G18A 1RVGA 3DKLA 5I3FA 3AJXA 2P0OA 1G4SA 3ATZA 4JDYA 2RDWA 3UWYA 2TMDA 4MLRA 2TPSA 3W1TA 2VFEA 3W7LA 2PRHA 4IX0A 3UWZA 4N9CA 4FB7A 5FEXA 5KZDA 2VEKA 3KRUA 1MSSA 5G4EA 1RQEA 1KTBA 3WFAA 3A22A 1WOAA 3KVKA 3WJSA 4MFDA 4C1KA 3LCWA 4HNUA 3TU9A 4G1KA 5LGXA 2BWGA 3TW7A 3DBPA 1RV8A 3F1QA 5CZ0A 5LNVA 1Q3NA 5D37A 5H2ZA 6ALDA 1LORA 2ZYFA 3QEZA 4QISA 2QR6A 3SJ3A 4LVDA 1OK6A 3GAKA 3MMTA 1XBZA 2ISVA 5D2TA 2ALDA 4R53A 1OFQA 3GZ3A 3LI1A 4ZQNA 3IIZA 1EPXA 1VYRA 4CCDA 3KAOA 5HUPA 4JX4A 1OX5A 1SZEA 3CPRA 3ELFA 2DZUA 1GPWA 3DGRA 2F84A 3R13A 1XL9A 2PURA 3TSMA 1W1ZA 1A5CA 1TJRA 5AC7A 4UR7A 4R7JA 4DBDA 3S1WA 2QUTA 3EX2A 4PODA 4WJEA 3GKAA 2BLEA 5CPOA 1QDSA 4XBKA 2OJPA 1KM4A 4UCGA 4ZQCA 4LS0A 2YW3A 1TTJA 2A0NA 2XFWA 5AHEA 3STGA 4MZYA 3PBYA 2B7QA 1EWDA 3GXPA 4P2VA 1RR2A 3LHWA 1TB3A 2VEPA 2ISWA 2O7QA 2WNNA 2ZRWA 3NQFA 2EAWA 1G69A 4FHAA 2QF7A 5K4ZA 1R30A 3GK0A 5F2GA 1A53A 4UTLA 3W84A 3M5XA 1H5YA 3I7QA 4ZQPA 3S5OA 4K39A 5LSMA 3LB0A 4PEKA 2B0MA 4K6AA 2YSWA 1ADOA 3W76A 3F03K 3MI2A 3UXDA 1A50A 3O6DA 4PA8A 3LOTA 1GG1A 2H8XA 3C4UA 4DBEA 2QUUA 2HMCA 3T4CA 3N73A 2GVJA 1WV2A 4M5PA 4Q32A 3W2UA 2J9YA 2JGQA 4FNPA 5E93A 2ZTJA 4TIMA 1GZGA 3PC0A 2QCLA 2VENA 1UASA 2FB3A 1RZMA 2JKEA 3ZR4A 5G5IA 4CNOA 1ICSA 3C8FA 3RFAA 3W2MA 3B0VC 4PL2A 2ZZ7A 1FY6A 5K7JA 1BWLA 4O18A 4GE8A 4FNTA 4LC8A 1R47A 1X1OA 1ME9A 3BO9A 4K7VA 4NJGA 1VLIA 1FX6A 1QO2A 5EKYA 5AYZA 1FCUA 1GEQA 3M16A 4BI7A 5KITA 3N2XA 2WSYA 3TROA 1U83A 4WD0A 5FF0A 3LV5A 3CQ0A 1HUVA 1XBXA 1VPXA 5FF4A 4MFEA 4JTFA 1B57A 4H6KA 5H91A 3WJYA 3EWYA 1AG1O 4TO8A 5DBTA 1SW3A 4JTEA 5KZMA 5BMXA 3RNDA 1LOQA 1IXNA 1HO4A 2CLHA 3G8EA 4I7UA 2G97A 3PBVA
chains in the Genus database with same CATH superfamily
4J3XA 4MPQA 1P7TB 3VABA 1G4EA 1OYCA 5J5DA 3P5YA 3W7GA 1W9PA 4DF0A 3GB6A 2RH9A 3LPGA 4B15A 1J93A 1U1HA 1P0BA 2GPTA 4E0CA 2G41A 1E9YB 1LG2A 3P8IA 3SCWA 1XYMA 3NQVA 4K8HA 1C3FA 2WW5A 3ITCA 3LHZA 3VFLA 4ATDA 1XPGA 3CQKA 3VK5A 3VNIA 2W66A 3P2VA 5C70A 1W32A 1J0YA 3TN4A 4F0RA 3AWOA 3M0VA 2BG5A 2FHCA 4QEEA 2VCCA 4PTMA 4HD5A 3G1RA 1PSCA 2EJ1A 4D8ZA 1F61A 3DOPA 1QW9A 3HURA 1K1DA 1RJPA 1KCZA 3FYPA 1FWGC 1EJSC 1MQPA 1HJVA 3NVDA 1Q6RA 3RLUA 3SQSA 2GVYA 4EF9A 3S1GA 1GVYA 2FTYA 2VC9A 2GLKA 1GONA 4PCSA 2XGBA 1EBHA 3O6AA 1UH3A 4IX2A 3N2OA 4GFIA 2CLMA 1FFQA 1K9EA 5FA5A 1A5OC 5H1WA 4P7NA 3KOZA 2GYIA 1JNEA 5A6BA 1YPFA 2FH6A 4OBSA 1XDJA 5HJXA 3CUGA 1SFLA 2PTZA 1I0DA 3EPOA 4TMCA 5EMKA 3L2MA 1M5WA 1PX8A 4AY7A 2Y5JA 3W27A 1TIWA 1SUXA 3V3WA 1UJQA 1R7AA 2MNRA 1XXXA 3L0KA 3W38A 1RAKA 1XR2A 1E56A 3LPPA 3UYIA 1XLKA 4Q6JA 2V3EA 5TBOA 4H6RA 5BNKA 3FOKA 2BHZA 4D6JA 4HMNA 3S2CA 4KWSA 2OFJA 5CGMA 4W8BA 2O9TA 1JZ4A 2F6KA 4LY4A 3NO3A 3L23A 1VD6A 4XIAA 3MHGA 1IWAA 3C52A 3TJIA 5BXTA 1TO3A 3BJFA 4ATWA 3LCLA 3OVQA 3UG5A 3VKJA 5AZ1A 3N15A 1JVNA 3ZZ1A 2Z29A 1M03A 1PS9A 4LB3A 3OGRA 4HYVA 2YOCA 4AD5A 3DERA 2W3ZA 4JAWA 3I6EA 3QLLA 2OZ0A 4AIOA 2BMBA 1S5NA 1XUZA 2WBKA 4ZOBA 5HPCA 3RM8A 3QPEA 2FTWA 1A0DA 1M7PA 3UWQA 3RN6A 1JYNA 1PVNA 4BWLA 4I8DA 3V75A 4I5XA 4JTJA 4DF2A 1LF1A 1KCXA 4IFOA 4AD4A 1LQAA 5MHBA 5CPMA 4V28A 3TK7A 2G4JA 3MBDA 4Y2WA 5IHRA 5DEZA 1HKWA 4G56A 5ENLA 3MO7A 3G1FA 1RP9A 1UOKA 2ZDSA 1D3HA 2G8ZA 3E9AA 1C8QA 2VTFA 2YX0A 3QH2A 4C6IA 1QNVA 4A35A 3TC6A 1NOWA 3R58A 1ITUA 3L21A 3OO2A 4WJ8A 3GIYA 4AVOA 1J4EA 4PUNA 3GVGA 3URNA 2ZKMX 1EB3A 1V3KA 1TYGA 2V67A 2JFEX 3A23A 2ZUUA 2CERA 4PMJA 1WNOA 2V82A 2Y0FA 5G1MA 3QHNA 5JBEA 3AS3A 2F2KA 3NOEA 3F5KA 3C0JA 3RGTA 4MB3A 4M80A 3LPFA 3NAVA 3UR7A 4J28A 4E4UA 3P60A 2Y1HA 1FWDC 2Z6JA 3TNOA 2QPXA 5ABGA 4NAEA 4LANA 