3IEDA

Crystal structure of n-terminal domain of plasmodium falciparum hsp90 (pf14_0417) in complex with amppn
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
258
structure length
224
Chain Sequence
RENLYFQGSPVEKYNFKAEVNKVMDIIVNSLYTDKDVFLRELISNASDACDKKRIILENNKLIKDAEVNDIKKLIIKIKPDKEKKTLTITDNGIGMDKSELINNLGTIAQSGTAKFLKQIEEGKADSNLIGQFGVGFYSSFLVSNRVEVYTKKEDQIYRWSSDLKGSFSVNEIKKYDQEYIKGSGTKIILHLKEECDEYLEDYKLKELIKKYSEFIKFPIEIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of N-terminal domain of Plasmodium falciparum Hsp90 (PF14_0417) in complex with AMPPN
rcsb
source organism Plasmodium falciparum
molecule tags Chaperone
molecule keywords Heat shock protein
total genus 66
structure length 224
sequence length 258
ec nomenclature
pdb deposition date 2009-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3iedA00
1I5AA 4U93A 4K4OA 3WHAA 3QDDA 1YS3A 1BYQA 4DUHA 3T10A 1US7A 2YJWA 2XX5A 3B24A 3T0ZA 1YT1A 2WI5A 5M4KA 5C93A 4ASAA 4E00A 4I3HA 4W7TA 2YEIA 1QZRA 1YT0A 3HEKA 4HXWA 2YEHA 3FT8A 2PNRA 3GIEA 3OW6A 3SL2A 5BODA 3OMUA 4V25A 1TILA 1Y4SA 1PVGA 2BYIA 4CWFA 4CE2A 2ZDYA 2HG1A 2VCIA 4L8ZA 5D7CA 2BREA 2YEBA 4XITA 5M4PA 4AWQA 3U67A 4CWPA 1B63A 4MP7A 5IDJA 1UY8A 3TZ4A 4H7QA 2E0AA 4CWQA 2YEGA 2YI6A 4EFTA 4FMTA 4H85A 3R4NA 2IWSA 3RLRA 4O04A 4KTNA 1S14A 4CWTA 3O0IA 5J6AA 4PL9A 4GFNA 5M4EA 1NHHA 4FPPA 1TH8A 1NHIA 4PU9A 4LPBA 3U2DA 2Q8IA 5L3JA 3Q5LA 2H8MA 4YKRA 3CGYA 4LP0A 3R92A 3INWA 1ZXMA 3ZKBA 4YKXA 1AJ6A 4E01A 1GJVA 2XHXA 2QG0A 2YKBA 4XKOA 4V26A 3WQ9A 2H55A 1ZW9A 3CGZA 4KSHA 1YC3A 2BU2A 1H7SA 1U0ZA 2ESAA 3TUHA 2YECA 4HXZA 5FWKA 1TBWA 1TIDA 4EGHA 4AS9A 4CE1A 3A0RA 1R62A 2ZKJA 2YEAA 4LWGA 1OSFA 1I58A 4U7NA 2Q8FA 4GCZA 2YE8A 3MNRP 4EMVA 1ID0A 4PRVA 1BGQA 2BU5A 2CCUA 4QPKA 1YERA 3DGEA 4BIZA 4WUDA 2YEFA 4GQTA 2WEPA 5M4NA 3GIGB 4YKTA 3R4MA 2ZBKB 1GKXA 1UY7A 4Q20A 4YKYA 5CPHA 2YE3A 3INXA 4YKWA 3Q5KA 2YE6A 4XCLA 1B62A 2YE9A 4URNA 2CCSA 4BAEA 1UYDA 4B6CA 4XIRA 1AM1A 2YK9A 3BMYA 4BQGA 3NMQA 4L93A 2EXLA 1UYGA 3U2KA 2GFDA 2Q8GA 2GQPA 3HHUA 3K99A 2FWZA 2YI0A 2YEEA 3G7BA 4CWNA 1TC6A 4O09A 1GKZA 4UROA 4XC0A 2WEQA 2K5BA 3TTZA 1Z5BA 5FNCA 3OWBA 1S16A 3C11A 4HYPA 4L90A 4O07A 4CE3A 4BQJA 3K97A 3B28A 2XABA 2IOPA 2WI2A 1Y4UA 4I5SA 2O1WA 1UYKA 3OPDA 1UYLA 3D36A 2BSMA 4X9LA 4XDMA 4CWSA 4P7AA 4LWEA 1B3QA 4FCPA 3TZ0A 5CF0A 2XHTA 1EI1A 4EFUA 2WI7A 2VCJA 2FWYA 1UYFA 4B7PA 2YEJA 2XJJA 3EHGA 4CWRA 3EHHA 5BOCA 1YC4A 1BKNA 4R1FA 2QFOA 2YKCA 4XKKA 3EHJA 2IORA 2XDKA 1MU5A 5M4MA 5CTXA 3Q5JA 4KQVA 3D2RA 5IDMA 4MOTA 4FCQA 1QY8A 4XIQA 1I59A 3CWVA 3PEHA 2XDSA 3HZ1A 3K60A 4HZ5A 3HYYA 4LWHA 2BT0A 3ZXOA 1AH8A 4BXIA 4XE2A 2FXSA 2XX4A 