3IEDA

Crystal structure of n-terminal domain of plasmodium falciparum hsp90 (pf14_0417) in complex with amppn
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
258
structure length
224
Chain Sequence
RENLYFQGSPVEKYNFKAEVNKVMDIIVNSLYTDKDVFLRELISNASDACDKKRIILENNKLIKDAEVNDIKKLIIKIKPDKEKKTLTITDNGIGMDKSELINNLGTIAQSGTAKFLKQIEEGKADSNLIGQFGVGFYSSFLVSNRVEVYTKKEDQIYRWSSDLKGSFSVNEIKKYDQEYIKGSGTKIILHLKEECDEYLEDYKLKELIKKYSEFIKFPIEIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat shock protein
publication title Crystal structure of N-terminal domain of Plasmodium falciparum Hsp90 (PF14_0417) in complex with AMPPN
rcsb
source organism Plasmodium falciparum
molecule tags Chaperone
total genus 66
structure length 224
sequence length 258
ec nomenclature
pdb deposition date 2009-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3iedA00
3MNRP 4XKAA 1YC1A 3U2KA 1UYFA 3OPDA 4I3HA 3EKRA 1A4HA 3U2DA 3PEHA 2K5BA 4LP0A 4XE2A 5IDMA 3T0HA 4E01A 4XITA 2Q2EB 2AKPA 5BODA 4XCLA 2VW5A 1NHHA 2YE7A 4MPEA 1H7UA 3TZ4A 4PL9A 4JASA 3CWVA 2BTZA 4XIPA 2YK9A 2CCUA 2ZKJA 2YE4A 3A0WA 3ZM7A 1Y8NA 1PVGA 2WI5A 4HY6A 4JAUA 4PRXA 3VHDA 5M4EA 2YE9A 2FWYA 1S16A 4Q20A 3HYYA 5F3KA 3K98A 4JQLA 4KP4A 4GT8A 1UYLA 1I5DA 3Q5KA 4L93A 1AM1A 4FCRA 3TZ2A 1Y4SA 4CE1A 4MPNA 5D7CA 2CCSA 2UWDA 4MB9A 3DGEA 4BIUA 4GFNA 5CTXA 5CPHA 3TZ0A 3EHFA 1U0ZA 4XC0A 4ASBA 2YJWA 3RLQA 5F5RA 3A0XA 4NH9A 3K99A 4URNA 1THNA 4O0BA 2YEFA 4FPPA 4KFGA 2PNRA 5CTYA 2YKCA 3TZ5A 4LWGA 4CWTA 1QY8A 2XHXA 2YEIA 3U67A 4HY1A 2YE5A 1Z5AA 1YERA 2XK2A 4LWEA 3RKZA 1UYMA 3OWDA 3ZXOA 2QF6A 5M4PA 3B24A 2FXSA 2XDLA 3HZ5A 1YSZA 4H85A 3O2FA 4HXZA 1KZNA 3QTFA 4B7PA 4EGIA 2IORA 3CGZA 2E0AA 4XKKA 2IWUA 2BREA 2FYPA 1UY7A 1BKNA 4XIQA 4V25A 3TTZA 4YKWA 3T0ZA 2XABA 4X9LA 2XX5A 1AJ6A 2YECA 4P8OA 2ZDYA 4PU9A 3EHHA 1YT2A 2YEBA 5D7RA 2BU6A 4K4OA 3LNUA 4V26A 3VADA 3ZKDA 2YEAA 1UY8A 4LWHA 4FCPA 1EI1A 1TBWA 2WEPA 4CE2A 2HG1A 2FWZA 4CWSA 2JJCA 2YE2A 3O0IA 3A0YA 3BM9A 5D6QA 2Q8FA 4YKQA 4AS9A 1OSFA 4O05A 4AWPA 1TILA 4CE3A 1QZRA 1UYIA 2IWXA 2BT0A 4QPKA 4PRVA 2YEHA 5C93A 5M4KA 4BIZA 4L90A 1R62A 1Z59A 4EM7A 4O04A 4URMA 2XDKA 4XKOA 2WI6A 3NMQA 3GIGB 3R4NA 2O1WA 4CWNA 4JAVA 4EFUA 3IEDA 3EHJA 5D7DA 3JZ3A 3T1KA 1JM6A 2XJGA 3G7BA 3C0EA 3INXA 2ESAA 1YC4A 2YGAA 2WI7A 4H7QA 4EMVA 1B3QA 4GGLA 1ZXNA 3SL2A 2XCMA 5GGZA 1EA6A 4HYPA 2XHTA 5CTWA 4HYMA 4EFTA 2YEEA 2XHRA 2YEGA 4XIRA 1BGQA 4CWOA 3RLRA 3WQ9A 1YC3A 2BU5A 2JKIA 5BOCA 4ZVIA 1Z5CA 3HHUA 5FNDA 1GJVA 3INWA 1YESA 1YS3A 4YKRA 2BYIA 4EGKA 4YKYA 5IDJA 2C2AA 4FCQA 2XJJA 4YKTA 2GFDA 4L94A 1TC0A 3B25A 3Q5JA 4XCJA 2WI2A 1UYCA 1UYGA 4WUCA 4MBCA 4AWQA 4KSHA 2Q8GA 1UY6A 2BSMA 5D6PA 2YGEA 3T2SA 4YKZA 3HYZA 5IN9A 1S14A 2CCTA 4KQVA 3ZKBA 3EHGA 3R4MA 2IOPA 2YE8A 4MP2A 1QYEA 4XDMA 2XX4A 2H55A 4R1FA 4XD8A 4YKXA 2HCHA 3VHAA 1BYQA 2YE6A 4U7OA 4CWRA 3OW6A 1L0OA 2H8MA 4E02A 1UYEA 3KE6A 2YK2A 1UYHA 4MOTA 3B27A 2WERA 2YE3A 3K60A 3FT5A 4H81A 1TC6A 4NH7A 1I59A 1YT0A 1GKZA 1AMWA 2BU2A 3D2RA 1I5AA 3H80A 1I58A 3CGYA 4U7NA 1NHIA 3CRLA 4GEEA 3RLPA 3B26A 2CGFA 3R91A 3G7EA 5FWKA 3CRKA 4MP7A 2YKEA 2GQPA 4ZKIA 4O07A 2XJXA 4KSGA 1UYKA 2EXLA 2ZBKB 4GCZA 3A0ZA 4BQGA 2O1UA 3H4LA 2IOQA 1UYDA 1YT1A 4UROA 5M4NA 1AH6A 1UY9A 1NHJA 3R4PA 1MU5A 