3IEBA

Crystal structure of 3-keto-l-gulonate-6-phosphate decarboxylase from vibrio cholerae o1 biovar el tor str. n16961
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
213
structure length
213
Chain Sequence
b'TKPMIQIALDQTNLTDAVAVASNVASYVDVIEVGTILAFAEGMKAVSTLRHNHPNHILVCDMKTTDGGAILSRMAFEAGADWITVSAAAHIATIAACKKVADELNGEIQIEIYGNWTMQDAKAWVDLGITQAIYHRSRDAELAGIGWTTDDLDKMRQLSALGIELSITGGIVPEDIYLFEGIKTKTFIAGRALAGAEGQQTAAALREQIDRFW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hexulose-6-phosphate synthase SgbH
publication title Crystal structure of 3-keto-L-gulonate-6-phosphate decarboxylase from Vibrio cholerae O1 biovar El Tor str. N16961
rcsb
source organism Vibrio cholerae
molecule tags Biosynthetic protein
total genus 73
structure length 213
sequence length 213
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3iebA00
4CNPA 2V8ZA 5C5YA 5BMXA 3W85A 1TPWA 4MFDA 5D09A 4LS1A 4M7TA 4UMBA 2R94A 3HBLA 1JJKA 1ZNNA 2QCNA 3BW3A 2ABBA 1TV8A 3GDLA 3B04A 3PS7A 4PCFA 2CZFA 3S8HA 1VCFA 1K02A 3KX6A 2QCCA 4WX2A 1TJRA 1OVDA 2RDUA 3B03A 5D2VA 1OFBA 3LERA 4LVFA 1QOPA 5TBOA 4PTNA 6ALDA 2VFIA 1KM1A 2DZVA 1KM2A 3HOJA 2NZLA 4AF0B 2C13A 1OYBA 2FDSA 4MFEA 1SZGA 1TRDA 4MOZA 3PB0A 4UNKA 1DOSA 4G1KA 1QR7A 2DZSA 4FIQA 2EPHA 5F2MA 3N9SA 1QWGA 2PRLA 4O28A 4JDYA 2VEPA 1LRNA 3G1AA 3GAYA 4TX9A 4UTMA 1DL3A 2C0AA 2WQPA 4M7SA 2YYUA 3PF3A 1CX9A 4FNSA 3W84A 4Z1CA 1RD5A 4TMBA 1C8VA 2QR6A 3O6DA 3NA8A 1AL8A 5IM51 5D04C 4TMCA 4IPIA 4DO6A 1O95A 3W1TA 1EA0A 3MYOA 1MEHA 4Z0JA 3P7YA 3TC7A 5CPOA 1YADA 1KV8A 2EGZA 3UY7A 3NM3A 3CC1A 4O14A 4LRSA 1VCVA 2VFHA 5C2XA 4N9EA 1OFDA 2QF7A 2WJZA 4UTUA 5D2TA 1GTHA 1EP2A 3T4CA 1FDYA 5HUPA 1TTQA 2ZBTA 1WA3A 1I2OA 3N9RA 2PRHA 3EB2A 4IXXA 3TQ0A 3IGUA 3G1VA 3TQVA 3C6CA 3WJSA 1VHNA 3HMJG 1XBVA 4UFKA 2FPYA 2JKPA 2A6LA 1LZOA 5G2IA 3PG9A 1MEIA 3HPSA 3L2IA 4O1CA 3C8FA 5F1VA 3VNDA 5LKYA 1IXOA 3TFXA 4JX6A 3NO5A 5BOOA 3W2NA 3NOEA 1JCMP 2Z0IA 3EKZA 2Q3RA 4AHPA 4I9AA 2WNQA 2QUUA 3LX9A 4NX0A 1GWJA 5AHMA 1YPFA 1M7OA 1LM1A 4UCGA 1T96A 4UNLA 3PWAA 3UZJA 1JQVA 2CLOA 5LSMA 2QAPA 1OFQA 5DY2A 3GDRA 3KVJA 2ZDRA 3R2GA 1QPOA 3SGUA 1IXNA 3KRSA 2ZFAA 3PM6A 2E1DA 4JDBA 4JXCA 2H3DA 3UXAA 3A21A 1OX4B 5G4EA 1TMHA 1J5TA 5FEXA 5G1TA 4OGZA 5LNVA 1T0OA 3L66A 3S5ZA 2NXIA 3QEZA 2C1HA 5EPDA 1GEQA 2GQ9A 4O57A 2A7NA 3A5FA 2O7SA 4JTHA 1K8ZA 1WBJA 3LTYA 3TE9A 1KW1A 3TXVA 3EWWA 1TPFA 1IXPA 3GR7A 5C54A 3SJ3A 4YLWA 3GXPA 2ATMA 2Z6JA 3QRHA 2B7NA 3NL2A 4NNAA 2XN0A 5I3KA 1PV8A 3RF9A 1DVJA 1SZNA 3M6YA 2QUTA 1BTMA 5E0KA 4Y6GA 3W74A 1ME7A 2Y7FA 4DELA 2A21A 1JRCA 3TX9A 1T8XA 2H8ZA 2WNZA 1GG1A 2VFEA 4I7VA 5K9DA 2ZZ7A 4Z1DA 4NUWA 1VGAA 3WJWA 1K7XA 1ME8A 1H5YA 3W7RA 5E1QA 3GX9A 3LCWA 4ZQMA 5J5RA 1O5KA 4LVGA 1X1OA 5DLCA 3M5VA 4BI7A 1LCOA 1KFJA 2KZHA 2JKEA 3WFAA 4HPXA 2JKAA 1QAPA 1HL2A 2VKZG 3NL5A 4BF9A 3IGSA 4X3ZA 3AJXA 5K9XA 3S1WA 4S2CA 3KFTA 3ABRA 1DJQA 2OJPA 3B06A 3QW3A 4UFIA 3HPXA 4O4VA 3W1UA 3HQ1A 1WV2A 3C2EA 4H4IA 1LROA 4QSHA 3IVUA 4YMZA 2V81A 4LC6A 1NF7A 1UUMA 4LC8A 3HG4A 3LB0A 3EXTA 3NQMA 3FKKA 2NXHA 2QJIA 3O1NA 1R2SA 2NV1A 3G22A 5K4XA 4UFHA 1TPDA 4IOTA 4JIPA 5F2IA 1SFJA 3QSTA 3BG5A 2FQIA 5C6MA 4HT3A 4BI6A 3P84A 1EP1A 1NVMA 4GXMA 4FF7A 4IUOA 4ONVA 1YXCA 3R89A 1LYXA 3DAQA 2ZZ1A 1EEPA 1EIXA 3B4UA 2WOQA 4N4PA 2CLKA 3HGSA 3CU2A 1G69A 1H7PA 3GDTA 5CZJA 4HHPA 4IX0A 1OFRA 2GJNA 3CM4A 3EX2A 3C2FA 4AB4A 2YFNA 3STCA 2CZ5A 3TKFA 3DFPA 1G6CA 2X30A 4KFPA 4QNWA 3T40A 1W3TA 2VC6A 2V0TA 1FQ0A 1THFD 2NV2A 5HNRA 3I7RA 3W87A 1H7OA 3SR7A 5K4ZA 1Q6QA 1LRQA 3PULA 4OU1A 1EUAA 4M6VA 3DI1A 1BWLA 4N6EA 4JTKA 4E2DA 3G18A 1TYGA 5H91A 3O63A 3TR2A 4AF0A 4JYEA 3INPA 2W6RA 4TIMA 2CLEA 2BWGA 1AW2A 5CZ0A 4NT0A 1EUNA 3DFSA 5D05A 1TIMA 3TW6A 4IMDA 2IQTA 3W7PA 1XBYA 1VC4A 3GNDA 1ZJIA 4ZQRA 3N3MA 4IMEA 2Z1BA 3ELFA 3L21A 3N34A 3P67A 5J5DA 5LNSA 3A9IA 4HNUA 3C2OA 4NU7A 1YXDA 2ATSA 2E5DA 6TIMA 3G1HA 3NQEA 3P8IA 2HTMA 3DXIA 2ZZ5A 1A5BA 1UB3A 3W6YA 2Z2UA 5IBXC 4PEKA 3A5VA 3VE7A 3JS3A 3PSVA 2G95A 2CLFA 3L65A 1B3OA 3I6RA 2W0UA 1KM5A 1VYPX 2NWRA 1PCKA 4Q4KA 2JGQA 1K8YA 2JBMA 3FA5A 3S5NA 3KVKA 3FYOA 4NJKA 1GQNA 2X1UA 3IV3A 1G67A 3G1XA 2B0MA 1D9EA 2A0NA 3UWUA 3N73A 3C3NA 5EBUA 3DH7A 3M16A 1PVNA 2D73A 2WSRA 2QCEA 5AYZA 1WXJA 4R34A 3VFLA 3USBA 3L0NA 2NX3A 3SIZA 4AH7A 3TH6A 2WV8A 2ISVA 5BRBA 4UFMA 5I3JA 3W7JA 2NX1A 5D30A 3TMQA 1I2NA 5BMWA 1PL9A 3P5YA 4CLMA 3HGOA 1TQXA 3CWNA 1WOAA 4RX0A 4NXKA 2DJXA 1B57A 1DKWA 3QMTA 4UFJA 5KZMA 2JK2A 4RJEA 1SO4A 5HQEA 3CT7A 3HG5A 3A23A 4HNVA 2BZNA 3U6WA 3W7HA 1LBFA 4YL2A 2NWSA 3EWBX 4KWWA 3THAA 4JTEA 3T7VA 1R2RA 1E51A 2R8WA 4ZMGA 4WY0B 1KBIA 2J9XA 4FX6M 1M5WA 4IPJA 1TPH1 4IMFA 1I2RA 3W76A 1AW1A 3MJYA 3CIXA 2VENA 1W54A 4DBDA 1RQBA 3VCRA 3B05A 3TU9A 1QPQA 1G7VA 1AG1O 2ZA1A 3W1LA 1F74A 1FWWA 2VFDA 4A29A 3UWVA 2DP3A 3QYQA 1UBSA 3L68A 1YDOA 1GZGA 3ZS4A 3E96A 5I3HA 2QDGA 4IXHA 3OG3A 5AC7A 4R33A 3OHIA 1RVGA 3GK0A 3TJXA 4ZVJA 5CSRA 1RZMA 3L5LA 1TO3A 4RZ4A 2ZRVA 1L6YA 1SSDA 1ML1A 3DKLA 4GC4A 3G3DA 1OABA 4UFLA 4JN6A 2QJHA 1B9BA 1SW0A 1H7NA 2WO5A 3LHTA 5H2ZA 4MLJA 2ZZ2A 3W7CA 3MO7A 2WPBA 1ZFJA 3GXTA 5AYYA 1H63A 2A5HA 3NQCA 4K37A 4PFMA 4E2BA 