3IECA

Helicobacter pylori caga inhibits par1/mark family kinases by mimicking host substrates
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
315
structure length
311
Chain Sequence
HIGNYRLLKTIGAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGWMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase MARK2
publication title Helicobacter pylori CagA inhibits PAR1-MARK family kinases by mimicking host substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/toxin
total genus 101
structure length 311
sequence length 315
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 3iecA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3iecA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3iecA01
1UU9A 3NDMA 3SW7A 4LOQA 3AD6A 3R7GA 1FINA 3OOMA 4RBLA 3CQWA 5FWKK 4AT3A 5DFPA 1KOBA 1PY5A 4RJ3A 1T46A 2FGIA 5A3XA 4CEGA 2QO9A 4EH3A 4I6QA 3DA6A 1HT2E 3D94A 2I40A 2QHMA 4CMOA 4RZWA 1RW8A 4O1PA 3AGLA 2Q0BA 5HG9A 2JIVA 5GJFA 2GQSA 4P5ZA 3AD5A 1RQQA 5HE0A 3QYZA 2QLUA 2JY6B 3ERKA 3C4FA 5C8NA 2GTNA 2XNNA 2QURA 3H4JA 4MXYA 3UIUA 3D15A 4J71A 4DAWA 2C6MA 1BL6A 2WIPA 1AGWA 1HCLA 1YXTA 5EW9A 4L67A 3ZUTA 2UW3A 3IDBA 1S9IA 1CKIA 5H2UA 1BL7A 5HNBA 2WMUA 4MD8E 1J3HA 2W4KA 4O0UA 3KRXA 4P7EA 3R7IA 5CAQA 5L2QA 3EB0A 4IEBA 2QHNA 3VHEA 5CAPA 1YHVA 5A4TA 2XVDA 1UKIA 2YEXA 3COIA 4MTAA 2ERKA 3VS6A 3UNKA 5CSHA 2JKKA 3NUSA 4ASXA 5IDNA 4ANMA 3R04A 5EKOA 4D4RA 4EYJA 3SG9A 4PWNA 3PFQA 4JOAA 5BUJA 2EB2A 3BWFA 2BALA 5FD2A 3M1SA 4ZMFA 4K0YA 4DEIA 5E8XA 4WNKA 1WBWA 5C4KA 4U43A 3FMEA 3IKAA 1PXNA 3LXLA 1CUKA 3QCYA 4P2KA 5EW3A 3T9IA 2YIYA 1LPUA 2P33A 1IFYA 4NSTA 4PQNA 1IG1A 4O0VA 3R9NA 2PYWA 3NLBA 4FV7A 2J0LA 4YPDA 4HJOA 4PPBA 1DI8A 4RRVA 2ITYA 3PPJA 2ZVAA 4CFFA 2C5YA 1J7IA 3LIJA 1IEPA 4S33A 2BZKB 5BVDA 5LVNA 1WZYA 4I41A 1PXKA 4YJPA 4P5QA 2VWYA 5HX8A 4PMTA 2BWBA 3LCDA 4FKIA 4OTFA 4CSVA 2BHEA 3DBQA 4O7LA 4BTKA 2ZMCA 5D9HA 4U7ZA 4Z55A 5AWMA 1OKSA 3GP0A 3I1AA 3EZRA 2XNGA 4C58A 2F9GA 3EQFA 4FX3A 1XO2B 3UP7A 4AGWA 4XS2A 3QKMA 3BV2A 1UKHA 4DGGA 2PVNA 4QMYA 4UMRA 4K8AA 4O1OA 4OTQA 5FM3A 4I93A 5EQPA 2WNTA 1OL7A 1WBVA 3QA0A 4XRLA 4QPMA 3WF5A 4FNYA 3UOHA 5K9IA 2H8HA 5D12A 3NWWA 3DDQA 4D0XA 1QPDA 1ZXEA 1R39A 3AMAA 4Y5HA 4FIEA 4O82A 2VAGA 3WF9A 1OM1A 4AG8A 3C5IA 3PLAE 1DAWA 4GKIA 2R64A 4FTIA 3ZBXA 1XH4A 4CQEA 5EHOA 2J0JA 2RFSA 1Q24A 1WMKA 2F4JA 2EXMA 2H6DA 5CAVA 2JP7A 3VNTA 5ACKA 3GNIB 4B8LA 3PY1A 3SDJA 1ZRZA 3BHYA 3SG8A 4TWCA 3MVHA 3TZ9A 4QMMA 4E93A 3HEGA 3R21A 4WNPA 4CMUA 3HA6A 2YIWA 3D5UA 2AUHA 4TY1A 4YLKA 4EH7A 2ETRA 1OIYA 1KYIA 3RAWA 3CGOA 3COMA 4DT8A 2CGXA 2OWBA 3FMHA 1YDTE 5C9CA 2WMSA 2QOOA 1IAJA 3BE9A 3QFVA 4ZSJA 3ZDUA 4CV9A 2UZNA 4BI1A 3RNIA 3TV4A 3ZHPC 4D4YA 1B38A 3OBGA 4FTRA 4QYGA 5DVRA 4FEWA 4BR3A 1ZMWA 3DBDA 4E6QA 3LKMA 3LJ0A 3L9LA 2XKEA 1BUHA 3Q6WA 4U42A 4FKUA 1ZMUA 3ORZA 4L8MA 3E64A 2C5VA 2R3HA 5JFSA 2GNHA 2QLQA 2WTKC 4UBAA 3QGYA 1XH7A 5M55A 4FYNA 4E26A 3SVVA 4RX8A 2MJ5B 3FI3A 2P2HA 1WVWA 3G9LX 5BVWA 3BQRA 4F1IA 4S2ZA 3CKXA 4YNOA 2OOBA 1PGYA 3D83A 1ZY5A 4LMNA 2BAJA 4LGGA 4UZDA 4QMZA 5I9WA 3F5UA 4I5MA 3I81A 2RL5A 2KULA 2VTTA 4J8MA 3GI3A 3LFSA 5AV1A 2ITNA 2OK1A 2X8EA 4Z9LA 2PY3A 1H08A 3MS9A 4HCUA 4PV0A 4UWBA 3U4UA 3ULIA 4UX9A 4FSNA 4C4EA 3KRWA 4BCGA 3EQBA 5CNOA 5CSVA 2YM7A 2CDZA 4DEAA 5CSWA 3H3CA 1KUTA 5EM5A 4S30A 3MJ2A 5CY3A 4FT3A 5AADA 1YHWA 4YPSA 4NT4A 3PDTA 1Y8GA 3CPCA 5HVYA 4AZWA 4NW6A 1QZEA 5BVEA 4F7SA 3N9XA 4CG9A 2ZTDA 3DS6A 3ULZA 5EH0A 4PX6A 4GV1A 4QMXA 4EHVA 2HK5A 5AP4A 2G2FA 4G3FA 2FVDA 3GFWA 4UALA 4CFXA 2BIYA 4FVQA 3BLHA 3CEKA 3DPKA 4GK4A 1TQPA 4IZYA 3VW6A 4D2PA 5I9ZA 3KREA 4DFBA 2WMVA 5JSMA 4YTHA 4BBEA 4Y5QA 5AR8A 5AV3A 5DOSA 3LCOA 4ZEGA 4FK3A 4FSQA 4XV2A 3Q4ZA 5HE1A 2F7ZE 4FTLA 4AT5A 3R63A 5HU9A 3SW4A 1P2AA 5HD7A 3EWHA 2YJRA 3R83A 3S95A 1UNLA 3OT3A 3PIXA 3CJGA 2O25A 4L7SA 2JD5A 1ZLTA 4W8EA 5TOZA 4L46A 2PE2A 2XEYA 4QQJA 4CMTA 1Q8WA 5DPVA 3EFKA 1W0XC 4ALUA 4BZDA 3DZOA 3LVPA 3ZM4A 2YM4A 4G16A 3RAHA 4ASEA 3D5VA 3U87A 4NEUA 4I20A 2YCRA 2XIKA 4MVFA 4RVTA 4BBFA 2BAQA 4C37A 4BWKA 4QMQA 4NKSA 4A4OA 3U6IA 2XJ1A 3NNUA 1P4FA 4O7WA 4PUZA 1YXSA 5IQHA 2XK6A 3FMLA 4RWJA 2O3PA 1UA2A 2FSTX 3LFBA 4USDA 2JY8A 4YJNA 4CFWA 4YLJA 3LFDA 2ITUA 3LXKA 3OMVA 2KNVA 3D9VA 3U54A 3ZLSA 2JZ0A 3DNEA 2CMWA 4R3CA 4ZSEA 4KS8A 4IAAA 5IQFA 4HW7A 1JOWB 4M67A 2O64A 4OTIA 4L00A 3HV7A 5B7VA 3LCTA 5CQUA 4E5AX 4X3FA 4I22A 3UZTA 4RVMA 4K1BA 1IA9A 2UZBA 5HCYA 2O8YA 1UWJA 3L8PA 4FZDB 4FMQA 4GFGA 2UVYA 4IFGA 4DH8A 3O71A 5IMEA 4MWIA 5J7HA 3EOCA 4JLCA 4IW0A 3RKBA 3MY0A 5BYZA 3BRBA 2G2IA 3UODA 4DCAA 2YAAA 3OCSA 3H30A 5CEOA 2ITPA 2C1AA 4H1MA 2VO6A 2VO0A 3V01A 2A1AB 2EKKA 1R3CA 4GYGA 4PY1A 3A4OX 5ANOA 4M7IA 5HBEA 5GZ9A 5LVOA 2X7OA 4CNHA 3MWUA 1JKLA 3KXXA 3BGQA 5M4UA 2G3QA 2R3JA 1I09A 4HCTA 4C8BA 3R1NA 4G6OA 5C8KA 1YI4A 3PYYA 4IWQA 2X81A 1VZOA 2HY0A 5E8YA 3RWPA 3UC4A 3ZRKA 5LXMA 3FE3A 2OIBA 3GENA 5EOBA 2WOUA 1ZZ2A 1DI9A 3B2TA 3L8VA 4NM3A 3P9JA 4EH2A 4FKWA 2QSFX 3CJFA 4L45A 4AZFA 4BCMA 5C01A 4DH7A 2G15A 2WTKB 5IQCA 4BWPA 2QVSE 3AT2A 3P7BA 1Q61A 2RFNA 3LFAA 4CZUA 3QWKA 1IASA 4HGTA 3BBZA 5IMXA 1OTRA 2BRNA 2V5QA 1PKDA 