3GIFA 4HZ0A 4LWIA 5M4HA 1ZXMA 3OWBA 3HZ1A 3R92A 4HXWA 4R3AA 1I5CA 2XX2A 2YEDA 3B28A 2XDSA 1TIDA 4AWOA 3ZXQA 3K97A 4WUDA 1MX0A 2ZDXA 3EKOA 4L8ZA 1BXDA 3R4OA 4I5SA 5FNCA 2YKJA 5M4MA 2IWSA 2YKIA 4L91A 4U93A 4FMTA 4B6CA 4E00A 2VWCA 2WI4A 1YSRA 2YI7A 4XTJA 4EEHA 4CWFA 4O09A 3D36A 3GIGA 2HKJA 3VHCA 2XDUA 1YETA 4BXIA 3FV5A 3O6OA 4DUHA 4YKUA 3PEJA 5FNFA 2XD6A 1ZW9A 4DZYA 5J6AA 2YI5A 1B62A 2QFOA 2YKBA 3WHAA 3TUHA 1ID0A 4ASFA 4NH8A 2QG2A 4KTNA 4P7AA 1GKXA 4ASAA 2BRCA 4CWPA 2O1VA 2VCIA 4BAEA 5CF0A 3D0BA 3Q5LA 1Y8PA 2YJXA 4R3MA 3A0TA 2YI0A 4HZ5A 5J71A 3GIEA 1B63A 4W7TA 2Q8HA 4URLA 2YGFA 4CWQA 2YEJA 3A0RA 4QPJA 4LPBA 1TH8A 1Y8OA 1Y4UA 5L3JA 2QG0A 2CG9A 3T10A 3QDDA 3BMYA 1US7A 4GQTA 2BZ5A 5CTUA 2BYHA 3G75A 2XDXA 2WI3A 1AH8A 4ASGA 2Q8IA 2YI6A 4WUBA 1Z5BA 2CH4A 3C11A 3LPSA 3OMUA 4EGHA 3FT8A 4MPCA 2WI1A 1KIJA 1I5BA 2VCJA 2WEQA 1U2OA 4LWFA 4BQJA 3HEKA 1H7SA 2BU8A 1ZWHA 2BU7A
chains in the Genus database with same CATH superfamily
3MNRP 4XKAA 1YC1A 3U2KA 1UYFA 3OPDA 4I3HA 3EKRA 1A4HA 3U2DA 3PEHA 2K5BA 4LP0A 4XE2A 5IDMA 3T0HA 4E01A 4XITA 2Q2EB 2AKPA 5BODA 4XCLA 2VW5A 1NHHA 2YE7A 4MPEA 1H7UA 3TZ4A 4PL9A 4JASA 3CWVA 2BTZA 4XIPA 2YK9A 2CCUA 2ZKJA 2YE4A 3A0WA 3ZM7A 1Y8NA 1PVGA 2WI5A 4HY6A 4JAUA 4PRXA 3VHDA 5M4EA 2YE9A 2FWYA 1S16A 4Q20A 3HYYA 5F3KA 3K98A 4JQLA 4KP4A 4GT8A 1UYLA 1I5DA 3Q5KA 4L93A 1AM1A 4FCRA 3TZ2A 1Y4SA 4CE1A 4MPNA 5D7CA 2CCSA 2UWDA 4MB9A 3DGEA 4BIUA 4GFNA 3S5TA 5CTXA 5CPHA 3TZ0A 3EHFA 1U0ZA 4XC0A 4ASBA 2YJWA 3RLQA 5F5RA 3A0XA 4NH9A 3K99A 4URNA 1THNA 4O0BA 2YEFA 4FPPA 4KFGA 2PNRA 5CTYA 2YKCA 3TZ5A 4LWGA 4CWTA 1QY8A 2XHXA 2YEIA 3U67A 4HY1A 2YE5A 1Z5AA 1YERA 2XK2A 4LWEA 3RKZA 1UYMA 3OWDA 3ZXOA 2QF6A 5M4PA 3B24A 2FXSA 2XDLA 3HZ5A 1YSZA 4H85A 3O2FA 4HXZA 1KZNA 3QTFA 4B7PA 4EGIA 2IORA 3CGZA 2E0AA 4XKKA 2IWUA 2BREA 2FYPA 1UY7A 1BKNA 4XIQA 4V25A 3TTZA 4YKWA 3T0ZA 2XABA 4X9LA 2XX5A 1AJ6A 2YECA 4P8OA 2ZDYA 4PU9A 3EHHA 1YT2A 2YEBA 5D7RA 2BU6A 4K4OA 3LNUA 4V26A 3VADA 3ZKDA 2YEAA 1UY8A 4LWHA 4FCPA 1EI1A 1TBWA 2WEPA 4CE2A 2HG1A 2FWZA 4CWSA 2JJCA 2YE2A 3O0IA 3A0YA 3BM9A 5D6QA 2Q8FA 4YKQA 4AS9A 1OSFA 4O05A 4AWPA 1TILA 4CE3A 1QZRA 1UYIA 2IWXA 2BT0A 4QPKA 4PRVA 2YEHA 5C93A 5M4KA 4BIZA 4L90A 1R62A 1Z59A 4EM7A 4O04A 4URMA 2XDKA 4XKOA 2WI6A 3NMQA 3GIGB 3R4NA 2O1WA 2HHIA 4CWNA 4JAVA 4EFUA 3IEDA 3EHJA 5D7DA 3JZ3A 3T1KA 1JM6A 2XJGA 3G7BA 3C0EA 3INXA 2ESAA 1YC4A 2YGAA 2WI7A 4H7QA 4EMVA 1B3QA 4GGLA 1ZXNA 3SL2A 2XCMA 5GGZA 1EA6A 4HYPA 2XHTA 5CTWA 4HYMA 4EFTA 2C1GA 2XHRA 2YEEA 2YEGA 4XIRA 1BGQA 4CWOA 3RLRA 3WQ9A 1YC3A 2BU5A 2JKIA 5BOCA 4ZVIA 1Z5CA 3HHUA 5FNDA 1GJVA 3INWA 1YESA 1YS3A 4YKRA 2BYIA 4EGKA 4YKYA 5IDJA 2C2AA 4FCQA 2XJJA 4YKTA 2GFDA 4L94A 1TC0A 3B25A 3Q5JA 4XCJA 1IXMA 2WI2A 1UYCA 1UYGA 4WUCA 4MBCA 4AWQA 4KSHA 2Q8GA 1UY6A 2BSMA 5D6PA 2YGEA 3T2SA 4YKZA 3CYGA 3HYZA 5IN9A 1S14A 2CCTA 4KQVA 3ZKBA 3EHGA 3R4MA 2IOPA 2YE8A 4MP2A 1QYEA 4XDMA 2XX4A 2H55A 4R1FA 4XD8A 4YKXA 2HCHA 3VHAA 1BYQA 2YE6A 4U7OA 4CWRA 3OW6A 1L0OA 2H8MA 4E02A 1UYEA 3KE6A 2YK2A 1UYHA 4MOTA 3B27A 2WERA 2YE3A 3K60A 3FT5A 4H81A 1TC6A 4NH7A 1I59A 1YT0A 1GKZA 1AMWA 2BU2A 3D2RA 1I5AA 3H80A 1I58A 3CGYA 4U7NA 1NHIA 3CRLA 4GEEA 3RLPA 3B26A 2CGFA 3R91A 3G7EA 5FWKA 3CRKA 4MP7A 2YKEA 2GQPA 4ZKIA 4O07A 