3IECA

Helicobacter pylori caga inhibits par1/mark family kinases by mimicking host substrates
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
315
structure length
311
Chain Sequence
HIGNYRLLKTIGAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGWMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase MARK2
publication title Helicobacter pylori CagA inhibits PAR1-MARK family kinases by mimicking host substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/toxin
total genus 101
structure length 311
sequence length 315
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 3iecA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3iecA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3iecA01
5JEBA 3F3TA 2XS0A 3QWKA 2YIWA 3ULIA 4KRCA 5D1JA 2CWBA 1P4OA 1R39A 3A4PA 3EQDA 5C27A 4PV0A 2XYNA 2IG7A 4AW2A 4RX5A 1J7LA 3SXFA 4D1SA 5HD4A 4LMNA 4KA3A 4O82A 2GHLA 1ZZ2A 3DAKA 3LHJA 3CR0A 3R9DA 4EOPA 5KKRC 2PUIA 4L44A 4Y83A 4QP3A 5JN2A 3VS4A 3NUYA 2OXDA 4QNYA 1H1SA 2AUHA 5GINE 5KO1A 5ANEA 4GEWA 4FVRA 4CFMA 3WE4A 3BCEA 3PSDA 4IZ5A 5D12A 2NNWB 2WGJA 3A8XA 4TWNA 4EK5A 3DZOA 3W33A 3AC4A 3QZHA 4KKHA 4QQTA 2FH9A 3FL5A 5HBJA 2CNVA 1GIIA 3I0OA 4MHAA 4FYNA 4FL2A 3RZBA 5D9HA 4BDHA 5IH5A 4FSMA 3DQWA 4RA5A 4BGHA 1URCA 4FKIA 3GC0A 4MQ1A 4YC6A 3DXPA 1CTPE 4X7QA 4H58A 5HHWA 4EUTA 4RVLA 4AACA 3VIDA 1MQ4A 1Q41A 3HMMA 2YEXA 3O71A 2WXVA 4JQ8A 5A54A 2OFUA 4MVFA 3SGCA 4HEOA 4GJ2A 5HVYA 4M67A 1PMEA 1PJKA 3R01A 3GLFE 3EH9A 4FOBA 2K9DA 3VF9A 1YDRE 3EFJA 1VYWA 4O7YA 5HEZA 3TV7A 2JIUA 2NPQA 2G2HA 4OTPA 1TQPA 5AUZA 4GVAA 3VJNA 3ATSA 4QNAA 3OF0A 3TNQB 3EJ1A 3W8QA 3ZFXA 1XH6A 3F3UA 4LFIA 5M53A 4MNEA 2W1IA 4J52A 1YI3A 5IUHA 4I23A 4BBEA 4FIIA 3Q2JA 3W2OA 1GNGA 2JDTA 3E93A 4X3FA 4BCQA 4J98A 3TNWA 1IM2A 2WIHA 2GNJA 4LM5A 5L8JA 4AZTA 2HWPA 3RK7A 5M09A 2OK1A 4KNBA 3ANQA 4HGSA 3Q5IA 4J1RA 4JRVA 4MBIA 4UV0A 4C37A 1CM8A 5CEKA 4BCFA 4G6OA 2ITWA 2OBJA 4KKEA 3FLSA 3RKBA 3ZSHA 1URWA 4L68A 2HK5A 2VWYA 3QTXA 2WOTA 3CJGA 4I93A 2C6MA 4Q9SA 1JQHA 3GU4A 4M66A 1RDQE 3F61A 1NV8A 1QCFA 3MVLA 4F1IA 3QTZA 3LAUA 4OTGA 4FI1A 4X3FC 1CKJA 2E2BA 2PMLX 3IW6A 4QMYA 5C8NA 2V62A 3P7AA 2DAKA 2YDJA 3NLBA 4WG5A 2C47A 4M69B 4YNOA 3QXPA 1H27A 3A7JA 2XK7A 3R04A 1M7NA 2BZKB 4BTKA 5TKDA 2F2CB 1VG5A 2C6LA 3K3IA 4RPVA 5CVHA 5ETFA 4AP7A 4AA5A 4CMOA 1T46A 4B4LA 3F2RA 2ZAZA 1ZYLA 5EHOA 4QMQA 4F08A 5AM7A 4JG8A 5HCZA 2XB7A 4R1YA 2VWUA 4YJQA 3HA8A 2W9ZB 3I79A 3QCQA 5IPJA 3PXKA 4EQUA 4EOQA 2IVUA 1PXLA 5EDQA 2P4IA 1Z57A 1ZY4A 4MCVA 4RC2A 4UALA 4A9UA 1ZY5A 2X2LA 3B2TA 4X21A 1REJA 4FTLA 5GJDA 5IUIA 3C4FA 3BI6A 3BQCA 5HICA 2VTPA 3DLZA 3FKNA 3UNJA 4EOOA 4KIKA 1SVHA 4L8MA 4YZ9A 2C5VA 3ZUVA 4FKJA 2PUPA 3QUDA 1PXOA 1IFYA 1MP8A 1O6LA 3FMKA 4CFWA 3TKUA 4F6WA 5BVDA 2LVAA 3BEGA 4A9SA 2YM8A 3HX4A 2BAKA 2VU3A 2X8DA 4FNZA 2WMTA 5G1XA 3MSSA 5L3AA 4IH8A 4O7ZA 1U59A 2BUJA 4QMTA 3R8LA 3ACKA 3REPA 3Q5ZA 4E3CA 3F2NA 2L4EA 2ITTA 3D4QA 4D58A 3KMWA 4EHZA 4BTJA 1PXKA 3OP5A 4M3QA 5DFLA 4QMZA 3KRRA 5EM6A 4AN2A 3BRBA 5EM5A 3WZUA 2XJ2A 5TR6A 2ZTCA 2WEIA 4BZNA 2GHGA 5EI8A 3ORXA 2OF4A 3DLSA 2G1TA 1J3HA 5HO7A 1H28A 3RNYA 5DT3A 5F95A 3TTIA 4HCUA 5JKGA 5T3QA 1JKKA 3PUPA 4EH3A 1ZMVA 5IQHA 3PVWA 3ZDUA 3Q4UA 3UGCA 1M2QA 2H5XA 2BIYA 4LUEA 2QQ7A 4QYYA 2VX1A 3V5TA 3ENHA 3V5LA 4A07A 3PY3A 2VTOA 3EWHA 3I4BA 4KSPA 4Z7HA 3BHYA 3RCDA 2WELA 5AFVA 5EQPA 2C69A 3CLYA 2QOQA 4A06A 5HORA 3RBWA 2YN8A 1Q8TA 4HYSA 3VUIA 2WD1A 3NUPA 3H0YA 4BDFA 1UKIA 3FZRA 3O8PA 4ITJA 2XIKA 3R21A 1YXTA 1H8FA 2LTUA 3MH3A 2Y6OA 1U5RA 4TWOA 4YO4A 3WZJA 4QTDA 1ZRZA 2GCDA 4IIRA 4CZYB 1PHKA 4U41A 4U97A 2JKOA 5DEWA 4AZEA 3EIDA 4RIWB 3OFMA 3NNUA 4BCHA 2UZDA 4FSNA 2CSNA 4R3PA 2OJFE 1ZYSA 4AA4A 2WEVA 3BYMA 4CT2A 5M06A 1W83A 2PE0A 2VO7A 3G6GA 4U42A 1OIQA 3UZRA 3FMJA 5I3RA 5J7BA 2H6DA 1Q8UA 4DITA 3R9HA 4I24A 3WF5A 2YCRA 5DN3A 5HLWA 5JGBA 4OLIA 2Y8OA 3UVRA 2JKMA 3KRXA 2Z7SA 5L2QA 5J9ZA 4JX7A 2B9HA 3CGFA 3O23A 4YP8A 4EZ5A 5E1SA 2WOUA 3D9VA 3RMFA 4B0GA 5M55A 4HGTA 3SG9A 3RK9A 4V0GA 2IW8A 3DBFA 1E9HA 3KK9A 2QOCA 1W84A 4IDTA 5F94A 4F1MA 2HCKA 3NEWA 4LRKA 4EOKA 4MF0A 5E4HA 4HOKA 4LOOA 5E1EA 4F9BA 3CS9A 1KOAA 3QCSA 2ZM3A 2WMUA 3MTLA 2GTMA 3FHIA 2Z02A 4GT4A 3G0EA 4FV4A 4HVGA 4I22A 5AUVA 2B52A 5HQ0A 3JYAA 3TG1A 3WIGA 2XKFA 4M0YA 4QD6A 1Q99A 4F7SA 1FBNA 5KMKA 1NY3A 1SYKA 5FP5A 2V7AA 2XM8A 5C26A 3WBLA 3ZC6A 5I9YA 1SMHA 3FC2A 3LFQA 2QU6A 3IPHA 1Q8WA 4L00A 3MVJA 4FT9A 5AM6A 5E92A 4TNDA 4B99A 5B7VA 3MPAA 1ZWSA 4P4CA 3R9RA 1GZNA 3AMBA 3IQ7A 4D9TA 3S4QA 2JY5A 3BWFA 4CKJA 2GU8A 4RIYB 2MJ5B 1SNXA 2ZV9A 4RQKA 2FSLX 3A2CA 4Y5HA 3FZTA 4HVDA 2AC5A 2V0DA 3A7FA 2JDVA 5EOLA 4QP9A 5AAFA 3OEFX 2YCQA 5HGIA 1UKHA 1ZOHA 4CCUA 3ACJA 5T6KA 4AW0A 4E6QA 4EH7A 2B9JA 4F7JA 5BVFA 3F7ZA 4IZYA 5J7HA 2Y7JA 4G6LA 4J8NA 3MWUA 5HO6A 3VJOA 2OIQA 4R8QA 1P2AA 3C13A 4YJTA 1FVTA 3HMNA 3GFEA 4IX5A 5B2KA 2J7TA 2W4JA 4BYJA 4CQGA 4LGHA 4YZNA 4ZXTA 5CEIA 4EOLA 2X9EA 5EQYA 2VTTA 4F6UA 5DPVA 2ITUA 5J79A 3KY2A 2V55A 3R1SA 4H36A 3G51A 5AR8A 4IB5A 4BDJA 4CMTA 5L4QA 3LKMA 3GU8A 4X2FA 1MUOA 1OKSA 3K5VA 5FXSA 2PZ5A 1VZOA 4FICA 3AMAA 1GZKA 2QHOB 3KU2A 3HUBA 3BHHA 