4OTPA 4FSUA 4I3ZA 4L42A 5J9YA 4FKVA 1TKIA 2OI4X 2WMTA 3LJ1A 4G3CA 3TXOA 3ZMMA 3GQLA 2QD9A 3W55A 3BGZA 4DEDA 3PVBA 4YC3A 2DKLA 3KULB 4QYYA 2YDIA 2UW7A 4RX9A 3KA0A 2LBCA 4NZWB 4FIGA 4ERKA 4BGQA 4A4XA 4E3CA 3TDWA 3ZLXA 1WVYA 3S4QA 3EQDA 1XHAA 3UZRA 4KBCA 1OUKA 4AGCA 2BZIB 2J90A 2WELA 2XK9A 4R77A 3HRFA 4U44A 3CQUA 5JK3A 4GT4A 3C4CA 5LARA 4ZY6A 4HYSA 4XV3A 1KE5A 2UZOA 1NA7A 5C1QB 1G5SA 1LR4A 5CVGA 4OT6A 4IB3A 2BVAA 5EK7A 1OKWA 3QD3A 4R8QA 5HO7A 4JQEA 3WZJA 2CCIA 2YFXA 3W10A 3R1YA 1WBNA 3R01A 4JRVA 4YJUA 4A7CA 3Q96A 4U97A 4FSYA 5AAEA 2RG5A 3PWYA 3A7FA 2BRGA 4OR5A 3Q3BA 4KIKB 4AE6A 2F57A 4O81A 1FGKA 3SLSA 3CE3A 2IZTA 2P3GX 1RE8A 4IZ5A 3OCGA 5AP7A 3EH9A 2C47A 3CTJA 4PRJA 5CZHA 4RLKA 4C57A 4M0YA 5CTPA 2ZYBA 2C68A 3IDPA 4RWKA 2BDFA 3KMWA 4N6YA 4NJDA 3UIMA 3G15A 3ETAA 1F3MC 1BVSA 4FEQA 2EXCX 4LV8A 5JQ5A 3NVMB 4G31A 3BYSA 3WIKA 4DITA 1Y6BA 3CGFA 3NW7A 5K0XA 2XB7A 4E5WA 3V04A 5IA1A 3TI1A 2R2PA 3FLQA 3QLFA 2VZ6A 5EM8A 2WMXA 1Q02A 3O7LB 5JMSA 2UVXA 4C38A 2R3GA 1H8FA 4RFYA 4X6RA 4K77A 5J8IA 3ZYAA 2I0HA 5AM6A 5E8VA 4A9SA 5M56A 3HL7A 4TXCA 3RPSA 2BROA 3WARA 3RAIA 3S0OA 3FKOA 4YZ9A 1FGIA 2GS7A 3TKIA 2ETMA 4YSJA 5AP2A 4BHZA 1HJPA 1KWPA 2RG6A 3SQQA 1GO5A 4C4IA 1XXHE 2W1DA 2WU7A 3S1HA 3OHTA 3KVWA 4PL3A 5CX9A 4HVHA 5L2TA 3LMHA 2NRUA 4UV0A 5IA2A 2OXDA 2C5NA 5FLFA 3ZBFA 4QQTA 4O7YA 3WZEA 4RA4A 5ANDA 3E8DA 2YWVA 3AC4A 4I5HA 5JZJA 4S34A 4UWYA 1U46A 4TKSA 3UE4A 4UWCA 5HESA 4KIQA 2KHHA 3TT0A 4DCEA 4WBOA 5CSPA 2B52A 4HNIA 2QOKA 1V0OA 4L53A 3SC1A 4WG3A 3LLAA 4QOXA 3UDBA 5J9ZA 2R3RA 5E91A 5BUEA 4EQMA 3FMJA 3SGCA 2PUPA 4ZK5A 4TNBA 5CF5A 3DJ5A 1W8CA 3RHKA 3UTOA 3P7CA 4Q9ZA 2CN8A 1DM2A 1NVQA 5FRIA 3U9CA 1M52A 2Z2WA 5HO8A 3SRVA 3OY1A 3QTQA 3NYNA 4QP9A 4ZLYA 4A9UA 3D5WA 5C4LA 5CWZA 2OSCA 4E6DA 5I0BA 3OVVA 4I6FA 4D5KA 1KE6A 2VU3A 3RZFA 5I9XA 3VJNA 4AA0A 4DE4A 5HO6A 2ITOA 3W2QA 4FEVA 4PP7A 1OKVA 3WZUA 3R7YA 4I1ZA 5L4QA 4FTJA 2IG7A 5BUIA 3GVUA 4W9XA 4ZS4A 1O6KA 4ZJIA 3TV6A 4EWHA 3HMOA 1PW2A 4OBOA 3EN4A 2XM9A 4JAJA 5D1JA 3WE4A 3KY2A 5HX6A 4FL2A 5JEBA 3IW4A 4IANA 4FODA 4W4VA 4ZTLA 3IQ7A 2WQEA 3AC1A 5EYCA 2FUMA 2JAVA 4F7NA 3AC2A 5AIKA 1FQ1B 4WNOA 3RPOA 3D2KA 2WD1A 2YCQA 2A19B 3MGYA 3MH2A 4O7RA 3VQUA 3M42A 3VS2A 3RINA 1JR3E 5AMNA 3ANRA 3UC3A 1AD5A 1O6YA 4KNBA 4MYGA 3U55A 4QQ5A 2R3KA 3DCVA 1T43A 3FC1X 2CGUA 2E9UA 3DZQA 5HLWA 3LW0A 3PJ3A 4EOOA 3CIKA 4FL3A 4XV1A 3HP2A 3SHEA 5KMOA 3EQCA 4XYFA 4X3JA 3VUIA 4K33A 4FTOA 3EFJA 3VF9A 4RIWB 2YACA 5H3QA 2ZM4A 4FV4A 2VWWA 3OTUA 3WBLA 2VTQA 2JNHA 3RK7A 5AIRA 3R9RA 3LMIA 2X4ZA 4PL4A 5F9EA 2W99B 3MY1A 2XBAA 2W1ZA 4E73A 1G41A 5D10A 5AR3A 2L2DA 1H1PA 4Q7JA 2YHVA 5M4CA 5HLPA 3F6XA 1V0BA 2BTSA 3F2AA 3H9OA 3V5WA 4YHFA 3BQCA 2HW6A 4X21A 4NW5A 4RWIA 4RG0A 5GZ8A 4DG3E 1MRYA 4EQUA 3G5DA 3PSCA 3ZO4A 5DWRA 5JFVA 3HX4A 3HA8A 5AFVA 3HDMA 3VUMA 3LMGA 1Q8YA 3DB6A 5CF6A 5F1ZA 5JGDA 1VEKA 3B89A 5CNNA 4QMLA 1IM2A 1TQMA 2XJ2A 3RPRA 4ZSGA 4EK4A 3MW1A 4FEUA 2W9FB 2IJMA 4IAIA 2X2LA 4MF1A 4DT9A 1UU7A 5E8TA 2OIQA 5A4QA 4FKJA 5I9YA 4FUYA 3MPMA 3DKFA 1IXSA 1H4LA 2F7EE 3ITZA 5HBJA 1SYKA 4BCOA 4UMTA 5CS6A 4WP2A 4YU2A 2GHGA 3E63A 2JBOA 4I21A 4GUBA 4P90A 5ANKA 5KE0A 4B9DA 2QOIA 3LZBA 3ANQA 3UBDA 3NYXA 4YZBA 2DAEA 4PMMA 4QP3A 3UIBA 4ANBA 3E3BX 4ANSA 5DG5A 1NW1A 3FV8A 4EOLA 3KQ7A 4PMPA 4G1WA 4MK0A 4JJRA 4U81A 1YRPA 3PJ2A 5HTIA 3EYHA 5M4FA 3DLZA 1UU3A 5CXZA 5AA8A 4QP4A 1FVVA 4ACDA 3MDYA 5LCKA 4AXAA 3KXNA 3FRIA 1V92A 1F0QA 4BCIA 5DT3A 1ZV1A 4DHFA 4AZVA 2UZVA 2BDJA 3FLSA 3LM5A 2VNWA 3RJCA 4EUUA 5L2SA 2C3JA 3VBTA 2B9FA 2PMOX 3ET7A 3QL8A 2LVPC 2F7XE 2BILB 4C61A 4R7BA 2BFXA 2YZAA 2NPQA 3M11A 3OY3A 3ZC6A 3C5UA 2IVVA 2PUNA 4PL5A 3BELA 4EUTA 3DFAA 2HZ0A 2OLCA 5M44A 3LCSA 1TR8A 2JIIA 4XOYA 2C0TA 4MH7A 2RFDA 5FP5A 3ZLYA 2PMNX 1ATPE 2JGZA 3UNJA 4KKHA 4XH6A 1TTEA 3PVGA 2JLDA 3DGKA 5KZIA 1H24A 3H0YA 5I3RA 3CQEA 2QR8A 4F1TA 4M8TA 2PUUA 3I60A 4HVIA 1YXUA 3WYYA 4WKQA 2GNGA 5CALA 3IHPA 2R5TA 1UWHA 3LPBA 3MVLA 3NCGA 1CTPE 4X2KA 2VTJA 4R3PA 2JAMA 3CC6A 3TTIA 1ZYDA 2XK3A 4FA2A 4GVAA 2VTOA 2ZTCA 3DK7A 3Q9YA 2C3IB 1Q3DA 2X9EA 2RSVA 3ORLA 3TEIA 4OBPA 3K9PA 3DBFA 4WUAA 3G6HA 5EW8A 2QKWB 3VAPA 4O96A 5AR5A 3MESA 1JNKA 4R1YA 3UOJA 4PPCA 5IQBA 1ZOEA 4FOCA 2DAKA 4F9BA 3C50A 2WIHA 3JVRA 5CQWA 1HT1E 3MB7A 3AT4A 4JIKA 3P86A 5I5ZA 5IPJA 2ERZE 2XRWA 3FLYA 2WGJA 3VBWA 4O0XA 3WZKA 2ZB0A 1PXIA 2JUJA 2YISA 1VJYA 2CJMA 4PDOA 2UW6A 4PDYA 4IM3A 3E5AA 4EWQA 2I0VA 4KIKA 4MF0A 2YA9A 4FG9A 3PZEA 4HPUE 2H34A 1M2QA 2HZNA 2K9DA 2YAKA 4GUEA 5CVFA 3VUDA 4ZMEA 3QYWA 3PIZA 3ODYX 3BX5A 5EYMA 2ZOQA 4FGRA 3DJ6A 3BWJA 3OG7A 4EK3A 1DS5A 3DQXA 4EK6A 2G9XA 3W8QA 4AA5A 4BIBA 5CEQA 5J5TA 3HNGA 5KMMA 4GEWA 3Q9XA 2UV2A 4FT9A 1XKKA 3BKBA 5GNKA 3UG1A 5DLSA 3PLSA 4K2RA 2RF9A 4CFNA 1JKTA 1PMVA 4PNKA 3ORKA 5BYYA 3AC5A 4DBXA 4FOBA 4KBAA 5GIPE 4G5PA 3FAAA 1STCE 3PG1A 3EHAA 3FMNA 2EWAA 4V0GB 4U45A 4FTNA 4I5PA 5TR6A 3C4EA 4F0GA 2GCDA 2UVZA 5I3OA 3PA3A 4P4CA 4BHNA 3E21A 4O0YA 4CTCA 5KBRA 3DQWA 4Q9SA 3HRCA 4JBOA 1Q8ZA 3TKUA 4YTIA 2AC5A 3EMGA 4D2SA 4DBNA 4EC9A 5CEPA 3NUAA 4BI0A 1OITA 2QOQA 4BDIA 4BGGA 5EHYA 3QRUA 2V7OA 1VQ1A 3A7IA 4NUSA 5CZIA 3COKA 3A7HA 