1JFHA 1E1CB 3WQWA 4LU0A 2BHYA 2Z00A 3N9SA 2NX9A 4JNZA 3A4AA 4XUGA 1WA3A 3WQGA 1W5OA 2WJEA 1P0DA 3GNPA 2A7RA 2DQWA 5MKGA 5IXEA 4KCWA 3PB2A 3T07A 3UJ2A 3BSHA 4LGXA 3DKJA 2QJMA 3VI2A 1X96A 3QFWA 1SPQA 4A3YA 2HVMA 3SUVA 2A79A 1OCQA 4MUZA 4QX4A 4ZTYA 4QJ1A 1W54A 3WLOA 4NJKA 4GQQA 1RY8A 4W93A 3SCVA 5F2MA 3VD5A 4JTTA 4D71A 4O1BA 1Q8JA 1U1UA 4IJBA 4LWWA 3KHJA 3B9NA 1Y8BA 3P81A 4Q33A 3S8HA 1KKOA 3O05A 3FW6A 3RILA 1SW0A 2VQUA 3WQVA 4IMGA 3TIMA 4FSAA 1Q7ZA 2OO6A 1UBPC 4MAZA 3G6MA 2PPGA 2HK1A 5BROA 3W7HA 1K3UA 1GKQA 2XYLA 4INFA 2CETA 3E0IA 4K1WA 3DAQA 4JTKA 1OEPA 1QPOA 3OZYA 5H8UA 4F9DA 3LSCA 5D8WA 1K6WA 1NDVA 3G1SA 2DDXA 4GBDA 1QVBA 3F5JA 1YEYA 1FHDA 4GY1A 2P0IA 3PPCA 4R88A 3OU8A 4PMZA 3PTDA 1W37A 3CZJA 3G0XA 4JDBA 4JFUA 2YB4A 2OLAA 3TJXA 1PV8A 1NQKA 2CXEA 1G67A 3UGRA 4MDPA 1TVNA 3HQOA 2W79A 3GFZA 4CVUA 1VLWA 3CTTA 3FYOA 4OE7A 3PUGA 1C93A 3E96A 3EWCA 1TE6A 3T1GA 2A4AA 4JY8A 1DBTA 2UZ9A 2R94A 5I78A 2BX7A 3I6RA 3LHUA 3ZLFA 7REQB 1A5KC 5G4WA 3W37A 3BG5A 4R9OA 3ZFHA 1NSJA 1DWAM 4QR6A 3UP8A 5TF0A 1KTCA 1F3WA 5HNUA 3RITA 4Q7BA 1OC5A 2YFNA 4E2VA 5ABHA 3MSYA 4K3ZA 3CMJA 1P0EA 1KGWA 5HJYA 4NRSA 3EX6A 2VJXA 2ZE3A 1XWYA 3PBMA 3BW4A 4B2DA 3L68A 1YE6A 2Q01A 3EDEA 4WHBA 4K1GA 2ZRXA 2PTWA 1EJVC 4IQJA 4CD4A 3CO4A 1XISA 2D69A 2XPKA 3P67A 2PCEA 4IFKB 3B05A 3VIFA 1ONEA 4L4MA 4RNHA 3FLUA 3PULA 2YGYA 4HMCA 1BSLA 2IPJA 5DMMA 3WN6A 4KT2A 5BRBA 5AHFA 4QM1A 3M0XA 2EPKX 1MW1A 2GK1B 4LFYA 5GVJA 4HU8A 3GDMA 2A2IA 3ITGA 3EB4A 2WVUA 1E6PA 1KNWA 4FX7A 3O3RA 3W2KA 3N18A 5BYWA 2Y7GA 1JI2A 2GDQA 4B2DD 5CPQA 1L8PA 1KLYA 2QUMA 4ERAA 1X6LA 5I03A 2J4GA 3C2RA 3CASA 4IP5A 5LIKX 2J74A 1FCVA 4FLRA 4NZ1A 2XN2A 4S3KA 5FAGA 2WMFA 2YA1A 4C5ZA 1ICQA 3PAOA 1CXFA 3EPNA 1VR6A 3MSRA 1XCWA 3ABRA 1G7UA 4CU6A 1GTEA 3FDKA 4HK6A 1WP6A 4IIHA 3FKKA 3UVAA 5I02A 4ZFCA 1AFSA 3CUIA 1D9EA 2NVCA 4UUIA 2XGIA 3A3XA 3GBDA 3HIJA 3WNPA 1H50A 1H0IA 3CIWA 1KV5A 3VZYA 3L2LA 1VYPX 3OODA 3JZEA 3B0PA 5FEPA 1RY0A 3UWEA 3HMJG 3QOMA 3DENA 1J0IA 4LC6A 5IM51 1V02E 3NQ8A 3H2NA 5ABFA 2YBTA 5C54A 1TJPA 3I7RA 5M17A 1QNSA 1HG3A 3W7JA 1H09A 5DX7A 1MDRA 3UR2A 4JN7A 3NPWA 1GVFA 1K7EA 3LGEA 1NH6A 3FEMA 3UNDA 2GSJA 2KX9A 2GJXA 3THDA 1ISZA 3NIYA 3O7UA 5M5DA 4EPKA 3ZO9A 4DO7A 3NFUA 4TU1A 4GG9A 1T0OA 2VWSA 4XO6A 5DT7A 1H11A 1M3UA 1JJKA 4NI8A 3Q37A 1OC7A 4LUYA 2X0HA 3ARQA 3WH8A 1FUYA 1LT8A 5BZAA 1YPIA 2P76A 1B0IA 4BHYA 4U5KA 3U8GA 4LAZA 4E2OA 5D2YA 1H51A 2HBXA 5LHEA 2QYGA 3B8IA 2WWCA 2W63A 3JZUA 3IVSA 1IEQA 4HNVA 1K02A 5G2HA 2V30A 4G2DA 3N14A 3NO1A 1US3A 2R1PA 2WVVB 2GGHA 1IWBA 1GTHA 1PTGA 4GLEA 2Z28A 1CXHA 4UR8A 4ICCX 1KM1A 1SR0A 1R3RA 3R89A 4WZHA 1PZ1A 4DPQA 1XSIA 3TMQA 4CUCA 1FP9A 3RLHA 4KCTA 1UJPA 4M24A 5AYIA 2GVLA 4CU8A 2BOFX 4HA1A 3CH0A 3G1DA 3MT1A 1KM5A 1BPLB 1XYLA 3L4VA 3OPSA 1TZ7A 6PTDA 4G5DA 4OIFA 4Q7IA 5KMYA 2BODX 1ZJHA 3ZWSA 1W9UA 1OGSA 1FWNA 4A8IA 1I4NA 2XSBA 4U28A 2E67A 4L6DA 1EX5A 1D7FA 1Y5VA 2BV9A 2F8QA 2QQ6A 3SGUA 5KZEA 1HZYA 3GDRA 4B5NA 4TV5A 1BVZA 2VELA 4XAYA 3PANA 1W1A1 1A3HA 1F8MA 4S3JA 2TSYA 3MMWA 2EPNA 1D8CA 3U6WA 4AC7C 3T7VA 1Y7VA 3GC5A 4ADUA 3ZVIA 3HG3A 4IIDA 2F38A 2V5JA 3ZT7A 8XIAA 4X60A 5C9RA 3G8RA 4XKYA 4UC5A 1TUFA 1SO3A 3EB2A 1F6KA 4BS0A 5DRCA 1UHVA 3EX4A 4TX8A 1FH7A 4N9BA 1Q4NX 3PNZA 4DAIA 3FJ6A 4JKMA 2J27A 4W8LA 3GW0A 4L56A 1J2BA 2OGYA 3SFWA 3W7RA 2Q8XA 1QWGA 4ORIA 4US5A 2WHJA 3MJMA 1P43A 3BQ5A 1R87A 4GIEA 5LXEA 3UD6A 5JU6A 1GW9A 5D2XA 4CQBA 3U2EA 2R91A 1UR3M 5CC3A 2AKZA 1SJDA 3LQGA 4MZ8A 3GUGA 3CMGA 2VXNA 4HBKA 2WJFA 1LRNA 3ITYA 1PTDA 3WK3A 4F0KA 3S46A 4JN8A 3SCPA 4N4PA 