5K0KA 3AT3A 5FD2A 5CSHA 1WBVA 2BCJA 5K4IA 4DYMA 1QL6A 2CLXA 5IF1A 3ORIA 3FYJX 3ZH8A 4GFMA 4ZSJA 4O21A 2AYPA 3D14A 5KNJA 3PA4A 1KWPA 2Z7RA 3PVGA 4QMLA 5FM3A 3LXNA 2PYWA 2UZVA 3P9JA 2RFNA 1PMNA 3PZEA 4O1PA 4BWPA 4IQ6A 3RGFA 3E92A 4KS8A 3UZTA 5AV2A 3SKCA 5CSPA 2YABA 4ZS0A 5HCXA 5CT7A 4HCTA 5HE1A 5M4UA 3NMUF 3GQLA 3BBWA 4IWOA 4Q5EA 5DFPA 5L2SA 4TWCA 4R77A 2XNPA 2IWIA 2J0JA 4L46A 4JIKA 3JVSA 4IB3A 3CEKA 4RWLA 3C5UA 3FLQA 2BHHA 3PXFA 4JAIA 4ZTNA 3NYOA 2ZV7A 3RAKA 2ONLA 4EQMA 3OOGA 1CKPA 4ANLA 4BICA 3EMGA 2Z2WA 3QTUA 5IA2A 1VEBA 5IUGA 3MYGA 3E3PA 4WT6A 2HW6A 4GV1A 1Q97A 4WBOA 5BPYA 2W06A 3ALNA 4FVPA 4EOMA 5FEQA 3W18A 4CMUA 3O7LB 1LP4A 4DGMA 4P90A 3NIEA 3P78A 3MJ2A 2UW3A 3AOXA 4W4XA 4NW5A 4FTQA 4FZ7A 4RZVA 3R0TA 2ONLC 5TOZA 4I20A 4CKIA 1NVRA 2W4OA 3AMYA 1BLXA 4GU9A 3MBLA 4XBUA 2UV2A 4UXQA 2IZTA 4ZTSA 1LUFA 5KCVA 4U6RA 2VRXA 2JD5A 4NM3A 2EWAA 4FTKA 3EQHA 2X8EA 1WHCA 4GRBA 4AE6A 2YACA 2XUUA 3TZ7A 4I5PA 2F2UA 5CSWA 4DG2E 1Q24A 4XUFA 2CGUA 4L9IA 3E8NA 3LFDA 4C4EA 1Q3DA 3ODYX 3WF9A 4B7TA 3VUDA 4ZS4A 3C0IA 3P7BA 2MGWA 1J7UA 3KREA 4C3RA 3IONA 3WI6A 3KXHA 2XA4A 5M4CA 4WNPA 1PXIA 4FV9A 5IKWA 2W7XA 3UVQA 4UYNA 2J0LA 4OBPA 3EQGA 5AWMA 3BEAA 1OM1A 4C4HA 2C3LA 1KOBA 3EFLA 2OGVA 3F5UA 3WZKA 4FSTA 2JDOA 3D83A 3NNVA 3QTQA 2FSMX 3FKLA 5EKOA 2ITNA 1H01A 2C5OA 3I5NA 3E64A 4HGLA 2GNIA 4OAUC 4KIQA 1PRYA 4EJ7A 1YOMA 2PE1A 5IA5A 4QYHA 3CY3A 3LXPA 3QU0A 4WHZA 2PULA 2YDIA 3R1QA 4FSWA 3EN6A 4BZOA 3EOCA 4D0WA 3KVXA 4HGEA 4UZDA 2AC3A 3KVWA 3NAYA 3UNKA 2X4ZA 1YRPA 2FYSA 4M69A 2WFYA 4MBJA 2RGPA 1Q3WA 1OB3A 2YLFA 2X2MA 2XCHA 2R3FA 3DBDA 2JFMA 2XMYA 3O8TA 4HZRA 4GH2A 3ZRKA 4PPCA 4USDA 2LGCA 2OJ9A 2O2UA 1WGLA 3DAJA 3LCTA 3FMEA 1H07A 2REIA 3M1SA 3R8UA 2J0KA 4YSJA 4WIHA 2QKWB 4R5YA 2ZMDA 3EQIA 4WNMA 4CTBA 5FWKK 5CYIA 5E8VA 2RKUA 3BGQA 4XJ0A 1JPAA 4UWBA 1XBAA 4ZTLA 2I7QA 3HV7A 4U45A 3LE6A 2BWBA 2VO6A 1IG1A 4KBKA 4QO9A 3GQIA 1M17A 2QC6A 3OT8A 5FQDC 4PTCA 3C50A 4GYIA 2EJSA 3V5PA 1OIUA 4BGQA 2W0JA 3FMMA 4IAKA 2CNUA 4J99A 4O7WA 2X39A 5IQCA 4U3ZA 2R3LA 4OBOA 5E8WA 2EUFB 4U8ZA 1FGKA 5J95A 4XRLA 3CGOA 3P23A 3QLFA 4EH5A 4C36A 2RF9A 1YDSE 4S32A 3QD0A 2HZ0A 3JR1A 4FEWA 1SG9A 2B9IA 2JKKA 2ZB0A 2CLQA 5I9XA 4GKHA 4BL1A 4BCGA 4GL9A 4DBGB 4U40A 2HWJA 4C2VA 5FLFA 4C61A 2XRWA 4IC8A 4WNKA 3QTWA 2WMBA 1R0EA 3OUKA 3QZIA 4Y72A 5KX8A 2XVDA 2Q0NA 1J1CA 2QHNA 2VN9A 4JLCA 3CTJA 3L8VA 4PP9A 4FUXA 1DV0A 5M4FA 3C1XA 1HOWA 4U5JA 2XCKA 4BDKA 2ZDUA 4K18A 3DNDA 4U80A 3GI3A 3E46A 3R7GA 5HO8A 1WVXA 2YDKA 2X7OA 4ZOGA 5EYMA 4AW5A 1UFZA 4FZAB 5ETAA 4FKUA 3ORPA 2FA2A 4Z55A 1BL6A 4AG8A 3U8WA 1GZ8A 1PW2A 2CGWA 2I6LA 4YTCA 5HVJA 4LL5A 3UO4A 5KZ0A 3TUBA 4W4YA 3WE8A 4EH8A 1VEKA 4J7BA 3ZTXA 3RM6A 2BDFA 3ET7A 4FIFA 4Y73A 2WMRA 4BCPA 2X7GA 3MFRA 5CU2A 2PUNA 2OG8A 3R8VA 3K9OA 4O7NA 4ASZA 2C1AA 4EC9A 1WBNA 4FNYA 2ACXA 4HVSA 3LCVB 2X7FA 4F9WA 4FUYA 4YTIA 1V1KA 3K9PA 5JK3A 2PY3A 1Y6AA 2CGXA 2QODA 1IR3A 5TO8A 3H30A 5CAOA 4K33A 4MXYA 4ZLZA 5JFWA 4RIWA 5A9UA 4FA2A 5JFSA 4RJ7A 5DYJA 3BE2A 4J53A 4JXFA 3E8CA 2O25A 4I6FA 1OUYA 3G5DA 1U4DA 4QMMA 4XG2A 3R7UA 1OL1A 4CSVA 3QKKA 3LLAA 3PWDA 3O2MA 4B9DA 3TN8A 3UDBA 2JNHA 3W2CA 4J97A 4AX8A 4IAAA 5BVOA 4E1ZA 1OL2A 4RX9A 4AWIA 2IVSA 3C4WA 1YKRA 4YGAA 4IANA 2A0CX 5T68A 3ZUUA 3UOKA 4FGBA 3NNWA 2P0CA 2W1FA 4QQCA 5CI7A 4E4XA 2HENA 2YCFA 3PSBA 3Q32A 5B2MA 5I4NA 3QHWA 3QD4A 4EH4A 3DK3A 1SNUA 3D7ZA 1OGUA 3DBEA 3LZBA 4BTFA 5CEMA 3MS9A 1XH7A 4JS8A 3ZZEA 1GZOA 4QT1A 3SOAA 4AN9A 1ZARA 2HELA 4N0SA 4JX3A 3NAXA 4M15A 4NWMA 2UVYA 3U54A 3CD3A 4PMSA 1GAGA 3W10A 5DR2A 2OI4X 3PLAE 3C4CA 3P1AA 3L9NA 5CXZA 2BDWA 3FLZA 5JT2A 4PDPA 2WU6A 3KQ7A 4ZTRA 1Y6BA 5AA9A 4FEUA 1XBBA 2RFDA 3LFEA 3H9FA 3PP0A 4UX9A 4BCOA 4DH1A 4UMTA 3HV3A 2YCSA 4ERKA 2L2DA 4O2ZA 2QD9A 5HU3A 3BYVA 1KE8A 3O51A 4XH6A 5LOHA 4Y46A 1BKXA 4RIYA 4ZSAA 2C0IA 4G3FA 2F7ZE 3QTIA 2W1GA 3AGLA 4K77A 3IW4A 4JQ7A 5BYZA 3SHEA 3II5A 2OZAB 1R3CA 3RI1A 5AV3A 3FYKX 4IWPA 3CY2A 4X2JA 2ZB1A 5AR4A 3GLGE 4K11A 5AR2A 4ORKA 2OU7A 3TXOA 2QO7A 5KHXA 4HPUE 3DY7A 3DKCA 4ZK5A 5L6OA 4DBNA 3HAMA 3UMXA 2XK4A 4D5HA 2J50A 3N51A 1LPUA 4BHNA 3RP9A 1O9UA 5DE2A 3R30A 4JG6A 3VAPA 4JBQA 3V01A 4RJ6A 1I09A 4F9AA 4RJ4A 1UU8A 2QHMA 3HA6A 4IHPA 4QP8A 3QRUA 4WD5A 5AA8A 1OIRA 5IA1A 1WR1B 4DT9A 5KMJA 2B53A 5IQDA 2GS6A 5LMAA 4D2WA 1PXMA 3PY0A 1VEJA 4EH2A 5CU4A 4GEOA 2YISA 2W1HA 1TQIA 4F9YA 3NGAA 1H26A 2OXYA 4UN2B 3DTCA 4FKOA 5EH0A 4D5KA 4LI5A 4C3FA 4DAWA 4E7WA 4FT5A 4ASXA 5AV4A 1GY3A 2OO8X 2LVNC 5ANIA 4C0TA 4RFYA 3EKNA 1TKIA 3DTWA 3MPMA 3EKKA 4BF2A 3GUBA 4NCTA 2YM5A 4FKTA 4I0RA 4LMUA 4I6QA 2PVRA 1FMOE 4MWIA 4UY9A 5JQ8A 2IZUA 2O3PA 4FYOA 4O7RA 4RWJA 5JI2E 2A2AA 3ZO2A 5LMBA 5CAVA 3RVGA 4BDAA 3EL7A 1ZZLA 3IOPA 1UA2A 1LEZA 2ETMA 1VQ1A 1JVPP 4IACA 3DU8A 1AIPC 3GT8A 4TNBA 4LUDA 3BX5A 3VWAA 2JIVA 5DVRA 3V6RA 2BZIB 3VRYA 1UVRA 3AD5A 2BMCA 1XXHE 5AAEA 1BL7A 4IDVA 4M8TA 3HMPA 5J87A 2R9SA 2W4KA 3E7VA 3N9XA 4FKPA 4NCTC 3UP7A 4CFXA 4YMJA 4MNFA 2HW7A 1FOTA 4QMVA 2PZIA 1EH4A 3FQEA 3VBQA 4ZTHA 3WIKA 4X2GA 3CBLA 3NR9A 1WGNA 2C3KA 1JNKA 3DQXA 3KC3A 4FTJA 3N4UA 2P33A 4RJ5A 3GLIE 3I81A 3TZ9A 4LOQA 1HJPA 2QU5A 2WQEA 2XBJA 