4OW8A 5AM7A 1YOJA 4X2NA 2R4BA 2VO3A 5HTBA 1ZZLA 4BTJA 3H0ZA 3ZXTA 4DN5A 4KUJA 3I0OA 1MQBA 3F3WA 5FG8A 1YWVA 3HV5A 1KV2A 3NR9A 5ETCA 5G1XA 4F1MA 4ZY4A 4BYJA 3C0GA 5AUUA 4C0TA 3CD8A 4IX3A 1J1BA 1K2PA 3R7OA 3Q53A 3OP5A 3R9DA 5HG8A 3EYGA 1OECA 3BZ3A 1XH6A 3MFSA 3G6GA 4PMSA 2DQ7X 1GOLA 4MXOA 4DFYA 3EQPA 4FSZA 2YLFA 1BX6A 3HMMA 4FTQA 4DEEA 4NU1A 5B2LA 4F70A 3TJDA 1BLXA 1NT2A 2YCSA 1PYEA 5EQEA 4ONAA 3UZPA 1C7YA 2Y4IB 4KS7A 2CKOA 3HVCA 3E93A 5FXRA 3FQHA 3QRIA 3TNWA 5IZFA 2GDOA 3TNQB 4EK5A 2IW9A 5B2MA 3UO5A 2OZAB 1URCA 2C3LA 3OT8A 3PVUA 3NUYA 3QZHA 1YWRA 2C6DA 3KK9A 5LVLA 4ANOA 5AP5A 4DFXE 2CGVA 4N0SA 5JFXA 2JZ1A 1Z5MA 3MB6A 2X0GA 4CD0A 5CF4A 2HWPA 2WOTA 4MQ1A 4NFMA 5BMMA 4CLIA 4J96A 4FTTA 2XJ0A 2C6IA 4GL9A 2A27A 2X6DA 4IJ9A 3PG3A 2WTDA 4PTGA 4EZ3A 4O21A 3FXXA 4BYIA 3CP9A 4DTKA 5KBQA 2A4LA 1KE8A 5HVJA 4ID7A 3F2NA 3DV3A 2BAKA 5GZAA 3HGKA 4QPSA 2DI0A 3ZFYA 3FRHA 2OH4A 4ITHA 3OC1A 3KU2A 4K11A 3GCQA 2IZUA 5BVKA 4EK8A 1H25A 3UQCA 3LCKA 1CMKE 3QX2A 4NK9A 2W96B 3WIGA 4CZTA 4C34A 3N4VA 3QTWA 2RIOA 3T9TA 2GNFA 3GC9A 1U5QA 5IEXA 5J5SA 5A6NA 2EJSA 3QHWA 2J5FA 5IQEA 2WQBA 2QG7A 2OFVA 4FG7A 1M7QA 4IX5A 4YURA 3E87A 4ZSAA 5L8LA 3FXWA 1UFZA 3KF7A 4XG6A 3RM6A 5CANA 5HEZA 3FLWA 4FKRA 2WZJA 4WO5A 3U6HA 4JDHA 4BZNA 2PVJA 3NW5A 4MNFA 3CSVA 5GIOE 3V8WA 4F9WA 1ZMVA 5BVOA 4L44A 1CM8A 3K2LA 4IXPA 4KAOA 3GGFA 2W1EA 4ZTHA 5DRDA 5IH6A 4WSYA 3DAEA 3G33A 3ALOA 4RIWA 3QTZA 3BIZA 3P79A 4H3QA 5E8SA 5GHVA 3HV4A 3KXZA 2YIQA 3QQUA 5HVKA 1Q41A 2C0IA 4U3ZA 4BDBA 4TZRA 4G9CA 3VBXA 3VQHA 4UN0C 2C5XA 3KRRA 5A46A 3AMYA 4TYGA 3RTPA 1SVEA 5H8BA 3QA8A 4AA4A 3N51A 4C7TA 4ACMA 5HTCA 5HIBA 3NUUA 1Q99A 2PULA 1KV1A 2DNAA 4FICA 1L3RE 3DTWA 1CKJA 3D7TB 3P5KA 4L6QA 4ACCA 3R8UA 1Q5KA 5CI7A 2XKFA 4TWNA 3U6JA 2PVFA 2BCJA 4FR4A 3AC8A 3H9RA 3RCJA 4CT1A 4EYMA 4F64A 2DS1A 5KO1A 2BPMA 3D0EA 2YCFA 3O51A 5FEDA 3R8MA 4BVUA 2WMAA 1XB2B 2XS0A 3SRVB 1PMNA 2WFYA 4O91A 2QU6A 3FSKA 3BEGA 2B53A 2GPHA 4TT7A 4DLJA 5LCJA 4JQ7A 3ZM9A 2LVAA 3IECA 4QYEA 3Q9ZA 2Z7SA 3NAYA 2VRXA 4KKEA 3ZCLA 1X8BA 5ANGA 3R8PA 2QOHA 3OW3A 3QC9A 4DFZE 2JEDA 3UVPA 4GT5A 2HYYA 4X6QC 2CKQA 3MA3A 3HECA 4LOPA 3LFQA 3POOA 4D9UA 5DGZA 3LLTA 5C26A 5JRSA 3QTIA 2RRUA 3ZFXA 4ZY5A 3RCDA 2YJSA 2O5KA 5F4NA 4D4SA 4RIYA 3DU8A 1V0PA 3FMMA 3FZRA 4YC6A 1GAGA 4WG5A 4ALWA 4DG0E 1H27A 3EKNA 2G2HA 3PXZA 2JBPA 4BKJA 4JG6A 4W4XA 2OF2A 4F6UA 3QQGA 2GFSA 3HAMA 4XP2A 3G9NA 1BI8A 4GW8A 3HP5A 5CSXA 4PTEA 4E20A 1FOTA 4KINA 4AW2A 3L9PA 3PP0A 2WTJA 5A54A 3ORTA 3RBWA 2EU9A 4L3JA 3V8SA 4IX6A 2ITZA 3UIXA 4FZFB 4I6BA 3UG2A 3VIDA 3NSZA 4DH3A 3QQJA 1KE9A 4Z7GA 3F2RA 3NEWA 1PXLA 1Q4LA 2B0QA 2ZJWA 3CPBA 4QP2A 4FTMA 5C27A 2WEIA 2HOGA 4E1ZA 3RVGA 3KEXA 3VS4A 4JAIA 2VGPA 4HVGA 5KMJA 3PSDA 5IH5A 5AUVA 5IG1A 1OPKA 1SM2A 4K6ZA 4H3PA 3OWPA 2QONA 5LMAA 5A4CA 1SZMA 5HQ0A 4M84A 4V04A 3NS9A 4XRJA 5BQ0A 4MXZA 5JRQA 4XV9A 3OWJA 4EZ5A 5CENA 4FIFA 4C2VA 3FUPA 2B4SB 2DAIA 5FM2A 2A0CX 2XA4A 5BPYA 2HWOA 4NYEA 2FB8A 3OTVA 3QU0A 3I4BA 5EI2A 1JLUE 1YKRA 3VUTA 2J9MA 4IC7A 2QNJA 1SMHA 1UVRA 1XH9A 4AW5A 4ZIMA 4HYUA 4EOSA 5DR9A 5DE2A 3SX9A 4ERWA 4FZ7A 4YTCA 4U9AA 3Q6UA 4U6RA 5M4IA 3KFAA 4EL9A 4QRCA 1E1XA 2F49A 3BU5A 3NNWA 4LMUA 4FT5A 4LYNA 2YM6A 4TWPA 4E5BA 3C0IA 2BRMA 2PVLA 2JDVA 1UNGA 4FG8A 4IDTA 1R78A 4L9IA 4EONA 5AA9A 5KHWA 5FEQA 2PUIA 2HWJA 4R3RA 3FKLA 4PDSA 2IW6A 4GFOA 3UVQA 4FK6A 3KF4A 2JDTA 4WT6A 3QTRA 2GQRA 3DAKA 1WFCA 4EHEA 4Y95A 5AP3A 4OGRA 4FVPA 4D4VA 2OO9A 4XBRA 3N4TA 5M57A 4N6ZA 4TWOA 3C4WA 2L4FA 2BHHA 2E2BA 4XG2A 2Q83A 1L8TA 3ALNA 4M15A 5J9LA 3EFLA 2NP8A 2BRHA 4G5JA 1BKXA 4F0FA 4XOZA 4L3LA 2JFLA 3HZTA 4AACA 5E9EA 2QOFA 4YZDA 1YI3A 3WZDA 2IVSA 1P3QQ 1ZAOA 4I92A 3NCZA 1YOLA 2B9IA 4YLLA 3VUKA 2CLXA 5JH6A 1G3IA 4AQCA 4X0MA 1DO0A 4X7QA 4QQCA 3VBQA 5ICPA 4R6VA 3GC0A 3BHHA 4II5A 1VR2A 2QCSA 3A8WA 4V0GA 4EH4A 1G3NA 4RA5A 4CCUA 2LTUA 2IZSA 3H10A 3R7UA 2FA2A 2CPKE 2CNUA 4EBVA 3MIYA 3ZONA 3COHA 3FL5A 4G6LA 4F0IA 2VWIA 3PTGA 3P08A 4QTCA 4APCA 3BHUA 5L8JA 3U8WA 2GTMA 3UOLA 4M12A 4XP3A 4MKCA 1BMKA 3QZFA 5D11A 5FTQA 3VC4A 4M0ZA 4R5YA 3RK9A 3PE2A 1UU8A 4AGDA 5TKDA 4EZ7A 2XK4A 2XK7A 3OWLA 3ATTA 2ZDTA 4MQ2A 4AWIA 4IAFA 3TN8A 3W1FA 2VTNA 4CZYB 2BUJA 4AT4A 4CKJA 4F6SA 4AP7A 1TVOA 1W84A 3NUXA 3QTUA 4RIOA 3GCPA 3AQVA 3WF8A 4Z16A 2QC6A 3PWDA 4DC2A 1QMZA 2CCHA 3FI8A 4BDAA 2J51A 3A2CA 2W1FA 1PHKA 2OJJA 3DNDA 4AOTA 2CNVA 3TV7A 4WRGA 5IH4A 4FE2A 3I6WA 3WOWA 3QCXA 4RVLA 1H01A 2PMIA 1OQYA 4DH1A 2C4GA 4HNFA 3EN6A 2OZAA 3OUKA 3PZHA 1M7NA 4YZCA 3ZDIA 3BE2A 2XK8A 3FY0A 3KRJA 2UZDA 4BI2A 3LFCA 2YZLA 4IWOA 4O7TA 3HMPA 4W4YA 2BRBA 4EH8A 2V0DA 3ACKA 3QXPA 4O2ZA 3RK5A 3BBTB 3NPCA 4GS6A 3ENHA 3IOPA 2CKEA 5EDRA 1HOWA 3DKOA 4FV9A 4OT5A 4ASZA 2IZRA 5EQYA 4OTWA 5JI2E 3NAXA 3D2IA 3IDCA 5CAOA 1LUFA 5DYJA 1OAIA 3E8EA 3DBCA 4D1SA 3TM0A 3IK3A 3II5A 1YI6A 3KGAA 4EC8A 2JDSA 4A9RA 4AX8A 4IADA 4GMYA 1WAKA 4IMYA 4PDPA 4QYFA 2UZTA 2IPXA 4G3GA 5FUTA 1XH5A 2BTRA 4IFCA 3BI6A 3H9FA 2YM8A 4G3EA 5IA3A 2WTVA 2WMRA 1UV5A 3PP1A 3TNHA 3TUBA 4WD5A 4FTKA 2G01A 4XMOA 5L8KA 2X7FA 4R71A 4BDCA 4M13A 2UW5A 3AG9A 4CQGA 2OFUA 2XZSA 3W32A 1WVXA 2R7IA 3DDPA 3GOPA 1REKA 