2XJXA 4KSGA 1UYKA 2EXLA 2ZBKB 4GCZA 3A0ZA 4BQGA 2O1UA 2C1IA 2IOQA 3H4LA 1UYDA 1YT1A 5JENA 4UROA 5M4NA 1AH6A 1UY9A 1NHJA 3R4PA 1MU5A 3GIFA 4HZ0A 4LWIA 5M4HA 1ZXMA 3OWBA 3HZ1A 3R92A 4HXWA 4R3AA 1I5CA 2XX2A 2YEDA 3B28A 2XDSA 1TIDA 4AWOA 3ZXQA 3K97A 4WUDA 1MX0A 2ZDXA 3EKOA 4L8ZA 1BXDA 3R4OA 4I5SA 5FNCA 2YKJA 5M4MA 2IWSA 2YKIA 4L91A 4U93A 4FMTA 4B6CA 4E00A 2VWCA 2WI4A 1F51A 1YSRA 2YI7A 4XTJA 4EEHA 4CWFA 4O09A 3D36A 3GIGA 2HKJA 3VHCA 2XDUA 1YETA 4BXIA 3FV5A 3O6OA 4DUHA 4YKUA 3PEJA 5FNFA 2XD6A 1ZW9A 4DZYA 5J6AA 2YI5A 1B62A 2QFOA 2YKBA 3WHAA 3TUHA 1ID0A 4ASFA 4NH8A 2QG2A 4KTNA 4P7AA 1GKXA 4ASAA 2BRCA 4CWPA 2O1VA 2VCIA 4BAEA 5CF0A 3D0BA 3Q5LA 1Y8PA 2YJXA 4R3MA 3LMMA 3A0TA 2YI0A 4HZ5A 5J71A 3GIEA 1B63A 4W7TA 2Q8HA 4URLA 2YGFA 4CWQA 2YEJA 3A0RA 4QPJA 4LPBA 1TH8A 1Y8OA 1Y4UA 5L3JA 2QG0A 2CG9A 3T10A 3QDDA 3BMYA 1US7A 4GQTA 2BZ5A 5CTUA 2BYHA 3G75A 2XDXA 2WI3A 1AH8A 4ASGA 2Q8IA 2YI6A 4WUBA 1Z5BA 2CH4A 3C11A 3LPSA 3OMUA 4EGHA 3FT8A 4MPCA 2WI1A 1KIJA 1I5BA 2VCJA 2WEQA 1U2OA 4E72A 4LWFA 4BQJA 2FTKA 3HEKA 1H7SA 2BU8A 1ZWHA 2BU7A
chains in the Genus database with same CATH topology
3MNRP 4XKAA 1YC1A 3U2KA 1UYFA 3OPDA 4I3HA 3EKRA 1A4HA 3U2DA 3PEHA 2K5BA 4LP0A 4XE2A 5IDMA 3T0HA 4E01A 4XITA 2Q2EB 2AKPA 5BODA 4XCLA 2VW5A 1NHHA 2YE7A 4MPEA 1H7UA 3TZ4A 4PL9A 4JASA 3CWVA 2BTZA 4XIPA 2YK9A 2CCUA 2ZKJA 2YE4A 3A0WA 3ZM7A 1Y8NA 1PVGA 2WI5A 4HY6A 4JAUA 4PRXA 3VHDA 5M4EA 2YE9A 2FWYA 1S16A 4Q20A 3HYYA 5F3KA 3K98A 4JQLA 4KP4A 4GT8A 1UYLA 1I5DA 3Q5KA 4L93A 1AM1A 4FCRA 3TZ2A 1Y4SA 4CE1A 4MPNA 5D7CA 2CCSA 2UWDA 4MB9A 3DGEA 4BIUA 4GFNA 5CTXA 5CPHA 3TZ0A 3EHFA 1U0ZA 4XC0A 4ASBA 2YJWA 3RLQA 5F5RA 3A0XA 4NH9A 3K99A 4URNA 1THNA 4O0BA 2YEFA 4FPPA 4KFGA 2PNRA 5CTYA 2YKCA 3TZ5A 4LWGA 4CWTA 1QY8A 2XHXA 2YEIA 3U67A 4HY1A 2YE5A 1Z5AA 1YERA 2XK2A 4LWEA 3RKZA 1UYMA 3OWDA 3ZXOA 2QF6A 5M4PA 3B24A 2FXSA 2XDLA 3HZ5A 1YSZA 4H85A 3O2FA 4HXZA 1KZNA 3QTFA 4B7PA 4EGIA 2IORA 3CGZA 2E0AA 4XKKA 2IWUA 2BREA 2FYPA 1UY7A 1BKNA 4XIQA 4V25A 3TTZA 4YKWA 3T0ZA 2XABA 4X9LA 2XX5A 1AJ6A 2YECA 4P8OA 2ZDYA 4PU9A 3EHHA 1YT2A 2YEBA 5D7RA 2BU6A 4K4OA 3LNUA 4V26A 3VADA 3ZKDA 2YEAA 1UY8A 4LWHA 4FCPA 1EI1A 1TBWA 2WEPA 4CE2A 2HG1A 2FWZA 4CWSA 2JJCA 2YE2A 3O0IA 3A0YA 3BM9A 5D6QA 2Q8FA 4YKQA 4AS9A 1OSFA 4O05A 4AWPA 1TILA 4CE3A 1QZRA 1UYIA 2IWXA 2BT0A 4QPKA 4PRVA 2YEHA 5C93A 5M4KA 4BIZA 4L90A 1R62A 1Z59A 4EM7A 4O04A 4URMA 2XDKA 4XKOA 2WI6A 3NMQA 3GIGB 3R4NA 2O1WA 4CWNA 4JAVA 4EFUA 3IEDA 3EHJA 5D7DA 3JZ3A 3T1KA 1JM6A 2XJGA 3G7BA 3C0EA 3INXA 2ESAA 1YC4A 2YGAA 2WI7A 4H7QA 4EMVA 1B3QA 4GGLA 1ZXNA 3SL2A 2XCMA 5GGZA 1EA6A 4HYPA 2XHTA 5CTWA 4HYMA 4EFTA 2YEEA 2XHRA 2YEGA 4XIRA 1BGQA 4CWOA 3RLRA 3WQ9A 1YC3A 2BU5A 2JKIA 5BOCA 4ZVIA 1Z5CA 3HHUA 5FNDA 1GJVA 3INWA 1YESA 1YS3A 4YKRA 2BYIA 4EGKA 4YKYA 5IDJA 2C2AA 4FCQA 2XJJA 4YKTA 2GFDA 4L94A 1TC0A 3B25A 3Q5JA 4XCJA 2WI2A 1UYCA 1UYGA 4WUCA 4MBCA 4AWQA 4KSHA 2Q8GA 1UY6A 2BSMA 5D6PA 2YGEA 3T2SA 4YKZA 3HYZA 5IN9A 1S14A 2CCTA 4KQVA 3ZKBA 3EHGA 3R4MA 2IOPA 2YE8A 4MP2A 1QYEA 4XDMA 2XX4A 2H55A 4R1FA 4XD8A 4YKXA 2HCHA 3VHAA 1BYQA 2YE6A 4U7OA 4CWRA 3OW6A 1L0OA 2H8MA 4E02A 1UYEA 3KE6A 2YK2A 1UYHA 4MOTA 3B27A 2WERA 2YE3A 3K60A 3FT5A 4H81A 1TC6A 4NH7A 1I59A 1YT0A 1GKZA 1AMWA 2BU2A 3D2RA 1I5AA 