4A3UA 1UD4A 3HO8A 5HR6A 1SYTA 1I2OA 5AHMA 4DRSA 1BG9A 3OA5A 1H3GA 4PTNA 1FWCC 4HP5A 4GUFA 3W6YA 1MMFA 3GNNA 3C6CA 5I3JA 4R7OA 1J96A 2H3BA 2JIWA 1VC4A 4R34A 4DO5A 1NOUA 2B7PA 2J8FA 3D0CA 3CL7A 3GDBA 1G5AA 2BOEX 3V1HA 1SMAA 1W1IE 3PSVA 5EPDA 4HPGA 2QLYA 1CB2A 5HBFA 3DFQA 3QYSA 1S2AA 1UWTA 1LBMA 3G1HA 4H01A 1O12A 3W28A 3W23A 1Q63A 4KGJA 3CHDA 2POZA 2IXVA 1JAEA 5I6SA 3AROA 1TELA 5AY7A 2VD9A 3KL5A 1MEHA 5HMFA 1XSJA 1W3IA 3R0DA 3B4UA 4K2SA 2KAUC 1RBAA 2EXOA 2QCMA 4FOJA 2DT0A 4IT1A 2HBVA 4ECLA 3LTYA 5DY2A 1LBLA 1EP3A 4MDOA 4KKXA 3BGAA 1XLBA 5XIMA 4ZA0A 3TFCA 1W5QA 3E2SA 4FF7A 5MKGB 2QIIA 4Y6GA 2RKXA 5I77A 3N4FA 1XUUA 2X1UA 4AVNA 4XX6A 4WK9A 3WLQA 1AW1A 1B3ZA 1POJA 1RD6A 1XFBA 3LENA 2WVVA 1V0KA 4O8RA 3B03A 3EWZA 5A6SA 5B7YA 4UFHA 2ZZ4A 4XAGA 3BSMA 2J7GA 2X2YA 1KW1A 4WQ6A 2NLYA 1C9WA 3VUSA 3IEBA 2PWDA 4FIQA 4W89A 2IKIA 2J7HA 2V2CA 5JBDA 4IQDA 4G7FA 4NZ5A 3BGGA 2DVUA 5I24A 2QGHA 3LEPA 3ARXA 1ME8A 4EE9A 3OHMB 4PUDA 3PZUA 2DQXA 4PSPA 1C8YA 1Z32X 3N6QA 3UW6A 3P8JA 3HGRA 1ZCCA 3GIPA 2BVWA 1YTEA 2ZVRA 2P8BA 4LX4A 3HPFA 1A3XA 4OBTA 4WCJA 4IPIA 4YNGA 1L2UA 3L2IA 5TD4A 5FJOA 2VR2A 2OOGA 4LUSA 2E6YA 2WCGA 4MKVA 1EOKA 2ZX9A 4MGGA 2NUYA 2IQDA 2Q3OA 1VKFA 2H8ZA 1PAMA 1SFJA 3T0TA 3WD2A 5JIWA 2I1OA 4FNRA 1W17A 5AECA 3NNTA 5K4XA 3FAXA 4QJ4B 4AZ6A 5AB3A 1UZDA 4L4OA 3VKBA 3W1MA 3LBMA 4EIVA 3KBMA 3N9KA 1GJUA 3DG7A 3PZIA 1BVWA 4IF2A 4YMZA 1AK5A 1EDQA 2DZTA 1VFFA 2A1YA 1TV4A 3OA3A 3DFYA 3TTYA 4PH6A 5MF5A 1GG0A 3GXTA 1M68A 3TFXA 1CECA 1UR8A 1JF6A 1JCMP 3O0KA 3UR8A 3SQMA 4CNSA 4GBUA 4W84A 1EO5A 2QDEA 5CSRA 3CHCA 3R11A 3UZ5A 1SO6A 3NA8A 4KFNA 3DYPA 1FCQA 2XIIA 3HPSA 4GQGA 1DORA 3W7DA 1KBJA 4JIIX 1KFBA 1EGZA 3GVRA 1RUSA 2F9RA 5DT5A 2XM1A 2FDMA 5AFDA 3NPVA 1VAHA 3LXAA 3W1LA 4AG0A 1R86A 1L8NA 1GEHA 1LROA 2PGEA 5A95A 5C5YA 5T9BG 4AMAA 3RXZA 4B5XA 4RDVA 3S2MA 3EOLA 8TIMA 3PTKA 1EH9A 2WB5A 4D1IA 1WDWA 1LCOA 3WIJA 3KHDA 4LB4A 4CEXC 2QDGA 3EWXA 3D5HA 4LXFA 4CD7A 3S9IA 2Z2UA 6CGTA 1FDYA 3JRKA 3KP0A 3HGOA 5A6AA 2C15A 2G5WA 4MJZA 4M1RA 1M1BA 3TEVA 4E3TA 1SQ7A 1E1EA 4JHZA 3TV8A 3ONBA 3ZM8A 1JUEA 1QOPA 2HDJA 2OGJA 2C79A 2CWNA 4ATLA 2AKMA 2G3NA 1JRBA 4LUJA 3CMFA 4F2TA 2V3GA 3ARSA 3LN3A 3B06A 3TAOA 1GCYA 3HQNA 2DZVA 4KQNA 3SN4A 4M6VA 2OEJA 4DAFA 2XIMA 2ALRA 1NIUA 3QGVA 2WHLA 4NJIA 1JPHA 1R9ZA 4PMQA 4H7CA 3CJPA 3EMQA 4HIBA 3EWUA 1TG7A 1E0VA 2YIHA 2TRSA 4LOCA 3QBUA 4F79A 5HWJA 1BEUA 1MXGA 3EWWA 4M82A 4PE8A 3RPTA 2X30A 1P0NA 4WSKA 4DZIA 1VFTA 1XIJA 4RDWA 1ZZMA 1ISXA 1FWHC 4QNEA 4A8NA 1TSIA 2DFAA 3MUIA 1QXLA 2UY3A 4ZO9A 1FCBA 4S3FA 3LLFA 2PTYA 4AZ7A 1FKXA 2PLCA 3UPWA 2D22A 4LRTA 2AQVA 2Y8VA 1I1WA 1ADSA 4Y9MA 4DPPA 1WDRA 1C91A 3E49A 1VZWA 2VEGA 1OM0A 5AVNA 1T99A 2G3JA 1XICA 3BURA 3LHYA 3NQMA 3PBGA 5E0CA 3HGSA 2YCKX 3PZNA 3RM4A 2GSHA 1Z48A 1OQFA 2UY2A 3JR2A 3U4AA 2CLPA 2BY0A 4Z2HA 3W1PA 1I2RA 4YXGA 3C5QA 4IGMA 4A21A 5D2VA 3UCDA 1E4LA 2B4GA 3KRZA 4O4VA 3C2EA 2G37A 3FS2A 2P53A 1L6FA 4ZOEA 3QOKA 1K77A 1Q6LA 1J2WA 4JHOA 3GZAA 3UY7A 1BYAA 3AXIA 3DG6A 1PCWA 3DI1A 1TCMA 5DRIA 3O8AA 2VP8A 1UUMA 2AOSA 3MCOA 2Q02A 5GQBA 4NX5A 3T78A 2GSEA 3T08A 1SO4A 1ME7A 2Z1SA 2FDSA 4EF8A 4FX8A 3E0FA 4W4QA 3RCNA 4D72A 1XP3A 7CGTA 2ZUSA 3S47A 1KQYA 1FXPA 4Z08A 3M0IA 2B31A 4ZBCA 1YXDA 3F4VA 4J3WA 1WAWA 1GYLA 1F7BA 3A13A 4I5UA 2CU0A 3I7SA 2ZADA 2D2JA 4N6EA 3PK7A 4DJDD 4LW7A 3ARZA 1AQFA 3ZT6A 4DWSB 2EGZA 3WYZA 1JCTA 4E8DA 3G5EA 4QBXA 5TQLA 1W8SA 2ZCGA 1ISWA 2HROA 3W1UA 1W1TA 4FK9A 1ALDA 1O1ZA 4N4QA 4YWSA 1VCFA 4TX6A 3NYZA 3KFTA 3MQTA 3NYDA 3GXFA 2DZBA 4WR3A 4WXYA 5DY3A 3J7HA 1XQKA 