3V51A 4F64A 4BFMA 4OTIA 4D2RA 2GNLA 4X0MA 2R3RA 5D7AA 2WQMA 4C8BA 4CV8A 3W2SA 4F1TA 4DFUA 2ZV2A 3OEZA 4ZZNA 5J9LA 1OIYA 1SM2A 4FSRA 4DA5A 4K9YA 3PTGA 4FKGA 4D4YA 3ZEPA 3E88A 4TY1A 2OJIA 1XB2B 2QURA 4WUNA 5CQUA 3UMWA 4C4FA 3DKFA 1OI9A 3FKOA 3OUNB 2VUWA 3MI9A 4TYEA 2YM3A 1ZYJA 2ZV8A 3ZS5A 4PF4A 5FTGA 1TTEA 3TDWA 4X3JA 5BMSA 5CT0A 4FSZA 4F7LA 2PUUA 3G33A 1V92A 3A8WA 4JBOA 4RBLA 5ANOA 4NSTA 4WO5A 2O64A 5HOAA 5JH6A 3FPQA 1YXSA 4O0XA 2PZYA 3OXTA 5K0XA 2QOIA 3EFWA 2UW6A 5H8EA 3R1NA 4ALUA 2CKEA 3VBVA 4E4NA 2KULA 4KD1A 1GJOA 4L53A 1SZMA 3H0ZA 5GJFA 1HCKA 2C6KA 3BPRA 3RPVA 1DM2A 2XNNA 5CWZA 1FINA 4PMTA 5EDRA 4FZFB 4AU8A 4CFFA 2GFSA 3ZO3A 1PF8A 3Q9YA 4ALWA 3L9PA 1PGYA 2B1PA 4FEVA 5J8IA 3NUUA 4Z16A 5GZ9A 3F5PA 2JAVA 2UW4A 3W2PA 3LLTA 3UIXA 2YIXA 3FXWA 4MH7A 5BNJA 3BBTB 3ANRA 1U54B 3BWJA 3DV3A 5IDNA 2GNGA 3C5IA 3BYSA 5ICPA 1ZAOA 5HI2A 3GOKA 3TACA 3ZZWA 3QTSA 2W1CA 3SX9A 4A9YA 4QOXA 4EH9A 2YITA 2EXMA 4NUSA 3NW6A 5GZAA 5CEPA 2E9VA 3F5XA 4L7SA 3CKWA 4JBVA 4BZDA 5HZNA 2C5XA 1WBPA 3Q04A 4FK3A 2QO2A 4UZHA 3FEGA 5LARA 2JUJA 1Q8ZA 2C3IB 3P86A 5HVKA 3FLNC 3KN5A 3C4ZA 2QNJA 5CF8A 5HX8A 3F6XA 4O81A 3NWWA 5IQGA 2XK9A 3SAYA 4NKSA 2WNTA 4ARKA 3PPKA 2QO9A 2R3HA 1Q62A 3GVUA 5K5XA 1IRKA 2VWVA 1ND4A 3GP0A 4DCEA 3UTOA 5IEVA 4ACGA 3FRIA 3DDQA 5AUWA 4QPMA 2I0EA 3TJDA 4BBFA 4D2PA 2WTWA 3R7OA 4FEQA 5DWRA 2J6MA 3BYOA 4CZUA 5JZJA 4NYEA 2BTSA 2VNYA 3PJCA 3Q52A 5DBXA 3CPCA 4X6RA 3KRJA 3R1YA 3IHPA 4FC0A 5AUUA 4HW7A 1UWJA 2HOGA 3FQHA 4FTNA 4RT7A 4D4RA 4FOCA 4M0ZA 3LOKA 4EONA 2OLCA 3U55A 4FT3A 4DFLA 3QYWA 3OOMA 4QMSA 4MXAA 4P5QA 4YC8A 2W9FB 2H9VA 3PE1A 4PPAA 2BAQA 3F7WA 2WMWA 2XM9A 2RL5A 1UU3A 4LYNA 1O6YA 5DOSA 1IEPA 3KXXA 4BKYA 1WBSA 4GIHA 1WFCA 1MN3A 4AUAA 1IA9A 4BWXA 3PXYA 3BKBA 4AZFA 4DEGA 1LR4A 4ITIA 2J5FA 4KAOA 2B0QA 5IQAA 3GU6A 3UYSA 4G3DA 3B89A 5HU9A 5LMKA 1J7IA 3EN7A 3AG9A 1YQJA 4XG6A 2NP8A 1DO0A 2WTJA 2XEYA 3GU5A 2PE2A 4I21A 4L42A 2Z7QA 5AR5A 3UODA 4ALVA 3E8EA 2JY7A 4TL0A 3UJGA 4EI4A 3QCYA 5GJGA 2UVZA 3F9NA 3GC8A 3NUSA 4U3YA 4QQ5A 2DI0A 1F4IA 5I5ZA 5DT0A 2XIZA 1OL5A 2X0GA 2Y4IB 3BZ3A 1MQBA 3KB7A 3PWYA 4IJPA 4N70A 3V3VA 5LMKC 1G8AA 4U9AA 3RALA 3IGOA 3TZMA 4QP1A 2BALA 2SRCA 1NVQA 3QBNA 4IMYA 4HYUA 3BU3A 2R7BA 2V5QA 2Y6MA 3FZSA 2A27A 2A19B 2F9GA 3C9WA 2CKOA 4CYJA 2VWZA 5C8MA 3NUAA 3QRJA 1PXNA 2J9MA 4L43A 4FODA 4G16A 4NFNA 2OF2A 4R71A 3A60A 1ZXEA 4E93A 5HTCA 4OTFA 1JR3E 5GZ8A 5KBQA 3NVMB 1GOLA 1FMKA 4HVIA 2BILB 2ZDTA 4TYGA 2BRNA 2GTNA 2QOOA 3HV6A 2X1NA 1KE5A 3OVVA 4PX6A 3R7EA 2B7AA 3COHA 4OTRA 4G6NA 4Z3VA 5HE3A 4KIOA 2C5YA 2UW0A 4EJNA 2MR9A 2B54A 3PXRA 5I0BA 2HZ4A 3PJ2A 1V0BA 1STCE 1DAWA 2Z7LA 3OCBA 4RFMA 1NXKA 5EM8A 3W55A 4BIEA 4F0IA 3FV8A 5LXMA 3AD6A 2YWVA 5AP2A 4C58A 2XK6A 3IOKA 4EZ7A 2GSFA 3EN9A 5J9YA 4YJSA 3NDMA 2O8YA 1E1VA 4N6YA 2EKFA 3ODZX 4CNHA 3QC4A 4C3PA 2C5NA 3SW4A 1PMUA 4M68A 2VTJA 1G3NA 1F5QA 3BHTA 4IADA 5FBNC 3R7IA 5DG5A 2ZJWA 4FMQA 2ZM4A 2XJ1A 4FIGA 3OXZA 2VO0A 5HE2A 3MH0A 3ERKA 3VUTA 1A48A 5DGZA 1Z9XA 4E20A 2YM7A 3D7TB 4KINA 4GYGA 4RSSA 4MEDA 3KRLA 1OVEA 3GC9A 4QTBA 4C35A 2IJMA 3F3ZA 3HGKA 4X6QC 4ZMFA 4XRJA 4O91A 4IVBA 3KFAA 3MB6A 5LJJA 2F57A 5AR3A 2W5HA 1JAMA 4TN6A 2VAGA 3KL8A 4IZAA 3KK8A 4KIPA 5E8ZA 5CLPA 1WVWA 3KF4A 3R7VA 3V6SA 4DH8A 3QYZA 3MIYA 4R7IA 1M14A 1CDKA 2VGOA 1AD5A 2OZAA 4S31A 3UG1A 1JSVA 3PIYA 2C6EA 4MXCA 2ESMA 3R9OA 5LVOA 1U46A 3UPZA 1M52A 3C4XA 4OT5A 5EOBA 4EOJA 3GU7A 4GFOA 4O7LA 3AC3A 4EK4A 4YZMA 3AC2A 5EYCA 1ZYCA 3KF7A 4GT3A 5F20A 4BVUA 3HL7A 2ITYA 3QALE 4ANBA 5BX0A 4L67A 2C0OA 2J51A 3FI3A 5HD7A 3WF8A 1R0PA 4TYJA 4HNFA 3TKHA 4M97A 4YZDA 5B0XA 2BVAA 2QG5A 4E6AA 4GUBA 3RM7A 1CSNA 2OFVA 4RJ3A 2QKRA 4CLIA 2CGVA 4DFZE 5HBHA 3NYVA 4ZJIA 4E4MA 5CALA 4DGOA 2UW7A 2VTNA 3C7QA 3VUHA 4CCBA 1JBPE 4GG5A 1WBWA 4IB1A 4FKSA 2MROB 5AR7A 4O7VA 3UVPA 4XP2A 3KCKA 1QPDA 3ZU7A 2XIXA 3VBXA 5K4JA 3FPMA 4DFBA 3HZTA 4DINA 3JS2A 5L8LA 5K9IA 2PVNA 2IVTA 3MB7A 3P7CA 2W5AA 3QD3A 4O96A 4XHKB 4ZSGA 4RMZA 4FTOA 1U5QA 3GGFA 3VUGA 4Q5HA 2XNEA 2LVQD 2OZOA 5EW8A 2UZBA 3HP2A 3OS3A 3ZLSA 5LVMA 4V05A 5M57A 3OTVA 4XYFA 5DRDA 3CC6A 4QMOA 1OKYA 3UO6A 3VS6A 1WMKA 3FMNA 4J96A 3PY1A 3Q6UA 4IXPA 2R64A 5HNBA 4ANNA 3ZXZA 5IA3A 4AXAA 4TWPA 3QRTA 2DS1A 5ANGA 1KV2A 4YLKA 2O65A 5HCYA 5BVEA 3SVVA 3DDPA 2BDJA 3DS6A 4OTDA 3R8MA 5KKRB 4FIEA 4YJRA 5FRIA 3RHKA 2QR8A 3G0FA 3DFAA 2X6EA 4QP7A 4RJ8A 4R5SA 5ACKA 3ZMMA 5A14A 2QCSA 5CI6A 4ZLYA 2QOHA 3U6HA 5HIBA 3KMMA 2W17A 4Y95A 3IDPA 4EK6A 4IX3A 4DT8A 2P2IA 4F99A 4FEXA 3E3BX 4JG7A 3S3IA 1WZYA 3ZRMA 2XK8A 2Z8CA 4F7NA 2VZ6A 4XMOA 3S95A 2WTDA 2XNGA 2I0HA 1KE6A 3AQVA 3ZBFA 2W05A 5GIOE 2QOFA 1P4FA 3JY0A 4K8AA 2BR1A 4HZSA 2CCHA 4GJ3A 5FTOA 4NIFB 1ERKA 2R3QA 4BCNA 2X2KA 4DEEA 1SVEA 2PVKA 1OKVA 2O5KA 2PVLA 4MYGA 4OTQA 5A4LA 4ACDA 5ETIA 2DAIA 3I7CA 4C2WA 5CAQA 4NFMA 5J5SA 1B38A 5FDXA 5GHVA 4CKRA 2PZRA 5DLSA 2WAJA 4O2PA 4F0GA 5HNGA 2CKQA 3R83A 3TZ8A 5KZIA 4W4VA 3OCTA 2A4LA 5E8UA 4FSQA 4U7ZA 5AX9A 3SRVB 5CF4A 4B8LA 4FTIA 4NKAA 4PL5A 3VBTA 2FB8A 4MD9E 4BIBA 3ORZA 3MN3A 5FP6A 4Y8DA 5LCKA 3SA0A 4IWQA 3Q9WA 1BI7A 2JZ1A 4UB7A 4Y85A 3ZSGA 2R7IA 4AT3A 4AZSA 3CKXA 4O6LA 1VEGA 