1OFAA 2QJGA 5I3FA 2HMCA 1ZENA 3LI1A 2F84A 2ZRWA 1GVSA 3QJAA 4UUIA 1IIHA 3UPWA 3IGXA 1RV8A 5CPMA 5DBUA 1LTDA 2G5WA 3PBUA 2V2DA 3IEBA 1NEYA 1FCVA 1B4KA 2G97A 4RR4A 2OZ0A 1EPXA 1LP6A 1TPEA 3E12A 3LLDA 1VH7A 1H1ZA 3TDFA 3CB8A 3NEVA 3SZ8A 5DY3A 3DZ1A 1P0NA 5HINA 1X6UA 2ALDA 4NJIA 1H1YA 1XKYA 1TREA 4Y8FA 1YTDA 2DZUA 3O16A 3KOFA 4K7VA 5F4XA 4BWLA 1P0KA 3SFKA 5HR6A 1PCWA 4GUFA 4CNOA 3NL6A 1EWEA 1PE1A 2E09A 2ZRUA 2FJKA 3HF3A 4JTLA 4B5NA 1VCGA 8TIMA 4WD0A 1HO4A 4FNRA 4QNEA 1OFOA 3ZFHA 3EX6A 4OE7A 1WDWA 4XTDA 3VKJA 5D02A 2A2IA 2H90A 3WJYA 3M1ZA 3OIXA 4N9CA 3MHGA 2J6XA 3S9YA 2A4AA 1SW3A 5EL1A 3L5MA 2PE4A 3NL3A 3GAKA 1FWTA 1BWKA 4MLRA 3EEGA 1K03A 2J9YA 1XDLA 1L9WA 3QQ0A 1IXQA 3NQFA 1N8FA 5I3IA 1R46A 4GNJA 1KM3A 1F05A 1LDCA 3F4NA 1QO2A 4FXSA 2Y62A 4JTGA 1C29A 4WJEA 5LNWA 3ZWTA 3DFNA 1ONRA 5KMYA 4PC8A 3UZ5A 4Q33A 4RZ5A 1XM3A 3O6YX 1MZHA 4FNTA 1JRBA 2X1RA 4MJMA 3EXRA 2I9EA 4UMAA 4QM1A 1W0MA 1SO3A 2J88A 3LDVA 3NPWA 4AHQA 1ICPA 5DELA 4K38A 4EOUA 2FIQA 2QCHA 3LOTA 4UTTC 2YX0A 1A53A 1GVRA 2C6QA 2EAWA 1YDNA 2V5LA 3S1UA 2YFOA 3S1XA 4GE8A 4GBUA 1JUKA 1MSSA 3W23A 1QPRA 1VYSX 2YCEA 4DF1A 4IX2A 3EWUA 1KFKA 1LORA 3DFTA 4A2RA 5K9CA 5KZDA 3JR2A 1UASA 3NYZA 2YW4A 4N2YA 4IQLA 4MUZA 1AL7A 4Y9AA 3NQVA 2NLIA 3M43A 2OMAA 3MW7A 3WK3A 4O13A 2V2HA 1GJPA 3JRKA 4BI5A 3W86A 1NFBA 3TIMA 2GUUA 3B0PA 1VJIA 3P81A 4UXDA 3P80A 5L6UA 3OVPA 1PIIA 1W3IA 1ZAJA 4JTJA 1ICSA 4YCPA 3FS2A 4Q32A 4OV9A 4UR8A 4O12A 2Y61A 2I1OA 3I7SA 5AOUA 3W75A 2CZDA 5F2LA 4N4QA 3SGZA 2Y85A 4ZQOA 2UV8G 3WJXA 3ATYA 3EKLA 2NUXA 3BG9A 1GPWA 1JUBA 1VLIA 1QMLA 3N19B 4LVBA 1L2UA 2J27A 3MMTA 5DN1A 1YXYA 3LXBA 3O05A 3CEPA 4DO4A 3MI2A 3MI3A 2QCDA 4NXSA 1GT8A 2V30A 3OVRA 1XBXA 2A7PA 3BO9A 2B7OA 3DKJA 1SFLA 4AAJA 3PUDA 2R14A 1ADOA 4JTIA 3MHFA 3W7DA 1KM4A 5MHBA 3E0IA 3W71A 3MHUA 4AWUA 1P5BA 4WY0A 3QPZA 4O53A 3NVTA 2E68A 3LRLA 4QIUA 5FEPA 4DQWA 5LHFA 4CCDA 3TSDA 1S5VA 3W3OA 1XUZA 2DZWA 4BFAA 3PAJA 1KTCA 2QUVA 3G1YA 3Q2DA 1VR6A 3KVMA 4S2BA 5KITA 4RK8A 1MXSA 3GR8A 3NQ8A 5G5IA 2TYSA 4UTIA 1CW2A 3LCHA 5FF4A 1GVQA 3D0CA 3DI0A 4L4MA 5AC6A 3CPRA 3QW4B 2YW3A 5A8GA 4WXYA 3LHZA 1Z42A 2Q3OA 3NGJA 4LV4A 4MZ1A 4WOQA 4A22A 4R53A 5HWNA 5KZEA 4TR9A 3UNDA 1A5CA 3HJZA 3PUOA 1OX6A 1XL9A 4KKXA 3LHYA 4P2VA 1FX6A 5D2WA 1DV7A 1JULA 3QMRA 4JY9A 3S5OA 2NXGA 5AHEA 4JEQA 3LCGA 4O4WA 3W2MA 2G96A 1F6KA 4QJ1A 4FX8A 3PG8A 3UWZA 5K3VA 3KHJA 3PC0A 4IMCA 3GDMA 2RDWA 1HFBA 2GQAA 3F1QA 4OBTA 3W1NA 1F5ZA 1YPIA 2BSLA 5AC8A 2Y7DA 3C0JA 3AO0A 4HN4A 4RV8A 1FWNA 4EWND 2A7RA 4UTJA 3M7WA 4O50A 1QO5A 3STGA 1SW7A 1QFEA 3HGJA 4LUIA 3LHWA 4A2SA 2TMDA 2I14A 3EX1A 3QF0A 1IGSA 3MP4A 1L6WA 4O0KA 3NQGA 5CGQA 1GOXA 3BARA 3LTPA 1I2PA 3ABSA 1JCYA 3P5ZA 4PH6A 3F4WA 1VPXA 4R7JA 3W7NA 3CEUA 1TTIA 1W3NA 4DO5A 3QFEA 1VS1A 4O15A 4UTKA 1NF0A 2FPVA 4Y90A 1L6SA 3EWZA 4NQ1A 2XN1A 4O52A 5EY5A 1TCDA 3DGRA 3G1SA 1RQHA 4DPQA 3C4UA 1XUUA 3FJLA 2Z6IA 3C2RA 1W8SA 4TU1A 5EMUA 1O5XA 3GLCA 1SO6A 2VEMA 1OYAA 3TJLA 2QDHA 5AN7A 3A24A 3E49A 1TSIA 2A1YA 3TXZA 1OYCA 1OHLA 3W7OA 1CI1A 4UTWC 3WK1A 3NM1A 2FPTA 3Q37A 4MZYA 4JR5A 2Q8LA 1YDVA 2J9ZA 3BW4A 1KA9F 4DXVA 1UCWA 3FEMA 4WOZA 1YTKA 3E9AA 2H8XA 3O15A 5FF7A 3TAKA 3NPVA 4K8HA 4K39A 3TSBA 4CCCA 3LGEA 1FWSA 3ANYA 1HO1A 4FB7A 4RLIA 5KSWA 3PBWA 2NUWA 1EP3A 2PCQA 5ABTA 3A22A 3PBVA 4LRTA 3HPZA 3VI2A 4ML9A 1QPNA 2QCLA 1UJPA 2P10A 3GDKA 4FEZA 4GUIA 5AB3A 3C52A 5LGXA 1H50A 3B0UX 3QMSA 3M41A 3WK2A 3GB6A 4K6AA 3DHFA 3I7QA 5A5WA 3OBKA 4FHAA 2QKFA 1O4UA 3EX3A 3FJ6A 4P61A 4QITA 3O8AA 3DFQA 2X1SA 5F4SA 1LBMA 5AHFA 4GJ1A 4XKYB 4FIRA 3P74A 2HSAA 3Q58A 3UWYA 3B0VC 4AMAA 3LI0A 4AVFA 4O1DA 3FIGA 3L5AA 3G1DA 1K7EA 4OQVA 4Z08A 2ZYFA 2ZA3A 3C61A 1S5WA 3LRMA 4XZ9A 3TQKA 1DQXA 4LT9A 3LM7A 4LVDA 3NQ6A 1TTPA 3TC6A 4O16A 3W2LA 1ZCOA 3RLUA 1ZAIA 3DU0A 3SECA 1R30A 3M44A 2TSYA 3L9CA 5HWMA 3PSWA 2V9DA 3S5YA 4M5PA 2ZRXA 1GTEA 1PHQA 2QCDB 3LXAA 1VYRA 3DENA 3Q94A 3BW2A 4Z1AA 5DXYA 1ALDA 1GYNA 3G24A 3W7EA 5DCEA 4DEFA 1H51A 3K30A 2ISSA 3PR2A 1AK5A 4NJHA 3QC3A 4JX5A 4HSOA 4POCA 1GVFA 3NQAA 4KFNA 1Z44A 2HS8A 3CIWA 4Z0SA 1EX5A 2X2GA 3TUUA 1VZWA 1KTNA 1D3GA 2P1FA 2QCFA 1J2WA 1SO5A 3C2VA 5GVJA 4YWIA 3GIYA 1ZAHA 4AEOA 3CTLA 3NXFA 2TPSA 3EWYA 1I8JA 3TA6A 1H7RA 3W7LA 3GXNA 4X22A 3N14A 1A5AA 1MEWA 1FWRA 2RKXA 1LLWA 4DBEA 3G0XA 1JQXA 3W7KA 4LS0A 4O10A 1I4NA 1FDJA 4PODA 4ZL1A 3V1PA 2BLEA 4FNPA 3LCFA 4NZFA 5E93A 4CQ9A 4LY8A 3QH2A 2OX1A 4CNNA 1G7UA 4K7YA 1LOLA 1XDMA 4EF9A 3E02A 2EF9A 2QCGA 4Z1BA 5L9FA 4DF2A 4CQ8A 4MYXA 5AFDA 1OG0A 1W31A 1ZALA 5EKYA 1LOSA 5AYXA 3W7MA 2E6DA 3MI6A 4U28A 2Y63A 3BLFA 1SPQA 2QCMA 3L0KA 3TV8A 3MBFA 3KXQA 5TQLA 3V75A 1H61A 3TK7A 5LGZA 3UD6A 4JNMA 3HO8A 4JTFA 1F76A 4MY9A 4ZQPA 2B7QA 1OX5A 4JYFA 4HNNA 4U4MA 3CQ0A 1DHPA 3MUXA 4WY0F 4PA8A 5FF0A 5EYWA 1Q45A 3IIVA 3WK0A 3NR0A 3LRKA 4XBSA 2QAFA 4FNQA 1IF2A 3H55A 4C1LA 5T26A 2RH9A 4IWWA 1KV5A 4JY8A 4BWLC 4LU0A 1V7YA 2YGYA 2E77A 3RMJA 4E38A 4OT7A 2J24A 3HG2A 4WZHA 1DJNA 3LV5A 2ZTKA 4HPJA 4L4LA 2BX7A 3LCXA 3LBMA 2C15A 3BK0A 3M5YA 1I45A 3OVQA 5AHNA 1OK6A 3IRDA 4S1FA 3LLFA 1W56A 5DBTA 2GQ8A 2YXGA 4MY8A 3BLIA 4RXFA 4ADUA 4GFSA 2FFCA 3UPBA 1W5NA 1DORA 4WQ6A 3STEA 4EIVA 1QDSA 