3IECA

Helicobacter pylori caga inhibits par1/mark family kinases by mimicking host substrates
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
315
structure length
311
Chain Sequence
HIGNYRLLKTIGAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGWMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Helicobacter pylori CagA inhibits PAR1-MARK family kinases by mimicking host substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/toxin
molecule keywords Serine/threonine-protein kinase MARK2
total genus 101
structure length 311
sequence length 315
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 3iecA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3iecA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3iecA01
3CTHA 2HZ0A 4QMZA 4QYEA 4K33A 2G2HA 5I9YA 4B6LA 3UYSA 2GNGA 4J71A 4WSQA 4EONA 2XNOA 5GINE 4NL0A 3OOGA 2X8IA 4WOVA 4QYGA 4QYYA 2LVNC 4MQ1A 3BIZA 5EI2A 1O6LA 3KMWA 4M84A 4M14A 4M13A 4ACHA 2JAMA 5DFLA 4LOQA 3VN9A 4QMSA 2JUJA 2OO9A 5HOAA 3GI3A 1XH7A 4ANSA 4RG0A 4EOSA 4B0GA 2VWYA 2OK1A 1PXPA 4NJDA 1W83A 2EVAA 4F6UA 4Z7GA 5A14A 1PF8A 2GQSA 1YRPA 4TW9A 4HOKA 3BZ3A 4CG9A 5D41A 5E8SA 2WTVA 1BI8A 3NUUA 4R77A 2R0IA 4FYOA 4QQ5A 4D28A 3LE6A 4FT9A 4ITHA 3S2PA 5IISA 3TUBA 3RAWA 2G1TA 2B4SB 3QRUA 4EC9A 4Q5EA 4BCQA 3QC9A 4O0UA 2BR1A 3NYVA 3UIBA 4XX9A 4UMPA 4GU9A 2VTNA 3PE1A 4II5A 3OG7A 4O6LA 5EI6A 4ACMA 4BCGA 2ZM4A 3GCVA 4G3GA 2XKFA 3PVWA 2WIPA 5J87A 4B4LA 5HCXA 4W9WA 2JKKA 3V01A 3NUSA 4DF3A 1AIPC 3DT1A 3UPXA 4OLIA 3GU4A 5L2IA 2RG5A 3CLYA 4FTQA 5IH4A 3DNEA 5IA3A 1WVWA 2ITNA 3C13A 4DEGA 3W18A 4R5SA 2PVYA 3VIDA 2B9FA 3MWUA 4O7SA 3MFTA 3Q9ZA 2WXVA 3C0HA 4AOTA 3ORTA 4EQUA 1F4IA 4IFCA 3DU8A 4KIOA 3FQHA 2LVQD 2E9OA 4R5YA 4FEXA 4MD8E 4PP7A 3B8RA 4IX4A 3CQUA 2KHHA 3NIEA 3WZUA 4BTJA 3HECA 3KULA 2O5KA 4PRJA 3VS1A 4AA5A 1OBGA 2CWBA 1NVQA 4RIWA 5AP2A 2C0TA 5AR7A 2Z7QA 3V8WA 4I6QA 4GFMA 3LCKA 2DAMA 2QOQA 5EQYA 3FYKX 2G2IA 1NT2A 2QOFA 3OF0A 5DIAA 3LQ3A 3A4PA 1V1KA 3NCZA 3DKCA 2CLXA 4JBPA 3DAEA 4O21A 3R7EA 3CSVA 1B38A 2VAGA 2X4FA 3MGYA 3WIGA 1R1WA 3G0FA 3HAVA 1A5TA 2QURA 2UZOA 3ZXZA 5AA8A 4L43A 4K6ZA 3GC0A 4NU1A 3DXQA 4BTFA 3AMAA 4NKAA 1SVHA 3GFEA 4FG7A 3HEGA 4YTHA 5DNRA 4Y85A 4EOQA 5HVKA 3I7BA 3MBLA 4X2NA 4YJQA 4CZTA 4DEBA 2JKOA 5LMAA 2OSCA 4DG2E 4YC3A 5JI2E 2VRXA 3A61A 1FGIA 3CD8A 3PXYA 4RA5A 5T6KA 3ACJA 5HG5A 3PY0A 4LMNA 3W2QA 1RE8A 4ZP5A 3ZS5A 3IOKA 3PVBA 5CF4A 4OAUC 5IQDA 1BMKA 3V5TA 5KMIA 2Z02A 3FKNA 2I0EA 3TCPA 4BWPA 4FI1A 4FSZA 2YIQA 1RW8A 4H39A 4RJ6A 4P5ZA 4EYMA 4HCVA 5DWRA 5CVFA 1M2RA 1RDQE 5IQHA 4X2JA 1KV2A 5CI6A 5JK3A 3ZHPC 4GMYA 2OZAB 3BRBA 3FLSA 3MV5A 4M15A 4M67A 4F70A 3UYTA 4ORKA 2YN8A 4O1PA 2Y6MA 1DI9A 2F4JA 2BILB 3QTIA 4MXOA 2ZTDA 5DVRA 2V7AA 2DKLA 1DI8A 3PY1A 5GJDA 3MW1A 4BBFA 4NH1A 4O38A 5F1ZA 4YJSA 4V0GA 4USEA 3SA0A 4KB8A 2BZKB 1X8BA 3V5LA 4C4FA 1J3HA 2WMAA 4JDHA 4XG2A 5TT7A 1ZZLA 2FVDA 3VS2A 4QYHA 4I93A 4MNEA 2VWVA 5A3XA 1OPJA 4DEEA 2LBCA 3WIKA 1VZOA 4O91A 3VS7A 2VTIA 2YAAA 4PMSA 4CT2A 4J1RA 5IDNA 4ZK5A 2JAVA 5KMNA 3A7GA 5ANIA 5HLPA 4UEUA 4G9RA 3T9TA 1AD5A 3A7FA 3GOKA 4FKWA 4XBRA 4CTCA 1SNUA 2P3GX 1OL2A 3R21A 4DYMA 2JDOA 4C4JA 1G3NA 2HZIA 4AZFA 3R1QA 3Q9XA 2BIKB 2R3JA 2NNWB 2I0YA 5J9YA 2O64A 4G3FA 4D2PA 4RJ8A 3UGCA 5JT2A 4R8QA 4YJUA 2WAJA 2FSMX 3UBDA 3HNGA 4TWPA 5LMKA 4DH7A 3Q6UA 3N4TA 3GC7A 2OOBA 5C8KA 3UPZA 2JY8A 1TR8A 3EN5A 3MN3A 4QP3A 4WHZA 5JGBA 2FSTX 1J1CA 2B9JA 3PWYA 4HGSA 4X7QA 2WO6A 4EOIA 3VS4A 2PTKA 4AW0A 1ERKA 3UQFA 1OPLA 1XBBA 4QTAA 3RAIA 1OI9A 3FZTA 5FM3A 4ALVA 5L6PA 4B9DA 4U81A 3I7CA 4PDPA 3IW6A 2YIXA 1H00A 3BV2A 3H9OA 1Y8GA 3HV6A 2PZIA 3LQ8A 2X1NA 2IZRA 3R7UA 3UC3A 3QTUA 1A48A 4O0VA 3REPA 4TL0A 4LUEA 3MS9A 3VBVA 3D14A 2C3KA 1M7QA 2F7XE 5AIKA 3UTOA 3KULB 3COKA 5HTIA 3NSZA 3OROA 3UMXA 3L8XA 3VUHA 4I23A 3V6RA 4CLJA 5L8LA 2PE1A 1ATPE 4O81A 4IXPA 3CJGA 1YOMA 4OTPA 3EL8A 5JFSA 4CYJA 2ITQA 1M14A 3LFEA 2XNNA 2YISA 3Q5ZA 5K4JA 1IAHA 5FTGA 2R3FA 4IQ6A 3W2SA 4M97A 3ZM9A 5DH3A 4IDTA 4IVDA 3M1SA 3EWHA 5FEQA 3QA8A 4AOJA 4IB5A 3Q4CA 4LM5A 4TYJA 4D1XA 3DKFA 4EKKA 4FEQA 1YVJA 5H8GA 3F5PA 4KRDA 2FO0A 4PTGA 2RKUA 3QF9A 3FSFA 2WMTA 2X2KA 2YEXA 2ZB1A 3UO5A 4AGUA 4WO5A 3ANQA 2J0LA 4PL5A 3CC6A 2WKMA 5LXMA 1ZYLA 1EFUB 1JOWB 3F3TA 5L2QA 3K3IA 4FK6A 2C3IB 2ZTCA 4IHPA 4UWBA 3W8QA 1JAMA 4J52A 5J9ZA 4OTGA 4F7JA 4KSPA 2W1EA 5HD7A 4A9TA 5DHJA 2B9IA 4U5JA 4MXAA 2ZMDA 4W8EA 3UDBA 5ETAA 1ZYDA 3VUGA 4MX9A 3EKNA 4G9CA 2OH4A 3C4FA 4F1IA 3CCNA 4HZSA 4DFZE 1H1QA 2VTTA 2Y0AA 3BHUA 4FX3A 2W7XA 3LXPA 3R7YA 5E1EA 3PJ8A 5F9EA 3QLFA 4UB7A 2V5QA 2YWVA 2X39A 3DLSA 3OEFX 4JG6A 5KCVA 4L42A 3EQFA 5IQBA 3OXIA 2QLUA 1H24A 4CMUA 4UMRA 2C5YA 5A9UA 2GNHA 4DFXE 4C62A 2R3PA 3ODYX 3DBQA 3TXOA 5HZNA 2BRGA 5GZAA 3LXNA 4FTOA 4M66A 4XJ0A 3W10A 1NY3A 4EOKA 3OD6X 4MXZA 2HY0A 4NFMA 4KBKA 4UXLA 3W2RA 4CV9A 4EWHA 2VWWA 4HYUA 4F4PA 2FB8A 3R28A 5I9WA 2DWBA 4LGHA 3A7HA 4PTEA 5J95A 5J5TA 4XP3A 2QOCA 3PPJA 4EORA 3ZUUA 4JX7A 1Q3DA 1PKGA 2F7ZE 1TQMA 2HIWA 4EH5A 3O0GA 1MRUA 2WQMA 4IB3A 3VBYA 4X6QC 4P2KA 2ZMCA 3LZBA 2VTRA 2VGOA 4LOOA 1BL7A 3NW6A 3QCYA 5FD2A 3T3VA 2OLCA 1M2QA 3BHHA 5CNOA 