2WMSA 2WU7A 3NCZA 3VF8A 3UIBA 2Y9QA 3WILA 2C6IA 4L3PA 2PPQA 3S2PA 3FL4A 2VTHA 3SV0A 2XRUA 4IVCA 4JR3A 4O6EA 4NJDA 4BRXA 4S30A 1YHWA 1YLAA 1H1RA 1YDTE 2E9PA 2QOKA 3LXKA 1YXUA 3CQUA 3OT3A 3QA8A 4DLIA 3M42A 4L6QA 4EK3A 5M56A 4XOZA 5EHYA 2R3MA 3POZA 2UVXA 4UMRA 1ZOEA 2VGPA 2OOAA 4O0SA 3E8DA 3T3UA 5FXRA 4ASEA 4KABA 1U54A 4YTHA 4D55A 3L8XA 3Q2MA 5IQFA 1H08A 2X8IA 3COKA 4EBVA 4O86A 1HT2E 3WF6A 4L01A 2YERA 1R4GA 4F70A 1PYEA 5IQIA 1OBDA 2PMOX 2BTRA 2QSFX 5AP6A 3H3CA 5HLPA 4DH7A 2IPXA 5F9EA 5EK7A 2GPHA 1M2RA 1QPEA 4I41A 1OITA 4LL0A 4FG9A 3TJCA 3QUPA 3TI1A 1XH5A 3DZQA 3OD6X 4A4OA 2OJJA 2QVSE 1W8CA 4FV2A 4JAJA 4YHFA 1JWHA 4ZIMA 3F69A 4ENXA 2J0IA 3E62A 2UZNA 4RG0A 3D2IA 4ERWA 5AP7A 3NS9A 2HY81 4DEIA 2CJMA 1YW2A 4R6VA 4B6LA 3HRCA 3RPOA 1KUTA 3Q53A 5BVKA 2G15A 4FNWA 4LGDA 3PJ1A 4XOYA 4DTKA 3O50A 1UV5A 3MV5A 2QI8A 3A7IA 3MGYA 4FTCA 4I1ZA 5CVFA 4EHGA 3ORLA 5H3QA 2E9OA 2OICA 1K9AA 2WTCA 2EB2A 3PYYA 5AP4A 4XX9A 3ZBXA 3RTPA 2ETKA 4FV6A 5H9BA 1ATPE 4WP2A 2DWBA 4XV1A 5CX9A 4LOPA 5JSMA 3KKVA 4DGGA 3DA6A 4EOIA 2KHHA 3QFVA 4IBMA 4YU2A 1W98A 3MY1A 2EB3A 2QOBA 4CRSA 4BTMA 4TPTA 4EKLA 4IX4A 4LQMA 3DBQA 5ANJA 4F6SA 3CE3A 4DEAA 1A5TA 2WKMA 3HDNA 4G3CA 4QP6A 4K2RA 2R4BA 3QQJA 3R22A 4GG7A 4XLVA 4AF3A 5KMIA 5KUPA 4Q9ZA 4R3RA 4AA0A 4E5WA 4QP4A 4AW1A 4D2TA 4N57A 3COMA 2ITOA 4J71A 3UC4A 4FL3A 3CD8A 2VWIA 3AGMA 3QLGA 4AZWA 4N4SA 1JSUA 4D1ZA 3LQ8A 3PVUA 4O38A 2WZJA 3V8SA 3ID6C 3DGKA 3MMPA 5AUYA 5HIDA 3QHRA 4PDSA 2NO3A 3BHUA 3UO5A 1RW8A 3TCPA 4NZWB 4YJOA 3EZRA 4G17A 1H1PA 4YSMA 4RQVA 3TWJA 3UE4A 4APCA 4HNIA 2CKPA 2R3IA 1CKIA 4DG0E 3PXQA 4RWKA 4KS7A 3R73A 4HYIA 3R8PA 3CTHA 3D5XA 4D4SA 4JI9A 4NM5A 3E21A 3UZPA 1XBCA 3MESA 3HDMA 2WQBA 5EI6A 3EYHA 3IW7A 3PZHA 3NVKI 3GNIB 4JJRA 3U51A 5C4KA 3KXMA 3PLSA 4FV1A 4M7IA 4G3OA 5C03A 5I9WA 4JOAA 4MD7E 3ELJA 1WCCA 5FGKA 1UU7A 5CU3A 5AV1A 5HIEA 5C01A 4IEBA 4AZVA 4FIJA 4K6ZA 3UIUA 2CMWA 5L2WA 1VYZA 3ATTA 4QYEA 3SDJA 4IM3A 4F2LA 4DHFA 2PWLA 2ERZE 2CDZA 3HKOA 5E90A 1OECA 2LVOC 3RNIA 1FVVA 2Y4IC 2CN8A 5HTIA 4XP3A 4MTAA 2HZIA 4BIDA 4PRJA 3QZFA 4UEUA 4L45A 4FX3A 3PRFA 2UZEA 2E9NA 1DAYA 1OBGA 4UBAA 5DMZA 4IX6A 3L9LA 4AQCA 4FTUA 4W8EA 2F7EE 3IK3A 3ORNA 5A4TA 1MRUA 3PG1A 3T9IA 3TUCA 4FV8A 1ZYDA 4ZJJA 4DH5A 3RINA 3P08A 2PHKA 3K5UA 3LFFA 3VS2A 3FQSA 4YO6A 3OW4A 2XNBA 1YHVA 3ZEWA 3JUHA 4E5BA 4BI1A 4DG3E 4U43A 5EYDA 4DFYA 3TL8A 2UZOA 2XEZA 2R0IA 5D41A 3V8WA 4BDGA 3HRBA 2XKDA 2BAJA 2QLQA 2G01A 4W4WA 3D7TA 5L2TA 5A3XA 2DUVA 2BROA 2J5EA 4V01A 5A4CA 3GC7A 3AXWA 2H8HA 4BKZA 1NA7A 4ZY4A 1FQ1B 3VS7A 3E7OA 4L7FA 2C0TA 1Q8YA 3D15A 4O1OA 2CHLA 4BDEA 4O0TA 4O0RA 3CCNA 3G90X 3ROYA 4AT4A 2PSQA 5BVWA 4CTCA 4J8MA 1YI6A 2DAMA 1UWHA 4O0YA 4CFNA 2VWWA 3I0QA 5A4QA 1F3MC 3P79A 1H25A 5EQEA 4I5HA 4D4VA 3PIXA 2RG6A 3LCKA 1ZLTA 4RC4A 4EWHA 2OIBA 3IO7A 5FTQA 3UG2A 2FGIA 2BRHA 3M11A 4O22A 4YJUA 4OGRA 4H39A 4XP0A 3IG7A 3PSCA 3OWPA 5EHLA 2G9XA 3HP5A 4WBBB 4BC6A 4BDDA 1DI9A 5AV0A 5A46A 1OMWA 3QX2A 4H3BA 3T6PA 4Y5QA 4FV7A 2IVVA 1Q4LA 4UYAA 4E5AX 5LCJA 5AAGA 5JFXA 2DAEA 3QQGA 5I3OA 4YUQA 3CSVA 2PZPA 1YHSA 2HXQA 1XH9A 4YPDA 5FXQA 3RWQA 3WYXA 2ZVAA 3Q9XA 4KSQA 4OTHA 3TNPC 3Q96A 5DNRA 4OR5A 2ZM1A 4NU1A 2NRYA 3CQWA 1XH8A 2XIRA 4H3QA 3LXLA 2PTKA 1IA8A 4EWQA 2WMXA 3LMHA 4PTGA 4G31A 5CXHA 2LBCA 2WIPA 3DJ5A 2IO6A 2Y0AA 4O27B 5HG9A 4GSBA 2XIYA 1RE8A 1WBOA 4YJVA 2WO6A 1WBTA 4AS0A 2RFEA 4GW8A 3OROA 4NK9A 3R7YA 3EN5A 2JDSA 4GT5A 4YHTA 4F9CA 5AIKA 3ZO4A 1B6CB 2DKLA 2GMXA 5CS6A 3IW5A 5JGAA 1JKLA 1RQQA 3MY5A 2JY6B 1A06A 2XYUA 2W1EA 4FG8A 4BI2A 5IA4A 3LQ3A 3UPXA 2I0YA 3R63A 3FMLA 4GCJA 4AOJA 5H8BA 1PYXA 4WNOA 4NM0A 2X6DA 1OPJA 3CIKA 3LW0A 3QRIA 3IDCA 4JDKA 4BDBA 2ETRA 2YM4A 4FVQA 5DEYA 1P3QQ 3G9NA 4C62A 2IZRA 4LV8A 4RC3A 3D5VA 5FEEA 2X4FA 4HCVA 2JIIA 4YTFA 4ZZMA 2YIYA 3HEGA 3DCVA 4M13A 3QD2B 2YAKA 1JOWB 4ZJVA 1GIJA 3ZRLA 3EQCA 3OWKA 4JBPA 4O0WA 3LM5A 1DO2A 2HAKA 3THBA 3QF9A 1R1WA 2QR7A 2QG7A 4USEA 5I9VA 2V22A 5CU0A 3ALOA 2IW9A 5J5TA 4IAIA 3FBVA 4TYHB 4YZCA 4L52A 4TRLA 4XG3A 4FZ6A 5TT7A 3LJ1A 1YXVA 3AD4A 1WIVA 2GNFA 2XKCA 4XS2A 2EXEA 4NIFA 3QXOA 4XEYA 4CYIA 1CUKA 4S2ZA 3TDVA 2YIRA 1NV9A 2JP7A 3B2WA 3Q4TA 3LIJA 4NM7A 2R3GA 4UMQA 3TNIA 4A9TA 1VDLA 1ZV1A 3C0HA 5E8XA 1T45A 2BFXA 2XKEA 3VBYA 5KMMA 5LVPA 4EQCA 4DCAA 4BY9E 3F82A 3K54A 3VS5A 2ZMCA 1W82A 4IFCA 5A6NA 2FVDA 4YJPA 4GKIA 5CU6A 2YWPA 3T3VA 3SRVA 3TIZA 3I6WA 4IB0A 4IJ9A 4DGLC 1OPLA 3ZLXA 4RIXB 2X9FA 4OT6A 2RSVA 5L6PA 5B2LA 3A99A 4B8MA 4J95A 5A6OA 2BRBA 3EFKA 3F3WA 5IG1A 4G5PA 3U9CA 3QA0A 5KMNA 4DEHA 2I1MA 5DR9A 5CENA 5I9ZA 3H4JA 3PIZA 4E4LA 4BR3A 4NEUA 2CNQA 4MXOA 3N4VA 2J90A 3B8RA 3NSZA 4BCKA 2P2HA 3KMUA 5DR6A 3WARA 5ANDA 2UW8A 2IW6A 3LFCA 3PA5A 4PUZA 2Q0BA 4IW0A 2FSTX 5HBEA 4NT4A 2PVJA 3QZGA 3DB6A 1L3RE 3HV5A 2UZTA 4FKWA 3MJ1A 4FGRA 4P5ZA 3VUMA 5LQFA 2K0BX 3BLQA 2WMQA 2B4SB 3GBZA 3GOPA 3LM0A 4ITHA 4YBJA 3DOGA 3LJ0A 5AJQA 5H8GA 4AE9A 5D10A 1F0QA 4KBCA 3OCGA 1I44A 2P55A 4YHJA 4E26A 2UUEA 3PPJA 3C0GA 2ITXA 2GHMA 1DS5A 2J0MB 5EDPA 3SD0A 1BX6A 5JQ5A 3BGZA 1Y8GA 4CFVA 3JPVA 5CVGA 3PE2A 4CRLA 5AEPA 1QMZA 1QZEA 2ERKA 3U87A 3VS3A 5EG3A 1HT1E 5DT4A 4EC8A 1M7QA 