3LCLA 3W2JA 1GVOA 4XQ6A 3W2KA 1K7FA 5U4NA 5CZTA 3FKRA 1OJXA 1KM0A 3RU6A 1K8XA 4XUGA 1HUVA 1SU5A 1SR9A 4O17A 1F7BA 4LWWA 3MBDA 2GJLA 3G0UA 1J4EA 2CW6A 3C56A 1EB3A 3QSRA 4QISA 1OF6A 1AW5A 3NZ1A 3W22A 2ZQ0A 4XWUA 3I65A 1W5PA 4N02A 1K3UA 2B4GA 3EX4A 3W1RA 4MPQA 2CFFA 2BXVA 2CLHA 3QZEA 4MKNA 4MZ8A 4OWGA 1VLWA 5DCDA 4UTHA 2DJLA 3BGGA 1Z48A 3IIZA 3PY2A 3W83A 2H6RA 3LXCA 3KRUA 2Q8ZA 4ORMA 1W5QA 3UXDA 3BG3A 4AXKA 2CLIA 4RXGA 5I3GA 2WSQA 4A3UA 1OFEA 1XXXA 3TROA 1Q3NA 1A5SA 2VXNA 5HJLA 2V82A 3UY8A 5D37A 3CLMA 4UTTA 2A6NA 1ZHAA 5DXXA 4XBKA 1TRIA 5CZSA 1P1XA 3MP3A 4XKYA 5HMSA 4J9JA 2X1TA 2VELA 1U5JA 2AGKA 3S1VA 3DBPA 2E5CA 2ZCGA 3TCEA 1VRDA 2JGYA 4ALDA 1F73A 3WJZA 3N2MA 1FCQA 4NVTA 4ADTA 2Y6ZA 2C19A 1R2TA 1TV5A 3L67A 4H3DA 4N9DA 3NPUA 4KWVA 4AHOA 1F6PA 4EVZA 4JTSA 4E0CA 3TSMA 4XTIA 1XFBA 3DFOA 4LW7A 3S6DA 1SUXA 4N9BA 4IGHA 1P4CA 1A50A 3SY5A 3STFA 3BPWA 3FOKA 3ABOA 3W72A 3W88A 2GVLA 2NUYA 5SWUA 2W79A 3ABQA 4RKAA 4EF8A 1Q6RA 3EWXA 4FXRA 1WAUA 2HS6A 3CWOX 1GG0A 2CU0A 1ICQA 1SZEA 4ZZ9A 3W1QA 3ZR4A 3I68A 4JS3A 1M7PA 1KFEA 4AWTA 1FXPA 1W5MA 1SZFA 1FCUA 2E5BA 1IIGA 2WNNA 1XC4A 4O11A 3L0GA 1YTEA 1PHWA 3RK8A 2OT0A 2DZXA 2YDAA 1EWDA 3RLVA 4PL1A 2GOUA 5D03A 4O8RA 3THQA 3NG3A 2GVJA 4ORIA 3SI9A 4GRSA 2WSYA 1G4TA 4RZ6A 1VQTA 5CG7A 1TB3A 1AMKA 3IVTA 2Y88A 5F2GA 1U83A 2ZRZA 4M6PA 1N7KA 2FLIA 4D2JA 2GPTA 4GUJA 1KM6A 4MVAA 4CCEA 2YZRA 3U2OA 4ADSA 4ZQNA 4TO8A 2ISWA 1HG3A 3O07A 7TIMA 5BNKA 3P82A 4N6FA 1FXQA 1QCWA 3LBCA 3HIJA 3GZ3A 1T99A 4NZJA 3M0ZA 3NAVA 1HTIA 1RQEA 1W1ZA 5TIMA 4GWEA 4LVAA 4JGDA 1RR2A 2BTMA 3H54A 4JTUA 2YPIA 1KTBA 4UIOA 2F7FA 1OK4A 3UYCA 2EKCA 1PS9A 3P61A 4X2RA 4NJJA 1TPUA 1XCFA 1JCJA 3W7GA 5F4WA 1B4EA 4NX5A 5D2YA 2A85A 3PVFA 1H62A 4HKPA 3W1MA 5F1UA 3N2XA 4LS2A 4YCOA 1TJPA 1LBLA 3B8DA 1WOBA 4ICNA 1M6JA 3W1PA 2EHHA 2E6YA 1DQWA 1JVNA 5D2XA 1NAL1 1LOQA 5BW6A 2ZTJA 2YR1A 2P0OA 5HULA 3RFAA 3GNNA 4YXGA 4NJGA 4HNTA 2C14A 4FNUA 5D33A 4IMGA 5AHLA 3ATZA 3PUEA 3W2UA 3PBYA 5D38A 1W5OA 4LNYA 3U8GA 2AAMA 5HR7A 5G1YA 1N55A 4PL2A 2DORA 4JIQA 1TPB1 3LHVA 1FUYA 2ZA2A 2TRSA 2C18A 3P62A 4HIBA 3S42A 4H6KA 4NNCA 1G4SA 1YYAA 2Y7GA 4NNBA 1XBZA 2CLLA 1OFPA 2CZEA 4UTLA 3GYEA 1MO0A 5CPLA 2R91A 2LLEA 3O6CA 3W9ZA 5FF2A 1FDZA 1GYLA 3R5EA 1FY6A 1Z41A 1ZY9A 4OHQA 3G0SA 3MWAA 4RCXA 4JX4A 1JUEA 1I2QA 1W37A 2GVGA 2ZRYA 1TQJA 3SW6A 3KAOA 1LLZA 1QNVA 2V2CA 4LV9A 1JCNA 2C16A 4UTWA 3W73A 2CWNA 2H3BA 5U7SA 5D32A 3NQ2A 5CKSA 3G8EA 2RHGA 4MYAA 5EA9A 4UR7A 2YSWA 3YPIA 4M6QA 3CHVA 1X7FA 1O60A 2C3ZA 4LUJA 3TNOA 4O1AA 3FFSA 2E6AA 2E6FA 3H53A 3TAOA 4LTSA 4MJZA 1BKSA 3NPXA 1NSJA 1F2JA 1KFBA 4FX7A 4O1BA 1S5TA 2QEZA 5K7JA 5IBXA 3R13A 1RPXA 3FYPA 3HB9A 3HGRA 1TPVA 3M47A 5G4WA 4W9TA 2Y89A 3F03K 5AHIA 1Q6OA 4DPPA 2PC4A 5FI8A 2XN2A 1QOQA 3T44A 4JTTA 4JICA 1H60A 5LNUA 5KTLA 3RNDA 2AQWA 2RFGA 3TFCA 4GUHA 1YLVA 3ZWSA 4UMCA 1KBJA 4JYDA 3NQDA 1XI3A 4M19A 3IIPA 3QM3A 3BGJA 5LHEA 1KLYA 3UQNA 3W7IA 3LV6A 1G4PA 1Y0EA 1ME9A 3QPYA 4QAIA 2NX9A 4DF0A 3PB2A 3OA3A 2OT1A 3GVGA 1WYIA 3DHDA 5FF3A 5FEWA 1JR1A 5HUOA 3BVJA 1X1ZA 1DBTA 1TV7A 2FB3A 3W7QA 4ZQCA 2YYTA 4HSNA 3OEXA 1SQ7A 2DZPA 1D3HA 3UWQA 2O7QA 1X8FA 1KLZA 2XFWA 5DCBA 3SSJA 5FEZA 1WBHA 1SSGA 4I7UA 3G1FA 2PRMA 3MYPA 4BK9A 1S3HA 1C9DA 2CLMA 2FB2A 1OX4A 1TTJA 4IJBA 4LOCA 5G2HA 3NQ7A 2VFFA 3S0CA 4X9SA 3BLEA 3LTSA 5LNRA 1FBAA 1OF8A 3R8RA 4MIMA 1KFCA 2B7PA 4K36A 3P8JA 2WKJA 5G2WA 3M5ZA 2VEKA 2RDTA 3LCIA 3KVLA 2ZZ3A 1UUOA 1WQ5A 2ABAA 1R47A 4QQ3A 1G4EA 1KFLA 3HG3A 5CSSA 4AWSA 4FO4A 1O94A 1FCBA 4BR1A 4GUGA 2DU2A 2OCZA 4Y96A 4CQAA 5FESA 3IIOA 4K8EA 4UC5A 5C55A 1Q6LA 1WX0A 2ZZ4A 4JD4A 5CPNA 3P60A 1JCLA 3FLUA 3KRZA 1H7XA 4O54A 2VOMA 3W70A 3TMLA 3M9YA 3LHUA 3NDOA 4O19A 3T55A 2DZTA 3IVSA 2VEIA 2FTPA 3GKAA 3R12A 2PURA 3NNTA 3VE9A 1BEUA 4WUIA 5HWJA 3W1XA 5LZLA 4KFOA 4MY1A 1H7WA 4A21A 3GKFA 3T78A 3W1AA 5KINA 2V5BA 3O06A 1V5XA 4OV4A 4I7WA 2ZZ6A 2VFGA 3M5XA 4C1KA 3IIXA 1LRTA 3BV4A 3UWWA 3W07A 3TW7A 4O0ZA 2X16A 3NZRA 1VHCA 4O18A 2Y7EA 4WXZA 3MP5A 3G3MA 3G8RA 1TPC1 1JCXA 5K2ZA 2Y70A 3EXSA 3QQ1A
chains in the Genus database with same CATH superfamily
3TYAA 5D09A 4UMBA 3HBLA 1JJKA 2VR4A 3BW3A 3UG4A 1UPMB 1SFTA 2QT3A 1DXFA 3RX4A 3UR7A 2OVLA 3S8HA 1HQTA 1K02A 3PNUA 4CD4A 4UQDA 2BY3A 1OVDA 2RDUA 5D2VA 3SGGA 1XYFA 4LVFA 2R9RA 4WDWA 1EXBA 3BANA 2A3CA 1KM2A 3NDYA 5AVNA 3VA8A 4MFEA 4YTRA 3K1GA 2X40A 4FIQA 3N9SA 1YPXA 2PRLA 1XJBA 2VEPA 2Y8KA 4QBXA 3GAYA 3M0YA 2OO6A 3MUAA 4UTMA 2FHFA 1UKTA 3TYEA 1SJBA 1WP6A 1PX4A 2YL9A 3CT2A 2ZWYA 5C9XA 3NA8A 5IM51 2WMKA 3CZEA 1M3UA 2OX4A 3CUIA 4TMCA 4V1XA 1ZL1A 1UR1A 3P0WA 5DMLA 1YADA 3ARYA 4LGXA 2X0HA 3NM3A 4B3LA 1ZJHA 4QFUA 3CC1A 3O9NA 2EG8A 4LRSA 2VWSA 1FWJC 1BQGA 1OFDA 1V02A 4UTUA 4XD5A 2JF6A 4J7RA 2BBFA 4FK9A 2EG7A 1GVIA 3UWEA 1XRSA 3AU6A 3N9RA 4IXXA 4H6RA 4GPNA 3G1VA 3WJSA 2R1MA 1VHNA 1P6CA 1XBVA 2FPYA 3R25A 4NAFA 1MEIA 4S39A 3HPSA 3UGVA 1KRAC 1OCBA 4HU4A 1VFTA 4LYKA 1OCJA 5LKYA 4DZAA 4C6MA 4J5NA 4QG9A 1KGUA 4EXAA 3K46A 5EGRA 4GX9A 1BD0A 4C6BA 4AHPA 1TFVA 4DYJA 3LX9A 3AMKA 5AHMA 4RDZA 1YPFA 1Z69A 1IWPA 5IHSA 3PWAA 4HPNA 2CLOA 5DY2A 4F0SA 3QR1A 5LIYX 2ZDRA 3SGUA 3ES8A 4TQTA 2H3DA 5G4EA 