5BNJA 2JBPA 3FZOA 3O2MA 2H8HA 4D2VA 4DH8A 5HG7A 3HRCA 4MNEB 2FSOX 2JDSA 3BQRA 5LMKC 2QO2A 2XBAA 2HAKA 4U3YA 3A2CA 3ORPA 3MSSA 2UUEA 1MN3A 1U54A 3OTUA 5E91A 4EQCA 3A8WA 3HV4A 5I0BA 1GAGA 3HV7A 2J5FA 4XV2A 3R22A 3VRZA 4O7TA 2VZ6A 3NW7A 5C01A 3UZRA 3HMNA 3GGFA 5DR9A 3LCVB 1XH8A 4U41A 5CZIA 2W5AA 3D4QA 4IAFA 3LFSA 2UW0A 4CT1A 3C50A 3I6WA 3MTFA 3DKGA 2F2UA 4HGLA 4NCTA 5HO6A 5I3OA 4FTIA 2QC6A 5J1VA 2O65A 3EJ1A 4BI2A 4RLLA 3JS2A 2IZSA 4BDHA 4D2RA 3EB0A 3RP9A 1REKA 4GK2A 3GU5A 3UP7A 3QA0A 3VBTA 3FPQA 5CXZA 2XJ1A 3R63A 2BZIB 4EEVA 5HO7A 2XB7A 4FTAA 3OP5A 2XS0A 2UZBA 2XF0A 4MBJA 1JWHA 2JY7A 3WZKA 4AE9A 5JFVA 1KE8A 2PMOX 4FSUA 4ZJJA 4WSYA 5HCYA 5FBOA 3GUBA 4RFZA 2BAJA 4HJOA 3R9NA 3U9NA 4DHFA 5EDPA 1OIQA 4PF4A 2BVAA 5HE2A 2QG5A 4KIPA 1PMEA 2XJ2A 3EQGA 2C6IA 3FLWA 1FVTA 2VTAA 3NAYA 4NM5A 4PPAA 3BLRA 5M08A 3VS5A 5CT0A 2VWBA 2X7GA 3BHYA 4YR8A 3AMBA 2HWOA 2UW9A 3ZUVA 2CNUA 4FL1A 5DBXA 2PVFA 2UW8A 5AAGA 2BDWA 3IS5A 3O8PA 4CCBA 4PWNA 3R73A 5CSVA 1U46A 2BTSA 5ANDA 3PG1A 5KBRA 4FMQA 3ZU7A 1OMWA 2C69A 4OTQA 5AR5A 5F4NA 2PE0A 3G9LX 3VUTA 4BCMA 4U9AA 3TV6A 5GIOE 1FINA 2XK9A 3RPRA 2VTOA 4I0TA 4XG9A 5E7RA 1IR3A 4BC6A 3HP5A 4BICA 4EOMA 4ZTNA 3MY5A 4YJVA 2O25A 1PHKA 1R78A 4KSQA 1VJYA 5HHWA 4QTCA 4RVLA 4YZBA 4GKHA 4ZSLA 1XH4A 1ZOHA 3DFCB 3PIZA 3LJ1A 4ENXA 2UZTA 3PJ2A 3B2TA 3QZHA 3OW4A 4O0XA 1XR1A 2HW7A 1YDSE 3MB6A 2J4ZA 5FLFA 5JFXA 4BZOA 2WMWA 2GDOA 3F2AA 4LV5A 5EG3A 1TQPA 3WARA 1IXSA 2E9VA 3I5NA 3G6GA 3OFMA 2ITTA 3TJDA 2VNYA 3ETAA 4JBVA 2WHBA 4JS8A 4IEBA 2OFUA 3MFRA 5GHVA 5M55A 4F9YA 3UNKA 2W9ZB 2YM5A 3WF6A 3WZDA 3RZBA 1J1BA 4MXXA 1YWVA 3OY3A 3VS6A 1HQYE 1WBSA 5TOZA 1MUOA 4IWQA 4HW7A 2IO6A 5FP6A 1RQQA 5A4EA 4ZLYA 3H10A 2JY5A 4FL3A 4AZTA 5HX8A 4DGGA 2XM8A 4O7NA 3LQ5A 2P4IA 2ZM3A 3AOXA 4H1MA 4QPAA 5EOLA 5J9LA 2NRUA 4NT4A 3RHKA 2YCQA 2EU9A 5A54A 2ITUA 2OG8A 1F5QA 1CUKA 2HXLA 4G16A 4BIBA 1SNXA 3C4CA 5C8NA 1PJKA 3FKLA 4YTFA 3MPTA 1WGLA 4BGHA 2YZLA 4U44A 3VF9A 2B7AA 4BDJA 3PSCA 3P7AA 5IUIA 3EQHA 4HVHA 4XG8A 2L2DA 3DDQA 5AUXA 4EH4A 3ZXTA 2CDZA 4RSSA 3ZFYA 4JQ7A 3ZZWA 2V0DA 3RWPA 4FICA 4NIFA 4KIQA 5AP4A 3RWQA 3FSKA 3KK9A 4GG5A 1RJBA 4GEOA 2R3QA 1J7UA 1PMNA 4JR3A 4OTWA 3EN4A 4MEDA 3AXWA 2HENA 3P78A 1YXUA 3ULIA 2R3MA 4CKRA 2BTRA 2CGVA 1OKZA 3NAXA 4PL4A 5IH5A 1QPEA 3KVXA 4WG5A 5HCZA 4BB4A 4D1SA 2OW3A 3DS6A 4MVFA 2WQEA 4ACCA 3PJ1A 5IA4A 1VEJA 4O84A 3AGLA 3NNVA 1SG9A 5AAFA 2X2MA 4L67A 5FTQA 4F1TA 2XEYA 2B53A 2GNFA 2AC3A 3KXNA 4YJRA 4B8MA 4D58A 3K9PA 2YCSA 5AEPA 4BKYA 1ZV1A 4QYFA 3U4WA 1V92A 2O8YA 3ORZA 3V04A 2C3JA 5EM8A 2XCHA 2WD1A 2PZRA 2EXEA 5IZFA 5KMJA 5M57A 5C9CA 4UMUA 3K54A 3QQKA 3QD4A 3GBZA 5LWNA 2PUPA 3I81A 4L52A 1IA9A 4U79A 2F9GA 3BWFA 4G2FA 4X21A 2XIKA 2ZVAA 4DH3A 3F9NA 3ZOSA 3ITZA 2B9HA 4ZIMA 2LGCA 3C7QA 1Q41A 5EDQA 5HQ0A 5IDPA 3E46A 3TUCA 3A7JA 4FR4A 5L3AA 2XK6A 5AUYA 2KNAA 4J95A 5CVHA 4JX3A 3OCSA 1YI3A 1G8AA 2XIXA 3W16A 3R2YA 5E8YA 4DFUA 2R3HA 4FZAB 4TXCA 3AD6A 5IMXA 4FV4A 5FXQA 4AXAA 1Q8ZA 2IW6A 4GVJA 4J53A 4AA4A 1GIIA 1FVRA 3LLAA 5CT7A 4RIXA 3NWWA 3U55A 1OTRA 4DITA 3SD0A 4ZTMA 4IE9A 3BYVA 1P4OA 5IEXA 4L3PA 3POZA 2W1CA 2VTPA 4J96A 3QXPA 3DDPA 3F66A 1Q8WA 2C6DA 5I3RA 3DAJA 4OT6A 3LOKA 4BI0A 3SV0A 3SVVA 4AUAA 3MPAA 2ITYA 4KBCA 5DYJA 1IRKA 2XNMA 4MK0A 3SLSA 4JDKA 3R30A 4AA0A 5HVJA 4QRCA 3SKCA 1OL7A 1GZNA 3HL7A 1YW2A 4NKSA 4F0IA 1WBPA 2GU8A 1WBWA 3LFCA 3PA3A 4RJ3A 4IAZA 4JVGA 4DLIA 3NUAA 3QHWA 3KRLA 2QOOA 5DGZA 5EW9A 2OBJA 4IAKA 3UOKA 3PZHA 3KRJA 2XUUA 1G4AE 4M69B 3P9JA 1TTEA 3TUDA 3NUXA 2Q83A 4I3ZA 4QMTA 4D9TA 1YXXA 3F2RA 4IWPA 4E93A 3HLLA 4ID7A 3WBLA 4CZUA 3PY3A 1KE5A 4L01A 3EQCA 4QPMA 1W84A 3TN8A 2XNBA 3LJ2A 2ETMA 4WNPA 2YM6A 3DAKA 4QNAA 4FKOA 2O0UA 3JVRA 3Q2JA 4UYNA 1R0PA 2VO3A 1OL1A 4RZVA 5DN3A 2X6DA 3ROCA 2CGWA 1NVSA 4D2TA 3DJ6A 4XLIA 4LGGA 4O96A 3ZBXA 4XG3A 2YM8A 4XH6A 3E3PA 3II5A 4PNIA 4L7SA 2UZLA 4K8AA 5HE3A 4ZLZA 4ZY5A 4DH1A 3QQFA 4F9AA 5H3QA 1O9UA 2WTDA 2YFXA 4MQ2A 4BDEA 5L6OA 4S33A 5DR2A 5EM7A 2OZAA 2P33A 3WOWA 3VF8A 2F49A 3LCUA 2AUHA 4TYGA 5EQPA 2XBJA 2L4FA 1S9JA 2A0CX 3BYSA 3OBGA 1KE6A 4IW0A 3OXTA 4CVAA 3QL8A 4G6NA 3VULA 5KMKA 4H1JA 3TEIA 4FKJA 2A19B 3Q4TA 1W8CA 2PHKA 3FXXA 5KKRB 2CCHA 3D7ZA 1JPAA 2MJ5B 3D83A 4BZNA 2PE2A 3TZ9A 4GV1A 4M8TA 3P0MA 3BYUA 4GG7A 5GJGA 3QQUA 5HEZA 3QWJA 2QI8A 4AN3A 4BGQA 3P4KA 1H0VA 1GJOA 1Y57A 2J9MA 4BKJA 2XMYA 2WMUA 3DNDA 1U5RA 1YXSA 4KAOA 4RX9A 2W17A 4FSWA 5CQWA 4A4LA 5AP5A 5B2KA 2LAVA 3NVKI 4R7BA 1ZAOA 4GH2A 4OBOA 3FI4A 3HX4A 2G9XA 4NEUA 3VBWA 4YC8A 4BI1A 4C33A 2CCIA 2C1AA 2UW4A 4APPA 4DT8A 4A9YA 1LEWA 4UZDA 4Y72A 3BKBA 2RFDA 3ZDUA 3WI6A 4UWCA 1XH6A 4HGTA 5EI8A 4USFA 4BRXA 5HBHA 4UZHA 2ITXA 3FWQA 3ZO4A 5FBNC 3R8ZA 4O2PA 1IG1A 1XBAA 3FMDA 2PU8A 3GU8A 3L8VA 2A1AB 4EL9A 2CKOA 3MVHA 5G6VA 4YLJA 5EHOA 5LVLA 1BUHA 4G6LA 3IPHA 4FKPA 5E8UA 4KRCA 3T8OA 3AD4A 4QMVA 4R3PA 3VAPA 4BDCA 1NW1A 2OXXA 5AR8A 3ROYA 2P0CA 2EJSA 3E63A 3IOPA 4F6SA 2J6MA 2PULA 4CMOA 3KQ7A 4XUFA 5ITAA 2Z8CA 1PMUA 2XM9A 1YWNA 1P2AA 2C5OA 5IQCA 2UZUE 2HOGA 5ACBC 1I44A 3IDBA 3RPVA 3CQWA 5TR6A 3MJ2A 4IJPA 1MQBA 3QX2A 2WFYA 4DBGB 4JQ8A 3U87A 3EKKA 4C3FA 1IA8A 4R78A 4ZZNA 