5C1QB 5FUTA 3VQHA 4W9WA 3Q4ZA 1NVSA 2R3OA 3RHXA 4TZRA 2C68A 1QPCA 4M12A 3ZCLA 1H1WA 4I5CA 4WUAA 1K2PA 5EYKA 4DTAA 2VO3A 2VV9A 2V7OA 4FT7A 4XG7A 3GCUA 5CTPA 3UQFA 2OH4A 4MD8E 4EK8A 4EHEA 4U0IA 4UWCA 5CZIA 3KXGA 5IMXA 4EEVA 2OIDA 3MH2A 5F1ZA 2JY8A 3A62A 4JQEA 4AFEA 3UP2A 2BIKB 5LVNA 2C6OA 3BIZA 4EORA 3P0MA 3AC8A 5BUEA 4GUEA 4XBRA 2CPKE 3ZONA 3KN6A 3OG7A 4PP7A 4X2KA 4IZ7A 3MPTA 3Q4CA 4I0TA 4MQ2A 5E8SA 4BYIA 2WMVA 3DT1A 4AGUA 3VHEA 4DH3A 4GFGA 4YJNA 3ZHPC 1TQMA 5C9CA 4E6DA 2NRUA 1YOLA 2BZHB 3FSFA 4NW6A 5CNNA 5KBRA 2E9UA 4LGGA 4WRSA 3ZYAA 3DK6A 2PMNX 3A7GA 3MVMA 3PPZA 5ACBC 4I4FA 3NW7A 4QMWA 1FPUA 1BI8A 3Q60A 3RPYA 4C57A 4CGAA 3OWLA 5F4NA 3W1FA 2BFYA 2B3TA 2OKRA 1YXXA 5BUIA 5IEXA 1UNHA 3I7BA 5TF9A 4C33A 4X2NA 5A4EA 3QWJA 4TW9A 3GEQA 5HESA 3NUNA 4HPTE 4FV0A 1XQZA 2G2IA 4GVJA 4JR7A 3V5QA 4DGNA 5IZFA 5E7RA 1KV1A 4O83A 1LEWA 3ZUTA 4FKQA 4NTSA 4D28A 2C6TA 3L9MA 3GCPA 3LJ2A 4RIOA 3NPCA 3FMDA 3TV6A 4H1MA 3IGGA 4W9XA 4ENYA 3COIA 4NJ3A 4I5MA 4E8AA 5FM2A 3D5UA 3JVRA 4TXCA 4YURA 1O6KA 5EM7A 5CF6A 3ZFMA 5L8KA 4ZMEA 1XJDA 3FSKA 5EW9A 4FZDB 4CV9A 3PJ8A 4FTRA 2JITA 3ORKA 1G4AE 4ACMA 2FUMA 2WPAA 2OWBA 4Z9LA 3V04A 3VS1A 2RIOA 3O0GA 3LFSA 3BQRA 4PQNA 3LCDA 1FGIA 3NUXA 1GIHA 5IMEA 2GS7A 3HECA 2O63A 3L8PA 3NX8A 4R3CA 3ZM4A 1OKWA 4LRJA 3UOLA 4ACHA 4DEDA 3MA6A 4PDYA 3R02A 4RVTA 3ZM9A 3U4WA 4RLKA 4QMPA 2YAAA 2Z60A 3FWQA 4ACCA 5E8TA 1MRYA 4BBMA 2BKKA 3DBCA 1JKSA 4GK2A 4O84A 5JFVA 3GENA 3KULB 3BU5A 3CTQA 2WTKB 1PKDA 4I6BA 4JRNA 2YIQA 3DK7A 5HKMA 4Z7GA 3FLWA 3KRWA 3PVBA 3FI4A 5BYLA 4F1OA 4EL9A 1KSWA 4EOSA 4EZ3A 4WOVA 3FZOA 1WJ7A 5I9UA 4GK4A 4CD0A 2ZYBA 4ANOA 4IVDA 3W8LA 1XH4A 2VTSA 4QQJA 1UNLA 3OMVA 3CXWA 3ZO1A 1YOJA 1TVOA 5H2UA 4C34A 4EYJA 3QGWA 3VHKA 3MDYA 2W1ZA 4YBKA 3MFSA 2RFSA 2YM6A 2JKQA 2R3PA 3GCVA 4FKLA 4OAVB 1PXPA 5EFQA 4CLJA 3G2FA 3FI2A 4S33A 5GIPE 4A9RA 3L8SA 3MFTA 3O8UA 1H00A 4FTAA 2ZOQA 3DB8A 3G9LX 4H1JA 4BN1A 1BVSA 2BWEA 5JGDA 1V0PA 1P14A 3F2AA 3FC1X 3FXXA 3TKIA 3AT4A 4RX8A 3PRIA 4XLIA 3BGPA 3A61A 3VQUA 2QONA 3UIMA 3LVPA 2YZLA 2EKKA 3VO3A 3PP1A 3I5ZA 4NL0A 3CPBA 1JKTA 3OY3A 2YZAA 4O7SA 4ASDA 2EXCX 4XV3A 4AGWA 1S9JA 2XF0A 4JVGA 2PK9A 3QC9A 5L2IA 3KCFA 2JC6A 3R2YA 4I0SA 1DI8A 2UW5A 3IKAA 3QUEA 4FTTA 4KBAA 4K0YA 3KXNA 4U79A 4DN5A 4YPSA 4ZSEA 3O7LD 2GQSA 2C4GA 1Y57A 5CSVA 5AUXA 4A4XA 4LV5A 4OW8A 5AUTA 1HCLA 2PVFA 3QKMA 4LG4A 4I4EA 5KHWA 1XWSA 4G3GA 3PA3A 3R2BA 2EVAA 4G5JA 1Y91A 2UZLA 3EZVA 3LPBA 4WG3A 5D7VA 5ETCA 1J1BA 4I3ZA 5CEOA 3EQRA 5EKNA 3TEIA 4DFXE 5HE0A 4FG7A 1M2PA 3ZLYA 1HQYE 4BWKA 3GXLA 2GNHA 3W32A 1YWVA 4DLJA 4NH1A 4DTBA 3UC3A 5AP5A 2BRMA 1GO5A 2KNVA 4AAAA 5BQ0A 4JT3A 2O0UA 5M51A 4DC2A 2GS2A 3BELA 4EBWA 1WVYA 4PL4A 2PMIA 4PY1A 4C38A 4O7TA 2OXXA 3O17A 4FV5A 4USFA 4BCJA 4OBQA 4RA4A 3FAAA 3BHVA 3FZPA 2H34A 3D5WA 3QTRA 5J1VA 3WOWA 5JMSA 3ROCA 2VTAA 4ANMA 3VVHA 2J4ZA 4WG4A 2PU8A 1R78A 4TTHB 2WTVA 3GCQA 3HRFA 4ANSA 1YWRA 4QPAA 3E5AA 4V04A 3K3JA 2WHBA 3QX4A 2G2FA 1OL7A 4F65A 4UWYA 3ORTA 2LAVA 3MW1A 3QQUA 2C3JA 4XV2A 4C4GA 1EFUB 1APME 5DIAA 3BV2A 4KRDA 5DH3A 4BCIA 3OTUA 4RWIA 4CEGA 3HVCA 2JGZA 3NIZA 2R2PA 4H05A 2FO0A 3PG3A 3ZDIA 4RVKA 3U6JA 2WMAA 1Y8YA 3HMIA 4FT0A 5C4LA 4RVMA 2XK3A 4RRVA 4MF1A 4TYIA 3S00A 1G8SA 3OBGA 4ZAUA 3QQHA 4IE9A 4JNWA 4R1VA 5L6WL 1PKGA 4ZTQA 2PVHA 3UOJA 1ZMUA 3EQPA 4BKJA 4IAYA 3D2KA 2OOBA 2XP2A 1K3AA 3UOHA 2HZNA 1A9UA 4IM2A 2JBPA 2RG5A 4M84A 3BBZA 1L8TA 3FE3A 4TYHA 4A7CA 3EB0A 4ZY6A 1KE9A 3FZ1A 3HLLA 3FJQE 4I6HA 5BMMA 3GB2A 3NNXA 3LCOA 3S1HA 1SVGA 2HYYA 3LFBA 3EQFA 3OW3A 3LFAA 4D0XA 1RJBA 4D9UA 3EHAA 1G5SA 1OUKA 3SLSA 4R78A 3A4OX 5ANKA 1G3IA 3UBDA 2R3JA 4BCMA 4EUUA 4DF3A 1XKKA 4BDIA 2VWBA 3NRMA 4RIXA 3U4UA 2HXLA 3CQEA 3P4KA 5E91A 4TKSA 3SW7A 2KNZA 2ITZA 2PVMA 5BUJA 5ITAA 4H3PA 2DAGA 4KKGA 5AIRA 4ZP5A 3H9OA 2P3GX 1W0XC 4HJOA 2ZTDA 3KXZA 2WQOA 1IXSA 1OQYA 3F92A 4IAZA 5FBOA 4DE4A 1OPKA 2R3NA 4R7BA 3IS5A 2HY0A 2F7XE 1Q02A 3ENMA 2CN5A 3QCXA 4PNIA 5CNOA 4EKKA 2PL0A 3OY1A 4P2KA 4ID7A 3MA3A 1G41A 3RAIA 1OTRA 3E63A 5LVLA 2F49A 1UU9A 3ULZA 2CP8A 2OO9A 3HMOA 4UN0C 4QPSA 4Q2AA 5CY3A 5HG5A 4F63A 2XNMA 3QRKA 2VX0A 4IFGA 4G9RA 5HG7A 2Q83A 3R8ZA 4UMPA 5HG8A 2J2IB 3ZC5A 4A4LA 3FDNA 4DFNA 1OL6A 2JZ0A 4OUCA 4MNEB 5AP0A 5CF5A 2GQRA 4EH6A 4L3JA 3KA0A 4OTWA 3D0EA 3LCUA 3Q6WA 3R71A 2W5BA 3NYNA 3FMHA 3NYXA 4X3FB 4XV9A 3T9TA 1OZ1A 1J91A 2W96B 1PXJA 3TUDA 4TT7A 4QYGA 1IAHA 3VS0A 2G3QA 4FSYA 4PNKA 4YR8A 5FG8A 3R28A 3G6HA 3VW8A 1H0VA 4M14A 4AT5A 3RCJA 3RPSA 4WKQA 3DXQA 5M08A 3K2LA 4GK3A 3NZ0A 4O0VA 3I6UA 2XNOA 4YZBA 1AGWA 3PDTA 3DKGA 4RFZA 2BZJA 3QKLA 4G3EA 4CXAA 5IEYA 5IH6A 1Q5KA 2HIWA 3D94A 3BLRA 1PMVA 4N6ZA 1BUHA 4KB8A 4E73A 3ORMA 4G2FA 4YC3A 4CZTA 4FL1A 1T43A 2DNAA 1JLUE 4D1XA 5M4IA 5KE0A 5AP3A 3BYUA 4ZY5A 2LVPC 1S9IA 2VD5A 5IQBA 2VTQA 2W1DA 1H24A 3W16A 5BYYA 4ANQA 1IASA 1VJYA 4CG9A 1V0OA 4K1BA 3UYTA 4D2VA 3M2WA 5K5NA 2DYLA 4JIAA 4Q7JA 1Z5MA 5IDPA 3RAHA 4FR4A 4C4JA 5IQEA 5J1WA 4FF8A 1FVRA 5HTBA 2F4JA 2UZUE 3H9RA 3WF7A 4GU6A 4PMPA 5CANA 2VTRA 5IISA 4EYMA 5DA3A 4KIKB 2KNAA 2I0VA 3HYHA 3L1SA 3LCSA 4W8DA 2GDOA 3PJ3A 4ZZOA 2W99B 4U81A 3AC5A 3BLHA 4MK0A 2VX3A 3Q9ZA 