3RLHA 1TMHA 1EJTC 5G1TA 4OGZA 3L66A 2NXIA 4B9ZA 2WB5A 3WLLA 4CU8A 2GQ9A 2PDBA 3GIPA 1XYMA 4L4PA 3VIFA 3ITXA 3W82A 3VX0A 2G3NA 3TONA 4IQEA 4IIEA 2AAAA 2ADAA 4YLWA 2Z6JA 2GJXB 1GKQA 1J0HA 5I3KA 1BPLB 1DVJA 2PZ0A 5M17A 2QUTA 2Y7FA 1JG9A 1JYWA 5BU6A 3WMCA 2PDJA 1GYMA 4Q8OA 2GZXA 3TX9A 3WLKX 2OSYA 2WNZA 1GG1A 4I7VA 3CQIA 4UZUA 3AXIA 3A4XA 1H5YA 5E1QA 1O5KA 5CSUA 4FALA 1H0GA 5DLCA 2VGFA 3MJMA 4HOXA 4ZSUA 2JKEA 4HA4A 4AUBA 2ZUUA 2VKZG 2BXZA 1E4IA 4S2CA 1DJQA 1V03A 2OJPA 3B06A 1Y7VA 4H8VA 3QW3A 2DDXA 4HJFA 4HU8A 3W1UA 4XZIA 1XLFA 3QV8A 3C2EA 3GC4A 4ZXLA 1UUQA 1AJ2A 4QSHA 5IHRA 4HK6A 3IVUA 4YMZA 5KEZA 2PDYA 1WDDA 3LB0A 3NQMA 4AD2A 1IEVA 2QJIA 1T5AA 3FYYA 1JDCA 1TPDA 1JL8A 3WDIA 1VBGA 3VCCA 4D6FA 4DZHA 3IJDA 3KTXA 4XAZA 4G7EB 4FF7A 3BAWA 4WSKA 1CGWA 4IUOA 3F4CA 3R89A 2D22A 5KETA 2XFFA 2ZZ1A 1EIXA 3KL5A 2CLKA 1G69A 1H7PA 3GDTA 4FOKA 5CZJA 1VFUA 1XD0A 4AB4A 3M4HA 5JBEA 1UR9A 3TKFA 5D9MA 1GGOA 1G6CA 4QNWA 1HKWA 2ZUTA 1TKKA 1C93A 1JFHA 2NV2A 3UR2A 4Q8NA 1G1YA 5A8MA 3PULA 1TVNA 3DI1A 3GD6A 6REQA 3H4XA 4E2DA 3TR2A 3STPA 3CYVA 4TIMA 1UD3A 4Z2HA 1EUNA 2FHBA 3TW6A 1BKHA 2IQTA 2V38A 1RHCA 1VC4A 4ZQRA 4DJDA 3L21A 2QXWA 5LNSA 3ITVA 3C2OA 3OQ8A 3NIYA 5I0DA 3IGHX 5TD4A 2VX5A 2IKGA 1XYAA 4RW3A 1L8NA 2ZZ5A 4J3WA 1FVPA 4H9UA 3WNMA 3S83A 4KT2A 2HISA 4ZO8A 3V5CA 3A5VA 3VE7A 2O92A 2F6KA 2G95A 3GG1A 5I02A 5GPRA 1B3OA 3L23A 3I6RA 2QPSA 2NWRA 4Q4KA 2JGQA 3VCNA 2OWCA 1GQNA 3DG7A 3W81A 1E0WA 4YTUA 1R9ZA 3N73A 1UP3A 4LAUA 2DV0A 1RXOB 1S2AA 4B15A 2PTWA 3RGTA 2Q09A 3AHVA 1U5HA 1WXJA 5AYZA 3UVIA 3USBA 4A8LA 1IEWA 4KWOA 1M7JA 4UFMA 1MRAA 1MNSA 1K9TA 4JTCA 1E1CB 3WQ6A 4D71A 2PTYA 2VD9A 3HGOA 4B2DD 1TQXA 1MDRA 2I9UA 2C7FA 4Z2KA 3V7PA 2DJXA 1B57A 1DKWA 5KZMA 3K4DA 2A3AA 1E6QM 1CT5A 1U5VA 1IEQA 3GXFA 4AZ6A 4PBFA 3A23A 4QP0A 1EYWA 2BZNA 1KR1A 3PZMA 5REQA 3W37A 3EWBX 3THAA 1KQZA 4C6JA 2J9XA 1M5WA 1PBGA 2HV5A 1TPH1 5C71A 4IMFA 3CIXA 1TA3A 4DBDA 1XLBA 1A4MA 4XZNX 1A0EA 1QPQA 1G7VA 2YXOA 2ZA1A 4A29A 1UBSA 3EYPA 3QTPA 3L68A 5M1TA 3ZS4A 4PUWA 2W5FA 3OG3A 3SCNA 3SFWA 1AJZA 3GK0A 1V6YA 1BFNA 3L5LA 4B5WA 4RZ4A 3EPMA 3G3DA 2Z1KA 1J11A 5LIXX 4IPPA 1D8CA 1R9XA 1L0PA 4EAYA 1YQ2A 3FVMA 3LHTA 4IP5A 5ECVA 3CZ8A 1O6IA 3URQA 4MLJA 1YE4A 3R1ZA 4FS9A 1BXCA 2A5HA 1DJWA 1W32A 4FSAA 5C7VA 4D9PA 4AWEA 5LIWX 3LI1A 4XB3A 1GVSA 4UUIA 1IIHA 2XIQA 3IGXA 3UPWA 5DBUA 4U10A 2CBIA 4RR4A 4DXXA 3PZQA 4JFTA 3E12A 4PMRA 3TDFA 3AIVA 1X97A 5DY3A 5T8GA 3RJYA 2PU1A 1H1YA 2V69A 1TREA 4Y8FA 1MQQA 4S23A 3GTNA 4K7VA 3WMBA 3SFKA 4WVXA 1PJ9A 3L4ZA 4DAIA 1V93A 1WPCA 2F9RA 1B1YA 3PN8A 3TWAA 4PB5A 3HF3A 1W1B1 4H83A 3DG6A 4WD0A 2P53A 3CV6A 1OD8A 3DOPA 3FY1A 2OQLA 3M1ZA 3PTQA 4HA0A 3ZT7A 3FA4A 4ZCWA 2J6XA 1SW3A 1XC6A 3L5MA 3WZ0E 3NL3A 1FWTA 4MLRA 4XZHA 1L9WA 4QG6A 2G4FA 5I3IA 1R46A 1LF1A 3L4VA 1CNVA 3N15A 4NHVA 1UA7A 2FKPA 4JTGA 5KMYA 1SJDA 2HVOA 3UETA 5AZ1A 1E3XA 1UR3M 3BOLA 4OUIA 2ACUA 1EJWC 3RCNA 1W0MA 3ABZA 3GU1A 1JNDA 2FGLA 3NPWA 5DELA 4K38A 4EOUA 2TODA 2QCHA 1E5NA 3LOTA 4Q8TA 2HCVA 3N9KA 1QW8A 2V5LA 4GE8A 4IPNB 7TAAA 4IX2A 3EWUA 1M04A 4D1JA 1KFKA 4BA0A 4A2RA 4MADA 2INZA 4LYRA 3R58A 4NG3A 4MUZA 2GWGA 3NQVA 4J3TA 2DUXA 1XLHA 2YBTA 1RVKA 3KCJA 4O13A 3JRKA 1HGYA 2XH0A 4MDOA 3SRDA 3I6TA 3VNIA 2PTXA 1ZAJA 4JTJA 3S3GA 4O12A 2PDFA 2FHCA 4F2UA 2I1OA 1BSIA 1T40A 5F2LA 3BAKA 3OLEA 2UV8G 3K2GA 2GFTA 1T6MA 3GUGA 3OZOA 5AECA 3N19B 2J27A 3SN4A 3MMTA 3R94A 5DN1A 1LJYA 4DO4A 3VIOA 4M8UA 3VIPA 3CHFA 2XWDA 3OVRA 2A7PA 3H26A 2B7OA 3DKJA 1IHIA 1SFLA 3M0JA 4FMVA 4AAJA 1E4MM 2R14A 3MHFA 3BUVA 1KM4A 3MHUA 1P5BA 2J7DA 4WY0A 4O53A 4DJFC 2ONEA 4R88A 1QHOA 2ZVIA 3LRLA 3N18A 3KLKA 2BS9A 2X09A 2DZWA 4FI4A 1JZ5A 2GSHA 5KITA 4AVOA 4Z1YA 1U22A 3SRFA 4KCUA 3SY8A 2BOGX 5FF4A 4G5DA 4L4MA 3SN1A 3BMXA 3SCSA 2YW3A 3QGAC 4WXYA 2PWVA 2PDUA 3KHDA 1JZ3A 2FH8A 1A5OC 4TR9A 3UNDA 3IJIA 2IW0A 3B8SA 1OX6A 3ISIX 2PP0A 4KKXA 1N2VA 1GK8A 2OXNA 4F0HA 3UR8A 4P2VA 3DESA 5D2WA 5DRIA 2GJPA 4JY9A 3S5OA 2YCLA 3LCGA 3W2MA 1F6KA 3E2RA 2QMJA 1CLXA 3PG8A 5ABGA 3N12A 3WL1A 1MUMA 3KHJA 3MZ2A 3PC0A 3UERA 4K1GA 1W9BM 2E4TA 3T8QA 3W1NA 2W63A 1YPIA 1PKNA 3C0JA 4C6FA 4RV8A 1FWNA 1S2UA 4UTJA 3M7WA 4DUOA 4QCEA 2ZUWA 1QFEA 4ZFCA 2HJPA 4A2SA 2ZX7A 5C9WA 4M81A 3QF0A 1IGSA 1ISVA 4W8LA 4O0KA 2D1ZA 3BARA 5EMKA 3LTPA 2D2OA 4PH6A 3WF2A 1WB0A 3QFEA 2PP3A 2FPVA 3GG0A 1ISWA 3CTTA 5EY5A 3A12A 4DPQA 3C4UA 3FJLA 2YB1A 4KIRA 4XSMA 4PMNA 2NV9A 4GINA 4GVGA 1OYAA 2QDHA 5AN7A 1GPFA 4IP4A 2VYOA 4B5VA 3O7UA 3CPUA 4PMUA 1TSIA 1DJIA 2RJHA 3OB8A 3WK1A 5ABFB 3WQ8A 2PA6A 3BW4A 4OJYA 4WOZA 3RMEA 3XINA 3BZGA 5FF7A 2FH6A 3I3DA 5A6AA 1J6PA 4CCCA 1TELA 1R3TA 3V5OA 2ZXAA 1HO1A 2HK0A 3W38A 1SR0A 5ABTA 2W62A 1IYXA 1AD1A 2NVAA 2RUSA 3O6AA 1HL9A 4ML9A 1FWEC 3MDWA 2QCLA 2XIOA 3RUBL 2P10A 1W8GA 4FEZA 4QG8A 2IKHA 3M41A 3WK2A 4DNHA 4HQVA 2J7CA 2HXTA 5A5WA 3EMZA 2QKFA 5MF5A 4GKTA 1X38A 4C6DA 3FJ6A 4P61A 3O0FA 1B9ZA 4J40A 3T0AA 1LBMA 2X05A 5AHFA 4XKYB 3G5EA 3LEPA 4GI9A 2HSAA 1KBBA 1GJWA 3UGRA 1DWFM 4AMAA 3GTIA 4H7VA 2POTA 4LCQA 3L5AA 3H7VA 4WJ8A 3SCWA 1XPYA 3DCPA 4XZ9A 2WCAA 3LPFA 3WH8A 1US2A 1R0MA 3HFYA 3WQCA 1GOQA 3TC6A 3W2LA 1KBLA 2VZUA 3RLUA 2F6XA 3KRBA 4AD5A 