1P4FA 2ZDTA 3EL7A 2GQRA 3UMWA 4BY9E 3ZLWA 2QO7A 2C0OA 3C0GA 3D5VA 2DYLA 4N70A 4CFNA 3THBA 2XZSA 5IEVA 4MF0A 4TYHB 4F9WA 4C4EA 3FC2A 2I40A 2X2LA 3ALOA 3DKOA 3KU2A 1UKHA 2JEDA 4FYNA 4IC7A 5CF6A 3IQ7A 3ZZEA 1XBCA 4YTCA 4P90A 2DAGA 1LP4A 2JDTA 4C34A 4RA4A 3VNTA 2XKCA 4IAIA 3B89A 3FDNA 4I6BA 4E6DA 4QTDA 3PJ3A 4LOPA 5FXRA 4ZTRA 1JBPE 4QP6A 4RIYB 3M2WA 2CMWA 3R02A 2QOBA 4V0GB 2QOLA 4FIFA 4AT3A 4L68A 1PMVA 5D12A 5HNIX 3RK7A 2IN6A 3K5VA 2BROA 5KUPA 2CNVA 2Z60A 2ETKA 4AN9A 4CG8A 4FV0A 4O7LA 2JDVA 5J7HA 1W98A 4Q9ZA 4H3QA 2OH0E 1MRYA 2H96A 3ET7A 3D5UA 2O2UA 5A6NA 2W5BA 5LJJA 4ZTQA 2HWJA 2BAQA 3F5GA 4FZDB 4PTCA 4TY1A 4ERKA 1K9AA 1XHAA 2QR7A 2VGPA 2EWAA 4O86A 3C51A 4G3EA 3AC3A 3QUPA 4AG8A 4GT3A 4AW2A 3FC1X 4QMMA 4E5BA 1QPJA 3PTGA 3QTSA 4ITIA 1PY5A 4QMYA 3QQHA 3VO3A 1JSVA 2X7FA 2YIYA 3D2KA 4I6HA 1UFZA 4FKGA 2IPXA 5CU3A 4ZJVA 2QONA 3GU6A 4ANNA 3IO7A 3PFQA 3KY2A 4Y5HA 4EUTA 4YNEA 2OJGA 3BX5A 4J7BA 2FA2A 5FG8A 4U45A 3RNIA 2VTMA 4N6ZA 5CAOA 1DV0A 3PXRA 4DGLC 3BEGA 3B8QA 1LPUA 2GHMA 4H3BA 3PLSA 1ZY4A 3TG1A 1KE7A 4GYIA 2EB3A 5E90A 2FUMA 4RGJA 4E4MA 5IQGA 4ASZA 1WBVA 4XOZA 4BDBA 4E6AA 2B52A 4IB1A 1H25A 4QMWA 3BLHA 3G6HA 2V22A 5EYMA 2YERA 4TNDA 3QLGA 3SXSA 3VW6A 5CEMA 1C7YA 4ZMEA 1TQIA 3IK3A 2GS2A 4BL1A 2YCRA 1T6OA 3F61A 3QUDA 4JG7A 3NGAA 4OTFA 3F92A 3QRTA 3UP2A 3K2LA 5B7VA 3LM5A 3HMPA 1U54B 3GQLA 3IW4A 5ANJA 4AS0A 2IW8A 1B39A 4K1BA 2UZWE 2JIUA 4WA9A 3AQVA 4P4CA 3ZCLA 3U6IA 5EYCA 4FEUA 4XV9A 3DY7A 1J7IA 2XK8A 3FQEA 4JDIA 3C4EA 4IJ9A 2HWPA 1CKIA 4FVPA 2E9PA 3TACA 3PPKA 4I22A 4L53A 4ANMA 3EQPA 3I0OA 1VDLA 5AR2A 4KKGA 1PYXA 1E1XA 4QP9A 5M44A 3ORKA 2EXMA 3OW3A 5EYKA 5E8XA 5EHLA 2XKDA 4OUCA 1WHCA 3Q4ZA 4OTDA 3ZFMA 1EH4A 2W1IA 4FKLA 4QP8A 3SDJA 4EBVA 2VWIA 4O22A 1URWA 3AGMA 3BQCA 5CU2A 4Q7JA 2C4GA 5HI2A 3GCSA 3FV8A 2W1FA 4TTHB 2JNHA 2A2AA 3FYJX 2J50A 4I0RA 3SRVA 2BCJA 1GZKA 3HRBA 3KXMA 3DZOA 4RWLA 1WBTA 2PY3A 4WUNA 2VWXA 5D10A 4MXCA 2RRUA 2YITA 4XMOA 3QYZA 5FM2A 1J7LA 5IUGA 3ZSIA 4FGBA 4I4EA 3ZLSA 4EOJA 4XP0A 3V5QA 4BDIA 4RVMA 3BPRA 3F3VA 1UU9A 1ZLTA 3V5WA 3L8PA 3VRYA 3F69A 5BVKA 4I5HA 1UNLA 2C6OA 2E2BA 1Y8YA 2JKQA 2WU6A 5LCKA 4EH8A 3MH3A 3JR1A 4CYIA 3U6HA 5DT4A 5CANA 5AWMA 3QU0A 4UY9A 4JAIA 3MIAA 2J7TA 4YO4A 2REIA 3ALNA 4OT5A 4A9SA 2ZAZA 5M53A 4G1WA 2YCFA 1YDRE 3F3WA 3RAHA 1YHWA 4G5JA 4LG4A 4BTMA 3NS9A 3Q32A 2ACXA 5BMSA 1IM2A 3PXKA 1MQ4A 1SMHA 2ITOA 5B0XA 3W1FA 2CGXA 3SW7A 1QMZA 2JFMA 2ZJWA 3C0IA 5CAVA 2R7IA 3GP0A 2R3KA 3I1AA 3PSBA 4QMLA 2QCSA 2UW5A 4OR5A 5ANGA 4JDJA 1CM8A 2BRNA 4QMXA 3E8CA 4FTUA 4R1VA 3NNUA 3QC4A 4N0SA 4Z16A 2VNWA 1YI4A 4ITJA 4JBOA 1DM2A 4FTRA 1BL6A 5KZIA 3RK9A 4O1OA 3RTPA 3TIYA 2DNAA 4F63A 4X0MA 5GZ9A 2J0JA 3MFSA 4HYHA 4J8NA 4WUAA 1ZRZA 3U8WA 3N4UA 3RGFA 4E20A 4FV7A 1DAWA 4U3ZA 1E9HA 3CTQA 1F0QA 5HO8A 4E5WA 2CKQA 4F0GA 3LKMA 3KRRA 3OUNB 4XYFA 4EQMA 2HZNA 4FOCA 2I0HA 1KV1A 5HVYA 5IUHA 4YSJA 3A8XA 5EM5A 4W4VA 1JSUA 4OBPA 4EH9A 4H36A 1IFYA 2XYUA 3VUMA 4BDFA 2F2CB 1I09A 5FQDC 2WU7A 3EMGA 4LL5A 3WF9A 4BCJA 3UZTA 4DA5A 3TTIA 1KE9A 1XWSA 4IVAA 4RRVA 4KS8A 5DR6A 5EDRA 2PUIA 4LGDA 3VS0A 3ZSGA 5CXHA 4I6FA 4NSTA 4ZAUA 2C5NA 5ANKA 1AGWA 4X3FC 2Y6OA 3TZ8A 1YOLA 4TN6A 4F1MA 2GNJA 2JY6B 3TNHA 3UOHA 2DS1A 1ZMVA 4K77A 5T3QA 2Y8OA 4DEHA 4EYJA 3UE4A 3E7OA 4TNBA 2QU5A 3PXFA 5FEEA 3UODA 4PDOA 2OF2A 2A4LA 3BHTA 3HMIA 3MVMA 4PUZA 5ANOA 5F94A 3Q52A 2W0JA 3KF4A 3PRIA 5CY3A 2H5XA 3PE2A 3OY1A 4FBXA 4HNFA 3GQIA 4NM0A 3VHKA 3LCTA 1IAJA 1VEKA 2WMSA 4FKSA 2JFLA 4O82A 3NR9A 5BVOA 4NW6A 4ZY6A 3KGAA 3TNWA 4DINA 5HESA 5M51A 3VC4A 4WNOA 1MRVA 1GZOA 2UZVA 3DXPA 4A7CA 5CEKA 4GJ2A 4FZFB 4S2ZA 4RIWB 4FF8A 4BCFA 1OAIA 4RWIA 4EUUA 3SXRA 3A4OX 2VD5A 2PZPA 4IX5A 2RG6A 4CEGA 5JKGA 2JLDA 3E8EA 3DK3A 3R8VA 4GCJA 3EFKA 4G3OA 3BI6A 3C1XA 4GUEA 4JXFA 1T43A 3IW8A 4B8LA 1SVEA 1ZZ2A 2R3IA 3PJCA 3D9VA 4PX6A 4YHFA 3QBNA 4X3FA 2VO0A 3KREA 4MH7A 2WEIA 4X3JA 3CKWA 5HIDA 4CZYB 2G2FA 4MWIA 4ZSEA 2X9FA 3NZ0A 4YTIA 5AAEA 2YHVA 2WTWA 5ICPA 4A4XA 3NW5A 5CSXA 4S32A 2CN8A 4TWOA 3D5XA 1OKYA 5E8TA 4CFFA 1YKRA 4CNHA 5AX3A 5JRQA 3UC4A 3GLGE 2G01A 4S30A 1SVGA 4DFLA 4YSMA 1YQJA 5I5ZA 4BIEA 5J8IA 3ZLYA 3N4VA 3DV3A 4WP2A 1UA2A 3GT8A 4FKQA 4EOLA 3HVCA 3UO6A 2Q0BA 2NO3A 1HCLA 1IASA 3QKMA 4YJOA 3KMMA 4EBWA 4ZTLA 2OO8X 2DUVA 5EOBA 3QRIA 2BPMA 2R3NA 4ANLA 4MBLA 1DO0A 4RWJA 3W2OA 4BHZA 3MVJA 5E8ZA 3CXWA 4DN5A 1OM1A 1OPKA 3HDMA 4YMJA 1FVVA 2CN5A 3NMUF 2UW7A 4G3CA 3T9IA 3UQCA 3FZPA 3CEKA 5KMOA 3S95A 4I1ZA 3CGOA 5AUVA 5HU3A 3CKXA 3PXQA 4U6RA 3BGPA 5AR3A 3HP2A 2QR8A 2QHNA 5CSHA 3VHEA 3OHTA 4AZWA 4E8AA 5LMBA 3KCKA 1H07A 3OCTA 1U59A 3N9XA 2XK7A 4W4XA 3IHPA 3WILA 4D2SA 5IEYA 4FV2A 4IFGA 2B55A 2ZV2A 4U42A 2Z7LA 4CD0A 5KNJA 4CSVA 3GVUA 3O17A 5JRSA 3DBEA 4EK8A 4QMOA 4ALWA 4GJ3A 4KWPA 1PXJA 2OIDA 2QOHA 3LLTA 4LMUA 5AV4A 5L2SA 3F82A 3IGOA 2X8EA 2ONLC 4FUYA 3ORLA 4DAWA 4JG8A 2LVOC 2MR9A 3DJ5A 3MB7A 2YLEA 5HNBA 3GCPA 3OUKA 2FGIA 1ZWSA 3TI1A 3DQXA 2YWPA 4EOOA 3UOJA 3GOPA 4LRKA 5AA9A 2BFXA 2R5TA 2IWIA 4LI5A 4ZZOA 2WEVA 5A46A 4LRMA 1XB2B 5HX6A 4IZAA 4DGNA 3FXZA 3HZTA 1STCE 2ITWA 3LFNA 3F5XA 5AV0A 1B6CB 2F57A 3I6UA 4IWDA 4QP4A 3HDNA 4ZTHA 4IMYA 1CMKE 