1YVJA 4MXZA 3GFWA 1UNGA 2VTMA 4CQEA 1IAJA 3MTFA 4I94A 5JRQA 4EHVA 3EYGA 5E8YA 5E9EA 4CT1A 5GNKA 2HWOA 1Q61A 3HAVA 3QGYA 2OJGA 5CAUA 2C1BA 5K3YA 2L4FA 1TR8A 3ZOSA 1ZOGA 2DZLA 3SQQA 1AQ1A 3RWPA 1QPJA 4MX9A 3DJ6A 4CG8A 4JDIA 4QP2A 4RX7A 1W7HA 5HNIX 4WA9A 3TNHA 1BMKA 2OH0E 4FE2A 3VUKA 4JDJA 5D11A 2CCIA 3ITZA 2BKZA 3FI8A 4WRGA 4BGGA 3F5GA 4FTMA 3QQKA 1P5EA 2OW3A 4G1WA 4R7HA 3TTJA 1MRVA 3ZXTA 4KWPA 5KMLA 5LWNA 1PY5A 3ZSIA 2R5TA 3FY0A 4FKRA 3W2RA 5LWMA 2R3KA 3P5KA 3KULA 5EI2A 2VNWA 4PWNA 3BE9A 2WQNA 3OCSA 3QAME 3GLHE 4FV3A 4FBXA 5CQWA 5FEDA 3WZDA 4F09A 1YI4A 4CVAA 4QRCA 3SG8A 2I40A 4BI0A 2Y4PA 3RJCA 4D2SA 3IECA 2RRUA 4MBLA 3U6IA 3NCGA 3W2QA 4MKCA 1KE7A 1XHAA 4C4IA 4JDHA 2JAMA 3BU6A 4O0UA 4RGJA 5CASA 4PL3A 3JXWA 1H1QA 2C6DA 1REKA 3V5JA 3QQFA 2WB8A 2R0UA 4PPBA 4DEBA 3JY9A 3DFCB 3LFNA 4WSYA 2WTKC 2A1AB 3QL8A 4G34A 4L3LA 5AP1A 1WAKA 5CZHA 4BHZA 3ETAA 5CEQA 4PMMA 2JBOA 1C7YA 3VNTA 2JDRA 5TE0A 2VWXA 5AX3A 2ITQA 4C59A 5DI1A 3FXZA 3POOA 4IM0A 2YJSA 3KEXA 3UQGA 1T6OA 2JFLA 2VTIA 4GS6A 3VRZA 3O96A 2BRGA 2WTIA 3Q3BA 4S34A 2JEDA 3E87A 3DXNA 1CMKE 3FUPA 3OWJA 3B8QA 2VTLA 3EN4A 4QTCA 4BDCA 5C8KA 2UW9A 3S0OA 1H4LA 4IAFA 4YNEA 2JLDA 3R00A 4QTAA 4V0GB 5IA0A 3SC1A 3C51A 4HVHA 3LMGA 2ITVA 4RZWA 1NW1A 3IDBA 3HV4A 1ZMWA 2UZWE 3TT0A 4FSUA 5HX6A 2YLEA 4PDOA 4HYHA 4ZTMA 3QQLA 4ZSLA 2QLUA 3FHRA 3FY2A 5CSXA 2X81A 4AN3A 2DENA 1NT2A 2YFXA 3V5WA 3EL8A 4XG9A 3HNGA 4U44A 3VULA 3WZEA 4E6CA 3I60A 4XNEA 5IH4A 3UQCA 3GCSA 3RK5A 2YJRA 4AGDA 1KYIA 2YHVA 3C4EA 4KUJA 3TM0A 3ZLWA 4FK6A 4I92A 3AC1A 3F66A 4IVAA 4F4PA 4FNXA 3G15A 3MVHA 4LRMA 2YA9A 4P7EA 3SXSA 3R9NA 4C7TA 2XBAA 5DRBA 2XJ0A 1E1XA 4MWHA 3VC4A 4CFUA 3LMIA 3BV3A 4GMYA 4QMNA 4ONAA 1X8BA 3FRHA 3CJFA 3AT2A 4FIHA 3V8TA 4XCUA 3RAWA 4QYFA 5AADA 3R6XA 4DBXA 1VR2A 2XH5A 4PTEA 5AMNA 5EW3A 3SOCA 3DAEA 5FDPA 3FLYA 3VW6A 2GFCA 4C02A 4QTEA 3OZ6A 3RPRA 3IW8A 3PXZA 3MIAA 4GIIA 4QMUA 4RLLA 3VBWA 3MFUA 4ZEGA 1E94E 2QOLA 3RZFA 2OSCA 1BYGA 5HLNA 2H96A 4AGCA 2BPMA 5KMOA 3HUCA 4UMUA 1OAIA 3PFQA 3U9NA 5BVNA 4AOTA 3DKOA 5IU2A 2ITPA 3N4TA 4UXLA 5M44A 4II5A 1XR1A 3SXRA 3VN9A 2IN6A 4XG4A 5DHJA 3KGAA 4AOIA 3OXIA 5JZNA 4APPA 1XO2B 4F0FA 2PVYA 3EQBA 1B39A 2BHEA 4XG8A 4YLLA 3TV4A 4ZLOA 3OHTA 3F88A 3DJ7A 4MXXA 4MAOA 4JL9A 2FSOX 4WSQA 3MY0A 3TIYA 3WYYA 2B55A 2EU9A 1H0WA 2KTYA 2XZSA 3MH1A 3NW5A 3H10A 3OC1A 3LQ5A 3CP9A 3T8OA 3ZFYA 4G9CA 2C30A 4YLJA 1OKZA 1YWNA 3DNEA 3F3VA 4IC7A 4IWDA 5JRSA 3OBJA 3I1AA 4FKVA 4QMXA 5CAPA 5M07A 1JSTA 2B9FA 2DQ7X 2IZSA 3A7HA 5G6VA 4AFJA 3UNZA 4BB4A 2GQGA 4NTTA 2DHYA 3DPKA
chains in the Genus database with same CATH superfamily
5JEBA 3QWKA 5D1JA 2CWBA 3A4PA 4PV0A 4RX5A 3SXFA 2AHMA 4D1SA 1ZZ2A 3LHJA 3VS4A 4X64M 5ANEA 4GEWA 3WE4A 3BCEA 3PSDA 2WGJA 3A8XA 4EK5A 3W33A 3T1YM 4MHAA 5D9HA 2HHHM 4RA5A 2YEXA 4M67A 2K9DA 5HEZA 3TV7A 4QNAA 3ZFXA 3TNQB 2W1IA 3W0LB 3E93A 2Y0QA 4BCQA 2GNJA 4LM5A 3U61B 3RK7A 4C37A 4G6OA 2ITWA 3RKBA 3ZSHA 4L68A 3QTXA 2JWSA 4LFAM 2C6MA 1JQHA 4M66A 4IBDA 3F61A 3LAUA 1CKJA 2E2BA 3P7AA 4WG5A 2C47A 2BZKB 5CVHA 4B4LA 1ZYLA 4QMQA 3TYKA 4II7A 5IPJA 3QCQA 3PXKA 4MCVA 1ZY4A 4UALA 4A9UA 1ZY5A 3B2TA 3REPA 3C4FA 3BQCA 5HICA 3UNJA 3FKNA 2C5VA 1PXOA 5BVDA 3FD9A 2YM8A 2VU3A 3R8LA 3KMWA 4QMZA 5EM6A 3WZUA 2XJ2A 2GHGA 5EI8A 2OF4A 1H28A 5DT3A 4HCUA 1ZMVA 4A9SA 4QYYA 2VX1A 3ENHA 3EWHA 3RCDA 2WELA 2C69A 3CLYA 2QOQA 5HORA 2YN8A 3KP0E 1Q8TA 3KIOC 2H1RA 1UKIA 1YXTA 4YO4A 1MX0A 1ZRZA 2GCDA 4IIRA 2JKOA 4R3PA 1ZYSA 3G6GA 1Q8UA 4DITA 3R9HA 2C5RA 3KRXA 1QYRA 2Z7SA 4HGTA 3RK9A 4IDTA 5F94A 2HCKA 2E5LM 4HOKA 4LOOA 1KOAA 3QCSA 2ZM3A 3MTLA 2GTMA 4GT4A 4FV4A 3WIGA 1Q99A 1NY3A 2XM8A 5I9YA 2ERCA 4L00A 5AM6A 1ZWSA 1GZNA 3S4QA 4RQKA 2AC5A 3A7FA 5KMIA 4QP9A 4CCUA 4F7JA 4AW0A 4E6QA 3VJOA 3MWUA 1P2AA 3C13A 4IX5A 3U6DA 5CEIA 5J79A 3FYDA 1IQPA 3R1SA 5AR8A 2DWLA 1OKSA 2PZ5A 2QHOB 3BHHA 5K0KA 4RF1A 5FD2A 5C18A 1QL6A 3ORIA 3FYJX 4O21A 4QMLA 2PYWA 2RFNA 4BWPA 4IQ6A 3RGFA 2FNAA 3SKCA 3CF2A 5CSPA 5HE1A 4IWOA 4L46A 4IB3A 3FLQA 3PXFA 4ZTNA 2ZV7A 4EQMA 3U6EA 4BICA 5IUGA 4WBOA 2W06A 4CMUA 3O7LB 4FTQA 4RZVA 5TOZA 3AMYA 4GU9A 3MBLA 4LJ9A 2IZTA 1L8QA 4NM3A 4IBIA 4AI6A 2X8EA 3EQHA 4GRBA 1L1TA 2CGUA 5EXXA 4C3RA 1XWIA 4FV9A 5IKWA 2W7XA 3BEAA 3I4VA 1KOBA 2JDOA 3NNVA 2FH0A 2J7NA 1PRYA 4WHZA 3R1QA 3NAYA 1Q3WA 2R3FA 4PPCA 1DGBA 3FMEA 1H07A 3R8UA 2QKWB 3VDUA 2VO6A 3OT8A 1M17A 1OIUA 4BGQA 2CNUA 4O7WA 4IAKA 5IQCA 4U3ZA 2R3LA 2EUFB 5J95A 2D7HA 4NC6A 2RF9A 1YDSE 4S32A 5I9XA 1IBKM 4IC8A 3QZIA 3OUKA 4Y72A 1HNWM 5KX8A 2XVDA 5EP3A 3C1XA 1HOWA 2XCKA 4K18A 5HO8A 1WVXA 2X7OA 4AG8A 4YTCA 2L09A 3WE8A 4EH8A 4J7BA 3RM6A 3ET7A 3R8VA 2C1AA 4EC9A 4FUYA 3K9PA 1Y6AA 4MXYA 4FA2A 5JFSA 4LG2A 3BE2A 4JXFA 4I6FA 3G5DA 4CSVA 3QKKA 4AX8A 1OL2A 3C4WA 1YKRA 4IANA 2A0CX 2YQZA 2W1FA 4E4XA 2HENA 3PSBA 3Q32A 2UVYA 3CD3A 4PMSA 3W10A 3PLAE 3P1AA 4ZTRA 3LFEA 3PP0A 4BCOA 2L2DA 3O51A 5LOHA 2F7ZE 4JQ7A 3RI1A 3FYKX 4IWPA 3CY2A 2ZB1A 3TXOA 5KHXA 3DKCA 2J50A 1O9UA 5DE2A 3I04M 3HA6A 4QP8A 4DT9A 1PXMA 5CU4A 2OXYA 3HHZA 1R5LA 5AV4A 1GY3A 2OO8X 4R7GA 1IY1A 3EKNA 1TKIA 3EKKA 2YM5A 4JI0M 4IJEA 4MWIA 2O3PA 3ZO2A 3RVGA 4BDAA 3EL7A 