5HG7A 3P78A 4EORA 4DGOA 3BPRA 4QP8A 4O0SA 5LVMA 3FYJX 3GBZA 1IAHA 3QD4A 4EKKA 1QL6A 1XBAA 3MIAA 1WHCA 1YDRE 4F99A 2VTMA 1PF8A 3W2OA 4JDIA 4FUXA 2VTSA 3MPAA 5F20A 3F61A 1SG9A 1YHSA 3PY0A 2UUEA 3BYMA 4IAKA 3VS5A 4JDJA 5DT4A 4RIXA 4F9AA 4H36A 1FVRA 3QD2B 2IWIA 5JKGA 5L3AA 2CP8A 4Y85A 3PA5A 2WTCA 2PVHA 2R0IA 2ZM1A 5A14A 4QYHA 4MD9E 5CEMA 1FVTA 3NX8A 3EJ1A 4RSSA 3VS1A 1HCKA 3WYXA 4LG4A 2JKQA 4MBJA 4ARKA 4UMUA 3P4KA 4FKGA 4S32A 3AT3A 4OBQA 4CYIA 4KIPA 4OTGA 4N70A 3D7TA 4EOJA 4TL0A 4BF2A 1FMKA 4QMWA 4H05A 4GIHA 1JSUA 3BBWA 4IZAA 1J1CA 2Z8CA 1MN3A 1I44A 1ZWSA 1ZYSA 2XIZA 3QRKA 4EOQA 3E92A 4W8DA 5M51A 3HLLA 2YM3A 4LV5A 2C6TA 2OGVA 3M2WA 4XHKB 4AFJA 3CTHA 5CVHA 3IW7A 4HGEA 5DEWA 5IISA 5T68A 2WXVA 4XP0A 4BDDA 5KHXA 2C69A 2PZ5A 3EN7A 4FV3A 3QF9A 3QZIA 3VS0A 5I9UA 4M14A 4EOIA 1M2RA 1Y8YA 4Y72A 5CAUA 2OOAA 4K18A 1OL5A 4R1VA 3BYUA 4QP1A 3NVKI 3SKCA 3R8ZA 2CN5A 2O65A 5EG3A 4HGSA 3QUDA 4MXXA 3MBLA 4FBXA 4M69B 4D5HA 3DBEA 4CFMA 2GS2A 3EN5A 3DK6A 3Q32A 4ZJJA 4R78A 4LGDA 3W2PA 4XEYA 1M14A 3SAYA 3FSFA 3RP9A 3UVRA 3IW6A 3PSBA 5GJDA 2DZLA 2XNPA 4FGBA 5AUXA 5CU4A 3EZVA 5L6WL 4D1ZA 1JAMA 2OICA 5DT0A 3SOAA 3BCEA 3THBA 3JR1A 3PA4A 4UB7A 1CDKA 4L01A 1BYGA 2BKZA 2Y7JA 3FI2A 3IW5A 4GRBA 4TYHB 5CU0A 5F94A 5A4EA 2X8IA 2ZAZA 2VWZA 4IB0A 4LOOA 2Y6OA 5E8UA 2C6EA 1SVGA 3ATSA 2ITVA 3HRBA 3TNPC 4YHJA 5FXSA 3E7OA 2I7QA 2GFCA 4E4NA 3PXYA 2R3MA 1H07A 4O0RA 4RJ7A 5E7RA 3QLGA 3C7QA 1A48A 3HYHA 2XKDA 3D5XA 2BZJA 4YBJA 3NMUF 4IVAA 2XNBA 1OB3A 4BCPA 5ETIA 3L8SA 5BX0A 3R8VA 2XF0A 2W17A 3GB2A 3F88A 2DHYA 5AUWA 4H3BA 4HOKA 3MSSA 3HAVA 1KSWA 2UZUE 4L68A 2XYUA 3FMDA 3KB7A 4F65A 3QALE 3DJ7A 4UMQA 4LM5A 4MEDA 2CKPA 4KABA 2PWLA 2PZYA 3T3VA 4EJNA 5E1EA 3VRZA 1YWNA 2BR1A 3F7ZA 2X8DA 3CXWA 3KMUA 4YJTA 1YXXA 2OJFE 3KRLA 2PHKA 3R0TA 3D7ZA 3FKNA 1DV0A 1EH4A 2JFMA 2JDRA 5M08A 3V51A 4FV5A 4B4LA 5D41A 3FPQA 3F3TA 1UNHA 1QPJA 4UYAA 3LCVB 5HICA 4IAYA 4JDKA 3C51A 3ORXA 4D2WA 3MA6A 5E1SA 1FPUA 4EI4A 4FC0A 2PU8A 3OS3A 3HMIA 4NL0A 5IQDA 4TYJA 2GMXA 2JITA 1PXOA 3MV5A 3NW6A 2XUUA 2YABA 3DXNA 3TIZA 3R6XA 4LUEA 4RIYB 4QNYA 2ZDUA 1ERKA 2IN6A 2WQNA 4RPVA 4MBIA 4QMSA 2B55A 1YVJA 5IA0A 3CS9A 2LAVA 4D55A 2JKMA 2VWBA 2WMQA 2Y4IC 4CG8A 2HY81 4Y46A 3PY3A 4G3DA 5BVFA 4XX9A 4F6WA 3FL4A 4UXQA 2IVUA 2V62A 2VV9A 3I7BA 3V8TA 3FLNC 3TZ7A 2YDJA 4YTFA 4XG3A 2XRUA 2VX1A 5DA3A 5HIDA 5DH3A 1YDSE 2OXYA 3GLGE 2DWBA 4RQVA 3R00A 4ZJVA 3QKLA 1WBSA 4IVCA 3CY3A 3VS3A 3MH3A 3JS2A 3UGCA 4HVSA 3W2RA 1R0EA 1JPAA 5K3YA 4WRSA 3W18A 2J0IA 1XR1A 1WGNA 2HZIA 3TNIA 5CYIA 3KXHA 1H00A 4JX7A 5CF8A 4O84A 1OIRA 3SA0A 2OXXA 1JKSA 3OEZA 1WCCA 3V5JA 1OI9A 2R3PA 3F7WA 3KK8A 4BBMA 3G51A 3GT8A 4JT3A 4WA9A 5JZNA 3VUHA 4BDEA 2HXQA 4ZZMA 2MR9A 2WMWA 4YGAA 4YSMA 3VJOA 5HGIA 3Q4TA 3TG1A 4ZP5A 3R7EA 5ACBC 3Q2MA 3RM7A 3ORPA 3OXZA 1VDLA 4N4SA 5AP0A 4AN9A 5E90A 1Q8TA 2EXEA 5LWNA 1VEGA 3S00A 2CWBA 3Q5ZA 4G17A 2Y8OA 2ONLA 5HHWA 3LCUA 3K9OA 3TKHA 3I6UA 4IM2A 3MI9A 5FDPA 5DIAA 2GNIA 4YR8A 1RDQE 4F1OA 1SVHA 4RFZA 2C6OA 4PNIA 3R7VA 3BLRA 3O17A 4AZSA 3R8LA 1APME 3VF8A 1O9UA 2ESMA 3C9WA 4QP7A 3S2PA 3VHKA 4C3RA 2E9OA 1OL1A 2RFEA 4RT7A 1G4AE 5JN2A 2XIYA 4JNWA 3LFEA 4ZTSA 2MROB 3ORNA 4JBQA 5KUPA 2GSFA 2VTHA 2ZM3A 4FV8A 2XNEA 2V22A 1MUOA 1AQ1A 3IS5A 3PRFA 4M66A 4AS0A 1K3AA 3OW4A 4IDVA 4X2JA 3NUNA 3UPXA 3W2CA 1Y6AA 4C36A 4BDJA 2H96A 4FEXA 2UZLA 3ZC5A 1U59A 5M07A 4N57A 2HIWA 2X2MA 4JBPA 4J52A 2LVNC 4YUQA 4ANLA 3DFCB 3IPHA 3PXKA 3FYKX 4IVBA 4UEUA 3AC3A 2J5EA 2OBJA 2JIUA 4U80A 4YBKA 3WF7A 3PJCA 3MYGA 5HORA 3EL7A 4LGHA 4FTAA 2W9ZB 2H5XA 3E88A 3WI6A 4EHZA 2VTPA 2FSOX 4RJ8A 4NKAA 4FV0A 5BVNA 1P14A 2YM5A 3FWQA 3E7VA 2B7AA 3ZH8A 2GHLA 3OWKA 4FT7A 4X2FA 5LVPA 2CLQA 2ITTA 4O86A 5IU2A 2ITQA 2JDOA 3GQIA 4FVRA 3GLFE 1Z9XA 1LEWA 1ZOHA 3BV3A 4QPAA 3FHRA 2VX0A 4EOKA 3EQGA 5JQ8A 3NUPA 1JWHA 2PZRA 3FQSA 2WEVA 4YMJA 2DENA 3RI1A 1OL2A 2QU5A 3OOGA 3U9NA 3G0FA 3A62A 4EOPA 4XLVA 4IX4A 2KNZA 3K3IA 3E62A 3HV3A 1WBOA 3LQ8A 4O22A 5CI6A 4ZTQA 1PRYA 4CRLA 5AR4A 3ELJA 4I4EA 3TTJA 4AW0A 3VO3A 5L2WA 4B7TA 4D2VA 1NV9A 3QQKA 5A4LA 4LQMA 4ZXTA 4YZMA 5D7VA 4IHPA 5HI2A 3GUBA 4Y83A 1J7UA 3BHTA 4MD7E 3FZSA 3DB8A 4RZVA 4CRSA 5I9VA 4MBLA 4C02A 4U5JA 4GKHA 4RC4A 3DKCA 4HZRA 1H1SA 2XP2A 3R1SA 3VWAA 2XMYA 4NM7A 5CXHA 3EQIA 4O0WA 1GZNA 2O0UA 3WF6A 1T45A 3I7CA 4G6NA 4Y73A 4AUAA 4HPTE 5EDPA 5FDXA 5IA5A 3TUDA 4DTBA 3MN3A 4TW9A 3SXRA 4CFUA 4KKGA 4FL1A 3NNXA 1OMWA 2Z7QA 2WO6A 3F5XA 4BTMA 4JR3A 5HZNA 2VTIA 3RNYA 2YWPA 3PIYA 5G6VA 3GCUA 1PXJA 2VD5A 4KSQA 4JRNA 5ITAA 3OBJA 1OIQA 3LXPA 4UYNA 2W1HA 3FLZA 3EL8A 5KZ0A 3E8CA 4XUFA 3MH1A 2R9SA 5DBXA 3MTLA 3ORIA 2X6EA 1QPEA 4CTBA 3ZLWA 3QBNA 2ETKA 5EM6A 3LJ2A 4NM5A 3LQ5A 2HCKA 1CKPA 4R7IA 3G0EA 1B6CB 1U5RA 4FKTA 5HCZA 4CV8A 1H1WA 1P4OA 3ZXZA 4QMNA 2B9HA 2PL0A 4J7BA 4M69A 4TRLA 2XH5A 1MP8A 2VNYA 3CKWA 3R71A 3QUEA 4JL9A 5FBOA 4XG9A 2WHBA 4A9YA 1PJKA 4OTDA 1NVRA 2JY7A 3JY9A 3LHJA 4MXCA 4BKZA 4FKOA 5FEEA 2VTLA 3QXOA 5H8GA 1JVPP 3F3UA 2QOLA 5E92A 4NIFB 4JR7A 5HG5A 5IEVA 4ZSLA 1ZY4A 2XYNA 1AIPC 1OIUA 3C4XA 3GXLA 3PE1A 4TYHA 3G2FA 5BNJA 5AUYA 3A4PA 4FNXA 4QMTA 3O0GA 2P0CA 4QD6A 1CSNA 4BIDA 1R1WA 