3KN6A 4NJ3A 5ETCA 2BWBA 2GMXA 1H1WA 3SC1A 2K0BX 4CFUA 3FEGA 5HKMA 3DCVA 1W7HA 2PVRA 4F09A 4BGGA 2Q0NA 1REJA 2Y4IB 3FMMA 3UVRA 2E9UA 5IQIA 3ZMMA 3BYMA 4I20A 1WGNA 4NM7A 3VW8A 2IW9A 1KOBA 4XHKB 5J7BA 3GU7A 2OXDA 4RJ5A 3ATSA 2V62A 3CBLA 2X9EA 3G90X 2PYWA 4PDSA 4CRSA 4YHJA 3EQRA 4PNKA 1PXNA 4WNKA 2C6TA 4NUSA 3MI9A 4EJ7A 4KIKB 2XRUA 2R4BA 4IM0A 1IEPA 4BCPA 4BKZA 3C4ZA 3S4QA 1OECA 2VX1A 4EC8A 4YURA 2YIWA 3QQGA 4L00A 2PMIA 5CF8A 1E1VA 1WR1B 2QD9A 5HIEA 4R3RA 2XKEA 2OIBA 4C38A 3ZONA 5J5SA 5AP6A 4F0FA 5IQEA 1WCCA 4O0YA 3EYGA 5GJFA 3R71A 2R9SA 4CRLA 1BVSA 2K9DA 4IZ7A 5L8KA 5JGDA 4OBQA 4E4XA 5HU9A 4Y46A 4DBXA 3G5DA 1PKDA 3TDVA 2RFNA 3O8TA 3QTZA 4RFMA 5AFVA 4FV8A 2B3TA 1DAYA 1Y6BA 2EUFB 4TYEA 1YWRA 4RLKA 5KZ0A 4QD6A 1URCA 2QOIA 5LARA 3CGFA 4YP8A 3UIMA 3L9NA 1Q97A 4I41A 3KA0A 3E21A 5JH6A 1Q8UA 3RM7A 4P7EA 3F3ZA 5LVMA 2UVZA 3PLAE 1H28A 4RZWA 5EW8A 2R2PA 2CNQA 4C4GA 4RC2A 4C3PA 2J90A 5CNNA 1G5SA 1WVYA 4FG9A 4JAJA 3BBWA 3EHAA 3H30A 2JIIA 4EK4A 4EHZA 5M4CA 5HORA 4U97A 4PPBA 4R7IA 4U8ZA 4E4LA 3GENA 3IGGA 3TZ7A 5JGAA 3QZFA 3R8UA 3AT3A 4ZS0A 4QQTA 4XOYA 3D5WA 2QOKA 3MA6A 3NYXA 3LJ0A 1U4DA 2QODA 2O63A 4FODA 5CVGA 1Z9XA 4A07A 1GY3A 4ARKA 4HEOA 5HTBA 4HPTE 3LMIA 3E8NA 3UO4A 3QGWA 1K2PA 2Z7SA 5CEQA 3F7ZA 1PXOA 4IACA 4OTIA 4HVSA 5C1QB 2XIRA 4FTTA 1Q3WA 3QKLA 4M7IA 1WAKA 3GB2A 4XLVA 3SRVB 1PGYA 1R4GA 4P5QA 3VJOA 3EZVA 4BCNA 2WQNA 3TNQB 3F6XA 3OS3A 3MDYA 5IKWA 4YLKA 5BMMA 1BLXA 4GUBA 3UVPA 2Y9QA 2VX3A 5ACKA 2BALA 3BWJA 3BEAA 1KUTA 3BHVA 4GK4A 3ZO1A 3GLIE 5D1JA 1VYWA 4XS2A 5JSMA 2XRWA 1APME 2JBOA 4GT5A 4LUDA 3SHEA 4NTSA 5CALA 3MYGA 4WBOA 4E4NA 3HA6A 2YM4A 4BWKA 4BF2A 5C26A 3ZEWA 4O0SA 2IG7A 3TTJA 4L6QA 2HYYA 3HYHA 4GEWA 4L45A 3FL5A 4ZSGA 3CR0A 5AADA 2BRMA 1ZXEA 3TKHA 3TWJA 4F08A 5M07A 4EZ3A 3BE9A 2C1BA 4WKQA 3I5ZA 4X2GA 1JKTA 3COMA 1G8SA 3ID6C 2BFYA 2H6DA 3RBWA 4XG6A 5AP7A 4RJ4A 2BWEA 2XH5A 2QVSE 3FZ1A 4W4YA 3E8DA 4K9YA 2IZTA 5IU2A 2R3LA 4AGDA 2QHOB 4NYEA 3F7WA 2I7QA 3VUIA 3ZEPA 2C30A 4EHVA 3P7CA 4LRJA 4EK5A 3ELJA 4J99A 3EQIA 3L9PA 4NCTC 3BU3A 4KA3A 3F5UA 5CENA 4WRGA 3BE2A 4I21A 2JIVA 3IKAA 3V8TA 2B0QA 5KE0A 2C6LA 2ESMA 3C5IA 2BAKA 3S00A 1JR3E 3H0ZA 4ZSAA 3V51A 3T3UA 2WMRA 1R3CA 3FMJA 4QT1A 2BUJA 1NVRA 2JKMA 2C47A 2WMXA 3EN7A 4GRBA 2QLQA 2JDRA 3H9FA 4ONAA 5K9IA 5BUIA 2XCKA 1NV9A 4FV9A 4IX6A 3MVLA 4AACA 5IPJA 1T45A 2WQOA 4K11A 1AQ1A 5I9XA 5L4QA 1GNGA 4M3QA 3M11A 3RAKA 5AUTA 5C4LA 2FYSA 4AT5A 5TE0A 5AUZA 3LPBA 5E4HA 4ZOGA 4ZS4A 3FUPA 2OJJA 3OCGA 3Q4UA 1DO2A 5KO1A 2YACA 4H3PA 4AP7A 1M17A 3QCQA 4TZRA 4C2VA 1OUYA 3NRMA 4ZLOA 4YC6A 1CKPA 4FIGA 3AC2A 4KKEA 1OIYA 2XYNA 3R9OA 3ORNA 1HT2E 3OEZA 3FZRA 3RPYA 1PXMA 2Z7RA 2PMLX 4L3LA 4LQMA 3V6SA 1BKXA 3R1NA 5LQFA 2J5EA 1L8TA 5FUTA 3EIDA 3KL8A 2EKKA 3P79A 4IADA 5FXSA 4E7WA 4LYNA 2YZAA 2C6EA 4G17A 2ZM1A 2BDJA 3AG9A 4IBMA 4IIRA 3JXWA 3QRKA 2DAKA 4BDDA 2BMCA 1V0PA 4EZ7A 1ZYCA 3IDCA 4DEAA 3QCXA 2NP8A 5H9BA 4YHTA 4L7FA 4BCIA 2SRCA 2OFVA 5I4NA 5CSWA 3C4WA 3QYWA 1YI6A 2VTJA 3BELA 4O6EA 3VQUA 3KXZA 4D1ZA 4F99A 5LOHA 2DAIA 1VQ1A 3O7LB 4OGRA 4EH3A 3PPZA 3EYHA 4RC4A 2QHMA 2ZV7A 5CQUA 4JOAA 5IQAA 3PDTA 4WG3A 3KFAA 3HKOA 4FZ6A 3VWAA 3RCDA 3ZRMA 3LXKA 4F7LA 3NLBA 5HNGA 5HTCA 2VO7A 3EN9A 4FUXA 4E5AX 5CYIA 1BI7A 1H1PA 4ERWA 4I94A 4EZ5A 4Z7HA 5CI7A 3LFFA 4RPVA 3VBQA 4AFEA 3SG9A 3GLFE 4D4VA 2XJ0A 4RFYA 3N51A 5C27A 1SZMA 1CSNA 4YZDA 4EK3A 4CGAA 3R1YA 1H0WA 2DZLA 3K9OA 3A99A 3GEQA 3QZGA 2RFSA 4BCKA 4AN2A 1T46A 2I0VA 4F2LA 5AM7A 3CE3A 2GTNA 1NXKA 3S0OA 1ZYSA 4O0RA 4TYHA 3RJCA 5HE0A 4YPSA 4XP2A 3L9LA 1HT1E 4PPCA 1QPDA 5KHXA 5M06A 2GPHA 3O23A 3PSDA 4FIIA 4TWCA 4Y73A 3R8MA 4AFJA 4DFNA 4BIDA 3LMHA 2GTMA 3S3IA 3PYYA 3FLZA 2HXQA 2GHLA 5K3YA 4E6CA 1JSTA 2AYPA 4USDA 3LFAA 2BHHA 3VQHA 3ENHA 4FSTA 5AV1A 4NK9A 1OB3A 1UKIA 2OOAA 3EFWA 4FTLA 1Z5MA 4UN2B 1YOJA 3OCBA 2OJFE 2WTKC 1OITA 5C03A 4PL3A 5TO8A 3VVHA 3NIZA 1XH9A 5BUJA 3HGKA 4F7SA 3P7BA 4YZ9A 1ZOEA 4GFOA 3UJGA 3RZFA 2YJRA 3HAMA 5AM6A 3LHJA 5CX9A 4FE2A 4O7YA 3DBCA 5FP5A 4KIKA 4G31A 2QO9A 3RINA 2PUNA 4DTAA 1HCKA 3FLYA 5JQ5A 4GFGA 4OW8A 1PXLA 5JFWA 2X4ZA 4IM3A 2PMNX 2Y4PA 1TVOA 5BVNA 3UZPA 1JNKA 2GSFA 4ANBA 2DAEA 3W8LA 3SQQA 1FGKA 2W05A 3HUBA 4L9IA 4XNEA 3C4XA 1VG5A 4QPSA 3ODZX 3QTWA 2HCKA 5BX0A 3EQBA 4FOBA 3RPSA 3UNJA 3VBXA 4BVUA 2ITPA 3FKOA 4EHGA 2C3LA 2VU3A 4X2FA 3PG3A 2WGJA 3VUDA 2CKEA 2ITZA 4ZEGA 2EKFA 3U4UA 5JEBA 4QMQA 3IW7A 3K3JA 4HNIA 3B2WA 3R7GA 4UV0A 4H05A 5L6WL 2YM7A 3I60A 2ERKA 2OI4X 2WQBA 4IM2A 3TKIA 3UQGA 3ZO3A 5HGIA 4FSRA 5E9EA 1UNHA 1H4LA 3IW5A 5B2LA 3OWKA 1XXHE 4V05A 5IA5A 4TRLA 3CIKA 4EOPA 4PMTA 2DQ7X 2WNTA 4C4HA 4C59A 4E3CA 3P86A 4N57A 1R39A 2UV2A 4D0XA 5TKDA 4M68A 3ZC6A 3MIYA 1GOLA 4D55A 4TWNA 4U80A 5H8BA 2PL0A 2PWLA 2PZYA 3ZRKA 5G1XA 3QRJA 2BZJA 3R9RA 2CJMA 4UALA 4DEIA 4DG3E 5IG1A 4RX7A 3Q53A 5DI1A 5EFQA 3TNPC 3DQWA 3NDMA 5EK7A 3DGKA 3OT3A 2VTLA 4I0SA 2WELA 4NTTA 3ULZA 4YZNA 2UW3A 3O96A 4BYJA 2HK5A 1XH5A 4AX8A 2XP2A 5DG5A 3ORXA 5BQ0A 4FA2A 3CPCA 5AV3A 1Q99A 2PVMA 3H4JA 4M69A 4NFNA 3GCQA 4W9XA 4D5HA 4FGRA 3COHA 3ZTXA 4K2RA 5M4FA 2I6LA 2Z2WA 3OWJA 3PVGA 3QFVA 3VUKA 5BYZA 2QQ7A 4DFYA 2RF9A 4F65A 4YUQA 