3WSUA 1KCLA 3ZVHB 4CD8A 4G9PA 4P8WA 3S5YA 1FHUA 3FXYA 3KLLA 9XIAA 3LXAA 3Q94A 3BW2A 2AL1A 4Z1AA 2WJFA 1ALDA 4GYPA 4AD3A 4PYSA 1B3WA 1NWRA 3K30A 2ISSA 1KXHA 2G50A 4L65A 1WKDA 2WAGA 1AK5A 3QC3A 3MUZ1 2X7VA 1GVFA 3LG3A 1Z44A 2HS8A 3CIWA 1F8IA 3M0IA 3GFYA 2QCFA 4RNFA 5GVJA 4GCXA 2J78A 3EOSA 2PS2A 1E4NA 3PWIA 1BYBA 2TPSA 3EWYA 3W7LA 1F3WA 3GXNA 1E5JA 2POZA 1RA0A 2HBXA 1E1FA 3VD4A 4HCHA 2Y8VA 2WVUA 3F5JA 1CTNA 1A5AA 5DT7A 1Z89A 4AIEA 4BQ2A 1E43A 3KOWA 3W7KA 1QHZA 1RH9A 1I4NA 3LM3A 3CUZA 1OZQA 1FH8A 4B91A 3HA1A 1XDMA 5A8QA 3VZZA 2ZXQA 4X0VA 3OBEA 4DF2A 2OOGA 3TYZA 1JZ8A 2J7BA 1FP9A 1LWIA 3NZQA 1OG0A 4IJCA 1OQFA 3W7MA 2E28A 4U28A 1SPQA 5LA1A 2E9LA 3T09A 2X42A 4CQBA 4F0MA 3L0KA 3AROA 3TV8A 1DXIA 4QS6A 3TK7A 3UD6A 2VZSA 3K4AA 4HNNA 4IGMA 5DF0A 3VUSA 1AZ1A 4WY0F 4G7FA 5FJJA 5EYWA 1Q45A 2OEJA 3WK0A 3NR0A 4XBSA 2QAFA 3MKCA 1A3WA 4C1LA 3OLIA 3JUGA 5BOFA 2VZOA 1QWKA 2E77A 1HJVA 4YHGA 4L61A 2V6AA 3IUHA 4Q8QA 2BX7A 5CBJA 2BGNE 1ONWA 3DC0A 3FVDA 3WMLA 3N17A 3RX3A 1CLKA 3U2EA 1OK6A 3IRDA 1A5MC 2GQ8A 1XRVA 3VC6A 3TOYA 1ZZMA 1W5NA 3BLOA 1DORA 4LPCA 1IT8A 5XINA 3EWCA 1WCGA 3S6TA 4ZE4A 2PLCA 1BVWA 1W9PA 2XISA 1CPUA 4EPDC 3AU2A 3ITTA 2HNHA 1O12A 3STEA 5A2AA 1G94A 1RCQA 8XIMA 3W2KA 1K7FA 1L6FA 3BSHA 3RU6A 3DFHA 1SR9A 4EACA 1JYNA 1R5YA 3S2CA 5FSEC 1VIZA 3UEQA 3POCA 2CW6A 1TVLA 5FJOA 1OF6A 1ZSXA 2ZQ0A 1F4HA 3I65A 3M0VA 4N02A 1TG7A 1YIXA 1REQA 1FRBA 1ZRQA 1O7AA 2C79A 4MZ8A 4OWGA 4UTHA 2DJLA 3IIZA 4MUPA 4JFWA 4D6EA 4ORMA 1R3SA 2YXXA 3UXDA 5BXTA 3H2AA 2WSQA 3ZXWA 1Q3NA 5HJLA 1L2QA 2Y5EA 3KW3A 5I77A 3CLMA 3WLNA 4UTTA 2F6UA 4GGHA 1MYRA 1ISXA 4R5EA 3QV7A 3LSBA 3SUSA 9XIMA 3VC5A 3DBPA 2ZCGA 3TCEA 4JQ3A 1VRDA 4ALDA 3VNKA 3WJZA 1FCQA 4ADTA 2Y6ZA 4DWSC 5HXMA 3TJIA 2PDLA 4CN6A 3AYTA 3MB9A 3AJ7A 3L4TA 4LB3A 1R6WA 4C7GA 1KWKA 2PPGA 3AHXA 3G6MA 5LYRA 3PPCA 1UH2A 2QHAA 3QR3A 1SJAA 1UR4A 1F3TA 1A50A 4KW2A 3SY5A 2PF0A 3VTRA 3ABOA 3W72A 3W88A 5SWUA 4RE2A 4UBPC 2X7WA 4ZB0A 3UNTA 1Q8JA 4EF8A 3MUY1 2QJJA 1ICQA 4ZZ9A 4XV0A 3VX1A 4JS3A 1KFEA 3NURA 4MJ4A 1SZFA 3KS5A 3U0HA 1RY8A 4XO7A 3L0GA 5XIAA 1YTEA 4IIBA 3RG6A 3OZPA 2OT0A 2OWWA 4EP8C 2DZXA 5DFAA 4XZMX 3BQ5A 3MCOA 4C6PA 4O8RA 3THQA 3QY8A 5H8MA 4ORIA 2A3BA 2GVJA 2PTDA 3EAUA 3N6HA 5CSYA 1DWAM 3IVTA 5F2GA 1OB0A 1JPHA 1A47A 1N7KA 4AU0A 3WQEA 4CEXC 2L5HA 3UCCA 4GUJA 4O1FA 4MVAA 2YZRA 5I3DA 2H9AB 4TO8A 3ONBA 1QT1A 3BMVA 1KRCC 1HG3A 4JFUA 3OVGA 1A5UA 2HE8A 5GJNA 5T9BG 1XRFA 3BMWA 4J35A 5CQ1A 1IGWA 4NZJA 3NAVA 4NYYA 3DDMA 4A6GA 3TW9A 1N82A 4B2DA 4M3PA 3GY1A 2VQTA 1WUEA 4YVVA 4GWEA 1RR2A 1DWHM 5DMNA 1XPGA 4NRSA 2YPIA 2J66A 3ZIZA 1WKYA 1YE6A 2EKCA 3P61A 3UG3A 2OQYA 3R8GA 2VEFA 5F4WA 4NAEA 3H4GA 3W1MA 3N2XA 3TEVA 1LBLA 3DUGA 1M6JA 2E6YA 4P7NA 3SUVA 3ALGA 5D2XA 1BXNA 4F8XA 1E15A 5EBAA 4I9JA 2Q6ZA 3AFBA 5HULA 4H19A 1RJPA 5CXPA 3GNOA 4FNUA 3AIWA 5M2FX 2PDWA 3CMGA 5JIPA 3PUEA 4HNOA 4ZENA 2AAMA 3RU8X 5HR7A 4C7FA 3OLDA 1NQ6A 4CQCA 3ZZ1A 1WUFA 2TRSA 4PMXA 4F0LA 4JHOA 2C18A 3AS0A 3P62A 4HIBA 3S42A 1RK6A 1Q85A 5CPLA 3HQPA 3PZVA 3O6CA 2Z1VA 3T6CA 3R5EA 1XGEA 1Q6EA 1UZ1A 1NDZA 3W73A 1MXGA 1Q2RA 2PUZA 3SADA 3M46A 5D32A 4JTAA 1RJQA 3NQ2A 1V6UA 2RHGA 4PUKA 5EA9A 3E0VA 4UR7A 3CHVA 1X7FA 2C3ZA 3MY9A 2QF8A 3M6DA 4IF2A 3BAYA 1YHTA 1NSJA 4NAFB 1KFBA 1S5TA 2QEZA 2Y0FA 5K7JA 1XW8A 2VNCA 3R13A 1GQLA 1RPXA 1UWQA 3HB9A 1UD6A 4PTVA 4C6OA 3I6EA 5C8BB 4W9TA 3VMPA 4TUFA 3WH6A 5FOOA 3PP7A 2BGQA 4YTSA 3VU2A 3H7RA 2WXDM 2O0TA 4JICA 5LNUA 5KTLA 1EO5A 2AQWA 3TFCA 4AY7A 4GUHA 4GH3A 5CAKA 3ZWSA 4UMCA 4JYDA 4IQJA 1EPVA 3LV6A 3R7MA 3W7IA 1G4PA 3L12A 3V36A 3GH7A 3QPYA 5EMYA 3WLMA 4FR6A 2NSOA 5HUOA 3BVJA 1X1ZA 1WDPA 4GYPC 3OOQA 3USZA 4AEEA 3W7QA 2FTWA 2PD5A 4ZQCA 4EAMA 1DWIM 2YYTA 2DZPA 3GVWA 1RAKA 2O7QA 1KLZA 1NARA 2PDGA 4W4QA 4W7VA 5DCBA 1U1HA 4I7UA 1GQJA 1VEOA 3MYPA 4MNJA 4HZ8A 2J7FA 1S3HA 4BK9A 1C9DA 4AY1A 4LEFA 1IE7C 2PAJA 2XZ9A 4TVCA 1TV3A 3S0CA 1PTGA 3EWDA 1S1PA 4FLQA 4X9SA 1JDEA 3BLEA 1DJGA 1POJA 1S2WA 1SMDA 1GUVA 2DVTA 4MIMA 2AMXA 3SO7A 3Q65A 2ACQA 1KFCA 4GC3A 3W27A 4GI8A 5G2WA 1JD9A 2RDTA 5C7HA 3AMGA 3AXXA 3DFYA 1PZ1A 4Y96A 3LYEA 4Q8PA 2ZC1A 1H49A 3DEQA 1XIHA 1E9YB 1WX0A 4JD4A 4EWJA 2BVYA 1HP5A 2VX7A 2VOMA 3W70A 3TMLA 4QE1A 3M9YA 4O19A 4J3XA 2FTPA 3W25A 3GKAA 3R12A 2PURA 3NNTA 3VE9A 4YWSA 4L7ZA 2WHMA 4A21A 4PCPA 2NQJA 2V5BA 2W61A 4D8AA 4DB7A 4Q4SA 3IACA 3GE7A 2WJEA 4I7WA 2ZZ6A 2P8BA 3L4XA 4QLKA 3AAMA 3UWWA 1LL4A 2SFPA 3TW7A 4NYUA 2X16A 4O18A 4HD5A 3MP5A 2DH3A 1J18A 4F79A 2G3JA 5K2ZA 4HMCA 2Y70A 3AYSA 2NQ5A 1UQZA 1TPWA 4MFDA 1HT6A 1TR9A 3S6OA 3CQHA 1GVEA 2R94A 5AC4A 2QCNA 3PZIA 3B40A 3HQOA 1TV8A 3B04A 2QGYA 4HHMA 3PS7A 3WBEA 2CZFA 3ZLHA 2WZEA 2QCCA 4WX2A 1TJRA 1QRQA 2WKLA 2F8QA 3B03A 4JTRA 1KGXA 1XX1A 1OFBA 3NO1A 4AIOA 1SJCA 1TIWA 1M65A 6REQB 2YA2A 1KM1A 2DZVA 1PTAA 3HOJA 1QXLA 3CAQA 4JKMA 2FDSA 1Y5WA 4QRNA 4UNKA 5FSDC 4JQ4A 1DOSA 1FWBC 4L9YA 1OG6A 1NTHA 4NL1A 5F2MA 4V2XA 2ZUSA 3H22A 2O9OA 4O28A 4GYKA 3RIKA 2VVSA 3N4EA 4GIYA 4Q8UA 4B9YA 4J3UA 5FJUA 2BOEX 4M7SA 4Q8WA 4TMBA 2P3ZA 1C8VA 4MDPA 4HNLA 4GQRA 4ZOAA 4DO6A 2WMJA 3MYOA 1MEHA 4Z0JA 2X2YA 3TC7A 1FWDC 1KV8A 3UY7A 4Y9MA 4BQ3A 1P6BA 1QTWA 2BV9A 2J8FA 1XG3A 