2X1RA 2E28A 1IV8A 3N11A 1U22A 3NZGA 9XIAA 4TR9A 4I90A 1RLCL 5LIYX 1P6CA 3MV01 3QY6A 1J01A 2ASHA 4DJDA 3IK2A 4Q4KA 5FL1A 2ZWYA 2IXUA 3OG3A 4UTTC 1R9XA 2GJNA 5A6KA 4OUIA 3P62A 2CITA 1E40A 1MW3A 1QWKA 3URAA 2XFYA 3P5ZA 4DWDA 1FWAC 4M1BA 2Y62A 3QLDA 4NHVA 1LJYA 2DUZA 1D3GA 3EKLA 1ICPA 1DWIM 1YXYA 4B4HA 5HQEA 1UZ4A 2H3DA 3GR4A 3ZVHB 4YVVA 5AYBA 2DZSA 3S2JA 5LA1A 2CHRA 3DKLA 3WNOA 2P0OA 1PWLA 4JFTA 5FCZA 4MLRA 1EL3A 1J79A 1UUQA 2PRHA 4NKCA 1DJHA 3UWZA 5KZDA 3KRUA 1RQEA 1DJYA 3WFAA 3A22A 2ZX6A 4GD0A 2ISDA 3LCWA 4HNUA 5LGXA 1W9DM 3DBPA 3AFBA 5CZ0A 4S3GA 5LNVA 2E9BA 2OZ8A 3T9PA 3BMVA 3K46A 4GZIA 4E5TA 1TVPA 3OGSA 1B3XA 2VI0A 2GWGA 2R82A 2BB0A 1GORA 2XH0A 1YKWA 1OX5A 2PDBA 5C71A 1CB7B 3CPRA 4QLLA 4CNUA 4NAEB 3DGRA 1NWTA 3AS2A 2GUBA 1W1ZA 1UKQA 4DBDA 3S1WA 3FY1A 2QUTA 4WJEA 4XVDA 4QLJA 2ACUA 4DXKA 2BLEA 5CPOA 1QDSA 1KM4A 2VDHA 4UCGA 3M64A 4ZQCA 2PBGA 2A0NA 4NZ3A 4BKNA 4MZYA 3OYZA 4LF2A 4LCQA 4XVEA 3GXPA 4D6DA 3LHWA 4W87A 1WZMA 1PDYA 3NQFA 4HZ7A 4ASTA 1YBQB 1IHIA 5K4ZA 2VGGA 1R30A 1KBLA 4GKTA 1A53A 4KW2A 1H5YA 1WKYA 2FZMA 1ZLPA 3I7QA 2NQZA 3AMCA 4K39A 4HPNA 3HM7A 4PEKA 2Z2AA 1OCNA 5D8ZA 3F03K 3MI2A 1ZBCA 4ZODA 4L9XA 4QG9A 2H8XA 1CT5A 3C4UA 3CL6A 2HMCA 5A8OA 1CGYA 1Z9AA 2J9YA 3EGJA 3PHAA 1V03A 2JGQA 2ZTJA 3CUZA 3PC0A 2QCLA 2FB3A 1QATA 4KEUA 1ICSA 3RFAA 1YE4A 4AWEA 1R38A 4LC8A 4NJGA 1FX6A 4DUVA 2PGWA 1FCUA 3M16A 5KITA 5JH1A 1ZJBA 3HMCA 1U83A 2W4XA 4TTUA 3QHMA 5FF0A 2PTDA 3UXLA 1VPXA 3JVAA 4I3GA 3VIIA 4JTFA 3PZOA 1B57A 1Q4WA 1JGIA 1HIZA 2WCAA 4H1ZA 4XIMA 2XFRA 1R3SA 3RIKA 4TO8A 1UQYA 1M41A 1LOQA 2CLHA 4GQRA 1XRVA 1K6AA 3WD3A 1TRDA 1WUEA 1JRCA 3OLIA 4Y9OA 2ZRVA 2O4MA 1O1HA 3BVJA 2A6LA 3CZGA 2PLJA 4D8AA 4H9MA 1XIMA 3KEHA 1CIUA 1A5BA 2FGZA 2ZUTA 3ANUA 3VOJA 1UWQA 1S5TA 1ZBVA 2BTMA 1F6PA 4O10A 4X61A 3HOJA 1PJ9A 4PN2A 4O57A 4DLFA 3LK6A 3ALFA 2CKRA 4H4IA 4JIPA 3VD4A 1RCOB 3ALGA 3QV9A 1HJSA 2E7FA 1DEDA 1NWRA 4DZ5A 1Q85A 3POCA 4O28A 4AHOA 3FIGA 4P8WA 3L0NA 3AYSA 1FWBC 3IANA 1EDTA 1QW7A 2BFGA 1N8FA 4J3ZA 2XN1A 1GZ1A 6ENLA 3DHUA 1OG6A 2V6AA 1SZRA 4O52A 3PBUA 1O5XA 3DH7A 4BI6A 3LCIA 3EKZA 4NY2A 1RBOB 1Q6OA 4ONVA 5EMMA 2WVTA 4ZL1A 4I9JA 1QOQA 1H1YA 1OIFA 1TV3A 2ZA1A 2A7NA 4PBGA 3CQIA 4Z42C 2HSAA 1KR0A 1WDDA 3ZVHA 4JIHA 3RX3A 2DW6A 1UG6A 4GRSA 3UEQA 4QP0A 4TV6A 3MCMA 4GACA 4MTVA 3O15A 2JKAA 2QIWA 5LGZA 4JCMA 3VOGA 3REQA 4ZFMA 4OV9A 4QXIA 4AY8A 1SVDA 3W02A 5CBJA 5C55A 2B81A 4J4KA 5FAJA 1N82A 1F4AA 2RJGA 2RDXA 5IHSA 1Q6FA 4IIEA 3VGFA 3QYQA 1GHSA 5IBXA 3FHQA 5CQ1A 2F6UA 2HRWA 3WD0A 1XV8A 4FI4A 8A3HA 1AL8A 3QTPA 4OU1A 4GIAA 3CM4A 1OX6A 4PRRA 1TPH1 1Q6EA 1UC4A 3BSGA 5C7HA 3WQ6A 4GXWA 4LAUA 4HOWA 1XYBA 1TX2A 3HG4A 4AZGA 3CAVA 4J35A 2WAGA 4PMDA 3WNLA 4XKYB 4AB4A 2PLMA 2VHLA 3A6OA 3WF2A 1DP0A 4N7QA 3JW7A 1JFXA 4XAZA 3N34A 1WPCA 1CXEA 1TPFA 3TE9A 1F3XA 5FJUA 3SN0A 3FYYA 1YTKA 2X1TA 2W6RA 4GK8A 4LNCA 4M19A 2OG9A 1W1VA 1Z44A 4GUJA 2VCBA 2XFFA 3EA2A 3PUOA 3QQWA 3WQFA 1UP3A 4RZ5A 1FKWA 1FXQA 4C7GA 4GINA 4O1DA 4GABA 1ITXA 1H7PA 3QVQA 1XH0A 2PFHA 3SI9A 3IGSA 4MIMA 4IIBA 1QPRA 3UYCA 2CW6A 3S83A 1DE6A 5H8PA 4LUTA 5LNRA 3LG3A 2ISFA 1R2RA 1BVNP 1RCQA 4AD2A 4V33A 2D24A 5TIMA 4JICA 4L1XA 1ODUA 1DHKA 4L80A 3PZTA 2V2HA 3LI0A 4DUXA 3AXKA 1Q45A 2WMIB 4PBEA 2TYSA 3WLSA 1GQLA 4ADTA 1Y65A 1UP2A 1GOXA 1WZLA 4KEZA 3H2EA 3TYZA 5CAKA 1DVJA 5DBUA 1T40A 4IXXA 3GTXA 2X2GA 4LY8A 1X38A 3NSMA 3PF3A 2WZEA 3NGJA 2E5BA 1E6QM 4LTSA 1EJTC 4C1LA 1M65A 1LLZA 2VT0A 3QC3A 4ZOCA 1FHUA 3VOFA 5HOSA 3SRFA 1U5JA 2GWNA 2FVLA 2J7DA 3LDVA 3R1ZA 2F7FA 2PSNA 4YYFA 4H9TA 2RHGA 5DFAA 