1H1RA 3R9HA 1Q97A 4DTAA 5FTGA 1H0VA 3B8QA 3S3IA 2BKKA 3ZZEA 3PJ1A 2CNQA 3OCBA 5FP6A 3I5NA 3T6PA 1GNGA 3ZFMA 2OIDA 3GFEA 4QNAA 3ZRLA 1OUYA 5LMKA 4HCVA 3P23A 4RIXB 4Q5HA 2L4EA 1KOAA 2GS6A 4YJSA 5AP6A 4B6LA 3K54A 4GYIA 2ZV8A 4KRDA 4GG7A 1QCFA 3F9NA 3AXWA 2W7XA 4H58A 2BWEA 2QO7A 4YP8A 2YERA 5JT2A 5KX8A 2GNLA 5J1VA 4E4MA 3Q60A 4FF8A 4LI5A 5FBNC 3QAME 4I94A 4CT2A 4XCUA 4TPTA 2XNOA 5BYLA 4UZHA 2J6MA 5AV2A 3FBVA 4E8AA 4DINA 3LQ3A 1QPCA 5L6OA 2UW4A 5L6PA 2WQOA 3KVXA 4Q5EA 4USEA 3DXQA 2OJIA 2WB8A 1JBPE 2BDWA 3GU6A 3MH0A 2IW8A 3R28A 4GK2A 3DK3A 2H9VA 2Y4PA 4FV2A 4EJ7A 4E7WA 3TUCA 3NIZA 3P7AA 2C6LA 4HYHA 3K5UA 2UZEA 4F2LA 3KCKA 4WUNA 4JS8A 5AX3A 2X9FA 3F3ZA 3O8TA 5EI6A 3R02A 5IKWA 3SXSA 4G9RA 5TE0A 2R3IA 4JG8A 4I24A 1VYWA 4BICA 3IONA 3TJCA 2VTRA 2R0UA 2OW3A 2O63A 3BEAA 5HCXA 3ZO1A 2IVTA 4RWLA 3TWJA 4RQKA 5EDQA 4HZSA 2OU7A 4C35A 1ND4A 4RJ4A 5HBHA 4LL5A 4YO4A 4L3PA 4RVKA 2P4IA 1WBTA 4I0RA 2ONLC 2REIA 3KN5A 3TZMA 5LJJA 3EN9A 3GU4A 1R0PA 2Y0AA 4GCJA 4M68A 4JVGA 3GU5A 3V3VA 4AZTA 4FI1A 4ITJA 3GCSA 5AR7A 2PVKA 5ANEA 4OAVB 4CVAA 3QCSA 1U54A 4O6EA 3GLIE 3NIEA 5HU3A 2PZPA 3R1QA 3VBVA 2C0OA 4LRMA 4XG4A 4TNDA 3V5QA 5IUHA 4DG2E 1MRVA 4JXFA 5K5NA 3LE6A 1W82A 3GU7A 3C1XA 3BYVA 3V5LA 5EI8A 4BB4A 3D14A 3IGGA 3NNVA 4KD1A 4F7JA 4IH8A 3A8XA 4C59A 3GCVA 5EM7A 4EH5A 4QTDA 1IA8A 2PTKA 3ODZX 3MFTA 4M3QA 5L2IA 5AP1A 4HYIA 3OXIA 4GH2A 1JQHA 4BCKA 3PUPA 4IM0A 5CU2A 3GU8A 5DEYA 5JFWA 2WKMA 1U4DA 5CLPA 5EOLA 2FYSA 1XQZA 3Q4UA 3MPTA 2GHMA 4I23A 5IUIA 4IVDA 2VN9A 3UQGA 4RGJA 1MQ4A 2W0JA 4CCBA 4B8MA 3PXRA 4FT0A 4QMUA 5HE2A 4XNEA 4TYIA 2B54A 3IG7A 2VWVA 3O8PA 3NZ0A 1IR3A 2XM8A 2ZB1A 5TF9A 5M53A 3FMKA 1VEJA 5FXQA 1R4GA 1GJOA 4FSRA 4R7HA 1PKGA 3VULA 4E4XA 4H1JA 4PF4A 5E4HA 4GSBA 1ZYJA 4O27B 1VEBA 2PVYA 3TZ8A 4EBWA 2Z7RA 3ZO3A 5K4IA 4GFMA 4BC6A 3Q2JA 3O23A 5BMSA 4BKYA 2ITWA 2YLEA 5J7BA 1J91A 4ZTRA 3FJQE 3FZPA 3C4ZA 4FSTA 4IWDA 4MXAA 4QTEA 1XBBA 3SOCA 2E9NA 4W4WA 2HZ4A 5HNGA 2QR7A 3FI4A 5T3QA 3HDNA 3O8UA 4ORKA 1GIHA 5CEKA 1Z57A 4GG5A 4ZAUA 2W1CA 4NTTA 2ZV7A 4WSQA 4ACHA 4U0IA 4D1XA 4MX9A 4O7VA 4PP9A 3WILA 1SNUA 3QUPA 4FIJA 3EQHA 1W7HA 1OGUA 1OL6A 4AOJA 2NNWB 4ZTNA 1WBPA 2W1IA 1XJDA 2C3KA 2PE1A 2QI8A 3PXFA 4RX7A 5DRBA 3MJ1A 3P1AA 3T3UA 1GZOA 2ZV2A 3V5PA 2Z60A 4J98A 3QTXA 2UZWE 3EFWA 3G90X 4Z7HA 3TCPA 3F5PA 4J99A 5KNJA 3RWQA 3QCQA 4XG8A 4FSWA 4NM0A 3ZSHA 4DEHA 5ETFA 2XKCA 3LOKA 3ZZWA 2WAJA 4J1RA 4CFVA 4D9TA 3ROYA 1YXVA 3FC2A 4USFA 3UOKA 3VS7A 1OBGA 5HD4A 5IQGA 1K9AA 3Q4CA 2W5AA 4FV6A 3RMFA 4F4PA 4O7SA 4FKLA 3DAJA 4FKSA 3E8NA 3I0QA 3OXTA 1OKYA 4HGLA 4J8NA 4MNEB 5CU3A 3UMXA 3NYOA 3W2SA 4NCTA 4Z3VA 3P0MA 4ZTMA 3VRYA 2SRCA 1WR1B 2DUVA 4O38A 4X2GA 4FYOA 3W8LA 3F82A 4DGLC 3OFMA 4FSMA 1GZKA 2OZOA 1J7LA 3GOKA 2PMLX 3BHVA 1DAYA 3OZ6A 3GC8A 4NWMA 4BFMA 4TN6A 2MGWA 3BU6A 2P2IA 4KIOA 3O50A 4C4JA 1PMEA 2EVAA 2G1TA 3ZTXA 1Q3WA 4BWXA 4JX3A 2WU6A 4WNMA 5IDPA 1NY3A 2DAMA 3OF0A 4BCFA 3GLHE 3R9OA 4ITIA 5HLNA 4H39A 2P55A 3BU3A 3F5GA 2GNJA 3QKKA 4OLIA 5DMZA 4YNEA 2LGCA 2WQMA 1KE7A 4QT1A 5LQFA 4O83A 2FSMX 3AD4A 4IJPA 4ZLOA 3C13A 2C5OA 1ZOGA 2HW7A 2ZV9A 3VUGA 3O96A 4RX5A 4V01A 3UNZA 3LFFA 4DEBA 2J0KA 2W05A 5AEPA 4IAZA 3VW8A 5H9BA 5LMKC 2X39A 3LM0A 4F09A 4O6LA 3AMBA 4UMPA 3NGAA 3IO7A 3PPZA 4ASDA 3GEQA 2BFYA 3W16A 4MCVA 3AGMA 4F08A 5LWMA 5DR6A 3FPMA 4CLJA 2WTIA 2VWXA 3R73A 2QO2A 1S9JA 4O0TA 4KWPA 4CKRA 4XLIA 3ZOSA 4APPA 4GU9A 4FTCA 1OKZA 5IF1A 2LVQD 3CD3A 2B9JA 4BDFA 5AV0A 1GIJA 5FGKA 5IQIA 3CY2A 3Q04A 3FQEA 3UO4A 1JSTA 3KL8A 2JY5A 4A06A 3A60A 4TYEA 4B0GA 4C4FA 5LMBA 4DFUA 4RMZA 2F2CB 4U3YA 1A9UA 4YO6A 2OJ9A 4L43A 2IO6A 2W4JA 1LEZA 1W83A 3DOGA 2QKRA 4QO9A 4D28A 1G8AA 4GJ3A 3MFUA 4L52A 5GINE 4NTSA 1M2PA 2O2UA 4I4FA 5KKRC 2FSLX 4YJOA 4AOIA 1ZYCA 3R2BA 4KRCA 3KKVA 3W33A 4O7NA 4BY9E 1H26A 3FY2A 2W1GA 2PSQA 4ACGA 1HQYE 4UXLA 4FV1A 1IRKA 2I6LA 3R30A 4J97A 1XH8A 4NIFA 2ITXA 4MAOA 5J87A 5A6OA 1OVEA 5DI1A 3ZUUA 2HXLA 2J2IB 2J50A 1A06A 4R5SA 4AN2A 4CYJA 3UYSA 4XG7A 4E6AA 3K3JA 3MY5A 2B1PA 2EUFB 4L7FA 1PXPA 5J95A 4F63A 3T8OA 3V6SA 1YLAA 1JSVA 4YZNA 2K0BX 3U4WA 4D58A 4BCJA 4ZOGA 3ROCA 2I0EA 3L1SA 3O7LD 3TIYA 1NVSA 4BTFA 4BZOA 3B8RA 4O7ZA 4K9YA 2JC6A 3JY0A 4OTRA 4FKPA 2WPAA 3UPZA 3UP2A 4KBKA 4IE9A 5DN3A 5HNIX 1URWA 1XBCA 2HELA 4LRKA 5K5XA 4U79A 5AJQA 2KNAA 2AC3A 4EKLA 4KA3A 4C33A 3E46A 4G2FA 5E8WA 3JYAA 4BDHA 3SD0A 2KTYA 4BGHA 5EYKA 2FH9A 5AUTA 5IUGA 2A2AA 1PYXA 2CSNA 3BGPA 4TTHB 3TACA 4ENYA 1VG5A 5J79A 2Q0NA 2RKUA 2I1MA 5ANIA 1OPLA 2NRYA 2QQ7A 4FIIA 1YW2A 5F95A 4AU8A 1NV8A 3PPKA 4GEOA 4BDKA 2GQGA 4EEVA 4ZLZA 2PE0A 3CTQA 5D7AA 3ZS5A 3ACJA 4BL1A 3QHRA 4A07A 4CGAA 3Q5IA 4IACA 2VUWA 4RJ5A 5E8ZA 3ZSGA 3Q9WA 2UW0A 3HV6A 1XWSA 2Z7LA 3CLYA 3MVMA 5ETAA 4AZEA 3LFNA 5LOHA 2QOCA 4OTHA 1REJA 4I0TA 4EQCA 3F69A 2R3OA 2FO0A 2R3FA 4LL0A 3TL8A 2OJGA 2BMCA 1VYZA 1GIIA 4IB5A 2WTWA 1BI7A 4NH1A 2BIKB 1H1QA 4IC8A 3ZRMA 4AW1A 4DFLA 1RJBA 3OROA 2V7AA 4PTCA 3V6RA 4ANNA 5HOAA 4IWPA 3JUHA 2PK9A 2XNMA 4XBUA 3VN9A 2W5HA 4CKIA 2OG8A 3DLSA 2DYLA 3KMMA 5FQDC 3OD6X 1F5QA 4WHZA 4JQ8A 4ZS0A 4DBGB 3HKOA 3MFRA 5AUZA 2QG5A 2C1BA 3GC7A 4U40A 4BCHA 1EFUB 4C4GA 5EHLA 