4JJRA 2C68A 4ASEA 3JYAA 4RBLA 5AX9A 5LVPA 2PVLA 4C0TA 5IA0A 4RJ7A 4FT7A 1LUFA 2EXCX 2OWBA 1WJ7A 3AD5A 4I4FA 1WBNA 3TNIA 4EH2A 2WTIA 2H9VA 4QMPA 3O71A 2ETRA 1XO2B 4ASDA 4IVBA 4QTEA 1KSWA 3H9RA 3NUNA 2W5HA 2BKKA 3FHRA 4R1YA 4QNYA 2ZV9A 2JZ1A 1JKLA 4IDVA 5DA3A 2KTYA 5GIPE 1R0EA 4BCOA 4FEWA 1G3IA 2UZNA 4PV0A 1CDKA 5L2WA 3AC8A 3LXLA 3WZEA 2PPQA 5AUUA 4V04A 3L9MA 2VTQA 2VWUA 4C4IA 3HRFA 3R8PA 4CFWA 4E6QA 5M4UA 3QTRA 2RIOA 4MD7E 5EH0A 2WOTA 4HGEA 5AUWA 2ZYBA 3E5AA 5CU6A 4O7ZA 4CKIA 2AC5A 1Y91A 4FL2A 3I79A 4MF1A 4MKCA 5HIBA 2CLQA 1J91A 4XCUA 2PVJA 2YAKA 2XEZA 4YJPA 5HG8A 4RIOA 1P3QQ 4FTJA 4ACDA 4ZMFA 2WZJA 3SXFA 1YHSA 3CS9A 3DTWA 4G5PA 3COIA 4C7TA 3G15A 2BDFA 2GQGA 4DFBA 4GVAA 1VYZA 3R1SA 1LR4A 4YJNA 1H27A 2UZDA 3NNXA 2OXYA 3FI8A 1Q8YA 4FSNA 3FY2A 3LFBA 2HELA 4XG7A 3W32A 3JPVA 3FMNA 4IB0A 1ZMUA 4JBQA 3G0EA 5T68A 4KABA 2CP8A 2Y4IC 4UMQA 3A60A 3FI3A 3BBZA 4IX3A 5F20A 2WPAA 4O7VA 4MWHA 3PA4A 5F95A 4BTKA 4IZ5A 3G51A 3DTCA 3PP0A 5HBEA 2BRHA 4KKHA 3H0YA 3SW4A 4E1ZA 4FTMA 4O0TA 2Y7JA 5KHWA 3RMFA 2BKZA 5CU4A 3UOLA 1V0OA 4L44A 4UBAA 2HZ4A 4ZTSA 1SYKA 3UG2A 4E26A 3WF5A 2CGUA 3MMPA 3GNIB 3TKUA 3QX4A 1WMKA 4DT9A 4GIIA 4CTBA 4OTRA 5BVDA 3MY1A 1M7NA 3P1AA 3AT4A 3C5UA 1XQZA 1OKSA 2PVKA 4KNBA 5A4LA 1QZEA 1OVEA 4CKJA 1Z57A 3KXHA 4FV5A 2C6KA 5ETIA 3O50A 4F64A 4Y5QA 3R01A 4AAAA 1UV5A 3HA8A 4RMZA 2JD5A 3TV4A 3IECA 2MGWA 3FBVA 3MH1A 4IC8A 4QP2A 3G33A 3KN5A 4ASXA 2W1DA 3ERKA 3ANRA 5FWKK 5CSPA 4FNWA 1H8FA 2OJIA 1M52A 3RHXA 2CSNA 3S1HA 4JIAA 3UG1A 3UVQA 4R6VA 3OWLA 3R9HA 3V5PA 4AWIA 3V5JA 5E8WA 2J51A 1L3RE 3MTLA 3FJQE 3FLQA 3FPMA 4TPTA 3NEWA 4IAYA 4FNXA 5L2TA 4FT5A 2W4OA 2XNPA 4I5CA 1VEBA 5A4QA 3OC1A 1UVRA 4BWXA 4EH6A 1JLUE 5CEIA 3ZSHA 4XG4A 4QMUA 2IVTA 4FTCA 3MPMA 2GNLA 4V01A 2V7OA 5AMNA 4CXAA 3HMMA 3LVPA 4Z3VA 4UMTA 1Q5KA 4WNMA 4GYGA 5FGKA 5LVNA 2GNIA 5GNKA 3QTXA 2IVVA 4U7ZA 3KMUA 4AOIA 2QNJA 3Q04A 4FKIA 2X0GA 2R3OA 1HJPA 4JIKA 3QUEA 4DBNA 3ZC5A 4NM3A 3PVUA 3Q96A 2LVPC 4D4SA 1YXVA 3DPKA 2B54A 2V55A 4AE6A 5A4TA 3FI2A 4BR3A 3W55A 4LV8A 3R9DA 4F7NA 3WYXA 3NYNA 2ZDUA 3F88A 2GFCA 3R00A 4FKUA 5AP1A 4RVKA 5B2MA 2G3QA 5DOSA 4Y8DA 3CP9A 5DT0A 3QD0A 3D7TB 2YA9A 1MP8A 3DBDA 1H08A 3PXZA 4TT7A 4C36A 4F9CA 2YIRA 1ZOGA 1VEGA 1PXKA 1YHVA 3OZ6A 1V0BA 3UIXA 4PQNA 5CAQA 2NPQA 3O7LD 3SGCA 1UWJA 3ZLXA 4AZSA 3R83A 5GZ8A 4PMPA 4FIJA 4S34A 2OIQA 3E92A 5DRBA 4M0ZA 5M09A 3RALA 5JZJA 4BFMA 4CFMA 3R8LA 4GL9A 3LAUA 4YJTA 1QPCA 3WF7A 3Q60A 4D9UA 2WMBA 4DLJA 3P08A 4AZEA 2BHEA 3U9CA 1UU7A 2BIYA 5DE2A 3QD3A 2QU6A 4WD5A 3GLHE 4AZVA 2HY81 2DHYA 2RL5A 1OL6A 3V3VA 1JVPP 3CQEA 4D4RA 1QCFA 2O3PA 4E73A 5IA1A 4JT3A 2PK9A 1H01A 3TL8A 3NX8A 3OT8A 3LCDA 2YM3A 4ACGA 3RKBA 2BRBA 3KB7A 4W8DA 5KMLA 3D0EA 3JUHA 3RCJA 4BBMA 3SOCA 4DE4A 4GSBA 5ETFA 4HCTA 4GT4A 4YLLA 5JN2A 5KBQA 3Q9YA 4C37A 2CKPA 2KNVA 4CQEA 4ZJIA 3C9WA 2WTKB 4JRNA 5A6OA 4J8MA 4L3JA 2YDKA 4YGAA 3R6XA 4C57A 4I92A 4HVGA 4FK3A 1LEZA 3TV7A 4DG0E 1YDTE 2NRYA 3MH2A 4JQEA 2MROB 3BU6A 4FKTA 1Q24A 3FMEA 3E87A 4AT4A 5K0XA 2G15A 2KULA 2ERZE 2W4KA 3RM6A 4BN1A 4A4OA 4D0WA 3D7TA 4RVTA 4EI4A 1FQ1B 4G34A 1FBNA 3CPBA 5IA2A 4GW8A 4AW1A 3DK7A 1OL5A 5IQFA 4NWMA 1JKSA 1ZYJA 3M42A 4Z9LA 1ND4A 4FTKA 2ZOQA 2W96B 4QP7A 4CCUA 2J0IA 3CY3A 3NYOA 3HUCA 4D2WA 3WE8A 4KUJA 1ZMWA 5JZNA 5JQ8A 2GHGA 3GXLA 3HV5A 4GIHA 3DBFA 4QOXA 4EWQA 4FIEA 4O7RA 4RT7A 3E7VA 4IWOA 3QQJA 4R3CA 3L8SA 5TF9A 4R71A 3V8SA 4I5MA 2YABA 3ZUTA 5DEYA 3DJ7A 4YO6A 4HVIA 3F3UA 4UN0C 4I24A 5DEWA 5K0KA 4R7HA 5K5NA 1VR2A 4MXYA 3OVVA 2CHLA 5E8VA 4K18A 4FV1A 4AU8A 3NUYA 4MD9E 4UWYA 5AP3A 2J0MB 2W4JA 2J0KA 4AGWA 5BVEA 4BHNA 3QXOA 5C8MA 4WT6A 4O7WA 2RGPA 3OTVA 4QQJA 2IVUA 4UYAA 2P2HA 4BDGA 4CFVA 2XNEA 2LVAA 1O6YA 3WF8A 4Y95A 3PUPA 2KNZA 5KKRC 4MTAA 2WMQA 3EQDA 3L1SA 5D9HA 4C35A 4O2ZA 2H34A 4O0WA 1CTPE 5DPVA 1XJDA 4ZZMA 3VS3A 1UU8A 2WMVA 3T6PA 3G2FA 3TT0A 4ALUA 1ZY5A 3MY0A 4BCHA 3EFJA 2BZHB 3EH9A 5HICA 3SAYA 3D94A 3LFQA 5L8JA 1OKVA 4FZ7A 4FT3A 3FY0A 1OGUA 4XRJA 2IJMA 3AMYA 5D11A 1G41A 2XIYA 3R04A 4JRVA 4ANOA 3LCSA 3OOMA 1U5QA 4K0YA 3RPOA 2OGVA 3FXWA 3NVMB 5CS6A 4RQKA 1W0XC 5CWZA 4YZMA 1A9UA 3Q6WA 3FL4A 2W1ZA 2YJSA 3PIXA 4X2KA 4IZYA 4OTHA 5DFPA 4AQCA 4UX9A 3UIUA 3DK6A 4MNFA 5LVOA 5J1WA 1UU3A 4TKSA 4DCAA 2DENA 4C02A 5K4IA 2W1HA 2LTUA 1OUKA 4C3RA 3NUPA 1DS5A 2QG7A 3I0QA 5CU0A 3TDWA 3FHIA 3SG8A 4FG8A 3QQLA 4FIHA 3TZMA 4HPUE 4CV8A 2PSQA 3QD2B 4RIYA 1UWHA 5DMZA 3SOAA 3IDPA 5BPYA 2VO6A 2J2IB 3KRXA 4FVQA 3P23A 4J98A 3NPCA 1Q8TA 3CY2A 4PP9A 4FV3A 3P5KA 3WZJA 3MESA 2GCDA 4XV3A 4F6WA 4YPDA 3Q2MA 5FTOA 2WIHA 3U54A 1Q62A 5EW3A 1WZYA 2WTJA 3LW0A 4QP1A 1S9IA 2P55A 4RX8A 1YXTA 2XNGA 5AV2A 4JL9A 2R3RA 4C58A 2R3GA 4C8BA 2JC6A 3R7IA 5KX8A 3BLQA 1OBDA 4B7TA 3BU5A 2QSFX 2ONLA 4A06A 2PZ5A 3EN6A 5CF5A 3R0TA 5H2UA 2C6MA 5M4IA 5EYDA 4YZCA 5IH6A 3FRHA 1WVXA 3KF7A 3QCSA 2YLFA 1SM2A 3NCGA 3PIYA 3WYYA 2R0UA 1UNGA 3AC5A 4RIXB 4BDKA 2FSLX 2JITA 3HV3A 4X3FB 4XEYA 4U40A 4YNOA 5DRDA 2ITVA 4MBIA 2EB2A 5CEPA 5E92A 1WFCA 3ZBFA 4LL0A 2C0IA 3BGQA 3OMVA 3EZRA 3PP1A 4YU2A 1TKIA 3FMLA 4J97A 3RVGA 3W33A 3QGYA 4FSQA 5I9ZA 1F3MC 5AP0A 2VUWA 4ZXTA 1KYIA 3ORMA 2C5XA 4BYIA 