4QEHA 4AU0A 1Z69A 4L9ZA 3LCXA 3QRHA 4L4LA 3R0KA 4O1CA 4L5ZA 1PEZA 1XHGA 4W88A 2DZPA 1VCGA 1AMKA 2RFGA 2OYKA 1R2TA 1UZHA 4AAJA 5I7GA 3L66A 4LAMA 3GSMA 3MKKA 3W07A 3EYPA 4MM1A 3C3UA 1H49A 1K4GA 5A6BD 3CYVA 3AIRA 2WSPA 2GUUA 1XD1A 3KVJA 3ECQA 3SSJA 2DH3A 3WFLA 1I1XA 3G1AA 1BSIA 4FXSA 4NF7A 5FACA 3ATYA 3R7MA 3T40A 3SN1A 3GHUA 3NQBA 5JMUA 1FVPA 1YPXA 5C7VA 2HS8A 1ISVA 3NL3A 3GG7A 3P0XA 2QCCA 3N6JA 3WK2A 2OZTA 1RA5A 4GIYA 3WUBA 1E6NA 1REQA 2XH4A 4QDMA 4GVGA 4JHMA 3WQCA 3RPMA 4C6OA 2QT3A 4MY8A 1LG1A 1NEYA 3OP2A 1AH4A 4MYXA 1RBLA 1NDZA 2REQB 4YS1A 2PDJA 4J9JA 2DJLA 1HJXA 1SGJA 2QVNA 1M7JA 1V7YA 5M03A 1DJIA 2R1LA 2ZXDA 3O0FA 2SFPA 5F1VA 4ZXLA 4FMVA 4DF1A 3AHZA 3PPFA 1BRLA 3TTSA 3TQVA 2EPMX 1ZP3A 2DZAA 2GK1A 4KERA 3U4FA 3W1NA 4U4MA 1LM1A 2J25A 4IJCA 2HE8A 1I9CB 1TA3B 2H9AB 2XU2A 1UBSA 4GYFA 3VKAA 3EA1A 2IPWA 3AO0A 3SM0A 1QJWA 2PZNA 2C91A 2VEIA 1VCVA 3T55A 4IFRA 1OZQA 1M9HA 3WF0A 1GOIA 3BAWA 3ME3A 1K70A 3UA4A 2ANUA 1PWMA 1OSEA 2PDKA 1ITQA 1V5XA 3GU1A 2E9MA 2OXNA 3B0XA 4DWSA 2WMJA 4J40A 3CT2A 3TC3A 4IOTA 1GOKA 1NWSA 1TMQA 2FZ9A 4L7ZA 4MB5A 5T91A 3WNMA 2DU2A 1JYWA 3AHYA 3K5XA 4HA3A 3R12A 4EAYA 1TTIA 3R25A 4PGLA 4C6FA 1JCYA 4YVXA 4XG1A 2P10A 1XW8A 2HWGA 4F9JA 2BY1A 2E3ZA 2YDRA 4O8AA 3ABQA 4P7RA 2ZRZA 4CQ9A 5HATA 4NX0A 3FJLA 1H2JA 3WLJA 2GVGA 3NL5A 1DJNA 4QGCA 2OEMA 3DESA 3H54A 2PF8A 4RNJA 3DFHA 2QGYA 4Q4MA 3CV6A 1X98A 3VIJA 3ARTA 4C6NA 3WEOA 4Q8NA 1ML1A 2IKJA 2R8WA 4O15A 4ZGYA 1VYSX 1ZAIA 3LRMA 4XK2A 4RXGA 4YCOA 4NASA 2PDQA 4F2BA 2HXTA 3ZS4A 4FOKA 2NT0A 2YYTA 4UFKA 3CGTA 4U3CA 1X6UA 2PDYA 1ZAJA 1JDDA 1O7AA 2BXYA 3VYLA 1O5RA 4NZFA 2INFA 3CIXA 2Q71A 5DN1A 3LPOA 3SBFA 1B30A 4PTXA 4UOZA 4KH2A 5B7ZA 2QJHA 4JFWA 1C90A 3ARRA 3CZKA 3S2NA 5F4XA 1Q66A 1RQBA 2A3AA 5ABTA 4PMOA 3T44A 1IEXA 8RUCA 1GQKA 1Q6QA 3ES8A 4GGBA 4E4PA 2EG6A 2OSWA 3AICA 5G1YA 1X7FA 1T5AA 3DHFA 5M1TA 2YXOA 3F4WA 4M7TA 4WY0B 4NI3A 4HCHA 3THCA 1IT7A 4QDWA 2QCNA 3SIMA 4BEQA 1QU4A 4YLWA 5DELA 3IV3A 4N02A 5FL0A 3T8LA 2XIOA 2QCDA 2ZZ5A 5T9CE 3WQ8A 5CZTA 1RJQA 1UD6A 1PX3A 1BFNA 1G6CA 4V27A 2V69A 4RE3A 4S39A 2ZOXA 3U2CA 3BMWA 1Q6GA 4DJDC 3NQDA 5BOOA 4JQ2A 1XH1A 4JTDA 4U5IA 1X6NA 2BXZA 3F2DA 3K4WA 4AC1X 3DN5A 4EWND 4GYJA 5A2BA 2HV5A 3VGHA 3LBCA 2DT3A 5HMDA 3TMLA 1EUAA 4FP1A 4AD0A 1FWJC 1AZ2A 5FJTA 3CNYA 3HJZA 4U10A 3WL1A 4BQ3A 3MI6A 1TV7A 5GPRA 4FA3A 4F2UA 1C8XA 2FVKA 3SUSA 2VEMA 3S3GA 1QRQA 3TP4A 2VL4A 3DDMA 2DUAA 2E6AA 4D6HA 1SSGA 2OLHA 3IRDA 4CQDA 2Y7EA 1KBKA 3NQEA 5K9XA 1S1RA 1VFUA 4JTAA 1UD3A 2YCEA 4GUHA 1VIWA 3GWQA 4UMCA 3L4UA 4KRZA 3BV7A 2DGAA 3GE7A 4Y8FA 4Z2GA 1DE5A 1HKMA 5SWUA 5D04C 4C1NB 2NZLA 1WX0A 1IEWA 1OD8A 4JEQA 3C61A 4DB7A 4O0ZA 1VIZA 4PEEA 2VNCA 5CLWA 4O13A 4HJWA 3LNMA 2V3DA 5I06A 1RK6A 1E51A 4ICNA 2GJPA 3TN5A 5A94A 4AZ5A 4EWJA 3ANVA 3GKFA 1W31A 2PC8A 1GQNA 4QITA 3C2VA 3DI0A 2Z0IA 4ALDA 1A0EA 4B5WA 4CNNA 4LS2A 3LBOA 3C0QA 5D9MA 1XH2A 7XIMA 4B5TA 2GJLA 1XIGA 3P80A 4GMEA 4XQ6A 3KDOA 2POTA 4RXFA 1R7OA 3R43A 3BG9A 4GKLA 3ITXA 4F66A 2EEXA 4JCLA 2V8ZA 1N7KA 4N0RA 4UZSA 4QG8A 4U2ZA 4PUEA 1BKSA 3S5YA 4QQUA 3M0ZA 2XINA 3RDKA 1GVRA 4L1WA 1EZWA 5E6ZA 1OVDA 3GTHA 1I45A 2X7WA 1IT8A 2AL2B 2Q8LA 3TVAA 4QROA 2Z26A 3WK0A 4MNMA 3IGHX 1V6WA 3L4TA 4ZENA 1XM3A 1W91A 1X7IA 1T96A 2LLEA 4NZJA 2VUNA 3QZAA 4IMCA 3NL6A 4GC3A 5IDIA 3M41A 2HCVA 2HS6A 1TR9A 4AWUA 3FSUA 3M6DA 4GY0A 3UFYA 3RPDA 4HZ6A 5CSSA 1W3KA 5HANA 1J8VA 2HISA 3GH5A 3KBNA 3NUKA 1OCJA 1ENUA 1CI1A 1KWKA 2YL6A 3FNDA 5D2WA 4IMEA 5AYXA 1FDJA 2WKLA 1XKYA 5PTDA 1J6PA 3FK4A 5DANA 4AZIA 2VX7A 5FEWA 3RO6A 3UJEA 1KFJA 