1LEZA 4IACA 3GT8A 4DR5M 3VWAA 3VRYA 5J87A 4IDVA 4NCTC 4CFXA 4YMJA 4QMVA 1AUAA 1JNKA 2P33A 3I81A 2QU5A 5DNYA 2XBJA 4X0MA 4CV8A 2ZV2A 4ZZNA 1OIYA 5DYIA 3PTGA 4D4YA 3E88A 4WUNA 4FD2A 1ZYJA 4PF4A 1TTEA 4FSZA 1V92A 5ANOA 5HOAA 5JH6A 1DGFA 4L53A 1SZMA 1HCKA 2XNNA 3W0QA 4CFFA 2IEWA 3ZH9B 4ALWA 3L9PA 1PGYA 2B1PA 4FEVA 5J8IA 2UW4A 5BNJA 3BWJA 5IDNA 3C5IA 4A9YA 2E9VA 4BZDA 3FEGA 2JUJA 3F6XA 3NWWA 1ZQ9A 3PPKA 2VWVA 2I0EA 4D2PA 3R7OA 5DWRA 4NYEA 3PJCA 1IN8A 1SXJD 3R1YA 3B74A 4RT7A 3LOKA 4DFLA 2WMWA 2XM9A 2RL5A 1O6YA 3Q8XA 3KXXA 4X66M 4GIHA 1MN3A 4BWXA 4AZFA 3PXYA 4DEGA 5HU9A 5LMKA 1YQJA 4DUZM 2NP8A 2WTJA 3GU5A 2PE2A 3UODA 3E8EA 4TL0A 3PFIA 5GJGA 4QQ5A 1F4IA 4LFCM 5DT0A 2XIZA 3KB7A 3BZ3A 4IJPA 1G8AA 3UGJA 1JB0F 1N33M 1NVQA 2R7BA 2V5QA 2Y6MA 3FZSA 2A27A 2CKOA 5IZ7D 2VWZA 3NUAA 3QRJA 3HHXA 4FODA 4R71A 3A60A 4E93A 4OTFA 1JR3E 5KBQA 1GOLA 1FMKA 4TYGA 3R7EA 4JYAM 2C99A 4OTRA 2UW0A 4EJNA 2B54A 1STCE 1VLRA 1NXKA 5LXMA 3AD6A 3MK6A 2XK6A 4N6YA 2EKFA 3ODZX 3SW4A 1PMUA 4M68A 2VTJA 5FBNC 1F5QA 2ZJWA 3MH0A 3VUTA 5DGZA 3PNYA 3D7TB 4RSSA 3GC9A 2W82A 4X6QC 4IVBA 2XLJA 5LJJA 5AR3A 1N32M 4TN6A 4KIPA 3KL8A 3V6SA 3QYZA 4S31A 1JSVA 2C6EA 4KLNA 3UPZA 1M52A 2LHCA 5EOBA 4NSRA 3AC3A 3AC2A 1ZYCA 5IWAM 3HL7A 5HD7A 3GLHA 2QG5A 4GUBA 1CSNA 2QKRA 4CLIA 5CALA 2UW7A 4Z6YA 3ZU7A 1QPDA 3FPMA 5L8LA 4OU7A 1U5QA 4Q5HA 2QPAA 2XNEA 5LVMA 5M57A 1OKYA 3UO6A 1WMKA 3FMNA 4DT8A 3PY1A 5DYGA 5ITTA 1KV2A 2O65A 4GITA 4YJRA 2QR8A 3ZMMA 3U6HA 2QCSA 4ZLYA 3KMMA 2W17A 3UDZA 1N78A 1N75A 2R44A 4F7NA 4XMOA 2I0HA 2QOFA 1P4FA 2CCHA 5FTOA 4NIFB 5C1BA 4OTQA 5ETIA 4NFMA 4O2PA 3R83A 5KZIA 3SRVB 4FSQA 4NKAA 3VBTA 3MN3A 3SA0A 4UB7A 4Y85A 4AT3A 4O6LA 2F5OA 2WMSA 3WILA 2Y9QA 3FL4A 2XRUA 4S30A 5GKNA 3LXKA 4DLIA 5M56A 4UMRA 3E8DA 5FXRA 4ASEA 4YTHA 4MUQA 4EBVA 4CJ6A 4L01A 1R4GA 4WW0A 1PYEA 4DH7A 2BTRA 5AP6A 5HLPA 2GPHA 4I41A 4LL0A 3OD6X 4QDEA 8CATA 4RG0A 3D2IA 5AP7A 4DEIA 5EXTA 1KUTA 4FNWA 3MV5A 3A7IA 4FTCA 5H3QA 2E9OA 5AP4A 2EB2A 4XX9A 4FV6A 1ATPE 3TWKA 4DGGA 4EOIA 3HKPA 1NY6A 2QOBA 5ANJA 4DEAA 3HDNA 4QP6A 4AF3A 4Q9ZA 4E5WA 3GLFA 3UC4A 2VWIA 4N4SA 1JSUA 3V8SA 3ID6C 5AUYA 3BHUA 3TCPA 3UE4A 3EZRA 3TWJA 1CKIA 4KS7A 3CTHA 3UZPA 1XBCA 4JJRA 4M7IA 5C03A 4JOAA 1UU7A 5AV1A 4AZVA 4IEBA 3HZJA 5L2WA 2CMWA 3ATTA 4DHFA 3OTOM 1FVVA 4Z8XA 4JI6M 3PRFA 3L9LA 4AQCA 4FTUA 4W8EA 3ORNA 1MRUA 1I94M 3I4YA 1ZYDA 4DH5A 3W67A 3P08A 1GVNA 2PHKA 1ST4A 3ZEWA 4BI1A 4DFYA 3HRBA 2XKDA 2G01A 5A3XA 2H8HA 4BKZA 1FQ1B 4L7FA 3D15A 4BDEA 4CTCA 1YI6A 4O0YA 4GHLA 4OW0A 2VWWA 1F3MC 2RG6A 3IO7A 4OVZB 2FGIA 4H39A 3IG7A 3UK6A 3PSCA 3L29A 2G9XA 4WBBB 1DI9A 5A46A 4Y5QA 1Q4LA 5LCJA 5JFXA 3CSVA 3ZC7B 5I3OA 3WYXA 4OTHA 5DNRA 2YFQA 2NRYA 3CQWA 4NU1A 4EWQA 3LMHA 4G31A 3DJ5A 5HG9A 2XIYA 4AAYA 3BL7A 2RFEA 3OROA 3EN5A 2JDSA 4GT5A 3W0MA 3JR4A 5JGAA 3IW5A 3MY5A 4FG8A 3UPXA 3R63A 3FMLA 4NM0A 3LW0A 3CIKA 2YM4A 5DEYA 4C62A 4RC3A 3D5VA 5FTLA 4M13A 2YAKA 3OWKA 4O0WA 3THBA 2QR7A 3ZUUA 4OAVB 3HJ8A 1YXVA 1WIVA 2GNFA 4CYIA 2EXEA 3QXOA 4XEYA 4AXCA 4O4DA 3TDVA 2YIRA 3B2WA 1G8KA 4BY9E 2XKEA 1IXZA 1W82A 4IFCA 2BNKA 5L6PA 2BRBA 3EFKA 2P2HA 3K92A 3KMUA 5ANDA 3PA5A 3LFCA 4PUZA 4IW0A 2FSTX 5HBEA 4NT4A 3W68A 3CF6E 3DB6A 3HV5A 5LQFA 5HNIX 2WMQA 4ITHA 5AJQA 4AE9A 4KBCA 3U6QA 4YHJA 3CF0A 4E26A 2UUEA 3PPJA 2ITXA 2GHMA 2LXEA 1BX6A 1Y8GA 3JPVA 5CVGA 3PE2A 5JQ5A 2ERKA 5C1QB 5FUTA 1HT1E 4W9WA 1QPCA 1H1WA 4WUAA 1XXHB 3E4RA 2V7OA 4FT7A 4XG7A 3GCUA 4EHEA 5CZIA 3KXGA 5F1ZA 5LVNA 3BIZA 4EORA 4DV0M 4GUEA 3OG7A 4X2KA 2I7PA 4MQ2A 4PT5A 3ZHPC 5C9CA 3KOWE 1XMOM 4FCTA 3MVMA 3PPZA 3Q60A 4TW9A 4HPTE 2APLA 4FV0A 1LEWA 4NTSA 4D28A 3PUFC 3NPCA 4W9XA 3IGGA 4ENYA 3COIA 4E8AA 2XAOA 4ZMEA 3PJ8A 4FTRA 3U5ZB 4ACMA 2OWBA 3VS1A 3O0GA 3BQRA 4PQNA 2GS7A 3HECA 3ZM4A 3UOLA 2R62A 3MA6A 1WXQA 5AFVA 2YAAA 3FWQA 1MRYA 3GENA 3CTQA 2YIQA 5BYLA 4QNMA 4WOVA 4GK4A 4CD0A 3W8LA 3ZO1A 4C34A 4EYJA 1OIPA 3MDYA 2W1ZA 1SXJB 2RFSA 2JKQA 3GCVA 5GIPE 1G71A 4BN1A 1H00A 3DB8A 1BVSA 2BWEA 5JGDA 3F2AA 3SAUA 3VO3A 4O4CA 3CPBA 2EXCX 1S9JA 2PK9A 1ST0A 2UW5A 4U79A 3KXNA 4YPSA 2C4GA 5CSVA 5AUXA 2PVFA 3QKMA 3PA3A 4G5JA 1Y91A 5ETCA 1NY5A 1J1BA 1M2PA 3ZLYA 3W32A 1YWVA 4DTBA 4NH1A 3UC3A 2BRMA 5M51A 3EIHA 3BELA 4EBWA 4PL4A 4O7TA 3O17A 4RA4A 2XSZD 3BHVA 3D5WA 1D0KA 2VTAA 2P5TA 1YWRA 1N36M 3K3JA 1OL7A 1PM5A 1EFUB 4KRDA 5DH3A 4MGIE 2R18A 4IBFA 4BCIA 2C98A 4CEGA 3A98B 3HVCA 2R2PA 4H05A 1NJFA 4LZJA 3KOXE 2WMAA 1Y8YA 3HMIA 4FT0A 4RVMA 1IN4A 2QBYB 3OBGA 5L6WL 1QAMA 2HZNA 4IM2A 1L8TA 4M84A 4TYHA 1J7KA 3S1HA 1SVGA 2HCBA 3EQFA 3AFHA 3OW3A 3EHAA 4R78A 1OUKA 3A4OX 3UBDA 4EUUA 1XKKA 4BDIA 3U4UA 2HXLA 3CQEA 2PVMA 5BUJA 3KXZA 4R7BA 2CN5A 2PL0A 1G41A 3B7QA 3LQQA 5HG5A 4F63A 2XNMA 2VX0A 3R8ZA 2J2IB 4DFNA 2JZ0A 4OUCA 4MNEB 3R71A 3NYXA 3T9TA 2W96B 2XARA 4QYGA 1IAHA 2G3QA 1NNJA 5FG8A 3R28A 3AKJA 3RCJA 3RPSA 4YZBA 3GLIA 4G4QA 1T43A 2DNAA 1W5SA 4ANQA 4CG9A 4K1BA 3M2WA 5K5NA 2DYLA 4JIAA 4Q7JA 3RAHA 4C4JA 2C96A 2F4JA 2UZUE 5IISA 2KNAA 3LCSA 4W8DA 2GDOA 4U81A 3Q9ZA 1UNGA 2VTMA 1IAJA 3MTFA 2XALA 2C1BA 2L4FA 1AQ1A 3RWPA 3DJ6A 4QP2A 3TNHA 4FVMA 4FE2A 4JDJA 5D11A 2Y21A 3F5GA 3QQKA 1P5EA 