3BCEA 3ZDIA 3ORIA 5EM6A 3BGZA 3MFUA 5C4KA 2OICA 3SX9A 2W06A 4AGCA 5EKNA 4N6YA 3W2PA 3CTJA 5HLWA 1PRYA 2YDIA 5EQEA 5AR4A 3QAME 3JVSA 4QMNA 4YBKA 4DTBA 4F9BA 3DOGA 5HG9A 2JP7A 3FMKA 1P14A 1JKKA 5E1SA 4AW5A 3E88A 4GK3A 4Q2AA 4JLCA 1H1RA 4U43A 3QKKA 3W2CA 2XA4A 2L4EA 1PXIA 2VN9A 3PZEA 3EFLA 4JI9A 1K3AA 4HCUA 2X6EA 2R7BA 1GIJA 3MJ1A 3FZSA 3KC3A 5D7VA 1A06A 2HW6A 5BYLA 4D4YA 2A27A 3RNYA 3WE4A 3LCOA 3F2NA 5AJQA 1KWPA 2E9NA 4HYIA 3TIZA 2IZUA 3FMHA 3D2IA 1OQYA 1ZARA 4PMMA 5CLPA 1H26A 4HZRA 1QL6A 4M0YA 5H8EA 5I9VA 3ACKA 1YLAA 4FNZA 4ZY4A 5KMMA 1PW2A 4FC0A 3MH0A 4DEDA 2B1PA 4JR7A 4ZSJA 5FDXA 1M2PA 4BDAA 4CFXA 1WBOA 4RQVA 4EJNA 1Y6AA 5FRIA 3G9NA 4XV1A 3E3BX 3U51A 1P5EA 2XK4A 2PUUA 4C2WA 3ENMA 3FAAA 4A9UA 2QKWB 4DC2A 2W99B 4EK6A 4FEVA 2X7OA 3KCFA 4KINA 4S31A 4H58A 3E62A 3KXGA 3QTQA 5D7AA 4L46A 3R7OA 4EKLA 2WTCA 1GIHA 5LWMA 1NA7A 1H1SA 3ZFXA 2GFSA 2VX0A 3TJCA 1KOAA 1FMKA 1BX6A 3A62A 3CD3A 4Q5HA 3OXZA 3QALE 4UXQA 5DLSA 4GKIA 3RK5A 4CMTA 4KBAA 3GC8A 5FDPA 4Q9SA 4IH8A 2R64A 4RWKA 5CZHA 2WOUA 3AT2A 3E93A 4FVRA 4FKRA 4N4SA 3FLNC 5CAPA 4JNWA 2UVXA 1Q4LA 3GC9A 4WRSA 4B99A 5HE1A 4RC3A 3DXNA 3K5UA 3O8UA 5JMSA 4MYGA 4DCEA 1Q61A 3DZQA 3IONA 4U0IA 4OAVB 4W4WA 5IMEA 5I9UA 3Q3BA 3O51A 1BYGA 3A7IA 5HBJA 5FEDA 2OZOA 4DH5A 4QQCA 4ANQA 2FH9A 4XRLA 3E64A 4FNYA 5DT3A 3QWKA 4WIHA 3EOCA 4I5PA 5J79A 4BBEA 1CKJA 2JGZA 2W9FB 4Z55A 2JZ0A 5BVWA 1W82A 4X6RA 2OKRA 3Q5IA 4O83A 4AF3A 2DI0A 3PA5A 2PVHA 3LMGA 4GU6A 3I4BA 4DGMA 3ZYAA 3NNWA 4C61A 4DGOA 1FMOE 4FV6A 3Q9WA 2GS7A 3AC1A 3OBJA 5ANEA 5HLNA 4XBUA 3KK8A 2QKRA 2VTHA 5HD4A 1OZ1A 2C5VA 2X81A 2ZV8A 4QTBA 3GFWA 5A4CA 4FTNA 2VWZA 4PY1A 5M56A 2VV9A 2UVYA 3BBTB 2YDJA 4LFIA 5BUEA 4PDYA 2UW6A 4FKVA 3LFDA 3DLZA 3AC4A 4FSMA 4EHEA 1XKKA 3ZM4A 2UZEA 4NW5A 3TM0A 2ZB0A 4QO9A 3OWPA 2WB8A 3R2BA 3FRIA 3ATTA 2XK3A 4G3DA 1OKWA 4D5KA 4IAAA 1PYEA 3UNZA 5CEOA 3DB8A 1GZ8A 2GS6A 4MAOA 3ZO2A 3H3CA 3GCUA 4RX5A 1HOWA 3QZIA 4A9RA 3MA3A 3FQSA 2OJ9A 3KRWA 3IG7A 2RFEA 4ENYA 3D15A 4L8MA 3KEXA 2W1GA 3POOA 3JY9A 5LCJA 4YBJA 3KKVA 3LM0A 2OF4A 4TYIA 5CTPA 1NV8A 2IVSA 3DA6A 3VJNA 4DTKA 1OIUA 2XVDA 4HVDA 1E94E 3BV3A 1Q02A 4NZWB 5BVFA 5CAUA 4MCVA 5BYYA 1JQHA 2I1MA 4APCA 3R7VA 1GO5A 4KS7A 4MHAA 4CQGA 4F1OA 4FSYA 4BZDA 4IVCA 3JY0A 2OU7A 2P2IA 4G6OA 5IF1A 3DFAA 5CASA 3PRFA 2CPKE 2VTSA 3FE3A 2XIZA 5AIRA 3ZH8A 3RI1A 1O6KA 3PWDA 3KVWA 3LIJA 5K5XA 4GS6A 1FPUA 3BYOA 4WG4A 3CJFA 3U6JA 4KD1A 3DB6A 1WIVA 5EHYA 4HYSA 2PVNA 2X8DA 5EKOA 3QHRA 4CLIA 2RSVA 4FT0A 4IANA 4Y83A 4O27B 3HMOA 1FOTA 2F7EE 1OIRA 3ZRLA 4EH7A 3KXXA 4NIFB 4WBBB 4M12A
chains in the Genus database with same CATH superfamily
3CTHA 3UK6A 2HZ0A 2L7IA 3AOEC 4QMZA 4QYEA 4K33A 2G2HA 5I9YA 4B6LA 2XAMA 3UYSA 2GNGA 4J71A 4WSQA 4EONA 4OVZA 2XNOA 5GINE 4NL0A 3OOGA 2X8IA 4WOVA 4QYGA 4QYYA 2LVNC 4JXJA 4MQ1A 3BIZA 1NHWC 5EI2A 1O6LA 4IBIA 3KMWA 1DGHA 4M14A 4M13A 2JAMA 5DFLA 4X64M 4LOQA 4M84A 1W2FA 4QMSA 2JUJA 2OO9A 3VN9A 5HOAA 3GI3A 1XH7A 2KA6B 4ANSA 4RG0A 1IXRC 4B0GA 2VWYA 4EOSA 3JAMS 2OK1A 1PXPA 3RE8A 5JK3A 4NJDA 1W83A 2EVAA 4F6UA 1PJQA 3A42A 1PF8A 4Z7GA 5A14A 2GQSA 1YRPA 3QYBA 4TW9A 2XANA 4HOKA 4O4BB 3BZ3A 2FS1A 4CG9A 4II7A 5D41A 5E8SA 2WTVA 1BI8A 3NUUA 4RF1A 4R77A 2R0IA 5KO3A 4FYOA 4GC5A 4QQ5A 4D28A 3LE6A 4FT9A 4ITHA 3S2PA 5IISA 4YHHM 3TUBA 4QOSA 3RAWA 2G1TA 1AUAA 4AKGA 2B4SB 3QRUA 4EC9A 3HY5A 4ANRA 4Q5EA 4BCQA 3QC9A 4O0UA 2BR1A 3NYVA 3UIBA 4XX9A 4UMPA 4GU9A 2VTNA 3PE1A 4II5A 3OG7A 4O6LA 5EI6A 3LVVA 4ACMA 1OAOC 2ZM4A 4BCGA 3GCVA 4G3GA 1D2NA 2XKFA 3PVWA 2WIPA 5J87A 4B4LA 5HCXA 4W9WA 2JKKA 3V01A 3NUSA 4DF3A 3E9SA 1AIPC 3DT1A 3UPXA 4OLIA 4JI6M 3GU4A 5L2IA 2RG5A 3CLYA 4FTQA 5IH4A 3DNEA 3ILKA 5IA3A 1WVWA 2ITNA 3C13A 1R2YA 4DEGA 3W18A 4R5SA 2PVYA 3VIDA 2B9FA 3MWUA 4O7SA 3MFTA 3SC3A 3GQ5A 3Q9ZA 2WXVA 3C0HA 4AOTA 3ORTA 4EQUA 1F4IA 4IFCA 4NXMM 3DU8A 4KIOA 3FQHA 2LVQD 2E9OA 3KDSE 4R5YA 4FEXA 4MD8E 4PP7A 3B8RA 4IX4A 3CQUA 2KHHA 3NIEA 3WZUA 4BTJA 3HECA 3KULA 2O5KA 4PRJA 3VS1A 2XF3A 4AA5A 2CWBA 1NVQA 4RIWA 5AP2A 2C0TA 5AR7A 2Z7QA 3V8WA 4I6QA 4GFMA 4CKRA 3HX3A 3LCKA 2DAMA 3TPZA 2QOQA 5EQYA 3FYKX 2G2IA 1NT2A 2QOFA 3OF0A 5DIAA 3LQ3A 3A4PA 1V1KA 3NCZA 3DKCA 2CLXA 4JBPA 3DAEA 2VQEM 4O21A 3R7EA 1B38A 2VAGA 3U6MA 2X4FA 3MGYA 3FKEA 1R1WA 3G0FA 1A5TA 2QURA 2UZOA 3WIGA 3ZXZA 5AA8A 4L43A 4K6ZA 4X62M 3GC0A 4NU1A 3DXQA 4BTFA 1XXHA 3AMAA 4NKAA 1SVHA 3GFEA 4FG7A 3HEGA 4YTHA 5DNRA 4Y85A 4EOQA 5HVKA 3I7BA 3MBLA 4X2NA 4YJQA 4CZTA 4DEBA 2JKOA 5LMAA 2OSCA 4DG2E 4YC3A 5JI2E 2VRXA 3A61A 1FGIA 3CD8A 3PXYA 4RA5A 5T6KA 3ACJA 5HG5A 3PY0A 4JV5M 4LMNA 1RE8A 4ZP5A 3W2QA 3IOKA 3PVBA 3ZS5A 5CF4A 4OAUC 5IQDA 1BMKA 3V5TA 5KMIA 1XMMA 2Z02A 3FKNA 2I0EA 3GRUA 3TCPA 4BWPA 3Q8XA 4FI1A 4FSZA 2YIQA 1RW8A 1W5SA 4H39A 4RJ6A 4P5ZA 5JI3E 4EYMA 4HCVA 5DWRA 5CVFA 1DGFA 1M2RA 1RDQE 5IQHA 4X2JA 4I8OA 1KV2A 1R5LA 4L4UA 5CI6A 4IBDA 3ZHPC 4C35A 4GMYA 2OZAB 3BRBA 3FLSA 3MV5A 4M15A 4M67A 4F70A 3UYTA 4ORKA 2YN8A 4O1PA 2Y6MA 1DI9A 2F4JA 4LRSA 2BILB 3QTIA 4MXOA 2ZTDA 5DVRA 2V7AA 2DKLA 4EWHA 1DI8A 3PY1A 5GJDA 3BLAA 3MW1A 4OTFA 4BBFA 4NH1A 4O38A 5F1ZA 4YJSA 4V0GA 4USEA 3SA0A 4KB8A 2BZKB 1X8BA 3V5LA 4QOZC 