2OKOA 4MNJA 2FJKA 4KEVA 3UXAA 2Z24A 3O1NA 4O0KA 3OG2A 4I7WA 2QMKA 2WM1A 3APTA 1J0HA 3U5UA 4HHMA 3P14A 3WQOA 2IQTA 3AHXA 4OFCA 3W6MA 3CIVA 1LYXA 3ITVA 4A6GA 3LU2A 4H41A 1CNVA 1EBGA 4MB4A 4CNPA 4NZCA 5JQ9A 2PDFA 2PWGA 2YBVA 2G4FA 3DXIA 3PZVA 1D2KA 4DJEC 5LKYA 3NTYA 1TMHA 4H3DA 1BXCA 5HINA 3S0CA 3GVVA 3DG3A 1TJ0A 2NV9A 1BF2A 1WZKA 3S1UA 1CYGA 2G50A 3SDOA 1DJWA 2VX6A 3TC7A 4RR4A 1R46A 4B3LA 2PA6A 3W7PA 5I3HA 1MRQA 4G7EA 1X1ZA 3PZGA 1VGAA 3G1YA 2AMXA 4DJED 4Q4OA 3WF1A 4GC4A 5HUOA 3GNRA 4LRSA 2NXHA 3ZQ9A 4U2YA 3VGDA 1VPQA 1J0KA 4DNMA 3EB3A 1THFD 3P6LA 2VC7A 3TA6A 1LBFA 4L64A 2WK2A 2CZ5A 3EZ4A 5BOEA 1UROA 3LERA 2DIKA 2NUWA 3A5VA 1RLDA 4S3CA 2PDHA 4B5SA 4RNFA 2CBVA 1JD7A 2DT1A 4QSFA 1AQHA 2X1SA 4FIRA 4XB3A 1F8IA 1VF8A 1CZ1A 5J8LA 1HP4A 2O7SA 1WBHA 2NV1A 3V0UA 2W9MA 3INPA 5I07A 3SEPA 4KGLA 1LL6A 4M3PA 1E4IA 3N2TA 4HN8A 2V5BA 2I17A 2NWRA 3BW2A 4YPJA 4I9MA 4F48A 5A2AA 1C29A 2V5DA 1CBGA 2F6XA 4OJYA 1F3EA 4AFYA 1TWSA 3LV6A 4H8HA 1NU5A 4X0NA 4LH8A 2AQWA 3U48A 1WKEA 3V4BA 3AIWA 4REQB 4NUWA 2OWCA 1XIBA 4Y90A 4M6UA 1P0KA 4JTLA 3KVMA 1UKOA 3EBVA 3RLGA 4ZVJA 1UR2A 2DUXA 2I7GA 1E0TA 5C8BB 4R85A 3W24A 2BXVA 4EPEC 5IBXC 3V36A 4BJHA 5HR7A 3C2YA 4ZB0A 2GQ3A 2PDIA 4CNTA 2Y5SA 1MZHA 4CD5A 4GUIA 2I16A 4CLMA 3LM7A 3NEVA 1H7WA 4XUYA 3SJNA 4WUIA 3BK0A 3WBEA 1WAUA 1D3CA 4D6GA 2HNHA 4TVDA 1UIOA 3WJZA 2VR4A 3F7JA 1JUKA 1CLVA 2J9XA 4NNCA 2OB3A 3BCJA 4DZHA 3M0YA 3PPHA 4CN1A 3LQLA 3W29A 1IEVA 3AXHA 5CEWA 2PZ0A 9CGTA 4UTFA 1OBAA 4RUBA 4AIEA 3BZJA 3U2OA 3S6OA 3WH7A 4JIQA 4XAPA 3F5LA 5FJJA 3H7RA 3WLHA 1FP8A 1QFEA 1PZ0A 3AHVA 1PXGA 2I5GA 3BWWA 1KXQA 1NWUA 2Z6IA 1H61A 1SR9A 1HKJA 3GVWA 3D47A 4JX6A 4PMUA 3T05A 1YHTA 3OW1A 5I3KA 3AHTA 1V8EA 1ZBKA 2YA0A 2VX4A 4HTYA 3W7MA 3OB8A 3MDWA 1VRDA 5C2CA 3H55A 4AZHA 5EMLA 4C6JA 3UA3A 1R3YA 3NXLA 3MCNA 4S23A 1UP0A 5KINA 3UZZA 4LPCA 4ADSA 4X9SA 3H4GA 4H6EA 3KZSA 2PRLA 2PWFA 3A4XA 4C6LA 3V0SA 3H2MA 1IEIA 1KV8A 2E77A 2E0PA 2XTKA 1PBGA 4Y96A 5K2ZA 1FWFC 5RUBA 4DLMA 3A3HA 3CEPA 1HVXA 2QUVA 3QMTA 3H2FA 1H5VA 6XIMA 4C90A 3WNNA 1EP2A 3ABSA 5GJMA 4DX3A 4QFUA 1PCKA 3N4AA 4LVAA 1PE1A 2E5DA 3KS5A 2A7PA 5FKYA 3EDDA 3ARVA 4WLCA 4J5NA 3CL8A 1I2QA 4CVWA 1TPUA 1UW9A 3WQ4A 3P3BA 4EPDC 1GYNA 1O4UA 4MAVA 3AOFA 4UFMA 3UJRA 3EA3A 3VC5A 4YIWA 1JNDA 2CLKA 2Z25A 1EKOA 3V35A 3GYEA 4I6VA 5FF7A 1EUNA 4AHQA 4CCCA 4M7SA 1H0GA 3BAKA 3EPMA 3NDOA 3KDNA 4IWWA 4O0QA 5EFFA 2VFHA 1IYXA 1TJ1A 4HU4A 3H8AA 3LHTA 3TA9A 1F5ZA 3CV2A 4TUFA 2FB2A 1ZP4A 5FOOA 4PCFA 4NU7A 4C65A 4JGDA 1T7LA 1HT6A 3WQDA 1C92A 1XGDA 5AKQA 4R27A 4AMCA 3VZZA 1W3JA 1KQZA 1F07A 1DTUA 3EWBX 4Q4QA 1E15A 1EIXA 1Q13A 4A3HA 3N4EA 3GXMA 3EXTA 1A5SA 3UZWA 3BJTA 2FFIA 4ROQA 2QW5A 2P8CA 1CLKA 1TFVA 2XZ7A 3T4WA 5LIWX 5CH9A 1E0XA 3N3TA 1WUFA 1S2WA 4MUPA 4DN1A 2PD5A 1NVMA 3IUIA 4JQ1A 4FXFA 4HQVA 3H2OA 3QKZA 2D3LA 4CKQA 3VNLA 2IKGA 5IRPA 4A3QA 4PMRA 2XG9A 1E71M 3NVTA 3SB0A 1W9XA 3JUGA 4L9YA 3THQA 3UCCA 2V2DA 3MZNA 4M29A 3PG8A 1IQ8A 1RCXB 2WPGA 3GD6A 1YIXA 3B9AA 3L4WA 2X0SA 3BPWA 3IPWA 4HN4A 2E68A 2EPOA 5ECUA 1UUOA 3OLEA 1E43A 4HCLA 3QKEA 4UQ9A 4KMQA 3BANA 3CT7A 3WLKX 5HA7A 4H6QA 1V6XA 1WOBA 4ACZA 4E38A 3QC0A 4IG2A 1ZUAX 1UH2A 3VDBA 2WPBA 4XBJA 3UY8A 1P1MA 3OLGA 1FA2A 4HHLA 4WVXA 4UNLA 2O4QA 4S3AA 3AMGA 4MWAD 3BJSA 1UWRA 4GVIA 3FGCB 1KTNA 4LQ1A 2GGEA 5AHNA 4ZR8A 3MUY1 1OFBA 5CJMA 2CZDA 4HK7A 5EYWA 3ZSTA 3QMRA 4KFPA 1JAKA 3M0JA 3NM1A 5T26A 3EXRA 5FF2A 1OT1A 2R6OA 4K36A 4NVTA 2W62A 1VPYA 5BU6A 1F74A 2OODA 5EBAA 1JYXA 5C0QA 1LLOA 1A5NC 1JZ8A 4F3HA 4GH3A 1E1CA 1BLIA 3G0UA 3OVRA 3SW6A 3D3FA 1CXKA 