3H80A 1I58A 3CGYA 4U7NA 1NHIA 3CRLA 4GEEA 3RLPA 3B26A 2CGFA 3R91A 3G7EA 5FWKA 3CRKA 4MP7A 2YKEA 2GQPA 4ZKIA 4O07A 2XJXA 4KSGA 1UYKA 2EXLA 2ZBKB 4GCZA 3A0ZA 4BQGA 2O1UA 3H4LA 2IOQA 1UYDA 1YT1A 4UROA 5M4NA 1AH6A 1UY9A 1NHJA 3R4PA 1MU5A 3GIFA 4HZ0A 4LWIA 5M4HA 1ZXMA 3OWBA 3HZ1A 3R92A 4HXWA 4R3AA 1I5CA 2XX2A 2YEDA 3B28A 2XDSA 1TIDA 4AWOA 3ZXQA 3K97A 4WUDA 1MX0A 2ZDXA 3EKOA 4L8ZA 1BXDA 3R4OA 4I5SA 5FNCA 2YKJA 5M4MA 2IWSA 2YKIA 4L91A 4U93A 4FMTA 4B6CA 4E00A 2VWCA 2WI4A 1YSRA 2YI7A 4XTJA 4EEHA 4CWFA 4O09A 3D36A 3GIGA 2HKJA 3VHCA 2XDUA 1YETA 4BXIA 3FV5A 3O6OA 4DUHA 4YKUA 3PEJA 5FNFA 2XD6A 1ZW9A 4DZYA 5J6AA 2YI5A 1B62A 2QFOA 2YKBA 3WHAA 3TUHA 1ID0A 4ASFA 4NH8A 2QG2A 4KTNA 4P7AA 1GKXA 4ASAA 2BRCA 4CWPA 2O1VA 2VCIA 4BAEA 5CF0A 3D0BA 3Q5LA 1Y8PA 2YJXA 4R3MA 3A0TA 2YI0A 4HZ5A 5J71A 3GIEA 1B63A 4W7TA 2Q8HA 4URLA 2YGFA 4CWQA 2YEJA 3A0RA 4QPJA 4LPBA 1TH8A 1Y8OA 1Y4UA 5L3JA 2QG0A 2CG9A 3T10A 3QDDA 3BMYA 1US7A 4GQTA 2BZ5A 5CTUA 2BYHA 3G75A 2XDXA 2WI3A 1AH8A 4ASGA 2Q8IA 2YI6A 4WUBA 1Z5BA 2CH4A 3C11A 3LPSA 3OMUA 4EGHA 3FT8A 4MPCA 2WI1A 1KIJA 1I5BA 2VCJA 2WEQA 1U2OA 4LWFA 4BQJA 3HEKA 1H7SA 2BU8A 1ZWHA 2BU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MNR P;  4XKA A;  1YC1 A;  3U2K A;  1UYF A;  3OPD A;  4I3H A;  3EKR A;  1A4H A;  3U2D A;  3PEH A;  2K5B A;  4LP0 A;  4XE2 A;  5IDM A;  3T0H A;  4E01 A;  4XIT A;  2Q2E B;  2AKP A;  5BOD A;  4XCL A;  2VW5 A;  1NHH A;  2YE7 A;  4MPE A;  1H7U A;  3TZ4 A;  4PL9 A;  4JAS A;  3CWV A;  2BTZ A;  4XIP A;  2YK9 A;  2CCU A;  2ZKJ A;  2YE4 A;  3A0W A;  3ZM7 A;  1Y8N A;  1PVG A;  2WI5 A;  4HY6 A;  4JAU A;  4PRX A;  3VHD A;  5M4E A;  2YE9 A;  2FWY A;  1S16 A;  4Q20 A;  3HYY A;  5F3K A;  3K98 A;  4JQL A;  4KP4 A;  4GT8 A;  1UYL A;  1I5D A;  3Q5K A;  4L93 A;  1AM1 A;  4FCR A;  3TZ2 A;  1Y4S A;  4CE1 A;  4MPN A;  5D7C A;  2CCS A;  2UWD A;  4MB9 A;  3DGE A;  4BIU A;  4GFN A;  5CTX A;  5CPH A;  3TZ0 A;  3EHF A;  1U0Z A;  4XC0 A;  4ASB A;  2YJW A;  3RLQ A;  5F5R A;  3A0X A;  4NH9 A;  3K99 A;  4URN A;  1THN A;  4O0B A;  2YEF A;  4FPP A;  4KFG A;  2PNR A;  5CTY A;  2YKC A;  3TZ5 A;  4LWG A;  4CWT A;  1QY8 A;  2XHX A;  2YEI A;  3U67 A;  4HY1 A;  2YE5 A;  1Z5A A;  1YER A;  2XK2 A;  4LWE A;  3RKZ A;  1UYM A;  3OWD A;  3ZXO A;  2QF6 A;  5M4P A;  3B24 A;  2FXS A;  2XDL A;  3HZ5 A;  1YSZ A;  4H85 A;  3O2F A;  4HXZ A;  1KZN A;  3QTF A;  4B7P A;  4EGI A;  2IOR A;  3CGZ A;  2E0A A;  4XKK A;  2IWU A;  2BRE A;  2FYP A;  1UY7 A;  1BKN A;  4XIQ A;  4V25 A;  3TTZ A;  4YKW A;  3T0Z A;  2XAB A;  4X9L A;  2XX5 A;  1AJ6 A;  2YEC A;  4P8O A;  2ZDY A;  4PU9 A;  3EHH A;  1YT2 A;  2YEB A;  5D7R A;  2BU6 A;  4K4O A;  3LNU A;  4V26 A;  3VAD A;  3ZKD A;  2YEA A;  1UY8 A;  4LWH A;  4FCP A;  1EI1 A;  1TBW A;  2WEP A;  4CE2 A;  2HG1 A;  2FWZ A;  4CWS A;  2JJC A;  2YE2 A;  3O0I A;  3A0Y A;  3BM9 A;  5D6Q A;  2Q8F A;  4YKQ A;  4AS9 A;  1OSF A;  4O05 A;  4AWP A;  1TIL A;  4CE3 A;  1QZR A;  1UYI A;  2IWX A;  2BT0 A;  4QPK A;  4PRV A;  2YEH A;  5C93 A;  5M4K A;  4BIZ A;  4L90 A;  1R62 A;  1Z59 A;  4EM7 A;  4O04 A;  4URM A;  2XDK A;  4XKO A;  2WI6 A;  3NMQ A;  3GIG B;  3R4N A;  2O1W A;  4CWN A;  4JAV A;  4EFU A;  3IED A;  3EHJ A;  5D7D A;  3JZ3 A;  3T1K