3NQBA 2DUAA 4URIA 1EP2A 1TTQA 2ZBTA 1WA3A 1I2OA 1RJRA 4BJHA 3ARUA 3AZSA 3TQ0A 3VD3A 3IGUA 2B31A 3TQVA 1KD0A 4W88A 3H2OA 1B3VA 3WEMA 3PG9A 4HOZA 3APGA 3C8FA 5F1VA 3BJFA 2BXYA 1RPKA 4DZ5A 5PTDA 4GIAA 2Z0IA 3EKZA 3AMLA 2I16A 2GGIA 4CGTA 3NZGA 2QUUA 4NX0A 5C2GA 1GWJA 4UNLA 1JQVA 3CAWA 1SM9A 2ZUNA 2HZGA 1IXNA 2QGHA 3KRSA 1V6WA 3PM6A 2XFYA 5REQB 3A21A 4B5XA 3SUUA 2NVDA 1OX4B 3B9DA 4C6KA 1J5TA 1FHDA 5E0CA 3AS3A 5LNVA 3VAVA 3U57A 4DUXA 5EPDA 4IUGA 4HK7A 4DHGA 1C8QA 2ZX6A 1H11A 3GFZA 2XH4A 4A4AA 4DWDA 1A3XA 1K8ZA 3QLLA 1QK0A 4XKMA 4HHHA 2V5JA 1TPFA 5C54A 3B9NA 3QRHA 5BXRA 2B7NA 1ESWA 4JAWA 3RF9A 2PSNA 5E0KA 1HXJA 3W74A 5FKYA 2PLKA 3IJ8A 2A21A 1ZS2A 2H8ZA 3VIGA 1VGAA 3WJWA 2BY1A 3GX9A 5B80A 1X1OA 3M5VA 4U5KA 4TOQA 2A79A 3WFAA 1QAPA 1Q6CA 2WC4A 2ZDSA 3NL5A 3AJXA 1RP9A 4DUWA 2D3NA 4MNMA 4XVDA 5RUBA 3HPXA 4E4UA 1OT1A 4R7OA 1RBAA 1WV2A 1CB2A 3UZZA 2DQXA 1UROA 2G37A 5FJIA 2AOSA 4E8DA 2NXHA 1AA1B 1V0NA 3G22A 3MCNA 4MKVA 4AYGA 3K8KA 4IOTA 3RO8A 4GVHA 4MWAC 4NILA 3BG5A 4HT3A 2QIWA 1EP1A 1NVMA 4WF7A 2CPUA 4OBSA 4ONVA 3DHPA 1LYXA 1EEPA 3BAJA 3WYZA 2FZBA 3B4UA 1RD6A 3HGSA 3EZ4A 1E6XM 1QJWA 4LEQA 2PDCA 1UMLA 2Y5SA 1OFRA 2GJNA 2VR5A 1KR0A 4U2ZA 3GG7A 4X63A 1LG2A 2YFNA 4D6CA 2CZ5A 2QUMA 2V3EA 4RDWA 2E25A 4A8IA 2X30A 1E71M 2GVEA 1FQ0A 5A6BD 1THFD 5G1MA 1CLVA 2CKSA 5K4ZA 3T07A 2XH2A 4OU1A 2VDGA 1OZMA 3XIMA 1J5SA 2D0FA 2VI0A 5H91A 3O63A 5GNZA 3TYUA 2W6RA 4PMJA 4I90A 3ARQA 1B5TA 2QNEA 3HQNA 4IMDA 3W7PA 1XBYA 1ZGDA 2FJUB 4KERA 3LS9A 3ELFA 3A4JA 5J5DA 4QX4A 3HFTA 2ATSA 1G5AA 3MVIA 2PDMA 4F40A 3G1HA 3NQEA 3P8IA 4HB7A 2HTMA 4WDXA 2FZMA 3RILA 3QV9A 2GWNA 1UKQA 1TE1A 4PEKA 1PKYA 1EOKA 1V51A 3BQ6A 2VGGA 4C5YA 1CEOA 3SCPA 3IAQA 2O56A 3EPNA 1PCKA 6A3HA 5E09A 1IWAA 4BQ4A 5DQPA 3S5NA 1E1EA 4NJKA 3WNNA 3H6OA 3IV3A 1JZ4A 3WQVA 3GBEA 4DJFD 4LBUA 1EC8A 2CERA 4KEZA 4MG4A 4PTWA 3DG3A 4B5UA 3TLQA 3NJ3A 5EBUA 1F61A 1BF2A 1XLAA 4DWSB 4A3HA 3W28A 2D73A 4ILSA 4FR1A 4E5TA 1T8QA 4LAMA 4R34A 4GI4A 1H1NA 1XLEA 1P1MA 2NX3A 1NH6A 3TH6A 1FWGC 2WV8A 2C1GA 1XLDA 2XZ7A 4XISA 4FOUA 2NX1A 5D30A 3QKEA 5BMWA 4CLMA 1MI3A 1R85A 5HMDA 1WOAA 3N6JA 4NXKA 2DIKA 5T91A 5I23A 4ROQA 1P6WA 4QHRA 2DSZA 5HQEA 1E56A 3CT7A 1UC4A 3W7HA 1GQIA 2NWSA 3WEZA 3E0LA 4JTEA 3T7VA 4LUSA 1R2RA 4ZMGA 1X98A 4WY0B 1IQ8A 2ODOA 3ANVA 3WNOA 2VRKA 5DO8A 3W76A 2C0HA 2G3MA 1UZDA 5A69A 3VCRA 3CK5A 4J28A 3VDHA 5E70A 3W1LA 1F74A 1FWWA 3UWVA 2DP3A 4WJXA 1EBGA 3QYQA 3EDJA 4Y9PA 3TZFA 5I3HA 4PBEA 4LBSA 3KP1A 5AC7A 5HNNA 3MSYA 4R33A 4M1BA 3OHIA 4OTKA 4GO9A 3TJXA 1M1BA 1EJSC 4FP1A 4M82A 5CSRA 1RZMA 2EPNA 3SAZA 4U3CA 1ML1A 3ARTA 1OABA 1IZKA 4H7CA 4UFLA 4KGLA 2QJHA 1SW0A 1OC5A 3MKKA 5FAJA 1O5RA 3CH0A 3WBXA 1MRQA 2JIWA 3W7CA 3MO7A 1ODZA 1VBHA 3N2OA 5AYYA 1V7AA 4XD6A 3NQCA 4PFMA 1AUSL 4K37A 5A3HA 3VOCA 1OFAA 3L7RA 1S5MA 4X61A 3MVTA 3TNBA 1ZENA 2BY0A 3EMCA 3QJAA 4UQAA 4YN5A 3PBUA 1VFOA 4E2OA 3MPGA 1AQMA 2EXOA 1FCVA 3IRSA 2D0HA 2VVNA 2OZ0A 3CZLA 4GD0A 3AWOA 4LYPA 2Z7KA 1ECEA 3CB8A 3QHNA 3GR4A 1RBLA 3LD5A 4LALA 3DZ1A 3IANA 1P0NA 5HINA 1X6UA 2XM2A 4RE4A 2ALDA 2OSWA 2VL4A 1HVQA 1X6NA 1YTDA 2VR2A 2DZUA 3O16A 3UA4A 5F4XA 2WMIA 2BFGA 2WMGA 1PCWA 1UOKA 2E09A 2ZRUA 2FJKA 1NWTA 4B5NA 3KL3A 5FD0A 2CWXA 3ZM8A 3P6LA 4IPLA 4QNEA 5A6LA 1OFOA 5I79A 2ZC8A 1Q6FA 3EX6A 3KBWA 3VKJA 3BXWA 1O5QA 3TN5A 2A2IA 3OIXA 4PR4A 1Z7AA 1UWSA 4M6UA 4KF1A 3S9YA 2A4AA 2PE4A 4MNLA 1BWKA 1KXTA 3WF3A 4KH2A 1K03A 3UJRA 2J9YA 4LH8A 4QE4A 4EPBC 1KM3A 4QJ4B 4FXSA 3LMZA 1CXHA 4WJEA 4R85A 4Z42C 2OYKA 5I00A 3DFNA 2DQWA 4PC8A 1YRRA 3CV2A 5ABFA 3PPHA 4FNTA 1JRBA 4GVFA 4ERIA 4F0RA 2ZUMA 2D2GA 4UMAA 3CO4A 4QM1A 4MF4A 2A3HA 1BSLA 2VC7A 2C6QA 5CGTA 1YDNA 3GU2A 2D23A 2BDQA 2BMBA 4H9VA 4IFRA 3S1XA 1S1RA 3KBJA 3VINA 3W23A 4FF5A 1VYSX 1DE6A 3DFTA 4MTVA 3WF1A 4EANA 3QYSA 4CQDA 1MW1A 1P7TA 2J79A 1QBBA 1E9IA 3M0LA 4ZFMA 2VHLA 3NYZA 1D2KA 2YKKA 1XH0A 2G8ZA 1QATA 2F2HA 4JFVA 4BKNA 1XF0A 2NLIA 2FDMA 5DRCA 1CGYA 2OMAA 2NSXA 3FGCA 2YA1A 1GJPA 1UP0A 3S2NA 3TIMA 3B0PA 3P80A 3OGVA 1ICSA 2KAUC 4F4RA 4OV9A 4W86A 3I7SA 2CZDA 3UJFA 4HCDA 4N4QA 3NUKA 2Y85A 5LXXA 2QPUA 3EKLA 2BP1A 1GPWA 4ZO9A 1JUBA 4JHMA 4PUDA 3LXBA 1BG9A 1EEXA 1O68A 1B30A 2XM1A 5HNTA 1XBXA 3BO9A 3WUEA 4QGCA 4L1GA 4JTIA 4AY8A 2P3EA 3E0IA 5DX7A 3S4TA 5JBDA 4PMYA 3QPZA 2CETA 3SBFA 3UFYA 1XSJA 1V0LA 4KS0A 3RJXA 5FEPA 3TSDA 3VGHA 1E72M 5C9ZA 1XUZA 4EX4A 3NWRA 3PAJA 1XQLA 1TX0A 3G1YA 3Q2DA 1VR6A 1K70A 2PDHA 4RE0A 3GR8A 3VD9A 5G5IA 1Q13A 3GVQA 2TYSA 3H4WA 1CW2A 3KZSA 4UTIA 1MW3A 2CBVA 4MAVA 5LIUX 2Q8XA 4XD4A 1CGXA 2V3FA 4CNSA 1E0XA 1J0YA 4LF2A 3FDGA 1EGVA 4WOQA 5HWNA 1N8IA 1A5CA 3N2CA 3PUOA 1XL9A 5KZ6A 1WO2A 3LHYA 1QI2A 1B90A 1JULA 4DX3A 4GA8A 4O4WA 1U1UA 2G96A 4WR3A 1OADA 4OKDA 4DY1A 2WPGA 3UWZA 2NVCA 2YLLA 4O8AA 3R79A 2WBGA 4V15A 4UOJA 1ONEA 1LT7A 2GQAA 4G1NA 4K2SA 1TZZA 3E74A 3F1QA 2OLSA 5BROA 3UG5A 3AO0A 2V3GA 2A7RA 2WBKA 3EOEA 4O50A 1QO5A 2AMGA 4D6HA 1EDQA 1JF5A 3OPSA 3KE0A 1NFGA 4CD5A 4GI6A 4P8UA 3LHWA 4C6IA 2TMDA 4EPKA 3BDKA 1MZRA 3OGRA 3ARZA 4Y9OA 2G3IA 5CGQA 3QY6A 1HKKA 4W93A 1I2PA 1J8VA 2F61A 5AKQA 3WELA 1EL3A 1VPXA 3EOLA 2YL5A 5FL0A 1OT2A 4MAZA 1YDYA 4UTKA 1NF0A 4Y90A 7A3HA 