2C6KA 2XBJA 4YJVA 3RZBA 3WE8A 3OEFX 3HMNA 4D0WA 3EKKA 3FZOA 4GVJA 4A4LA 4JIAA 1MRUA 3A61A 3QQLA 4KB8A 5CT7A 3L9NA 5AAFA 2X2KA 4A9TA 4ANQA 3A7JA 2BZHB 4HEOA 3QZGA 4FNZA 4U8ZA 3CCNA 3K5VA 1NXKA 3EIDA 2YDKA 3CBLA 1TQIA 2X1NA 3ZSIA 3IOKA 3DTCA 5KMLA 2X7GA 4JG7A 4DEGA 4EOMA 3NYVA 2VGOA 1V1KA 4YHTA 4RC2A 2WMBA 3QRJA 4X3FC 4D2TA 3TDVA 4IB1A 3C0HA 3FZTA 4D2RA 4BCQA 1YOMA 4DF3A 3MVJA 3QGWA 2AYPA 4QTAA 4BRXA 3DT1A 3MTFA 1OBDA 1ZARA 2PVMA 1A5TA 1PXMA 3B2WA 4QP6A 5TT7A 2E9PA 4JBVA 4DH5A 3FHIA 3PJ8A 2VWUA 3SXFA 3I5ZA 3PVWA 4JI9A 4GJ2A 4ZZOA 2OF4A 3R22A 3ZU7A 2NO3A 1E1VA 2GU8A 3JVSA 3KXMA 3U51A 3KCFA 4DLIA 4I5CA 1FBNA 3A99A 5KKRB 3F3VA 4RLLA 1FMOE 1F4IA 4GK3A 3UYTA 3O2MA 3ENMA 4AE9A 5AX9A 4WG4A 4RJ6A 4IBMA 5FTOA 2XEZA 5C03A 4NCTC 4YJRA 4F9YA 4S31A 1Y91A 3A7GA 3CR0A 2LVOC 5DR2A 1JKKA 1WIVA 3KXGA 5KMNA 2CHLA 5I4NA 2Z02A 4QMVA 5K0KA 5AR2A 3FXZA 2PPQA 5CT0A 5KMKA 2XCKA 4WBBB 1PMUA 3BLQA 2JKOA 5GJGA 3POZA 2XIRA 2J4ZA 3QWJA 3DY7A 5C8MA 4W9WA 4C3FA 3L9MA 4FZ6A 5KCVA 2QODA 4YC8A 3UMWA 2Y6MA 5KMIA 2PZIA 3RALA 3KC3A 3ZEPA 1U54B 3ZO2A 3QD0A 3NRMA 4RFMA 4G34A 2B3TA 2R7BA 3AOXA 4FKQA 2EB3A 4ENXA 4OAUC 3HUCA 1O6LA 3REPA 1E94E 5DNRA 5ANJA 4ALVA 3UQFA 4C2WA 1Y57A 4AFEA 2W5BA 4OUCA 4AF3A 3EQRA 4FNWA 4WOVA 3LXNA 4I0SA 4QMOA 5HKMA 4C4HA 3QQHA 5DHJA 2I0YA 4GT3A 4IZ7A 2W06A 4ZZNA 4QMPA 3ID6C 4UY9A 5J1WA 1Q8UA 3QQFA 2EKFA 5DFLA 3FEGA 4XJ0A 4IQ6A 3RHXA 4WIHA 5M09A 4IIRA 3HUBA 3FDNA 2RGPA 2ZMDA 4MNEA 4Y8DA 3DKGA 3OCTA 2R3QA 3Q52A 2VX3A 4O2PA 5M06A 1Q62A 2PVRA 4U41A 1B39A 4NFNA 4E4LA 3D4QA 3L8XA 5CU6A 4QTBA 3F66A 4BDGA 4EHGA 3VBYA 3F92A 4AGUA 5JGBA 3QRTA 5H8EA 4MHAA 5IEYA 3QC4A 4FTUA 3JXWA 4YJQA 2HAKA 1P5EA 3PXQA 2C30A 3ORMA 2ACXA 2YIRA 4CXAA 3UO6A 3V5TA 4I6HA 4EH9A 2OH0E 3DXPA 3JPVA 2UW8A 4BIEA 3FZ1A 5AAGA 2CGWA 4AAAA 4DGNA 2QHOB 2YIXA 3MMPA 2HENA 2VTAA 4NJ3A 2VO7A 3RPYA 3ZUVA 3IGOA 5EYDA 3RGFA 2J0MB 2YN8A 1LP4A 3KULA 4LFIA 1YQJA 1M17A 4J53A 5IA4A 4DYMA 4C3PA 1WJ7A 1SNXA 4BN1A 3QTSA 5IQAA 4C62A 2R3NA 1GZ8A 3E3PA 5B2KA 2X4FA 4GIIA 4J95A 4FZAB 2E9VA 2Y9QA 5JGAA 4DGMA 3RPVA 2XCHA 2XIXA 3KN6A 3PRIA 3QX4A 2W4OA 3IW8A 3N4UA 2V55A 2R3LA 1H28A 2YITA 5HE3A 5CEIA 4V05A 4X3FB 3LAUA 5HIEA 1OPJA 3OUNB 4MWHA 2QOBA 4G3OA 4Q2AA 4EH6A 4DA5A 1OZ1A 3R2YA 4AN3A 5B0XA 4HVDA 5TO8A 3ZEWA 5EFQA 1WGLA 5EKNA 3SV0A 4E6CA 2F2UA 5K4JA 3RAKA 4M97A 4PPAA 5AV4A 2J7TA 4UN2B 4DFNA 2OKRA 4KSPA 4LUDA 5T6KA 4F9CA 3BYOA 4LRJA 4F7LA 5CASA 1G8SA 1ZYLA 4RC3A 1DO2A 1GY3A 4GU6A 4BCNA 1E9HA 1T6OA 2OO8X 5A9UA 4FIHA 2UW9A 1W98A 3VVHA 3I79A 3UJGA 2DAGA 1H0WA 4B99A
chains in the Genus database with same CATH superfamily
1FINA 4AT3A 4RBLA 5FWKK 1KOBA 1HT2E 2XAOA 4RZWA 2GQSA 5GJFA 2JY6B 3ERKA 3H4JA 4MB7A 4MXYA 1OIZA 1HCLA 1YXTA 3ZUTA 2UW3A 2CUZA 4MD8E 5CAQA 3R7IA 2QHNA 5CAPA 1YHVA 3UNKA 5CSHA 3MK6A 4ANMA 4D4RA 4EYJA 5BUJA 4DEIA 1WBWA 1PXNA 1R2ZA 4FWDA 5EW3A 1LPUA 4HJOA 2ZVAA 1Q3CA 2F5PA 1WZYA 4YJPA 4PMTA 4U7ZA 4C58A 2F9GA 4QMYA 4UMRA 4O1OA 1OL7A 4QPMA 4FNYA 3UOHA 5K9IA 3DDQA 1QPDA 4O82A 2XARA 2VAGA 4AG8A 3BLAA 2H6DA 4L15A 4B8LA 3SDJA 3SG8A 3TZ9A 4E93A 4TY1A 2ETRA 1YDTE 3C3DA 4LDTA 3TV4A 4FTRA 2CFOA 3DBDA 2ZAMA 3L9LA 4U42A 4L8MA 3E64A 2C5VA 2R3HA 4UBAA 3QGYA 4FYNA 2MJ5B 2P2HA 5ITQA 5BVWA 4S2ZA 2OOBA 3D83A 2X8EA 4PV0A 1D0MA 2CHGA 3H3CA 5EM5A 4CHTB 5HVYA 4NW6A 2ZTDA 3DS6A 5EH0A 4QMXA 4EHVA 4G3FA 3GFWA 4CJ6A 4GK4A 4D2PA 4AW4A 3KREA 2WMVA 4YTHA 5DOSA 4FK3A 4FSQA 4XV2A 3Q4ZA 5HE1A 3R63A 3SW4A 2YJRA 3S95A 3PIXA 3OT3A 3CJGA 2O25A 2PE2A 3D5VA 3L28A 4QMQA 4NKSA 5IQHA 1P4FA 4PUZA 1YXSA 2O3PA 3LFDA 4NL4H 2KNVA 3D9VA 2JZ0A 2O64A 4OTIA 4L00A 5CQUA 3UZTA 1R5LA 1UWJA 4FZDB 4GFGA 4IFGA 5J7HA 4JLCA 1V33A 2VIIA 3OCSA 3H30A 4H1MA 2VO0A 5LVOA 5GZ9A 3BGQA 5C8KA 1YI4A 2CHQA 2IF8A 4G4RA 4NM3A 3P9JA 2QSFX 3CJFA 4L45A 2G15A 4X64M 2RFNA 2FOIC 5IMXA 2V5QA 1PKDA 4FSUA 4G3CA 2ZFYA 3ZMMA 2QD9A 3BGZA 4QYYA 4K0KM 3MHVC 3TDWA 3S4QA 3CQUA 5LARA 1LR4A 5CVGA 4JQEA 3ILKA 2YFXA 3U6QA 3FUXA 2RG5A 3PWYA 2F57A 3SLSA 2IZTA 2P3GX 3EH9A 4PRJA 4C57A 5CTPA 4RWKA 2E5LM 3KMWA 4N6YA 2EXCX 5JQ5A 3BYSA 1XC8A 3V04A 2R2PA 2VZ6A 1IXRC 3O7LB 5JMSA 2UVXA 4C38A 4X6RA 5AM6A 4TXCA 3RPSA 3S0OA 4YZ9A 2ETMA 4YSJA 5AP2A 1HNXM 3S1HA 5DNYA 4DHIB 3KVWA 3FKEA 2NRUA 5IA2A 4O7YA 3WZEA 5ANDA 4I5HA 4UWYA 5HESA 4QDVA 5CSPA 1V0OA 3LLAA 3W67A 3UDBA 2R3RA 4EQMA 3FMJA 3RHKA 1DGHB 3D5WA 5I0BA 4DR4M 4FEVA 3R7YA 4ZS4A 2IG7A 5BUIA 1O6KA 3HMOA 4OBOA 5D1JA 1XXHB 5KPZA 4ZTLA 4IJEA 4L6V6 3AC1A 2FUMA 3AC2A 1OGYA 3RPOA 3MH2A 3VQUA 1JR3E 4KNBA 4QQ5A 4KT0F 3CIKA 3HP2A 3EQCA 3VUIA 4K33A 3VF9A 3LVWA 5H3QA 2ZM4A 2VWWA 3OTUA 2VTQA 5F9EA 2W99B 3MY1A 2XBAA 2W1ZA 4E73A 1G41A 5D10A 2BTSA 3BQCA 2HW6A 4NW5A 4RG0A 4EQUA 3G5DA 3HDMA 3W0QA 1Q8YA 5F1ZA 5JGDA 3B89A 4JI2M 4MF1A 5I9YA 4FUYA 3DKFA 3RGSA 3KFUG 4WP2A 4I21A 4O4CA 4GUBA 4P90A 5ANKA 2F5QA 4PMMA 5DG5A 3KQ7A 4G1WA 1YRPA 3L25A 5CXZA 3GRVA 3MDYA 5LCKA 2ZAOA 3FRIA 1V92A 1F0QA 5DT3A 3FLSA 5L2SA 3QL8A 2LVPC 2F7XE 4R7BA 3ZC6A 3C5UA 4PL5A 4EUTA 2HZ0A 2OLCA 5M44A 1TR8A 4LJ9A 4M0WA 3ZLYA 2JGZA 5KZIA 3PVGA 3H0YA 5I3RA 3CQEA 2QR8A 4F1TA 4M8TA 4HVIA 3IHPA 3MVLA 2JAMA 3CC6A 3W0FA 2C3IB 