1PKMA 4IIFA 4DBSA 5E9AA 3DGBA 2NV2A 5KETA 2VURA 5HDRA 4KWUA 4RZ6A 3CUHA 3LXBA 4GI6A 2X7VA 4M81A 1UWUA 3CQJA 4XZLX 5BWAA 4HNNA 3CHEA 1DJZA 4KWVA 3E1F1 2CZFA 1KM3A 2QJJA 3UPBA 2C19A 3I3DA 3AYTA 1B31A 1XG3A 1XLAA 3HG2A 3UZYA 1F9CA 3TSDA 1QMLA 1T6MA 2YZRA 5BW6A 3BAJA 4WDUA 3KOWA 2J7BA 2PCQA 2XUCA 4Q8QA 2P3EA 2HXUA 3N2MA 4ZOAA 4UTKA 2BGSA 3DYOA 4I8YA 4UMAA 3VIGA 3QQ1A 1OK4A 3G22A 4PMYA 2GJXB 1SZFA 4HTBA 5E0KA 1L6YA 4I9AA 3SR7A 3TR2A 3URQA 3W2JA 1OX4A 2PTXA 4ZTXA 5H6HA 4HNTA 4XKMA 1ZCOA 4UQAA 3VILA 4DY1A 2J77A 2ZRYA 2Q09A 1RJRA 4X3ZA 3DYMA 1HGWA 3TXVA 4Z1YA 2BZNA 2TAAA 3WLTA 1KWGA 5AC6A 2QNEA 4Z1AA 3H23A 3BCFA 2W0UA 4UTWC 3W00A 1G1YA 3B9DA 1GOMA 1OFOA 3PJTA 5HMEA 3B04A 5I3FA 3AJXA 1LT7A 1AODA 4PCTA 4JDYA 2RDWA 2IKHA 2IQ0A 2TMDA 1DTNA 4L4PA 2TPSA 3RO8A 4XZIA 1GKRA 1QNPA 1V77A 4IX0A 4FXJA 3RCMA 1ESWA 3UG8A 1VBUA 5G4EA 2QJNA 2V3FA 3KVKA 3WJSA 3MS8A 1CLXA 1ZBWA 1HF6A 3TW7A 2ESCA 2Z1WA 3LNPA 2PS2A 4YYCA 5D37A 3AWNA 3RG6A 1E4NA 1K9FA 1LL4A 3QEZA 3QV6A 3T8QA 3SJ3A 2OLSA 4IG2B 4YU1A 1LWJA 2HQAA 1B5TA 5D2TA 1U33A 2ALDA 4R53A 4F0LA 3GZ3A 3IIZA 1EPXA 2QDDA 4YTUA 3VIPA 3DECA 2PDNA 3ELFA 2DZUA 3R13A 4V1XA 1XL9A 1V3LA 7PTDA 3UCQA 3R8GA 2ZE0A 1A5CA 5AC7A 4ENLA 1O66A 1S46A 3EX2A 4ML4A 4PODA 3GKAA 4XBKA 2OJPA 2XIBA 2OZ3A 3EDKA 2Z1XA 4GI4A 1OD0A 2XFWA 3VNMA 4XD4A 4D6EA 2YL5A 3AMLA 2ISWA 2ZRWA 2E1WA 2CPUA 2BGNE 4UTLA 3GH7A 3S5OA 5LSMA 3LB0A 4EACA 4K6AA 4EXBA 3FSTA 4H7ZA 4PZVA 3UXDA 1A50A 2PDCA 4Y7EA 1R8LA 4DBEA 4M5PA 4B90A 2ZX8A 4Q32A 4Q8MA 2XIJA 4FNPA 4TIMA 2AGTA 2WMHA 2QV5A 3RCYA 1G0CA 2OTDA 1RZMA 3WH9A 4CNOA 3C8FA 3U2ZA 4WKFA 2E8YA 4PL2A 4DXXA 1QW8A 2HJPA 3LMYA 3PN8A 2PDLA 2DSWA 4GO9A 4O18A 4GE8A 1X1OA 5D4YA 3VKKA 3BO9A 4K7VA 4UB9A 1YNPA 2BVYA 2QHAA 1LUCA 3N2XA 3BZGA 1JPKA 1VJZA 3TROA 5M3WA 1F6YA 1SJBA 3GVQA 2A3LA 3HZ3A 1HUVA 2V38A 3VD9A 4MFEA 3SO7A 3VGEA 2CZVA 5H91A 5G4HC 2XH2A 1AG1O 5DBTA 1SW3A 1VEMA 3H7UA 3GFXA 4BF7A 3RRAA 4EPBC 1ODZA 1EJXC 4LCRA 4Y9PA 4QAWA 4RE2A 3U9IA 3AZSA 3FXGA 2GZXA 1XRTA 2FPYA 1GGOA 4OV4A 1QNRA 3IV8A 3S2LA 5DF0A 1WO2A 1X1NA 1VS1A 4NYYA 1B54A 2OT1A 4K7YA 4PUUA 1R3WA 1XKJA 2VC6A 3DU0A 5D33A 1KD0A 2HK0A 3PG9A 2X05A 5BXSA 1UR9A 3IIPA 3BLOA 3U7BA 1WKDA 3K8LA 3VMPA 4W85A 4IXHA 1W3LA 2FYMA 1H60A 4NZ4A 3SCRA 2PWUA 5DXXA 1PIIA 1JCXA 1QAPA 5I09A 4DJEA 3RAOA 1ONWA 1PKNA 3KCJA 2BASA 4O19A 4UQBA 2PP1A 1OG0A 1JXJA 3WBXA 2PGFA 1HKIA 3T0BA 2XVGA 4FNSA 4DVOA 2V5LA 4EXAA 2OMAA 3U7VA 3VNJA 4PFMA 4BFAA 2W61A 2Y89A 2WWDA 1JDCA 3CZ8A 1RK5A 4L1GA 1YBQA 3D3AA 1YDNA 1PPIA 2VMFA 3D46A 4UTIA 5EB8A 3ZLHA 2FHBA 6TAAA 4FZIA 2GGIA 4Z0JA 3AU6A 2D73A 3OIXA 1KBIA 1XI3A 1XC6A 4AWSA 1P7TA 1K8XA 1S38A 2UY5A 1A3WA 5HQMA 2WSKA 4L6OA 3WLNA 3L12A 1TE1A 1E6XM 2G3FA 2GL5A 2Y6ZA 3CHFA 1FTXA 3CTLA 4GYPA 5H8MA 1WXZA 4HYRA 5BXRA 2AQOA 3GC2A 1JUBA 2QCHA 3E0WA 5EA9A 3ARWA 3CUFA 1Z89A 4MLJA 4L6HA 2L5HA 3IIVA 5C2GA 3MC5A 1MFVA 2WYSA 4NRRA 2E5CA 3E02A 3FKRA 1VBGA 2O55A 3A4JA 4AEEA 1S3HA 1CXLA 4Y9NA 4BF9A 4Z1CA 4A29A 2ZVIA 3ES7A 3BLEA 4AX7A 1OGGA 1KM2A 3T0CA 4AXNA 5JXQA 3M1ZA 4FXRA 4WRHA 3TYUA 3W7NA 3CLWA 2DVXA 3TONA 4EX4A 1EF2A 1SZNA 2QUNA 4MWAC 1QK2A 3W26A 1WBJA 1RP8A 2BY3A 3FA5A 1MI3A 3GTFA 1GQJA 5A6LA 4PMVA 3ZYZA 2Z7GA 2ZRUA 3G1XA 3SGZA 4RZ4A 2XVLA 3IARA 2KZHA 2FPVA 1PHQA 1KCLA 3VFCA 2QF8A 3GR7A 4UIOA 5KSWA 4W9TA 5E70A 1ZS2A 3Q4DA 4LYKA 1ZSXA 1IXPA 4URIA 3QPZA 1OFRA 5FJPA 5LXXA 4GZJA 3FDGA 2GOKA 7A3HA 1KFCA 1E6SM 4M56A 9RUBA 3P0WA 4NXKA 4XZNX 1XGEA 1GOOA 1M53A 4KPLA 3N2BA 2VX5A 1OIMA 5A8GA 4DQWA 2CYGA 3MVTA 3S6DA 4B91A 4MHBA 5DMLA 3WENA 4RDZA 