2FVKA 4O52A 4WKHA 1W1A1 4L5ZA 4OFCA 1SO6A 1TJ1A 3WFZA 3E49A 1OYCA 1KXQA 5D9PA 1CI1A 2FZ8A 2FPTA 3B8UA 3QZ6A 4JR5A 1YDVA 1YBQB 1UCWA 1EO7A 1YTKA 2NW0A 1X96A 3VNJA 4YYFA 4YVPA 1REQB 5HQLA 4K39A 3TSBA 1HKMA 4ZB5A 3ITLA 3QN3A 1FWSA 2PWHA 4EE9A 2PCQA 3A22A 4W85A 3PBVA 3GG8A 4HK5A 1OBAA 1XIBA 4JIEA 1QPNA 3MUIA 2VX4A 4PFHA 3GDKA 3EGJA 4GUIA 1C8XA 1ITCA 4B4HA 2J6VA 4FHAA 4AD1A 1HX0A 3E1F1 3EX3A 4AIBA 5F4SA 1Y8BA 4GJ1A 4FIRA 1WNOA 2EPLX 3WLQA 4OBRA 4KEVA 1LG1A 3UWYA 3LI0A 4C5ZA 3WQ5A 4O1DA 3FIGA 4OQVA 3MMWA 2OU4A 2ZYFA 1ZBWA 3SUWA 3LRMA 3SRKA 1DQXA 1C7SA 1TTPA 3N29A 4XIMA 4ZO6A 3DU0A 3SECA 3WD2A 4YNGA 3A6OA 3M44A 2TSYA 3FW6A 4AZHA 1VFMA 3RM4A 4AVNA 2GDUA 2V9DA 4Z2JA 1RSCA 1GOOA 4QEHA 1GTEA 2QCDB 4S3CA 1VYRA 3DENA 5DXYA 1VFSA 1GYNA 1FP8A 3LGDA 2DW7A 3PZ9A 1H51A 3V1HA 3MCMA 3ZR5A 4H8UA 4JX5A 2IQ0A 4POCA 2YDRA 3GW3A 1EA9C 2X2GA 1VZWA 4AFYA 1O1ZA 3C2VA 4Q22A 4YWIA 3GIYA 1DTUA 3S1GA 1LLOA 3SCUA 4U33A 2MUCA 2QYGA 3TA6A 1H7RA 2ON3A 1T41A 2PBGA 1YW1A 1JXJA 4QCFA 4C6CA 1QNPA 1FWRA 1MEWA 1LLWA 1JQXA 3HV9A 3TWBA 2QIIA 4PODA 4FNPA 7ODCA 4CQ9A 4LY8A 3QH2A 2I5QA 4K7YA 3E02A 5L9FA 4CQ8A 5AFDA 4ZODA 1LQ2A 3GNRA 1CXIA 1ZALA 1NP2A 5E0FA 3VD7A 5AYXA 2FZ9A 2E6DA 2WLYA 2Y63A 2GLKA 2UY2A 1V3JA 3R0UA 2QQ6A 2H9AA 4PRTA 4AZBA 4HMDA 3KXQA 1RLCL 5TQLA 3V75A 4JNMA 1RP8A 3HO8A 1F76A 3BWWA 4ZQPA 5CCZA 4JYFA 2YJQA 4XBJA 4U4MA 3HPAA 5LA0A 4PA8A 3KP0A 1EHNA 4MWAB 4ICMA 2G0WA 4QDPA 3VIHA 4BEUA 1J93A 3VVGA 4NZ3A 5I24A 7ENLA 1IF2A 3H55A 4IWWA 1KV5A 1O66A 3WL0A 3PZOA 3LU2A 3RMJA 4E38A 4X2PA 3L2LA 3R43A 2ZTKA 2OR2A 4HPJA 3GC5A 4HPGA 2C15A 3BK0A 5CJNA 4DM2A 4H9TA 1OY0A 2Q01A 4S1FA 2W9MA 1XCWA 2YXGA 4MY8A 1EHAA 3BLIA 4ADUA 3GQYA 3UPBA 3WF4A 4DYEA 1VBUA 1J96A 2R1PA 2XGBA 3S47A 1QASA 2D3LA 4WQ6A 3UP8A 2CHOA 4KQNA 1XRTA 4PCNA 1FH7A 4EIVA 3REQA 3W24A 4F9DA 4XQ6A 1C9WA 3MU7A 4CD6A 3GU9A 1F7BA 3RR1A 4LWWA 3MBDA 2GJLA 3G0UA 4PTMA 1J4EA 2E8ZA 4ZOEA 1RBOB 3C56A 1F3EA 3KBNA 8XIAA 3W22A 4XWUA 3GXDA 4I9TA 2WZHA 1EJRC 1XYCA 3EX4A 4ES4A 3H2FA 5A8PA 3AI0A 2IS7A 4HMEA 4N0RA 3VGGA 2Z00A 4RDYA 2CLHA 3QZEA 3D46A 3QBUA 3PY2A 3TTOA 1W3HA 3W83A 3IK4A 3LXCA 3BC9A 4DAFA 2Q8ZA 1W5QA 3BG3A 2CLIA 4LX4A 4PZVA 5I3GA 4CN4A 3N2TA 1XXXA 3TROA 3KBSA 3QOKA 1AMYA 5D37A 4CN1A 3UVAA 1L8PA 1E55A 1ZHAA 3E3HA 1CYGA 4CVWA 4RV3A 4CNTA 1TRIA 5CZSA 4JCMA 2VELA 2BASA 2YBUA 3S1VA 1KQYA 1W2PA 5A6BA 4CCZA 4NZ4A 3UYIA 3NFUA 1TV5A 3LZ3A 2C1IA 1FTXA 5HJYA 4JTSA 4CUCA 1XFBA 8RUCA 1Z9AA 3GXIA 2ALRA 3DFOA 1QI3A 2PD9A 4BZYA 2XGZA 1V0MA 3ZSSA 1P4CA 3K1DA 5FJRA 3U4FA 5LXEA 4XZBA 3RPMA 1DJYA 3BPWA 3FOKA 2GVLA 2NUYA 2BHYA 8A3HA 4B16A 4IFOA 3J7HA 2HS6A 2CU0A 1SZEA 4PSRA 3C3UA 1J12A 3I68A 3E0FA 1M7PA 1NELA 4L1WA 1NWUA 3ZJ6A 3ZO9A 3A4AA 4QXIA 1FCUA 2E5BA 5JVLA 1IIGA 2OKTA 4IGNA 2WNNA 1XC4A 2JQXA 1PXGA 4NZ5A 1B3YA 3R0KA 4WLCA 1HP4A 1OC6A 1EJUC 2DT3A 4IZGA 4PL1A 3DECA 3NG3A 1XIIA 1PYFA 1G4TA 4RZ6A 5CG7A 4ZO7A 2BOFX 2Y88A 1U83A 4M6PA 4DJFA 4HCLA 1X1NA 4D2JA 1NFPA 2GPTA 1E0VA 1KM6A 4CCEA 4P7OA 3L4YA 1Y5VA 1K4GA 4ZQNA 1V3IA 4GY7A 3N3TA 2ISWA 2XG9A 1MXDA 5BNKA 3TN3A 1QCWA 3GZ3A 1UWUA 1BYCA 1HTIA 1RQEA 3CQJA 3WQ4A 1W1ZA 3WO8A 3AIEA 5TIMA 1UH3A 2WM0A 4PMQA 3NDZA 4JGDA 2OZ3A 3PNZA 3H54A 2OZTA 4KESA 1XIEA 1QW9A 1VENA 4UIOA 1GZJA 2Y2WA 1XCFA 4GQQA 1H09A 4GXPA 1R3YA 4NX5A 4ZA0A 2W4XA 4HKPA 5H8UA 4WIWA 3UZXA 4AC1X 3ABXA 1WOBA 3P0XA 2EHHA 1CDGA 1OIMA 1FWCC 2IPWA 3ANUA 2ZTJA 1BAGA 1MUWA 3RFAA 4MPKA 3GNNA 4YXGA 1GCYA 1CWYA 2PODA 3ATZA 4B92A 4R7WA 5FCZA 1V3KA 2PU0A 6PTDA 1WKFA 3T05A 1DXEA 1XCXA 1N55A 2ISFA 3ITOA 4JIQA 4H1ZA 3LHVA 3CXOA 1OWQA 3S46A 2O55A 4H6KA 2IUZA 4GNVA 1MW2A 4NNCA 1YYAA 5EFFA 4HTYA 1IWBA 2E3ZA 2Y7GA 2CLLA 1OFPA 3GZAA 2CZEA 4LCSA 4UTLA 1MO0A 1PZ2A 2LLEA 3W9ZA 5FF2A 1ADSA 3KCLA 4S3FA 3AICA 4BHYA 2D69A 4OHQA 2PLMA 3LNMA 4JX4A 1JUEA 2HNEA 2ZRYA 1TQJA 5A6JA 3GS6A 4LV9A 1QNVA 4KCWA 4MB3A 2H3BA 3BURA 5U7SA 4EXBA 2ZUVA 5CKSA 3WMSA 1Q4WA 1R3VA 2YSWA 5E6YA 3SCOA 3GWQA 1PKLA 4LUJA 2Z27A 2VUNA 4B3KA 1V0KA 4LTSA 2VD8A 4YTTA 2OB3A 4XK2A 1W9VA 2GYIA 5JU6A 1ADDA 1TPVA 4I9MA 2WHJA 3V0UA 5G4WA 1UWRA 1Q6OA 3G6LA 2PC4A 5FI8A 4LBRA 1BHGA 2I17A 4JTTA 3QV6A 2ZX8A 3FA3A 3RNDA 4UTFA 3MC5A 3PHAA 4P7RA 4LUYA 3JU2A 3WCZA 1K77A 2NQ9A 3BGJA 3B8WA 3RRXA 1TWDA 2JALA 1FOBA 1Y0EA 5ECUA 4A8RA 2PTZA 1W9DM 4DF0A 3PB2A 3OA3A 4GJJA 3ITYA 1C8YA 2DZBA 1WYIA 2QV4A 4H8NA 5FF3A 5FEWA 4RPPA 2GQ3A 1TV7A 4LQ1A 4GVIA 3ONCA 4HSNA 4ERAA 1K9FA 1Q4NX 2Z4GA 4I3GA 2QDEA 3E2VA 2XFWA 4GZIA 2ZX5A 3CMJA 4S3BA 3V4BA 3M0KA 2P88A 1QI4A 2F38A 2EBNA 4HZ7A 2CLMA 3ZT6A 2HRWA 2I56A 3ZR6A 4LANA 1OX4A 1TTJA 4S38A 4LOCA 3BLPX 5G2HA 3NQ7A 1UQYA 2VFFA 1U1JA 1PPIA 5LNRA 1FBAA 4MWAD 1WE5A 2B7PA 1AH0A 2YOCA 3KVLA 2ABAA 1GNXA 4IIDA 1R47A 4Q8MA 4YJ5A 1HW6A 7REQB 4BR1A 2Z7GA 3GVVA 5D4YA 4GUGA 4EPEC 1HF6A 5I2UA 4M1RA 5FESA 1JAEA 4UC5A 1TV2A 3VDBA 1G9HA 4ASTA 5CPNA 3P60A 3WQFA 3FLUA 3SRHA 4JKLA 2JF7A 3W53A 1NJJA 1CENA 4Q7IA 3T55A 2AKZA 5MKGB 2DZTA 4PSPA 1B2YA 1EF3A 1XFCA 4UQCA 3H24A 3BE7A 1BEUA 1UKOA 3W1XA 3OZMA 5LZLA 3B8VA 4MY1A 1H7WA 3W1AA 1XH2A 3IS4A 2C91A 3O06A 2Y8UA 3KDOA 5CC6A 3H8AA 4IH3A 4XZLX 4PE8A 4ERGA 4XIAA 3CGTA 4G6CA 3EOUA 4JFSA 5HBFA 