A;  1JM6 A;  2XJG A;  3G7B A;  3C0E A;  3INX A;  2ESA A;  1YC4 A;  2YGA A;  2WI7 A;  4H7Q A;  4EMV A;  1B3Q A;  4GGL A;  1ZXN A;  3SL2 A;  2XCM A;  5GGZ A;  1EA6 A;  4HYP A;  2XHT A;  5CTW A;  4HYM A;  4EFT A;  2YEE A;  2XHR A;  2YEG A;  4XIR A;  1BGQ A;  4CWO A;  3RLR A;  3WQ9 A;  1YC3 A;  2BU5 A;  2JKI A;  5BOC A;  4ZVI A;  1Z5C A;  3HHU A;  5FND A;  1GJV A;  3INW A;  1YES A;  1YS3 A;  4YKR A;  2BYI A;  4EGK A;  4YKY A;  5IDJ A;  2C2A A;  4FCQ A;  2XJJ A;  4YKT A;  2GFD A;  4L94 A;  1TC0 A;  3B25 A;  3Q5J A;  4XCJ A;  2WI2 A;  1UYC A;  1UYG A;  4WUC A;  4MBC A;  4AWQ A;  4KSH A;  2Q8G A;  1UY6 A;  2BSM A;  5D6P A;  2YGE A;  3T2S A;  4YKZ A;  3HYZ A;  5IN9 A;  1S14 A;  2CCT A;  4KQV A;  3ZKB A;  3EHG A;  3R4M A;  2IOP A;  2YE8 A;  4MP2 A;  1QYE A;  4XDM A;  2XX4 A;  2H55 A;  4R1F A;  4XD8 A;  4YKX A;  2HCH A;  3VHA A;  1BYQ A;  2YE6 A;  4U7O A;  4CWR A;  3OW6 A;  1L0O A;  2H8M A;  4E02 A;  1UYE A;  3KE6 A;  2YK2 A;  1UYH A;  4MOT A;  3B27 A;  2WER A;  2YE3 A;  3K60 A;  3FT5 A;  4H81 A;  1TC6 A;  4NH7 A;  1I59 A;  1YT0 A;  1GKZ A;  1AMW A;  2BU2 A;  3D2R A;  1I5A A;  3H80 A;  1I58 A;  3CGY A;  4U7N A;  1NHI A;  3CRL A;  4GEE A;  3RLP A;  3B26 A;  2CGF A;  3R91 A;  3G7E A;  5FWK A;  3CRK A;  4MP7 A;  2YKE A;  2GQP A;  4ZKI A;  4O07 A;  2XJX A;  4KSG A;  1UYK A;  2EXL A;  2ZBK B;  4GCZ A;  3A0Z A;  4BQG A;  2O1U A;  3H4L A;  2IOQ A;  1UYD A;  1YT1 A;  4URO A;  5M4N A;  1AH6 A;  1UY9 A;  1NHJ A;  3R4P A;  1MU5 A;  3GIF A;  4HZ0 A;  4LWI A;  5M4H A;  1ZXM A;  3OWB A;  3HZ1 A;  3R92 A;  4HXW A;  4R3A A;  1I5C A;  2XX2 A;  2YED A;  3B28 A;  2XDS A;  1TID A;  4AWO A;  3ZXQ A;  3K97 A;  4WUD A;  1MX0 A;  2ZDX A;  3EKO A;  4L8Z A;  1BXD A;  3R4O A;  4I5S A;  5FNC A;  2YKJ A;  5M4M A;  2IWS A;  2YKI A;  4L91 A;  4U93 A;  4FMT A;  4B6C A;  4E00 A;  2VWC A;  2WI4 A;  1YSR A;  2YI7 A;  4XTJ A;  4EEH A;  4CWF A;  4O09 A;  3D36 A;  3GIG A;  2HKJ A;  3VHC A;  2XDU A;  1YET A;  4BXI A;  3FV5 A;  3O6O A;  4DUH A;  4YKU A;  3PEJ A;  5FNF A;  2XD6 A;  1ZW9 A;  4DZY A;  5J6A A;  2YI5 A;  1B62 A;  2QFO A;  2YKB A;  3WHA A;  3TUH A;  1ID0 A;  4ASF A;  4NH8 A;  2QG2 A;  4KTN A;  4P7A A;  1GKX A;  4ASA A;  2BRC A;  4CWP A;  2O1V A;  2VCI A;  4BAE A;  5CF0 A;  3D0B A;  3Q5L A;  1Y8P A;  2YJX A;  4R3M A;  3A0T A;  2YI0 A;  4HZ5 A;  5J71 A;  3GIE A;  1B63 A;  4W7T A;  2Q8H A;  4URL A;  2YGF A;  4CWQ A;  2YEJ A;  3A0R A;  4QPJ A;  4LPB A;  1TH8 A;  1Y8O A;  1Y4U A;  5L3J A;  2QG0 A;  2CG9 A;  3T10 A;  3QDD A;  3BMY A;  1US7 A;  4GQT A;  2BZ5 A;  5CTU A;  2BYH A;  3G75 A;  2XDX A;  2WI3 A;  1AH8 A;  4ASG A;  2Q8I A;  2YI6 A;  4WUB A;  1Z5B A;  2CH4 A;  3C11 A;  3LPS A;  3OMU A;  4EGH A;  3FT8 A;  4MPC A;  2WI1 A;  1KIJ A;  1I5B A;  2VCJ A;  2WEQ A;  1U2O A;  4LWF A;  4BQJ A;  3HEK A;  1H7S A;  2BU8 A;  1ZWH A;  2BU7 A; 
#chains in the Genus database with same CATH topology