3KZPA 7REQA 3GS6A 2NWSA 1R2SA 5CXPA 4DI8A 5KEZA 3WEZA 1X39A 4JOMA 1N8WA 5F7UA 1KFEA 3RHGA 2J62A 1H63A 1UYQA 5BCAA 3K8KA 4L65A 1AH3A 1E3ZA 1RALA 1VBJA 1RQHA 2DW7A 3L4YA 1XIFA 1V4YA 2P50A 1XLMA 5JBFA 5BMWA 4HPJA 3PBWA 1TWZA 1I2NA 2PU0A 1EWEA 2CCRA 2FLIA 2J7CA 1XYAA 4LVGA 4RPQA 4EKJA 3RM9A 2I56A 2R1KA 1AW2A 1KCKA 1EJWC 1DIKA 3VZXA 5AHIA 1IE7C 1ZHAA 1PYMA 1SJAA 1JCLA 3H26A 4MOZA 2J24A 3AXXA 5GNXA 3ZR5A 3AI0A 3E38A 3KWXA 1NAL1 1FWSA 3GNDA 5A8NA 4EANA 4LVBA 1HTIA 3NPXA 4C91A 2ADAA 2D2HA 1GYMA 1E6RA 1TPC1 4G6CA 2V81A 2I9EA 3CPUA 3BOXA 3W83A 1TX0A 4UOQA 4FNUA 1A49A 3TQPA 5F1UA 2VFIA 2XWEA 2HZGA 2OELA 3COTA 3EX1A 3BLPX 1NELA 4C6PA 3I3BA 4CCEA 2FKPA 4UXDA 4YTQA 3WUFA 2ZZ2A 3BLDA 1UMYA 1TPB1 4RCXA 3FFSA 2JF6A 3W86A 3A21A 3GDLA 5DLCA 2A3CA 3RYSA 1V08A 1UA3A 1CPUA 1YNYA 3BUVA 5D9PA 1KFLA 3MPGA 3PWAA 5I3IA 2J7EA 2YR1A 1VP5A 3B3DA 2Z7KA 3TNBA 3AMDA 2VFDA 1UH4A 1EEPA 2ZTKA 4B9YA 2GGJA 3MYOA 1TCDA 3PVFA 2YL8A 1EPVA 1W9BM 3DFPA 5FEZA 2QZRA 3KRBA 4K8GA 1PTAA 1UQZA 3I6TA 1JCJA 4QE4A 1OC6A 2CESA 4F0SA 5FIPA 3BTNA 5EL1A 1Q8AA 1UR4A 3N6HA 3AQUA 3LCFA 2O9OA 1E0UA 3O2LA 1A4LA 2ZZ6A 2HE5A 1GVSA 4BY3A 1DPMA 3PP7A 4H00A 3KCLA 3TOYA 4A05A 2I5QA 3M5VA 3GX9A 2VO5A 4HNCA 5CGTA 4HB7A 1L9WA 3WO8A 4UR9A 4ROPA 2BNJA 2QEZA 1KRCC 2A6NA 3AZRA 4UMBA 1Q65A 3MP3A 4O1AA 3M44A 6XIAA 5F4WA 2DP3A 4S3DA 3F4DA 4PMNA 3TTOA 1EFZA 3VINA 4NJJA 2C7FA 3PZ9A 1ZNNA 1SO5A 4LYRA 4N6FA 4S3BA 2V5CA 2E40A 1PZ2A 2VOTA 4NG3A 3FA3A 4J7RA 3QV8A 3ZJKA 2YCIX 4KF1A 4JL1A 4GVHA 1V6UA 4C6EA 3A12A 4FR1A 1IGWA 2ZUWA 3W1AA 5AC5A 3PY2A 3KWSA 4GCAA 4GZ7A 5CAHA 4JX5A 3NZQA 5XINA 1ZALA 3VNDA 5EGRA 2HEJA 1JDFA 4UCFA 3DFOA 1OFPA 1XYFA 2CLEA 3OVPA 4PUWA 1HN1A 3W73A 1LWIA 3UPMA 1DWHM 1PO9A 1S2VA 1W1PA 1FWWA 2WSRA 2Y85A 3PUEA 4KRTA 4DYKA 3ONCA 4AISA 1HGYA 3MMUA 2W27A 1YDOA 2J78A 4WOQA 1M6JA 3OQ8A 1Z3NA 3O07A 4AZBA 3PAJA 3AYRA 2I5IA 4Q8PA 4LCSA 1TQXA 2WQPA 3P82A 1XX1A 1GVIA 4V2XA 3E0LA 3AS0A 4B5UA 4UFIA 4DJFC 3H7VA 3QSTA 3MO4A 3DZ1A 3CK5A 3TCSA 1T8XA 1QNOA 3TYEA 2X0YA 3CUXA 3VC6A 3M43A 4FLQA 4Q4PA 4N42A 1ZPTA 3VOIA 1MNSA 3WQPA 1X97A 3T0AA 1K7FA 2V0TA 3UWWA 1OINA 3CV1A 3G24A 3WMLA 3RX2A 1ONRA 3PSWA 4OHQA 1BD0A 5CZKA 1JDAA 3BLKA 3I68A 1Y5XA 2E9LA 5D09A 3H2AA 1J12A 4Z2LA 4U31A 3SRHA 3TW9A 5A8MA 1B4KA 2YBUA 1JPDX 1OF8A 2GQAA 1SFSA 2VEFA 1K03A 3WX7A 3QQ0A 3NR0A 3Q45A 2FMNA 1IF2A 4GO8A 1YTDA 3AXMA 4HCDA 3KBSA 2VVSA 4Y9AA 4DIAA 3BOFA 1M7OA 4PUMA 1JZ7A 1FHVA 3RK8A 3OBKA 3MYPA 4GISA 3VMNA 4HA4A 4Q8OA 3EXSA 2C8NA 4GIRA 4WGXA 1RD5A 3L4ZA 3VDGA 4B16A 5EMJA 2WOQA 4W5ZA 4KRUA 2PLKA 1BHGA 4JS3A 5JH2A 2D0FA 1O60A 2CBUA 4O50A 3LM3A 4ZB2A 2PEVA 3W7IA 3CLMA 4PTWA 1VB9A 3QZ6A 5F2IA 1BG4A 1B2YA 4UTWA 4TX9A 1FOBA 1DIOA 4YHEA 1MDLA 2Z1BA 4Q8WA 4H19A 1HL9A 4GXPA 4FEZA 3CZLA 4W7UA 3NDYA 4X63A 1EJ7L 1NP2A 4R3UA 5D30A 2WZHA 5TNVA 4A2RA 4A8RA 1RSCA 2ACSA 2EG8A 4ZEPA 4GY7A 2UV8G 3WMBA 3OTRA 5ECVA 4S1FA 4GCXA 5E09A 3R10A 1TQJA 4X0VA 3A9BA 3UETA 4GUGA 2WV8A 2GVEA 5FESA 1FFRA 2XIQA 2JE8A 4JTUA 4J3TA 1OFDA 3B0YA 4FLSA 4IPPA 2NW0A 2W67A 4FPSA 4IH3A 3NZ1A 2WLYA 4ML9A 2NQJA 3CO8A 3GHTA 4BEUA 3NQAA 2VRJA 1IT0A 4PRWA 4XD6A 3OQEA 2NT1A 2OQLA 3NQ6A 1ECEA 2DSVA 4YHGA 1UPMB 1CGUA 4C6MA 3O16A 4H04A 5CG7A 1V51A 3T09A 2VCAA 4QQ3A 4W8AA 3LZ3A 1KA9F 2X16A 3NQGA 2FZNA 4UWMA 3KTSA 3VX0A 1GJPA 4YTRA 1E0WA 1KB3A 5CGQA 2QKFA 3WLIA 1B1YA 1TV5A 3HG5A 2VGBA 3DFTA 5B80A 1BYDA 3L0GA 1ZENA 4BWLC 3GNXA 5AHLA 1UB3A 1YDYA 2XZ9A 4DYEA 2VR5A 3R79A 1DHPA 2VZOA 4X22A 4DELA 3HQ1A 1LLWA 1XLHA 1FBAA 4QJ3B 3ZXWA 1BXNA 1G9HA 2WVSA 3M07A 1NTHA 2VZTA