4L56A 3SUTA 1W3LA 3LPPA 1TPC1 1JCXA 5A6KA 3T4CA 5A6SA 4FLRA 2V8ZA 5C5YA 3PPFA 3W85A 3H21A 4LS1A 5F7UA 1EH9A 4GZJA 2DSKA 2WC7A 1S2VA 4XO6A 6XIMA 4PCFA 1CCWB 5J8LA 1AQ0A 1VCFA 3EOOA 3KX6A 2OEMA 4HYRA 3EB3A 1V79A 1V6VA 3B9AA 1QOPA 1LWHA 2EJ1A 2VFIA 1EGZA 1XYZA 3ARRA 3MSDA 3IAPA 5CBIA 2NZLA 2C13A 1OYBA 1SZGA 1TRDA 2ACRA 3B3DA 3PB0A 4HBKA 2AL2A 4CKQA 4G1KA 4OVXA 3TA9A 4TX9A 1CXEA 4KBXA 4I8DA 2YYUA 3PF3A 4FNSA 3W84A 1RD5A 1H3GA 1TWIA 1I1WA 4NASA 2VDHA 2QR6A 3S2MA 1AL8A 4PCSA 1D7FA 2E1WA 4IPIA 2YDSA 1O95A 4REQA 4DXKA 1HKJA 3P7YA 2I5IA 3MV11 1K6AA 3KOXA 1GOKA 3AIBA 5CC5A 3W6LA 2VFHA 3AXHA 2OQHA 3C5QA 2EJAA 3DHUA 1FDYA 5HUPA 2V63A 3RM8A 2PRHA 4YHEA 1EX1A 3TTYA 4EXQA 2QVNA 3V16A 3N04A 2OEKA 4UFKA 2JKPA 6XIAA 3JVAA 1LZOA 5G2IA 3SCVA 2XIJA 1UD5A 3L2IA 3CYJA 3VNDA 3TFXA 4ZXOA 1NOFA 4JX6A 3NO5A 3CIVA 5BOOA 3W2NA 5CLWA 4UB9A 5B7YA 1LT8A 4DN1A 3FAWA 2Q3RA 1FWIC 1GORA 4I9AA 4LY4A 2PDIA 4UCGA 1T96A 2IPGA 3UZJA 5D8WA 2R1LA 2QAPA 1OFQA 4X0NA 3VOFA 2EPOA 3GDRA 3KVJA 1DEDA 3R2GA 1QPOA 3TR9A 5I09A 1TJ0A 2ZFAA 1XSKA 2WZMA 3WLRA 4DWSA 2E1DA 4JDBA 4JXCA 3UXAA 2X1IA 2QMKA 4LUSB 1A5NC 4DI9A 3N1AA 4NI3A 3S5ZA 4PMOA 3QEZA 3PJXA 3A4WA 2EPKX 2VM8A 4O57A 2A7NA 2WVTA 1BRLB 2O7SA 4JTHA 1KW1A 2QDDA 3EWWA 4QQUA 1LQAA 2D2JA 2Z2AA 1IXPA 3SJ3A 3E6EA 3VO0A 2ATMA 3NL2A 1UD4A 2XN0A 5M3WA 1PV8A 3M6YA 1BTMA 1XDJA 2FVLA 4Y6GA 2GL5A 3CQKA 2VMFA 4YIWA 4WKFA 1LUCB 3UXKA 1JRCA 3EA1A 2XVGA 1T8XA 3AMDA 1ZUAX 4NUWA 1BGAA 1QHPA 1Q63A 1K7XA 1ME8A 1RALA 4US5D 4ZQMA 2DVUA 4LVGA 3OP2A 4BI7A 3W01A 1LCOA 4PUNA 3RRAA 1KFJA 4UQEA 4P7QA 3QTGA 4HPXA 1DJHA 4BF9A 1WKEA 1XR2A 3MT1A 4XZWA 2G4JA 3S1WA 4E3VA 1SGJA 3ABRA 4ZTXA 2ESCA 1YNQA 2HE5A 3HQ1A 4V1YA 2OOFA 3RAOA 3WENA 2V81A 1NF7A 4LC8A 4W89A 3HG4A 3EXTA 5GNYA 4C1NA 3CNYA 5TF0A 3O1NA 1R2SA 5I6SA 1NU5A 3VKDA 4UFHA 2HEJA 1B31A 3U2ZA 1Q6GA 4Y7EA 1ZBCA 1C3FA 1XIGA 4DI8A 3QSTA 5C6MA 1F6YA 2VT0A 3NVDA 2WMIB 5TNVA 5A6MA 3C2YA 5BWAA 1ENUA 3DAQA 7XIMA 3RYSA 4FXJA 3PJTA 2ACSA 3CU2A 4UWMA 2YCIX 2NQZA 3S2LA 2J74A 4IX0A 1EDGA 3EX2A 2P50A 3CUFA 3STCA 1YKWA 1NDWA 4KFPA 2CBJA 4LB4A 2VC6A 2V0TA 2RAGA 4PB4A 3I3EA 3W87A 4W8AA 3SR7A 1Q6QA 2DIEA 4JTDA 4CU6A 1LRQA 3F5LA 4M6VA 4PUJA 4JTKA 4MGGA 3G18A 3BLDA 4AF0A 3O2LA 1JZ7A 2CLEA 2HVNA 3QZAA 4NT0A 3DFSA 5D05A 5H1WA 1TIMA 2ZE0A 1PX3A 1TR1A 3GNDA 4I5RA 5JH2A 3WBYA 1NY1A 4RUBA 1CB7B 3N34A 2EPMX 3PK7A 1KRBC 4NU7A 1YXDA 4D6IA 4IL0A 1GW9A 1A80A 1HJSA 1UB3A 3FK4A 2Z2UA 5CH9A 1XLLA 3S9ZA 2GUYA 4C60A 3SIMA 4B5SA 1FHLA 3AS1A 3JS3A 3PSVA 2ZOXA 4KWSA 2CLFA 2WJDA 1VYPX 2BHUA 1JCTA 1P7TB 1YMYA 3FA5A 3FYOA 2X1UA 1HKVA 3ZMRA 1G67A 3G1XA 2Z1WA 5AYBA 1D9EA 3FGCB 4RZBA 1EKOA 5FJTA 2BB0A 3LQGA 1OCQA 4PRWA 4KCVA 2HPMA 3DH7A 4H01A 2QCEA 3DBNA 3DERA 3L0NA 1TX2A 3SIZA 4AH7A 1AQFA 2ISVA 4DVOA 3V0TA 4F66A 4NZ1A 3TMQA 1I2NA 3UG8A 3P5YA 3U2CA 4J2MA 3FSTA 3CWNA 4O0QA 4AIUA 1VEPA 3QMTA 4UFJA 4RJEA 1SO4A 3HG5A 3NXLA 4W5ZA 5HJXA 4FA3A 4KWWA 2R8WA 1KBIA 1VFLA 4QS5A 2W3ZA 1I2RA 3FN9A 1PYMA 1AW1A 3MJYA 3POHA 5IFTA 4FZIA 1J0KA 1RQBA 1DYSA 3CBWA 2OZ8A 2W66A 2DT1A 3WLOA 4FAMA 3TU9A 1AG1O 3AC0A 2VFDA 4W8BA 3JW7A 2Y1HA 1YDOA 5IDZA 1W1TA 4IXHA 1J9YA 1PZ0A 1BGGA 2AQVA 1RVGA 3IWPA 1TO3A 3FSUA 3A3HA 2WCSA 2ZRVA 1SSDA 3CH9A 3DKLA 3R4IA 1PZ3A 3E5PA 3QXBA 2GOKA 2XTKA 1PDZA 3CMFA 4W7WA 3H12A 5H2ZA 4JTQA 4MB5A 1V6TA 3OA5A 2WPBA 4GY0A 1ZFJA 1RK5A 3QGVA 1H63A 4I5XA 1CIUA 4H9XA 2QJGA 1GQKA 1UOZA 2F84A 3B8TA 3LSCA 2ZRWA 1QUMA 1RV8A 3A9BA 3C0QA 1LTDA 2G5WA 2VWTA 3EB4A 3EEZA 2V2DA 3ARXA 2G97A 3F7JA 2IQDA 1EPXA 1LP6A 1PTDA 1TPEA 2PBOA 4OIFA 1BWVA 1OC7A 4JKKA 4U31A 3SZ8A 3AISA 2FGBA 4BWLA 5HR6A 4H2HA 1ECQA 4J3SA 1GOMA 2VZVA 4GQBA 3NL6A 1JYVA 1W9XA 1EWEA 1PE1A 3PFRA 4JTLA 2QPXA 1VCGA 2VP8A 1HO4A 4P8VA 1WDWA 2YB4A 4XTDA 1BVZA 4D8LA 2REQB 2H90A 3UA3A 4Q6JA 3GAKA 2J7GA 4IGSA 1K4HA 2CEQA 3T1GA 1XDLA 3K8MA 3QQ0A 1IXQA 3NQFA 1N8FA 1F05A 1IT7A 1UZHA 1QO2A 1IT0A 1G01A 1C29A 5LA2A 4H7ZA 3AQUA 4ROPA 1ONRA 2J8TA 1NIUA 4RZ5A 3WLTA 4Q7NA 1TMQA 2X1RA 1YBQA 1U33A 3EXRA 2UY4A 2YL6A 2QULA 3WLIA 2J88A 3WQGA 3QPEA 2D24A 1ICPA 1ELSA 3AALA 1J0ZA 1UP2A 2YX0A 4N42A 1A4LA 3VUPA 2GVYA 3WLSA 3FV9A 4IM4A 2O9TA 2YFOA 5CC3A 4GY1A 2BGSA 5G4HC 3AYRA 4GQ0A 4W7UA 4DF1A 5C9RA 1A0CA 1XGZA 1ISZA 2WK2A 5KZDA 2OGYA 1E0TA 5GQBA 1UASA 2DSVA 3T9PA 2YW4A 3BH4A 4N2YA 4IQLA 5E6ZA 4M29A 3IUIA 3KS6A 4HGXA 3MW7A 1MQRA 2V2HA 3CASA 3GIQA 4IICA 1NFBA 2GUUA 1W1PA 1E70M 3P81A 3MV01 4UXDA 5L6UA 3RM9A 3OVPA 3S2JA 3JZEA 4B3ZA 1RLDA 7PTDA 5BCAA 4YCPA 4Q32A 4UR8A 2Y61A 3W75A 3CUGA 2GSJA 1JAKA 4B90A 3SGZA 1XISA 4LNCA 4ZQOA 4US6A 5BYWA 2VC9A 2P5NA 3RCYA 3MTWA 1VLIA 1QMLA 5JIWA 1L2UA 3OGSA 1YXYA 3O05A 3MI2A 3MI3A 2QCDA 1GT8A 3AIUA 2MNRA 4JCLA 1QVBA 3N4AA 4GBDA 5BU9A 1UBPC 4NSBA 1QK2A 5HQMA 3NVTA 2E68A 4DQWA 4QIUA 3GM8A 3W3OA 3VMOA 2I5GA 2QUVA 3VNZA 1XIJA 4XSLA 2PFHA 3KVMA 4RK8A 1MXSA 3NQ8A 1ZP3A 2GK1A 2I7GA 2DPEA 3LCHA 1GVQA 2EQDA 3PFMA 3D0CA 5AC6A 3HN3A 1I1XA 3QW4B 4CVUA 4DLFA 5A8GA 1Z42A 3PUGA 3NGJA 4Y2WA 4MZ1A 4R53A 5KZEA 3URBA 4QAWA 4LAOA 2OFJA 3HJZA 3DYMA 4RNJA 1HGWA 4V27A 4M24A 1FX6A 1DV7A 2NXGA 5AHEA 2Q02A 4QJ1A 4FX8A 4PRRA 3VZYA 4UQ9A 5K3VA 3V0SA 4IMCA 3GDMA 3NEHA