2AHMA 2RSVA 4OBPA 3K9PA 4DR1M 5EW8A 3MESA 4R1YA 4F9BA 2DAKA 3C50A 2WIHA 3JVRA 3AT4A 4O0XA 1PXIA 4PDOA 4OX9M 3E5AA 4KLNA 4HPUE 4ZMEA 3BX5A 5EYMA 3DJ6A 3BWJA 3DQXA 5CEQA 3U5ZA 3EIHA 4FT9A 3UG1A 2UV2A 2NYAA 5GNKA 4K2RA 1JKTA 5BYYA 3AC5A 4FOBA 3FMNA 5TR6A 4I5PA 2R45A 5I3OA 3DQWA 3TKUA 3NUAA 2QOQA 3QRUA 4BTJA 4KUJA 5G1XA 3F3WA 5FG8A 4F1MA 3C0GA 3R7OA 3Q53A 3R9DA 1OECA 3G6GA 2DQ7X 1GOLA 4MXOA 5ITYA 3HMMA 3UZPA 3QRIA 5IZFA 2GDOA 4EK5A 1NY5A 3OT8A 3NUYA 3QZHA 5JFXA 5LVLA 3MB6A 1IBKM 4MQ1A 4NFMA 5BMMA 2XJ0A 4X62M 2Z4SA 3FXXA 5KBQA 4ID7A 3F2NA 3HGKA 4QPSA 5FSWA 3GCQA 1H25A 4NK9A 4C34A 3GC9A 1U5QA 5A6NA 3QHWA 5L8LA 3RM6A 5CANA 2PVJA 3GGFA 4ZTHA 3GRRA 3DAEA 3G33A 4RIWA 5ITRA 4TYGA 3N51A 4ACMA 5HIBA 3P5KA 2DS1A 2BPMA 3O51A 5DYGA 4TT7A 3BEGA 2GPHA 3ZM9A 3IECA 5IWAM 4QYEA 2XEPA 2Z7SA 2VRXA 3NAYA 4KKEA 4DFZE 2JEDA 2HYYA 3HECA 4LOPA 3LFQA 2YJSA 2O5KA 4F0IA 4WG5A 2G2HA 3PXZA 4JG6A 4XP2A 5CSXA 4E20A 2EU9A 4L3JA 4IBEA 3NBIA 4FZFB 4I6BA 3F2RA 1PXLA 4DR7M 3CPBA 3RVGA 2VGPA 5KMJA 1TH2A 3OWPA 5A4CA 4XK8F 1SZMA 5JRQA 4XV9A 5BPYA 4NYEA 3QU0A 1JLUE 1YKRA 2J9MA 4AW5A 5EJCA 4ZIMA 3B7ZA 2HHHM 5KPRA 4LZJA 4EL9A 2F49A 3HJSA 4LMUA 4FT5A 4LYNA 4TWPA 2JDVA 3FKLA 3DAKA 4EHEA 4OGRA 2OO9A 3KOZE 3N4TA 2BHHA 2Q83A 3SBJA 2BRHA 1BKXA 3HZTA 2QOFA 2IVSA 1P3QQ 1IN8A 3L29A 4YLLA 4X7QA 1DO0A 1VR2A 3A8WA 2LTUA 3H10A 3ZONA 2VWIA 4APCA 3BHUA 4M12A 4MKCA 3QZFA 4GC9A 4AGDA 4EZ7A 5FTKA 3TN8A 3Q8GA 4AT4A 1TVOA 3QTUA 1N75A 3AQVA 3FI8A 2QZ4A 4BDAA 1QAMA 1PHKA 4AKHA 4AOTA 3TV7A 3U6MA 2C4GA 3EN6A 3OUKA 4LF7M 2XK8A 3D8LA 1N77A 4W4YA 2V0DA 2CKEA 4FV9A 5JI2E 5CAOA 1OAIA 3E8EA 3KGAA 1YI6A 4A9RA 4AX8A 5FUTA 4PDPA 1KFVA 3H9FA 2YM8A 4G3EA 2WTVA 4CQGA 3W32A 3FYJX 4EKKA 3HJQA 3MIAA 1WHCA 1YDRE 1PF8A 3VS5A 3BYMA 4RIXA 4F9AA 1FVRA 4MD9E 5CEMA 4RSSA 2F4VM 3P4KA 4CYIA 4OTGA 4BF2A 2CE7A 4IZAA 4LF9M 1MN3A 5KO3A 2XIZA 4EOQA 3E92A 4W8DA 2YM3A 5IISA 5T68A 4XP0A 2C69A 3QZIA 3VS0A 1Y8YA 5CAUA 2OOAA 4K18A 4O4FA 4R1VA 4QP1A 3R8ZA 3QUDA 4MXXA 4FBXA 4M69B 3UVRA 3FSFA 3PSBA 4D1ZA 1JAMA 2OICA 5DT0A 3JR1A 3BCEA 1CDKA 5CU0A 2BKZA 4GRBA 5A4EA 2ZAZA 4IB0A 2C6EA 3ATSA 3E7OA 5E7RA 1H07A 3C7QA 5IZ7D 4YBJA 3AFHA 4BCPA 5BX0A 3R8VA 2XF0A 3F88A 2DHYA 2UZUE 2J7NA 3IG5A 4F65A 4KABA 2PZYA 3T3VA 4EJNA 2BR1A 3KMUA 4YJTA 3MJ5A 2JFMA 3V51A 1TZDA 3FPQA 3TACA 3LCVB 3HHXA 4TYJA 3R6XA 1DGFA 3CS9A 2LAVA 4D55A 2VWBA 4CG8A 2HY81 4Y46A 2VDBB 4UXQA 2V62A 4XG3A 5HIDA 3GLGE 3VS3A 4B3MM 4HVSA 1R0EA 2HZIA 5CYIA 3KXHA 1D0LA 5CF8A 1OIRA 3HY5A 1JKSA 3KK8A 4JT3A 3GT8A 4WA9A 3VUHA 4BDEA 3CGWA 4YGAA 3Q4TA 3TG1A 3Q2MA 3ORPA 3H4MA 1VDLA 3OXZA 3S00A 2Y8OA 2ONLA 3LCUA 1T3TA 3MI9A 5DIAA 2WSFF 2C6OA 3R7VA 3O17A 3VF8A 1O9UA 4C3RA 3C9WA 1G4AE 4JNWA 2ZM3A 4FV8A 3SARA 3DA1A 1MUOA 1AQ1A 3IS5A 3OW4A 5M07A 3KSJA 1TH4A 4YUQA 4ANLA 2OBJA 5HORA 4LGHA 2FSOX 4RJ8A 4NKAA 2XSZD 1P14A 4LZZA 3FWQA 3ZH8A 5LVPA 2ITTA 2ITQA 4EOKA 1JWHA 2PZRA 2DENA 3U9NA 3G0FA 4IX4A 2KNZA 3E62A 5L2WA 4B7TA 1J7UA 3BHTA 4MD7E 3FZSA 3DB8A 4RZVA 4JI6M 4OVZA 2KZUA 2XP2A 1T45A 5C18A 5EDPA 5FDXA 4DTBA 4Y28F 3F5XA 4BTMA 3RNYA 1PXJA 3OBJA 3TQSA 3LXPA 3EL8A 5KZ0A 1QPEA 5EM6A 3LQ5A 1CKPA 3GLFB 4R7IA 1B6CB 2B9HA 4B7FA 1MP8A 4XG9A 2JY7A 3LHJA 2XZUA 3SYKA 1JVPP 4DR6M 4DR3M 4NIFB 5HG5A 2GQRA 4ZSLA 3PE1A 4QMTA 4KHPM 1CSNA 4BIDA 1R1WA 5FTGA 3B8QA 3S3IA 2CNQA 3OCBA 5FP6A 3GFEA 4Q5HA 1KOAA 3K54A 3F9NA 2D7EA 2QO7A 5J1VA 2YERA 4CT2A 2XNOA 3FBVA 2UUAM 5L6OA 2UW4A 3KVXA 3DXQA 3GU6A 2IW8A 3R28A 3SATA 2C6LA 4HYHA 2UZEA 3KCKA 5AX3A 3U6SA 5IKWA 4G9RA 3J27B 4BICA 3FTFA 4M9SA 5EDQA 4YO4A 4RVKA 2REIA 5LJJA 3V3VA 1QUSA 2Y0AA 4M68A 4LRMA 3SC3A 4XG4A 3V5QA 4DG2E 1MRVA 4JXFA 3LE6A 1W82A 3GU7A 4MGKE 3NNVA 4CGYB 5EM7A 4EH5A 3ODZX 3PUPA 2FYSA 3MPTA 5IUIA 2VN9A 1MQ4A 1AUAA 2W0JA 2VWVA 2ZB1A 1ST0A 1R4GA 4FSRA 1PKGA 4H1JA 5E4HA 3TZ8A 1J09A 4O27B 2Z7RA 3Q2JA 4IBFA 5BMSA 2HL7A 5ITTA 1J91A 4FSTA 3C4ZA 4W4WA 5T3QA 3O8UA 1GIHA 5CEKA 4ACHA 4MX9A 4O7VA 1W7HA 2NNWB 1OL6A 4ZTNA 2W1IA 4RX7A 2C3KA 3VK7A 2QI8A 3MJ1A 4J98A 2UZWE 3TCPA 3ZSHA 2WAJA 4CFVA 5IQGA 4FKLA 1OKYA 4J8NA 4MNEB 3UMXA 3NYOA 4NCTA 1WR1B 4NSOB 1GZKA 2P2IA 4KIOA 3C9PA 1NY3A 2DAMA 4H39A 5DMZA 3F5GA 2GNJA 4IJPA 4ZLOA 2HW7A 4O4BB 3O96A 4RX5A 3AV0A 4V01A 3UNZA 5H9BA 5LMKC 4UMPA 3IO7A 3PPZA 2BFYA 2QO2A 4O0TA 4CKRA 4GU9A 1OKZA 3EIEA 2L09A 4FD2A 5IQIA 4TYEA 5LMBA 4U3YA 2OJ9A 3A46A 4QO9A 2W4JA 2QKRA 5E26A 1ZYCA 3KKVA 4O7NA 2XLJA 2PSQA 2M5ZA 2ITXA 2J2IB 4R5SA 1MJGM 2B1PA 2EUFB 3TMOA 1PXPA 3CF0A 3V6SA 3T1HM 2K0BX 3NFFB 4B7HA 3TIYA 4BZOA 1NVSA 5AJQA 4KA3A 2KTYA 5EYKA 2FH9A 2A2AA 1PYXA 5J79A 2RKUA 2QQ7A 4FIIA 5F95A 4GEOA 2GQGA 4BL1A 2C9CA 4A07A 3Q5IA 4IACA 2UW0A 3HV6A 1XWSA 5ETAA 4AZEA 2FO0A 2R3FA 2OJGA 2BMCA 3GQ5A 1RJBA 3V6RA 4IWPA 2PK9A 3KMMA 4I81A 4JQ8A 3MFRA 3U61A 3GC7A 2C1BA 4U40A 4C4GA 5EHLA 2QENA 3RZBA 3WE8A 3FZOA 3A61A 4KB8A 3L9NA 4A9TA 2BZHB 4HEOA 3QZGA 3K5VA 3EIDA 1QDTA 3CBLA 3IOKA 4JG7A 1V1KA 3CTWB 3CF6E 1OBDA 2PVMA 1A5TA 1PXMA 3B2WA 4G6ZA 4DH5A 3FHIA 4ZZOA 4DLIA 3U51A 1MU5A 3KCFA 4I5CA 1FBNA 1F4IA 3UYTA 3ENMA 5AX9A 3GLIA 4S31A 1Y91A 3SAVA 5K0KA 2PPQA 5GJGA 2H1RA 2XIRA 4W9WA 3L9MA 4YC8A 