 3MNR P;  4XKA A;  1YC1 A;  3U2K A;  1UYF A;  3OPD A;  4I3H A;  3EKR A;  1A4H A;  3U2D A;  3PEH A;  2K5B A;  4LP0 A;  4XE2 A;  5IDM A;  3T0H A;  4E01 A;  4XIT A;  2Q2E B;  2AKP A;  5BOD A;  4XCL A;  2VW5 A;  1NHH A;  2YE7 A;  4MPE A;  1H7U A;  3TZ4 A;  4PL9 A;  4JAS A;  3CWV A;  2BTZ A;  4XIP A;  2YK9 A;  2CCU A;  2ZKJ A;  2YE4 A;  3A0W A;  3ZM7 A;  1Y8N A;  1PVG A;  2WI5 A;  4HY6 A;  4JAU A;  4PRX A;  3VHD A;  5M4E A;  2YE9 A;  2FWY A;  1S16 A;  4Q20 A;  3HYY A;  5F3K A;  3K98 A;  4JQL A;  4KP4 A;  4GT8 A;  1UYL A;  1I5D A;  3Q5K A;  4L93 A;  1AM1 A;  4FCR A;  3TZ2 A;  1Y4S A;  4CE1 A;  4MPN A;  5D7C A;  2CCS A;  2UWD A;  4MB9 A;  3DGE A;  4BIU A;  4GFN A;  3S5T A;  5CTX A;  5CPH A;  3TZ0 A;  3EHF A;  1U0Z A;  4XC0 A;  4ASB A;  2YJW A;  3RLQ A;  5F5R A;  3A0X A;  4NH9 A;  3K99 A;  4URN A;  1THN A;  4O0B A;  2YEF A;  4FPP A;  4KFG A;  2PNR A;  5CTY A;  2YKC A;  3TZ5 A;  4LWG A;  4CWT A;  1QY8 A;  2XHX A;  2YEI A;  3U67 A;  4HY1 A;  2YE5 A;  1Z5A A;  1YER A;  2XK2 A;  4LWE A;  3RKZ A;  1UYM A;  3OWD A;  3ZXO A;  2QF6 A;  5M4P A;  3B24 A;  2FXS A;  2XDL A;  3HZ5 A;  1YSZ A;  4H85 A;  3O2F A;  4HXZ A;  1KZN A;  3QTF A;  4B7P A;  4EGI A;  2IOR A;  3CGZ A;  2E0A A;  4XKK A;  2IWU A;  2BRE A;  2FYP A;  1UY7 A;  1BKN A;  4XIQ A;  4V25 A;  3TTZ A;  4YKW A;  3T0Z A;  2XAB A;  4X9L A;  2XX5 A;  1AJ6 A;  2YEC A;  4P8O A;  2ZDY A;  4PU9 A;  3EHH A;  1YT2 A;  2YEB A;  5D7R A;  2BU6 A;  4K4O A;  3LNU A;  4V26 A;  3VAD A;  3ZKD A;  2YEA A;  1UY8 A;  4LWH A;  4FCP A;  1EI1 A;  1TBW A;  2WEP A;  4CE2 A;  2HG1 A;  2FWZ A;  4CWS A;  2JJC A;  2YE2 A;  3O0I A;  3A0Y A;  3BM9 A;  5D6Q A;  2Q8F A;  4YKQ A;  4AS9 A;  1OSF A;  4O05 A;  4AWP A;  1TIL A;  4CE3 A;  1QZR A;  1UYI A;  2IWX A;  2BT0 A;  4QPK A;  4PRV A;  2YEH A;  5C93 A;  5M4K A;  4BIZ A;  4L90 A;  1R62 A;  1Z59 A;  4EM7 A;  4O04 A;  4URM A;  2XDK A;  4XKO A;  2WI6 A;  3NMQ A;  3GIG B;  3R4N A;  2O1W A;  2HHI A;  4CWN A;  4JAV A;  4EFU A;  3IED A;  3EHJ A;  5D7D A;  3JZ3 A;  3T1K A;  1JM6 A;  2XJG A;  3G7B A;  3C0E A;  3INX A;  2ESA A;  1YC4 A;  2YGA A;  2WI7 A;  4H7Q A;  4EMV A;  1B3Q A;  4GGL A;  1ZXN A;  3SL2 A;  2XCM A;  5GGZ A;  1EA6 A;  4HYP A;  2XHT A;  5CTW A;  4HYM A;  4EFT A;  2C1G A;  2XHR A;  2YEE A;  2YEG A;  4XIR A;  1BGQ A;  4CWO A;  3RLR A;  3WQ9 A;  1YC3 A;  2BU5 A;  2JKI A;  5BOC A;  4ZVI A;  1Z5C A;  3HHU A;  5FND A;  1GJV A;  3INW A;  1YES A;  1YS3 A;  4YKR A;  2BYI A;  4EGK A;  4YKY A;  5IDJ A;  2C2A A;  4FCQ A;  2XJJ A;  4YKT A;  2GFD A;  4L94 A;  1TC0 A;  3B25 A;  3Q5J A;  4XCJ A;  1IXM A;  2WI2 A;  1UYC A;  1UYG A;  4WUC A;  4MBC A;  4AWQ A;  4KSH A;  2Q8G A;  1UY6 A;  2BSM A;  5D6P A;  2YGE A;  3T2S A;  4YKZ A;  3CYG A;  3HYZ A;  5IN9 A;  1S14 A;  2CCT A;  4KQV A;  3ZKB A;  3EHG A;  3R4M A;  2IOP A;  2YE8 A;  4MP2 A;  1QYE A;  4XDM A;  2XX4 A;  2H55 A;  4R1F A;  4XD8 A;  4YKX A;  2HCH A;  3VHA A;  1BYQ A;  2YE6 A;  4U7O A;  4CWR A;  3OW6 A;  1L0O A;  2H8M A;  4E02 A;  1UYE A;  3KE6 A;  2YK2 A;  1UYH A;  4MOT A;  3B27 A;  2WER A;  2YE3 A;  3K60 A;  3FT5 A;  4H81 A;  1TC6 A;  4NH7 A;  1I59 A;  1YT0 A;  1GKZ A;  1AMW A;  2BU2 A;  3D2R A;  1I5A A;  3H80 A;  1I58 A;  3CGY A;  4U7N A;  1NHI A;  3CRL A;  4GEE A;  3RLP A;  3B26 A;  2CGF A;  3R91 A;  3G7E A;  5FWK A;  3CRK A;  4MP7 A;  2YKE A;  2GQP A;  4ZKI A;  4O07 A;  2XJX A;  4KSG A;  1UYK A;  2EXL A;  2ZBK B;  4GCZ A;  3A0Z A;  4BQG A;  2O1U A;  2C1I A;  2IOQ A;  3H4L A;  1UYD A;  1YT1 A;  5JEN A;  4URO A;  