2OW3A 4R7HA 4KWPA 1PY5A 3ZSIA 2R5TA 3FY0A 1NNUC 2UXCM 4JI2M 5EI2A 3QAME 4FV3A 2I40A 3GRUA 1NSFA 1KE7A 4C4IA 4JDHA 1OFIA 2JAMA 4PL3A 3JXWA 1H1QA 1REKA 4PPBA 2A1AB 4L3LA 4XGIA 1WAKA 4BHZA 5TE0A 3GRVA 4C59A 3FXZA 2YJSA 1T6OA 2VTIA 4S34A 2JEDA 3S0OA 4QTCA 3TWMA 4QTAA 3SC1A 1SXJC 4RZWA 2UZWE 1QAQA 2YLEA 1TF0B 4PDOA 3FUVA 5CSXA 4AN3A 4U44A 4XNEA 5IH4A 3C4EA 3F66A 4FNXA 4P7EA 4CFUA 3BV3A 3HGIA 3RAWA 1YE9A 4DBXA 3FLYA 3VW6A 3RPRA 4GIIA 3VBWA 2QOLA 5KMOA 1ORYB 2H96A 3HUCA 5IU2A 5M44A 3VN9A 1XR1A 5DHJA 2PVYA 1XNRM 4ZLOA 2G5GX 3OHTA 3F88A 4MAOA 2FSOX 2B55A 2KTYA 3J27B 3OC1A 3ZFYA 4G9CA 2C30A 3F3VA 1QDRA 3OBJA 1JSTA 3A7HA 5G6VA 4LF8M 3ULIA 2N35A 1P4OA 1J7LA 4LMNA 2GHLA 3DAKA 5KKRC 4QP3A 5JN2A 3NUYA 4QNYA 4FVRA 4TWNA 3DZOA 2FH9A 3I0OA 1KSFX 1G8PA 4BGHA 4YC6A 1CTPE 4AXDA 4H58A 3W0FA 1MQ4A 1Q41A 3O71A 4MVFA 1PMEA 1PJKA 3T15A 3VF9A 5BPVA 4O7YA 2NPQA 2G2HA 5AUZA 4GVAA 3W8QA 3OF0A 1XH6A 5IUHA 1YI3A 4I23A 4BBEA 1W2FA 3Q2JA 1GNGA 2CHQA 1IM2A 5L8JA 4AZTA 2HWPA 2OK1A 4KNBA 3Q5IA 1CM8A 2VWYA 2X4AA 4Q9SA 1X37A 3GU4A 1NV8A 4F1IA 1OIZA 2V62A 4DHIB 4M69B 1H27A 4BTKA 2F2CB 1VG5A 3K3IA 4RPVA 2AEGA 5ETFA 1XHBA 1T46A 3F2RA 4DDIA 5ITUA 4F08A 2VWUA 3I79A 4EOQA 4RC2A 5I3RA 2VTPA 4L8MA 4YZ9A 3ZUVA 2PUPA 1IFYA 1MP8A 3JAMS 4CFWA 4GHAA 3BEGA 5G1XA 4O7ZA 1U59A 2BUJA 3Q5ZA 4E3CA 2YNMD 4IBGA 4BTJA 4AN2A 3KRRA 3BRBA 5EM5A 2ZTCA 1TH2A 3UJNA 1JKKA 5T3QA 3Q4UA 3UGCA 2BIYA 4DV5M 1H6UA 3I4BA 4A06A 3RBWA 1XMQM 3VUIA 3H0YA 4BDFA 4ITJA 3R21A 4PCZA 3MH3A 4TWOA 3O5AA 4U97A 5DEWA 3EIDA 4RIWB 3OFMA 4BCHA 2CSNA 2VO7A 2PE0A 4U42A 3FMJA 5DN3A 1IBMM 5L2QA 3O23A 4YP8A 2WOUA 3RMFA 4B0GA 5M55A 2IW8A 3KK9A 2QOCA 4X65M 4FJVA 3NEWA 5E4HA 5E1EA 2WMUA 2Z02A 4HVGA 5HQ0A 3TG1A 4M0YA 3UZUA 5KMKA 5C26A 1D0LA 4TNDA 3AOEC 3MPAA 4D9TA 3PFYA 4RIYB 2MJ5B 4Y5HA 4HVDA 2JDVA 1UKHA 2B9JA 5HO6A 2OIQA 3GFEA 2J7TA 2W4JA 4YZNA 4ZXTA 4F6UA 4ANRA 3KY2A 2V55A 5L4QA 3GU8A 4X2FA 1MUOA 5FXSA 1VZOA 5CSHA 1WBVA 2CLXA 3ZH8A 4GFMA 4ZSJA 4NL4H 3D14A 3PA4A 2X0OA 3LXNA 3HU1A 2UZVA 3UZTA 2YABA 5CT7A 3GQLA 3BBWA 5L2SA 3C5UA 4JAIA 3RAKA 3OOGA 4MB7A 1VEBA 4JI5M 3MYGA 4FVPA 4P90A 3P78A 2UW3A 3PXGA 2ONLC 3M6AA 4CKIA 1NVRA 4XBUA 3M7GA 3FUTA 4ZTSA 2EWAA 4FTKA 5CSWA 4DG2E 1Q24A 4XUFA 3KOYE 3E8NA 4C4EA 1Q3DA 3ODYX 3VUDA 1J7UA 3IONA 2XA4A 5IREB 2J0LA 3EQGA 4C4HA 3EFLA 2ZBKB 3F5UA 3U61A 4HLQA 4HGLA 4OAUC 4KIQA 4EJ7A 2PE1A 5IA5A 3LXPA 2PULA 3A45A 3EN6A 4BZOA 4HGEA 3UNKA 4QHTA 2AC3A 3KVWA 1QAOA 1OB3A 2JFMA 4GH2A 1WGLA 5FTNA 3LCTA 3M1SA 2J0KA 4YSJA 4R5YA 2ZMDA 3EQIA 4CTBA 5E8VA 4XJ0A 2I7QA 1XBAA 4KBKA 4QO9A 2QC6A 5FQDC 4PTCA 2EJSA 3V5PA 4J99A 2X39A 5E8WA 3CGOA 3QLFA 3QD0A 4FEWA 2JKKA 4BL1A 4U40A 5FLFA 2XRWA 4WNKA 2Z3XA 2QHNA 4FUXA 4U5JA 3DNDA 4U80A 4P16A 2FA2A 4Z55A 4JV5M 1BL6A 2CGWA 4DHZA 3UO4A 4W4YA 1VEKA 3ZTXA 2BDFA 2PUNA 3NFGB 4BCPA 5CU2A 3MFRA 2CE7A 1WBNA 1V1KA 5JK3A 2PY3A 5TO8A 3H30A 5JFWA 3MJ5A 5DYJA 3E8CA 2O25A 1OUYA 4QMMA 1U4DA 1OL1A 2V6ZM 3O2MA 3TN8A 3W2CA 2JXNA 4E1ZA 4AWIA 5T68A 3UOKA 2P0CA 4QQCA 3QD4A 3DK3A 1OGUA 3DBEA 4QT1A 4AN9A 1ZARA 4BB9A 2FFJA 4QOSA 1OAOC 5CXZA 3H9FA 4UX9A 4UMTA 3HV3A 2YCSA 4ERKA 4O2ZA 1KE8A 3KXEC 1BKXA 4K77A 2OZAB 1R3CA 3GLGE 2QO7A 4HPUE 5L6OA 2CV2A 3RP9A 4JBQA 1UU8A 2QHMA 1C1KA 3QRUA 5AA8A 1OIRA 5KMJA 2B53A 4D2WA 2YISA 1TQIA 4L6V6 4UN2B 3DTCA 4FKOA 2CNVA 4FT5A 4ASXA 2LVNC 4RFYA 3GUBA 3GP1A 3KW6A 3AL0C 4NCTA 4FKTA 4LMUA 4UY9A 5CAVA 1ZZLA 1UA2A 2ETMA 2UUBM 3NWLA 4TNBA 2BZIB 3AD5A 4NXMM 1BL7A 5AAEA 4FKPA 3UP7A 4MNFA 2HW7A 5E26A 5BV3A 3FQEA 4ZTHA 3DQXA 3KC3A 1N77A 1HJPA 4BFMA 4OTIA 2UUCM 2WQMA 4F1TA 4FSRA 4TY1A 3OUNB 2VUWA 4TYEA 2ZV8A 5CT0A 4QDVA 2PUUA 3G33A 4NSTA 4WO5A 5KO3A 3OXTA 3EFWA 2UW6A 4ALUA 2A98A 3BPRA 1DM2A 1FINA 2KRUA 5EDRA 4BLCA 4FZFB 2GFSA 3ZO3A 4Z16A 3TE6A 3R9XB 2YIXA 3C3EA 1U54B 2GNGA 1HNZM 5FSWA 3KDSE 3GOKA 3ZZWA 4QOXA 4EH9A 5HZNA 3F5XA 4L7SA 5EXPA 4UZHA 5LARA 1Q8ZA 3P86A 3KN5A 4O81A 3SAYA 4NKSA 2WNTA 4ARKA 2QO9A 5K5XA 3GP0A 3UTOA 4G4OA 3TJDA 1G8JA 5JZJA 3BYOA 3U60B 4X6RA 5AUUA 4HW7A 1UWJA 5FTJA 2HOGA 2OLCA 4M0ZA 3U55A 3QYWA 2W9FB 2V1CA 4PPAA 2BAQA 3F7WA 4AG5A 1WFCA 3RGPA 1LR4A 3UYSA 4G3DA 3B89A 4XG6A 2NQ8C 2XEYA 4I21A 4ALVA 4REZA 3QCYA 2UVZA 3F9NA 4U3YA 2DI0A 2R45A 1MQBA 5EXSA 3IGOA 3TZMA 4QP1A 3QBNA 4HYUA 2R4JA 3BU3A 2F9GA 3T38A 5C8MA 3H4MA 5HTCA 3HV6A 2GTNA 3COHA 4Z3VA 5HE3A 2C5YA 1V0BA 1DAWA 3OCBA 4RFMA 5EM8A 5AP2A 4C58A 3A42A 4EZ7A 3C9PA 3HWSA 3BHTA 3LQRA 4FMQA 2XJ1A 2VO0A 1Z9XA 2YM7A 4GYGA 4C35A 3KRLA 4ZMFA 4XRJA 3KFAA 2F57A 5E8ZA 4IZAA 3KK8A 4DH8A 3AJIB 3MIYA 4R7IA 3FUXA 1CDKA 4GKJM 3UG1A 4GIPA 4OT5A 4EOJA 3GU7A 4O7LA 4YZMA 4BVUA 4ANBA 3QALE 5BX0A 4L67A 2J51A 3FI3A 3TKHA 4YZDA 3J2PB 2Q2EB 2OFVA 4DFZE 3NYVA 4ZJIA 4CCBA 4GRIA 4GG5A 1WBWA 4PD2A 4IB1A 4FKSA 5AR7A 3UVPA 4CGYB 3L25A 4DFBA 4DINA 3MB7A 2IVTA 3QD3A 4ZSGA 4RMZA 4FTOA 1PJTA 2OZOA 2UZBA 4V05A 4QMOA 5HNBA 3Q6UA 2R64A 2CV1A 3I51A 5J1VA 4FIEA 5FRIA 4RJ8A 5ACKA 4R5SA 4EK6A 2P2IA 5EP4A 3ZRMA 3ZBFA 5GIOE 3JY0A 4K8AA 2R3QA 2X2KA 4DEEA 2O5KA 4NRWA 2DAIA 5DLSA 2WAJA 4XK8F 2CKQA 3TZ8A 4HL4A 4W4VA 3OCTA 5E8UA 5AX9A 5CF4A 4FTIA 4BIBA 3ORZA 5LCKA 4Y8DA