2PZIA 3ZO2A 2B3TA 3AOXA 4OAUC 1O6LA 1E94E 1Y57A 3EQRA 4D82A 4I0SA 3FUTA 3QQHA 2W82A 3FEGA 4XJ0A 5IREB 4IIRA 3FDNA 2ZMDA 3OCTA 5M06A 2PVRA 4QTBA 3F66A 3QRTA 3QC4A 3JXWA 2HAKA 3PXQA 3ORMA 4CXAA 4EH9A 3DXPA 3JPVA 5AAGA 1IXZA 2QHOB 2HENA 2VO7A 1RU3A 3L26A 4J53A 4G4OA 1WJ7A 1SNXA 5IQAA 4DGMA 3KN6A 3LAUA 4MWHA 2WSEF 4G3OA 1WGLA 4KSPA 5T6KA 4F7LA 3TYKA 1GY3A 4BCNA 1E9HA 2OO8X 3P5JC 2UW9A 3I79A 3UJGA 2DAGA 4ANSA 4LOQA 3CQWA 1PY5A 5A3XA 1T46A 2FGIA 3L27A 3D94A 2Q0BA 2JIVA 3C4FA 2XNNA 3D15A 2C6MA 2RGHA 1BL6A 2WIPA 1JB0F 1S9IA 5H2UA 2WMUA 4O0UA 5L2QA 2EO2A 4BLCA 4MTAA 3VS6A 2X49A 4ASXA 3R04A 5EKOA 4ZMFA 5FD2A 4U43A 3QCYA 4P2KA 3T9IA 4JYAM 2OQ4A 4NSTA 3KDSE 4MGYE 4FV7A 2JWSA 2J0LA 4PPBA 1DI8A 4RRVA 3PPJA 2C5YA 3J7BA 3UK6A 4S33A 5BVDA 5LVNA 3SAWA 3LCDA 4OTFA 4BTKA 3I1AA 2XNGA 3UP7A 4AGWA 4XS2A 1UKHA 4K8AA 4I93A 3NWWA 4KO8A 4D0XA 3AMAA 3BOSA 3WF9A 1DAWA 4GKIA 3ZBXA 2V1UA 4CQEA 2RFSA 1Q24A 2F4JA 2JP7A 2IEWA 3GNIB 1ZRZA 4M9XA 3B9PA 4WNPA 3D5UA 4YLKA 3RAWA 3CGOA 4DT8A 2CGXA 2WMSA 1IAJA 3QFVA 4ZSJA 3RNIA 3OBGA 5EP4A 4FKUA 5JFSA 2WTKC 5M55A 4RX8A 3IG8A 3CKXA 3KP0E 1ZY5A 4LGGA 5I9WA 4XGIA 3I81A 2RL5A 2KULA 4J8MA 3LFSA 4Z9LA 1H08A 4HCUA 4UWBA 4UX9A 2XALA 4BCGA 3EQBA 5CNOA 2YM7A 2CDZA 4DEAA 5CSWA 3MJ2A 5CY3A 1YHWA 4NT4A 3CPCA 4ZPXA 4CG9A 5AP4A 2G2FA 4UALA 4FVQA 3BLHA 5I9ZA 4IZYA 4FWGA 4BBEA 4Y5QA 2Z8YM 1IN4A 5HU9A 3R83A 5TOZA 4L46A 4QQJA 3EFKA 4BZDA 3ZM4A 4G16A 4ASEA 3HGIA 4MVFA 4BBFA 2BAQA 3NNUA 2XK6A 3FMLA 4RWJA 2FSTX 4USDA 4IBCA 2JY8A 1TH3A 3U54A 3DNEA 2CMWA 4IAAA 5IQFA 3LCTA 3L8PA 2OPFA 1LTMA 2J5YA 3EOCA 4IW0A 3RKBA 3BRBA 2YAAA 2EKKA 4PY1A 4M7IA 3GQ3A 3MWUA 1JKLA 1I09A 4C8BA 3ZRKA 5LXMA 2OIBA 1ZZ2A 1DI9A 4FKWA 4BCMA 5C01A 2WTKB 3QWKA 3BBZA 4OTPA 3LJ1A 4DEDA 3PVBA 4YC3A 3KULB 2UW7A 4BGQA 1WVYA 3EQDA 4KBCA 2WELA 4R77A 3C4CA 4ZY6A 1KE5A 2UZOA 5C1QB 5HO7A 1XNRM 4FSYA 5IT9S 4KIKB 4AE6A 5CZHA 2CV1A 4M0YA 3G15A 3UIMA 2BDFA 4NJDA 4DV7M 3SYLA 1F3MC 4LV8A 3WIKA 1Y6BA 3CGFA 3NW7A 1GKIA 3FLQA 1D0KA 3JAMS 1H8FA 4RFYA 3HL7A 3AOEA 4BHZA 3SQQA 4C4IA 4HVHA 1K3WA 4YHHM 5FLFA 4RA4A 3PNYA 3BXWA 5JZJA 1U46A 4IBDA 4WBOA 2B52A 4L53A 3WHKA 5BUEA 4ZK5A 3KSXA 3FUVA 2CN8A 2Z2WA 5HO8A 3SRVA 4ZLYA 5CWZA 4I6FA 3VJNA 4AA0A 3FD9A 4DV1M 1OKVA 2DWNA 3EN4A 3KY2A 5HX6A 4FODA 3D2KA 3VS2A 5AMNA 3ANRA 1O6YA 2CHVA 2YFQA 1T43A 5HLWA 3LW0A 3PJ3A 4XV1A 3SHEA 5KMOA 3EFJA 2DWLA 2YACA 3RK7A 3LVVA 5AIRA 5M4CA 1V0BA 3I51A 3V5WA 4X21A 1MRYA 3PSCA 3HX4A 3LMGA 5CNNA 4QMLA 2XJ2A 4EK4A 3MW1A 4FEUA 2W9FB 4IAIA 4LCBA 1LV7A 5EXTA 2F7EE 5HBJA 2BJWA 1SYKA 3I04M 4UMTA 4YU2A 2JBOA 5KE0A 2QOIA 3LZBA 3UBDA 2DAEA 4ANBA 5EP2A 3E3BX 4EOLA 4PMPA 4MK0A 4U81A 3GPXA 5AA8A 1FVVA 4ACDA 3KXNA 4BCIA 1PJQA 1PJJA 3QYEA 4AZVA 3LM5A 3RJCA 4EUUA 3VBTA 2B9FA 3ET7A 1NJFA 2YZAA 3OY3A 3BELA 3DFAA 3LCSA 2RFDA 5FP5A 1PJTA 1H24A 4LF4M 3NCGA 1UWHA 1ZYDA 4FA2A 2ZTCA 1Q3DA 4WUAA 5AR5A 1JNKA 4PPCA 4FOCA 2LWXA 1G71A 3MB7A 3P86A 3FLYA 2CJMA 4PDYA 4IM3A 2I0VA 4FG9A 3PZEA 5CVFA 2H34A 1M2QA 2YAKA 3VUDA 3ODYX 4FGRA 2NQ8C 2G9XA 3W8QA 4AA5A 1QYRA 4CFNA 4DBXA 5GIPE 1J7KA 3FAAA 1STCE 4F0GA 2GCDA 4BHNA 3E21A 5KBRA 4YTIA 3EMGA 4EC9A 5CEPA 2V7OA 3COKA 2R4BA 1UM8A 3ZXTA 4RF1A 4ZY4A 1KV2A 2C9OA 4BYJA 3CD8A 1J1BA 1K2PA 3MFSA 2YLFA 1BX6A 2EUCA 4DEEA 5B2LA 4F70A 3TJDA 4ONAA 1NHGC 5B2MA 2OZAB 2C3LA 1YWRA 2CGVA 1L8QA 2JZ1A 1DGHA 2HWPA 2GQFA 2A27A 2X0QA 4O21A 2A4LA 5HVJA 5GZAA 2FH0A 4ITHA 2OH4A 5BVKA 5EP1A 1XXHA 1CMKE 2RIOA 3T9TA 2GNFA 2EJSA 2WQBA 2KRUA 2OFVA 4FG7A 4IX5A 1Z5CA 4YURA 4ZSAA 3FXWA 2WZJA 4JDHA 1R7RA 3V8WA 3K1JA 4L44A 1CM8A 3K2LA 2W1EA 5IH6A 2JXNA 3QTZA 5E8SA 3KXZA 3QQUA 2LH0A 2C0IA 4BDBA 4TZRA 4G9CA 3VQHA 3KRRA 3RTPA 5H8BA 3QA8A 4C7TA 3NUUA 3DTWA 3D7TB 3R8UA 5CI7A 2XKFA 4F64A 2BCJA 4EYMA 3AC8A 5KO1A 4BVUA 3R8MA 2WMAA 4DLJA 2B53A 4JQ7A 1HQCA 2QOHA 3UVPA 2CKQA 5DGZA 1TDHA 5JRSA 2RRUA 3RCDA 4D4SA 4DCAA 3DU8A 1V0PA 3FZRA 4ALWA 1GAGA 4DG0E 1H27A 2JBPA 4W4XA 2OF2A 2GFSA 1BI8A 4GW8A 1FOTA 4KINA 4AW2A 3L9PA 4AKGA 3UIXA 4LFBM 1DGBA 2BJVA 3NSZA 4DH3A 1KE9A 4Z7GA 5C1BA 4FTMA 2WEIA 4JAIA 3PSDA 5AUVA 4K6ZA 2QONA 3HHWA 4XRJA 5CENA 3FUPA 3U60B 2B4SB 2DAIA 4QEBA 2XA4A 3I4BA 3VKHA 4IC7A 2QNJA 1UVRA 4LY6A 4HYUA 3M6AA 4YTCA 3KFAA 3NBXX 3BU5A 3NNWA 5AA9A 1UNGA 5FEQA 4R3RA 2IW6A 4RF0A 4FK6A 4WT6A 4MGZE 3QTRA 1XMOM 4FVPA 4XBRA 5M57A 3K92A 1KSFX 2XSZA 3ALNA 3EFLA 2NP8A 4G5JA 4AACA 2DZOB 1YI3A 2VF7A 1YOLA 2QCUA 1G3IA 4X0MA 5EXXA 3BHHA 3R7UA 2CPKE 3COHA 3PTGA 3QYBA 4JI3M 3U8WA 5D11A 5FTQA 4M0ZA 1UU8A 5TKDA 2XK7A 4GITA 2ZDTA 4CKJA 4F6SA 1W84A 3NUXA 4RIOA 3GCPA 3WF8A 3PWDA 3A2CA 3I6WA 4RVLA 2PMIA 4DH1A 3ZDIA 3FTDA 2YZLA 4O7TA 4GS6A 3IOPA 5EDRA 1HOWA 4DV0M 2IZRA 4D81A 1LUFA 3TM0A 4D1SA 3II5A 4IADA 2IPXA 2UZTA 4G3GA 4HLQA 5IA3A 3PP1A 4WD5A 4XMOA 1IY0A 2X7FA 4M13A 2UW5A 3AG9A 1WVXA 2R7IA 1IAHA 1XBAA 3W2OA 4JDIA 4FUXA 3MPAA 1L2CA 3PY0A 1PM5A 2UUEA 4IAKA 2A5YB 2WTCA 2PVHA 5A14A 4QYHA 3VS1A 3ML1A 4OBQA 4H05A 4N70A 4B3SM 1JSUA 3BBWA 1ZWSA 5M51A 3HLLA 3IW7A 2WXVA 2ZM6M 4EOIA 1M2RA 3B74A 2R44A 3SKCA 4LRSA 5EG3A 3DBEA 3EN5A 3Q32A 4LGDA 3W2PA 3SAYA 4FGBA 3RGPA 3EZVA 3SOAA 3PA4A 4L01A 1BYGA