5M4N A;  1AH6 A;  1UY9 A;  1NHJ A;  3R4P A;  1MU5 A;  3GIF A;  4HZ0 A;  4LWI A;  5M4H A;  1ZXM A;  3OWB A;  3HZ1 A;  3R92 A;  4HXW A;  4R3A A;  1I5C A;  2XX2 A;  2YED A;  3B28 A;  2XDS A;  1TID A;  4AWO A;  3ZXQ A;  3K97 A;  4WUD A;  1MX0 A;  2ZDX A;  3EKO A;  4L8Z A;  1BXD A;  3R4O A;  4I5S A;  5FNC A;  2YKJ A;  5M4M A;  2IWS A;  2YKI A;  4L91 A;  4U93 A;  4FMT A;  4B6C A;  4E00 A;  2VWC A;  2WI4 A;  1F51 A;  1YSR A;  2YI7 A;  4XTJ A;  4EEH A;  4CWF A;  4O09 A;  3D36 A;  3GIG A;  2HKJ A;  3VHC A;  2XDU A;  1YET A;  4BXI A;  3FV5 A;  3O6O A;  4DUH A;  4YKU A;  3PEJ A;  5FNF A;  2XD6 A;  1ZW9 A;  4DZY A;  5J6A A;  2YI5 A;  1B62 A;  2QFO A;  2YKB A;  3WHA A;  3TUH A;  1ID0 A;  4ASF A;  4NH8 A;  2QG2 A;  4KTN A;  4P7A A;  1GKX A;  4ASA A;  2BRC A;  4CWP A;  2O1V A;  2VCI A;  4BAE A;  5CF0 A;  3D0B A;  3Q5L A;  1Y8P A;  2YJX A;  4R3M A;  3LMM A;  3A0T A;  2YI0 A;  4HZ5 A;  5J71 A;  3GIE A;  1B63 A;  4W7T A;  2Q8H A;  4URL A;  2YGF A;  4CWQ A;  2YEJ A;  3A0R A;  4QPJ A;  4LPB A;  1TH8 A;  1Y8O A;  1Y4U A;  5L3J A;  2QG0 A;  2CG9 A;  3T10 A;  3QDD A;  3BMY A;  1US7 A;  4GQT A;  2BZ5 A;  5CTU A;  2BYH A;  3G75 A;  2XDX A;  2WI3 A;  1AH8 A;  4ASG A;  2Q8I A;  2YI6 A;  4WUB A;  1Z5B A;  2CH4 A;  3C11 A;  3LPS A;  3OMU A;  4EGH A;  3FT8 A;  4MPC A;  2WI1 A;  1KIJ A;  1I5B A;  2VCJ A;  2WEQ A;  1U2O A;  4E72 A;  4LWF A;  4BQJ A;  2FTK A;  3HEK A;  1H7S A;  2BU8 A;  1ZWH A;  2BU7 A; 
#chains in the Genus database with same CATH homology
 3MNR P;  4XKA A;  1YC1 A;  3U2K A;  1UYF A;  3OPD A;  4I3H A;  3EKR A;  1A4H A;  3U2D A;  3PEH A;  2K5B A;  4LP0 A;  4XE2 A;  5IDM A;  3T0H A;  4E01 A;  4XIT A;  2Q2E B;  2AKP A;  5BOD A;  4XCL A;  2VW5 A;  1NHH A;  2YE7 A;  4MPE A;  1H7U A;  3TZ4 A;  4PL9 A;  4JAS A;  3CWV A;  2BTZ A;  4XIP A;  2YK9 A;  2CCU A;  2ZKJ A;  2YE4 A;  3A0W A;  3ZM7 A;  1Y8N A;  1PVG A;  2WI5 A;  4HY6 A;  4JAU A;  4PRX A;  3VHD A;  5M4E A;  2YE9 A;  2FWY A;  1S16 A;  4Q20 A;  3HYY A;  5F3K A;  3K98 A;  4JQL A;  4KP4 A;  4GT8 A;  1UYL A;  1I5D A;  3Q5K A;  4L93 A;  1AM1 A;  4FCR A;  3TZ2 A;  1Y4S A;  4CE1 A;  4MPN A;  5D7C A;  2CCS A;  2UWD A;  4MB9 A;  3DGE A;  4BIU A;  4GFN A;  5CTX A;  5CPH A;  3TZ0 A;  3EHF A;  1U0Z A;  4XC0 A;  4ASB A;  2YJW A;  3RLQ A;  5F5R A;  3A0X A;  4NH9 A;  3K99 A;  4URN A;  1THN A;  4O0B A;  2YEF A;  4FPP A;  4KFG A;  2PNR A;  5CTY A;  2YKC A;  3TZ5 A;  4LWG A;  4CWT A;  1QY8 A;  2XHX A;  2YEI A;  3U67 A;  4HY1 A;  2YE5 A;  1Z5A A;  1YER A;  2XK2 A;  4LWE A;  3RKZ A;  1UYM A;  3OWD A;  3ZXO A;  2QF6 A;  5M4P A;  3B24 A;  2FXS A;  2XDL A;  3HZ5 A;  1YSZ A;  4H85 A;  3O2F A;  4HXZ A;  1KZN A;  3QTF A;  4B7P A;  4EGI A;  2IOR A;  3CGZ A;  2E0A A;  4XKK A;  2IWU A;  2BRE A;  2FYP A;  1UY7 A;  1BKN A;  4XIQ A;  4V25 A;  3TTZ A;  4YKW A;  3T0Z A;  2XAB A;  4X9L A;  2XX5 A;  1AJ6 A;  2YEC A;  4P8O A;  2ZDY A;  4PU9 A;  3EHH A;  1YT2 A;  2YEB A;  5D7R A;  2BU6 A;  4K4O A;  3LNU A;  4V26 A;  3VAD A;  3ZKD A;  2YEA A;  1UY8 A;  4LWH A;  4FCP A;  1EI1 A;  1TBW A;  2WEP A;  4CE2 A;  2HG1 A;  2FWZ A;  4CWS A;  2JJC A;  2YE2 A;  3O0I A;  3A0Y A;  3BM9 A;  5D6Q A;  2Q8F A;  4YKQ A;  4AS9 A;  1OSF A;  4O05 A;  4AWP