4C4FA 3C9PA 1J3HA 2WMAA 4JDHA 4XG2A 5TT7A 1ZZLA 2FVDA 3VS2A 4QYHA 4FCWA 4I93A 2VWVA 4MNEA 1OPJA 5A3XA 2LBCA 4DEEA 3WIKA 1VZOA 3T9TA 4O91A 3VS7A 2VTIA 1QDTA 4CGYB 2YAAA 4PMSA 4CT2A 4J1RA 1I4WA 4ZK5A 2JAVA 5IDNA 5KMNA 3A7GA 4FW9A 5ANIA 4UEUA 4G9RA 5HLPA 1AD5A 3A7FA 3GOKA 4FKWA 4XBRA 4CTCA 2CUZA 1SNUA 2P3GX 1OL2A 3R21A 4DYMA 2JDOA 4C4JA 1G3NA 2HZIA 4AZFA 3R1QA 3LMMA 3Q9XA 2BIKB 2R3JA 2NNWB 2I0YA 5J9YA 2O64A 4G3FA 4D2PA 4RJ8A 3UGCA 1Z5BA 5JT2A 4R8QA 4YJUA 2WAJA 2FSMX 3UBDA 3HNGA 4TWPA 5LMKA 4DH7A 3U5ZB 3AKZA 3Q6UA 3N4TA 3GC7A 2OOBA 5C8KA 3UPZA 2JY8A 1TR8A 3W0LB 3EN5A 3MN3A 4QP3A 4WHZA 5JGBA 2FSTX 1J1CA 2B9JA 3PWYA 4HGSA 4X7QA 2WO6A 4EOIA 3VS4A 2PTKA 4AW0A 4DR7M 1ERKA 1OPLA 3UQFA 4LV7A 1XBBA 3VK7A 4QTAA 3RAIA 5FSWA 3RGSA 1OI9A 3FZTA 5FM3A 4ALVA 5L6PA 4B9DA 4U81A 3I7CA 4PDPA 3IW6A 2YIXA 2ZFYA 1H00A 3BV2A 3H9OA 1Y8GA 3HV6A 4MGKE 2DVWB 2PZIA 4Z8XA 3LQ8A 2X1NA 5M07A 2IZRA 3R7UA 3UC3A 3QTUA 1S3SA 1A48A 4O0VA 3REPA 1ST4A 4AXEA 4TL0A 3PVSA 1L1TA 4LUEA 3MS9A 3GLFA 3BXWA 3VBVA 3D14A 2C3KA 1M7QA 2F7XE 5AIKA 3UTOA 3KULB 3COKA 5HTIA 3NSZA 3OROA 3UMXA 3L8XA 3VUHA 4QHTA 4I23A 3V6RA 4CLJA 5L8LA 2PE1A 1QVRA 1ATPE 4IXPA 3CJGA 1YOMA 4O81A 4OTPA 3EL8A 4I5SA 5JFSA 4CYJA 2ITQA 1M14A 3LFEA 2XNNA 2YISA 3Q5ZA 5I9ZA 1K3XA 2UU9M 5K4JA 1IAHA 1IY2A 2R3FA 4GHAA 3B7ZA 4IQ6A 3W2SA 4M97A 3ZM9A 5DH3A 4IDTA 4IVDA 3M1SA 3EWHA 5FEQA 3QA8A 3GPXA 4IB5A 1XXHB 3HHWA 3Q4CA 4LM5A 4LJ5A 2X49A 3DKFA 4FEQA 4TYJA 2MH8A 1YVJA 4EKKA 3AL0C 3F5PA 5H8GA 4KRDA 2FO0A 4PTGA 3U6LA 1PJJA 2RKUA 3FSFA 2WMTA 3QF9A 2X2KA 2XZUA 3HHZA 2YEXA 2ZB1A 5A2QS 4AGUA 4WO5A 3UO5A 3U5ZA 2J0LA 3ANQA 4PL5A 3CC6A 2WKMA 3UDTA 5LXMA 1ZYLA 1EFUB 1GL7A 1JOWB 3F3TA 5L2QA 3K3IA 4FK6A 2C3IB 2ZTCA 4IHPA 4UWBA 3W8QA 5EJCA 1XC8A 1JAMA 4J52A 5J9ZA 4FCVA 4OTGA 4F7JA 3GLGB 4DR6M 1N34M 2D7GA 4KSPA 2W1EA 5HD7A 4A9TA 5DHJA 2B9IA 4U5JA 4MXAA 2ZMDA 4W8EA 3UDBA 5ETAA 1ZYDA 3VUGA 2YQZA 4MX9A 3EKNA 4G9CA 4O4DA 2OH4A 3C4FA 4F1IA 3CCNA 4HZSA 4DFZE 1H1QA 2VTTA 2Y0AA 3BHUA 4FX3A 2W7XA 3SAVA 3LXPA 3R7YA 4ITQA 3PJ8A 5E1EA 5F9EA 3QLFA 3FEGA 4UB7A 2V5QA 5DYIA 2X39A 3DLSA 3OEFX 2YWVA 4JG6A 5KCVA 4L42A 3EQFA 5IQBA 4B3TM 3OXIA 3GLIA 2QLUA 3ML1A 1H24A 4CMUA 4UMRA 2C5YA 5A9UA 4GC9A 2GNHA 4DFXE 4C62A 2R3PA 3ODYX 3TWLA 3DBQA 3TXOA 5HZNA 2BRGA 5GZAA 3LXNA 4FTOA 4M66A 4XJ0A 3W10A 1NY3A 2F5NA 3OD6X 4MXZA 2HY0A 4NFMA 4KBKA 4UXLA 3W2RA 4CV9A 4EOKA 2K47A 2VWWA 4HYUA 4F4PA 2FB8A 3NWLA 3R28A 5I9WA 2DWBA 2X0OA 4LGHA 3B7NA 2CHGA 3A7HA 4PTEA 4G4NA 5J95A 4XP3A 5J5TA 2QOCA 3PPJA 4EORA 4D0WA 3ZUUA 4JX7A 1Q3DA 1PKGA 3AKKA 2F7ZE 1TQMA 2HIWA 4EH5A 3O0GA 1MRUA 4FWDA 2WQMA 4IB3A 3VBYA 4X6QC 4P2KA 2ZMCA 3LZBA 2VTRA 2VGOA 4LOOA 1BL7A 3NW6A 3QCYA 5FD2A 3T3VA 2OLCA 1M2QA 3GRYA 3BHHA 5CNOA 5BNJA 2JBPA 4B3MM 3FZOA 3O2MA 2H8HA 4D2VA 4DH8A 5HG7A 3HRCA 3VKGA 4MNEB 2FSOX 4QDVA 2JDSA 3BQRA 5LMKC 2QO2A 4D82A 2HCBA 2XBAA 2HAKA 4U3YA 5ITQA 3A2CA 3ORPA 1Z59A 3MSSA 2UUEA 1MN3A 5IREB 1U54A 3TQSA 3OTUA 5E91A 4EQCA 3A8WA 3HV4A 1GABA 5I0BA 1GAGA 3HV7A 2J5FA 4XV2A 4ACHA 3R22A 3VRZA 4O7TA 2VZ6A 3NW7A 5C01A 3UZRA 3HMNA 3GGFA 5DR9A 3LCVB 1XH8A 4U41A 2GQFA 5CZIA 2W5AA 3D4QA 4IAFA 3LFSA 2UW0A 4CT1A 3C50A 3I6WA 3MTFA 3DKGA 2F2UA 4HGLA 4NCTA 5HO6A 3QAUA 4FTIA 2QC6A 5I3OA 5J1VA 2O65A 3EJ1A 4BI2A 4RLLA 3JS2A 2IZSA 4BDHA 4D2RA 3EB0A 4GIPA 4M9XA 1REKA 3RP9A 4GK2A 3GU5A 3UP7A 4NSRA 4G4QA 4DV2M 4MH0E 3QA0A 3FPQA 3VBTA 5CXZA 1NY5A 2XJ1A 3R63A 2BZIB 4EEVA 5HO7A 2XB7A 4FTAA 4EK5A 1SXJD 4LDTA 3OP5A 2UZBA 2XF0A 2XS0A 4MBJA 1JWHA 2JY7A 4DUZM 3WZKA 4AE9A 1KE8A 2PMOX 4FSUA 4ZJJA 4WSYA 5HCYA 5FBOA 2L6OA 3GUBA 2BAJA 4HJOA 4RFZA 3R9NA 3U9NA 5EDPA 4DHFA 1OIQA 4PF4A 2BVAA 5HE2A 2QG5A 4KIPA 1PMEA 2XJ2A 2DWMA 3EQGA 2C6IA 3B9PA 1FVTA 2VTAA 3FLWA 3NAYA 4NM5A 4PPAA 3BLRA 2CV1A 5M08A 3VS5A 3KOZE 5CT0A 2VWBA 2X7GA 3BHYA 4YR8A 3AMBA 2HWOA 2UW9A 3ZUVA 2CNUA 4FL1A 4DR3M 4KHPM 5DBXA 2PVFA 4DLIA 5FTJA 2UW8A 5AAGA 4PDGA 2BDWA 3IS5A 3O8PA 4PDIA 4CCBA 3BL7A 4PWNA 3R73A 5CSVA 1U46A 3LW5F 2BTSA 3PG1A 5ANDA 5KBRA 4FMQA 3ZU7A 1OMWA 2C69A 4OTQA 5AR5A 5F4NA 2PE0A 3G9LX 3VUTA 4BCMA 4U9AA 3TV6A 5IQEA 5GIOE 1FINA 2XK9A 3RPRA 2VTOA 4I0TA 4XG9A 5E7RA 3GP1A 1D0KA 1IR3A 3KS4A 3HP5A 4BC6A 4BICA 4EOMA 1JQJC 4ZTNA 3MY5A 3B7QA 4YJVA 1PHKA 2O25A 4IW0A 1R78A 4KSQA 4GHLA 1VJYA 1EE8A 5HHWA 5LMUM 4QTCA 4RVLA 4YZBA 2DZNB 3HHXA 4GKHA 4ZSLA 1XH4A 1ZOHA 3DFCB 3PIZA 3U61A 1V33A 3LJ1A 4ENXA 2UZTA 3PJ2A 2ERCA 3B2TA 3OW4A 3QZHA 4O0XA 1XR1A 4NC6A 3U6QA 1ORYB 1YDSE 2HW7A 2KRUA 2J4ZA 3MB6A 5FLFA 4BZOA 5JFXA 2WMWA 2GDOA 2CHVA 3F2AA 4LV5A 5EG3A 1TQPA 3WARA 1IXSA 4JI8M 2E9VA 3G6GA 3I5NA 3OFMA 2ITTA 3TJDA 2VNYA 3ETAA 4JBVA 2WHBA 2L7HA 4IEBA 2OFUA 3MFRA 4JS8A 5GHVA 5M55A 4F9YA 3UNKA 1EIJA 2W9ZB 2YM5A 3WF6A 3WZDA 4O4FA 3RZBA 1J1BA 4MXXA 1YWVA 3OY3A 3VS6A 1HQYE 1WBSA 2F5SA 1MUOA 4IWQA 5E26A 2IO6A 5FP6A 1RQQA 5TOZA 5A4EA 4ZLYA 3H10A 2JY5A 1XMQM 4FL3A 4AZTA 4DGGA 2XM8A 5HX8A 3LQ5A 4O7NA 2P4IA 2ZM3A 3AOXA 4H1MA 4QPAA 5EOLA 5J9LA 2NRUA 4NT4A 3RHKA 2YCQA 2EU9A 1QYRA 5A54A 3TWMA 3SAUA 2ITUA 2OG8A 1F5QA 1CUKA 2HXLA 4G16A 4BIBA 4WURA 1SNXA 3C4CA 5C8NA 1PJKA 3FKLA 4YTFA 3MPTA 1WGLA 