A;  1TIL A;  4CE3 A;  1QZR A;  1UYI A;  2IWX A;  2BT0 A;  4QPK A;  4PRV A;  2YEH A;  5C93 A;  5M4K A;  4BIZ A;  4L90 A;  1R62 A;  1Z59 A;  4EM7 A;  4O04 A;  4URM A;  2XDK A;  4XKO A;  2WI6 A;  3NMQ A;  3GIG B;  3R4N A;  2O1W A;  4CWN A;  4JAV A;  4EFU A;  3IED A;  3EHJ A;  5D7D A;  3JZ3 A;  3T1K A;  1JM6 A;  2XJG A;  3G7B A;  3C0E A;  3INX A;  2ESA A;  1YC4 A;  2YGA A;  2WI7 A;  4H7Q A;  4EMV A;  1B3Q A;  4GGL A;  1ZXN A;  3SL2 A;  2XCM A;  5GGZ A;  1EA6 A;  4HYP A;  2XHT A;  5CTW A;  4HYM A;  4EFT A;  2YEE A;  2XHR A;  2YEG A;  4XIR A;  1BGQ A;  4CWO A;  3RLR A;  3WQ9 A;  1YC3 A;  2BU5 A;  2JKI A;  5BOC A;  4ZVI A;  1Z5C A;  3HHU A;  5FND A;  1GJV A;  3INW A;  1YES A;  1YS3 A;  4YKR A;  2BYI A;  4EGK A;  4YKY A;  5IDJ A;  2C2A A;  4FCQ A;  2XJJ A;  4YKT A;  2GFD A;  4L94 A;  1TC0 A;  3B25 A;  3Q5J A;  4XCJ A;  2WI2 A;  1UYC A;  1UYG A;  4WUC A;  4MBC A;  4AWQ A;  4KSH A;  2Q8G A;  1UY6 A;  2BSM A;  5D6P A;  2YGE A;  3T2S A;  4YKZ A;  3HYZ A;  5IN9 A;  1S14 A;  2CCT A;  4KQV A;  3ZKB A;  3EHG A;  3R4M A;  2IOP A;  2YE8 A;  4MP2 A;  1QYE A;  4XDM A;  2XX4 A;  2H55 A;  4R1F A;  4XD8 A;  4YKX A;  2HCH A;  3VHA A;  1BYQ A;  2YE6 A;  4U7O A;  4CWR A;  3OW6 A;  1L0O A;  2H8M A;  4E02 A;  1UYE A;  3KE6 A;  2YK2 A;  1UYH A;  4MOT A;  3B27 A;  2WER A;  2YE3 A;  3K60 A;  3FT5 A;  4H81 A;  1TC6 A;  4NH7 A;  1I59 A;  1YT0 A;  1GKZ A;  1AMW A;  2BU2 A;  3D2R A;  1I5A A;  3H80 A;  1I58 A;  3CGY A;  4U7N A;  1NHI A;  3CRL A;  4GEE A;  3RLP A;  3B26 A;  2CGF A;  3R91 A;  3G7E A;  5FWK A;  3CRK A;  4MP7 A;  2YKE A;  2GQP A;  4ZKI A;  4O07 A;  2XJX A;  4KSG A;  1UYK A;  2EXL A;  2ZBK B;  4GCZ A;  3A0Z A;  4BQG A;  2O1U A;  3H4L A;  2IOQ A;  1UYD A;  1YT1 A;  4URO A;  5M4N A;  1AH6 A;  1UY9 A;  1NHJ A;  3R4P A;  1MU5 A;  3GIF A;  4HZ0 A;  4LWI A;  5M4H A;  1ZXM A;  3OWB A;  3HZ1 A;  3R92 A;  4HXW A;  4R3A A;  1I5C A;  2XX2 A;  2YED A;  3B28 A;  2XDS A;  1TID A;  4AWO A;  3ZXQ A;  3K97 A;  4WUD A;  1MX0 A;  2ZDX A;  3EKO A;  4L8Z A;  1BXD A;  3R4O A;  4I5S A;  5FNC A;  2YKJ A;  5M4M A;  2IWS A;  2YKI A;  4L91 A;  4U93 A;  4FMT A;  4B6C A;  4E00 A;  2VWC A;  2WI4 A;  1YSR A;  2YI7 A;  4XTJ A;  4EEH A;  4CWF A;  4O09 A;  3D36 A;  3GIG A;  2HKJ A;  3VHC A;  2XDU A;  1YET A;  4BXI A;  3FV5 A;  3O6O A;  4DUH A;  4YKU A;  3PEJ A;  5FNF A;  2XD6 A;  1ZW9 A;  4DZY A;  5J6A A;  2YI5 A;  1B62 A;  2QFO A;  2YKB A;  3WHA A;  3TUH A;  1ID0 A;  4ASF A;  4NH8 A;  2QG2 A;  4KTN A;  4P7A A;  1GKX A;  4ASA A;  2BRC A;  4CWP A;  2O1V A;  2VCI A;  4BAE A;  5CF0 A;  3D0B A;  3Q5L A;  1Y8P A;  2YJX A;  4R3M A;  3A0T A;  2YI0 A;  4HZ5 A;  5J71 A;  3GIE A;  1B63 A;  4W7T A;  2Q8H A;  4URL A;  2YGF A;  4CWQ A;  2YEJ A;  3A0R A;  4QPJ A;  4LPB A;  1TH8 A;  1Y8O A;  1Y4U A;  5L3J A;  2QG0 A;  2CG9 A;  3T10 A;  3QDD A;  3BMY A;  1US7 A;  4GQT A;  2BZ5 A;  5CTU A;  2BYH A;  3G75 A;  2XDX A;  2WI3 A;  1AH8 A;  4ASG A;  2Q8I A;  2YI6 A;  4WUB A;  1Z5B A;  2CH4 A;  3C11 A;  3LPS A;  3OMU A;  4EGH A;  3FT8 A;  4MPC A;  2WI1 A;  1KIJ A;  1I5B A;  2VCJ A;  2WEQ A;  1U2O A;  4LWF A;  4BQJ A;  3HEK A;  1H7S A;  2BU8 A;  1ZWH A;  2BU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...