4BGHA 2YZLA 4HLQA 4M0WA 4U44A 3VF9A 2B7AA 4BDJA 3PSCA 1J7KA 3P7AA 5IUIA 3EQHA 4HVHA 4XG8A 2L2DA 3DDQA 5AUXA 4EH4A 3ZXTA 2CDZA 2XARA 4DR4M 4RSSA 3ZFYA 4JQ7A 3ZZWA 2V0DA 3RWPA 4FICA 4NIFA 4KIQA 5AP4A 3RWQA 3FSKA 4I81A 3KK9A 4GG5A 2UXBM 1RJBA 4GEOA 2R3QA 1J7UA 1PMNA 4JR3A 4OTWA 3EN4A 2BJVA 4MEDA 3AXWA 2EO2A 3GQ4A 4LY6A 1YXUA 2HENA 2R3MA 2BTRA 2CGVA 1OKZA 3NAXA 3P78A 4PL4A 1QPEA 3KVXA 3SATA 4WG5A 5HCZA 4BB4A 1G8KA 4D1SA 2OW3A 3DS6A 3UJNA 4MVFA 3UMMA 2WQEA 3PJ1A 4ACCA 1VEJA 2BNKA 5IA4A 4O84A 3AGLA 3NNVA 1SG9A 5AAFA 2X2MA 4L67A 5FTQA 4F1TA 1GKIA 2XEYA 2B53A 2GNFA 4DV1M 2AC3A 3KXNA 4YJRA 4B8MA 4D58A 1T3TA 3K9PA 2YCSA 4BKYA 5AEPA 1ZV1A 4QYFA 1G8PA 1V92A 2O8YA 3ORZA 3U4WA 5BPVA 2C3JA 3V04A 5EM8A 2XCHA 2WD1A 2PZRA 2EXEA 5IZFA 5KMJA 5M57A 2KEBA 1QUTA 2CV2A 5C9CA 3R8FA 3K54A 3QQKA 3QD4A 4FVMA 3GBZA 4UMUA 5LWNA 2PUPA 3I81A 4L52A 1IA9A 4U79A 4LFBM 2F9GA 4G2FA 3BWFA 4X21A 2XIKA 2DWZB 2ZVAA 4DH3A 3F9NA 3ZOSA 3ITZA 2B9HA 4ZIMA 1Q41A 2LGCA 3C7QA 5EDQA 5HQ0A 5IDPA 3E46A 3TUCA 4G4RA 3A7JA 4FR4A 5L3AA 2XK6A 2X8AA 5AUYA 2KNAA 4J95A 5CVHA 3NFFB 4JX3A 3OCSA 1YI3A 1G8AA 2XIXA 3W16A 3R2YA 5E8YA 3W0MA 4DFUA 2R3HA 4FZAB 4TXCA 3AD6A 5IMXA 4FV4A 5FXQA 4AXAA 1Q8ZA 2IW6A 4GVJA 4J53A 4AA4A 1GIIA 1FVRA 3LLAA 1PJSA 5CT7A 4RIXA 3NWWA 3U55A 1OTRA 4DITA 3C3EA 3SD0A 4ZTMA 4LJ8A 4IE9A 3BYVA 1P4OA 5IEXA 4L3PA 3POZA 3FTDA 3FTCA 2W1CA 2VTPA 4J96A 3QXPA 5FTGA 3DDPA 4XK8F 1Q8WA 2C6DA 3F66A 3DAJA 5I3RA 1PJIA 3L29A 4OT6A 3LOKA 4FWGA 3SV0A 4BI0A 4AI6A 3SVVA 4AUAA 3MPAA 2ITYA 4KBCA 5DYJA 4DR1M 1IRKA 2XNMA 4MK0A 3SLSA 4JDKA 3R30A 4AA0A 4Y28F 5HVJA 4QRCA 3SKCA 1OL7A 1GZNA 3HL7A 3VKHA 1YW2A 4NKSA 4F0IA 1WBPA 2Z4SA 1WBWA 5ITXE 4JI0M 2GU8A 3LFCA 3PA3A 4IAZA 4JVGA 4RJ3A 3NUAA 3QHWA 3KRLA 2QOOA 5DGZA 5EW9A 2OBJA 4IAKA 3UOKA 3PZHA 3KRJA 2XUUA 1G4AE 4M69B 3P9JA 1TH4A 1TTEA 2L09A 3TUDA 3NUXA 2Q83A 4I3ZA 4QMTA 3DOAA 1YXXA 4D9TA 4IWPA 4E93A 3HLLA 4ID7A 3WBLA 4CZUA 3PY3A 1KE5A 4L01A 3EQCA 4QPMA 1W84A 3TN8A 2XNBA 3LJ2A 2ETMA 4WNPA 2YM6A 3DAKA 4QNAA 3W67A 2O0UA 3JVRA 4FKOA 3Q2JA 4UYNA 1R0PA 2VO3A 1OL1A 4RZVA 5DN3A 2X6DA 3ROCA 5CAUA 2CFOA 2CGWA 1NVSA 4D2TA 3DJ6A 4XLIA 3DA1A 3I51A 4LGGA 4O96A 4EIWA 4XG3A 3ZBXA 1JB0F 2YM8A 4XH6A 3E3PA 3II5A 2C9OA 4PNIA 4L7SA 2UZLA 5C18A 4K8AA 5HE3A 4ZLZA 4DH1A 3CGWA 3QQFA 5H3QA 4F9AA 4ZY5A 1O9UA 2WTDA 2YFXA 4MQ2A 4BDEA 5L6OA 4S33A 5DR2A 5EM7A 2OZAA 2P33A 2KZUA 3WOWA 1MX0A 3VF8A 2F49A 5LMNM 3LCUA 2AUHA 2LXEA 2R45A 4TYGA 2XBJA 2L4FA 1S9JA 4IJEA 2A0CX 3BYSA 1KE6A 3OBGA 3OXTA 2KZSA 5DYGA 3QL8A 4G6NA 3VULA 4CVAA 4H1JA 5KMKA 3TEIA 4FKJA 1PM5A 2A19B 3Q4TA 1W8CA 2PHKA 3FXXA 5KKRB 2CCHA 3D7ZA 3L25A 1JPAA 2MJ5B 3D83A 3U60B 4BZNA 4AKHA 2PE2A 4P16A 3H4MA 4GV1A 3P0MA 4LRTA 3BYUA 4GG7A 4M8TA 5GJGA 3TZ9A 3QQUA 5EXSA 1N78A 3QWJA 5HEZA 7CATA 1IN7A 2QI8A 4AN3A 4BGQA 4ZPXA 3P4KA 1H0VA 1GJOA 1Y57A 2J9MA 4BKJA 2XMYA 2WMUA 2VDBB 1U5RA 1YXSA 3DNDA 4KAOA 2W17A 4FSWA 4RX9A 5CQWA 4A4LA 5AP5A 5B2KA 2LAVA 3NVKI 4R7BA 1ZAOA 4GH2A 4OBOA 3FI4A 3HX4A 3NBXX 4IJFA 2G9XA 4NEUA 3VBWA 4YC8A 4BI1A 4C33A 2CCIA 2C1AA 2UW4A 4APPA 4DT8A 2VF8A 4A9YA 1LEWA 4L15A 4AXCA 4UZDA 4Y72A 3BKBA 2RFDA 3ZDUA 2FFJA 3WI6A 4UWCA 1XH6A 4HGTA 5EI8A 4LJ6A 4USFA 4BRXA 5HBHA 4UZHA 2ITXA 3FWQA 3J7AS 3ZO4A 5FBNC 3R8ZA 4O2PA 1Z5CA 1IG1A 1ZQ9A 1XBAA 3FMDA 3GU8A 2PU8A 3L8VA 3IG8A 2A1AB 1IY0A 4EL9A 2CKOA 3MVHA 5G6VA 4O4CA 4YLJA 5EHOA 5LVLA 1BUHA 4G6LA 3IPHA 4FKPA 5E8UA 4KRCA 3T8OA 3AD4A 4QMVA 4R3PA 3VAPA 4BDCA 2N35A 1NW1A 2WSEF 2OXXA 5AR8A 3ROYA 2P0CA 2EJSA 3E63A 3IOPA 4W5WA 2J6MA 4F6SA 2PULA 4CMOA 3KQ7A 4XUFA 5ITAA 2Z8CA 1PMUA 2CE7A 2CRUA 2XM9A 1YWNA 2K6BA 1P2AA 2C5OA 2UZUE 2HOGA 5ACBC 5IQCA 1I44A 3IDBA 3RPVA 3CQWA 5TR6A 3MJ2A 3NFGB 4IJPA 1MQBA 2F4VM 3T15A 1TH3A 4DBGB 2WFYA 3QX2A 3EKKA 4JQ8A 1N36M 1IA8A 3U87A 4C3FA 4R78A 2E5LM 4ZZNA 4DUYM 1P4FA 2ZDTA 3EL7A 2GQRA 3UMWA 3PFIA 4BY9E 3ZLWA 2QO7A 2C0OA 2V1UA 3C0GA 3VK8A 2DYLA 3D5VA 1OFHA 4N70A 4CFNA 3THBA 2XZSA 5IEVA 1QANA 4MF0A 4TYHB 4F9WA 4C4EA 3FC2A 2I40A 2X2LA 3ALOA 3DKOA 3KU2A 1UKHA 2JEDA 4FYNA 4IC7A 5CF6A 3KXEC 3IQ7A 1VLRA 3ZZEA 1XNQM 1XBCA 4YTCA 4P90A 1IXSB 2DAGA 4D81A 1LP4A 2JDTA 4RA4A 4C34A 3VNTA 2XKCA 4IAIA 3B89A 3FDNA 4I6BA 4E6DA 4QTDA 2IF8A 3PJ3A 4LOPA 5FXRA 4ZTRA 1JBPE 4QP6A 4RIYB 3M2WA 4AOJA 2CMWA 3R02A 2QOBA 4V0GB 2QOLA 4FIFA 5EXXA 4L68A 1PMVA 5D12A 4AT3A 3RK7A 5HNIX 3UDZA 4LFCM 2IN6A 4WW0A 3K5VA 2BROA 5KUPA 2CNVA 2Z60A 2UXDM 3W0PA 2ETKA 4AN9A 2VIIA 4CG8A 4FV0A 2JA2A 4O7LA 2JDVA 5J7HA 2YNMD 1MU5A 1NHGC 1W98A 4HL4A 4Q9ZA 2ZBKB 1YSYA 4L16A 4XBOA 2OH0E 1MRYA 1SXJB 2H96A 3D5UA 2O2UA 3ET7A 2W5BA 4H3QA 4ZTQA 5A6NA 5LJJA 2HWJA 2BAQA 3F5GA 3FUXA 4FZDB 4PTCA 4TY1A 4ERKA 1K9AA 1XHAA 2QR7A 2VGPA 4REZA 2EWAA 3C51A 4O86A 4G3EA 3AC3A 3QUPA 5IH5A 4AG8A 4GT3A 2WSCF 3FC1X 4AW2A 4QMMA 4QNMA 4E5BA 3WHLA 3L27A 1QPJA 3PTGA 3QTSA 4ITIA 1PY5A 4QMYA 3QQHA 3VO3A 1JSVA 2Z7JA 2X7FA 2YIYA 3D2KA 4I6HA 1UFZA 4FKGA 2IPXA 5CU3A 4ZJVA 2QONA 3GU6A 4ANNA 3IO7A 3PFQA 3I4VA 3U6SA 4JI1M 3KY2A 4Y5HA 4YNEA 2OJGA 3BX5A 2R6FA 4J7BA 2FA2A 5FG8A 4EUTA 2G8LA 3AJIB 5FEEA 4U45A 3TE6A 2VTMA 4N6ZA 4D80A 3RNIA 5CAOA 4B08A 4IBEA 1DV0A