3B25A 3R4OA 3RLPA 4ASFA 2WI1A 2IWUA 2BZ5A 4E02A 3QTFA 2YKJA 5J71A 1H7UA 4MBCA 1KZNA 3T1KA 4O0BA 1MX0A 3ZKDA 2XJXA 3A0ZA 4MPCA 1Z59A 2C2AA 1UYIA 4R3MA 1YC1A 1Z5CA 4MB9A 4HZ0A 4HY1A 2FYPA 3R91A 4EGIA 2Q2EB 4PRXA 2UWDA 2Q8HA 4L91A 1ZXNA 4WUBA 2VWCA 4URMA 3C0EA 3TZ5A 2WI4A 3LPSA 1YSZA 5FNDA 2YE7A 2YGEA 3D0BA 4ASGA 4XIPA 4NH8A 3TZ2A 5GGZA 5CTUA 4XCJA 2BU8A 3CRLA 2XDLA 1JM6A 3OWDA 2YE5A 1YSRA 3B26A 4GGLA 3ZXQA 4AWOA 1UYCA 3JZ3A 2ZDXA 4NH9A 3H4LA 3ZM7A 2CG9A 1Y8OA 2IWXA 2WI6A 1UYEA 3KE6A 2YJXA 4KSGA 2YGAA 2QF6A 2WERA 4WUCA 1U2OA 5D6QA 3EKOA 5CTWA 1UYMA 1NHJA 4JAUA 4O05A 3A0XA 2YKEA 1UYHA 4AWPA 1THNA 1ZWHA 2YEDA 3O2FA 5D7DA 4U7OA 4GT8A 3G75A 4FCRA 2BRCA 2WI3A 2XHRA 4URLA 3IEDA 2XX2A 1BXDA 2YK2A 2YI7A 4ZKIA 3VADA 1UY6A 5FNFA 3GIGA 5CTYA 2JJCA 1UY9A 4LWFA 3GIFA 1TC0A 3CRKA 4XKAA 1YESA 2YGFA 3VHAA 2XJGA 4EM7A 5F5RA 4KP4A 3K98A 4KFGA 2HKJA 2VW5A 1AMWA 2IOQA 4YKQA 3BM9A 5D7RA 3G7EA 4JQLA 2BU7A 2O1VA 3A0TA 2XD6A 3H80A 4HYMA 4MPNA 2CH4A 4HY6A 2O1UA 3B27A 3PEJA 2CGFA 1YETA 3LNUA 2BU6A 4MPEA 2BYHA 3T0HA 2YE4A 1I5DA 3FV5A 4XD8A 4R3AA 4BIUA 4EGKA 3HYZA 4XTJA 3RLQA 2XDXA 3A0WA 2XDUA 3EKRA 5IN9A 4EEHA 3HZ5A 4H81A 1L0OA 4YKUA 1EA6A 3VHCA 1I5BA 1A4HA 5D6PA 2HCHA 3O6OA 3R4PA 4YKZA 4DZYA 1Z5AA 2BTZA 2QG2A 2JKIA 1AH6A 1QYEA 4MP2A 4JAVA 2YI5A 1Y8NA 2YKIA 2XK2A 5F3KA 3VHDA 3EHFA 1KIJA 4GEEA 4NH7A 4ZVIA 5M4HA 1Y8PA 4QPJA 2YE2A 4P8OA 1YT2A 1I5CA 2XCMA 4L94A 4JASA 4ASBA 4CWOA 3T2SA 2AKPA 3RKZA 3FT5A 3A0YA 2CCTA 4LWIA
chains in the Genus database with same CATH superfamily
1I5AA 4U93A 4K4OA 3WHAA 3QDDA 4E72A 1YS3A 1BYQA 4DUHA 3CYGA 3T10A 1US7A 2YJWA 2XX5A 3B24A 3T0ZA 1YT1A 2WI5A 5M4KA 5C93A 4ASAA 4E00A 4I3HA 4W7TA 2YEIA 1QZRA 1YT0A 3HEKA 4HXWA 2YEHA 3FT8A 2PNRA 3GIEA 3OW6A 3SL2A 5BODA 3OMUA 4V25A 1TILA 1Y4SA 1PVGA 2BYIA 4CWFA 4CE2A 2ZDYA 2HG1A 2VCIA 4L8ZA 5D7CA 2BREA 2YEBA 4XITA 5M4PA 4AWQA 3U67A 1F51A 4CWPA 1B63A 4MP7A 5IDJA 1UY8A 3TZ4A 4H7QA 2E0AA 4CWQA 2YEGA 2YI6A 4EFTA 4FMTA 4H85A 3R4NA 2IWSA 3RLRA 4O04A 4KTNA 1S14A 4CWTA 3O0IA 5J6AA 4PL9A 4GFNA 5M4EA 1NHHA 4FPPA 1TH8A 1NHIA 4PU9A 4LPBA 3U2DA 2Q8IA 5L3JA 3Q5LA 2H8MA 4YKRA 5JENA 3CGYA 4LP0A 3R92A 3INWA 1ZXMA 3ZKBA 4YKXA 1AJ6A 4E01A 1GJVA 2XHXA 2QG0A 2YKBA 4XKOA 4V26A 3WQ9A 2H55A 1ZW9A 3CGZA 4KSHA 1YC3A 2BU2A 1H7SA 1U0ZA 2ESAA 3TUHA 2YECA 4HXZA 5FWKA 1TBWA 1TIDA 4EGHA 4AS9A 4CE1A 3A0RA 1R62A 2ZKJA 2YEAA 4LWGA 1OSFA 1I58A 4U7NA 2Q8FA 4GCZA 2YE8A 3MNRP 4EMVA 1ID0A 4PRVA 1BGQA 2BU5A 2CCUA 4QPKA 1YERA 3DGEA 4BIZA 4WUDA 2YEFA 4GQTA 2WEPA 5M4NA 3GIGB 4YKTA 2C1IA 3R4MA 2ZBKB 1GKXA 1UY7A 4Q20A 4YKYA 5CPHA 2YE3A 3INXA 4YKWA 3Q5KA 2YE6A 4XCLA 1B62A 2YE9A 4URNA 2CCSA 4BAEA 1UYDA 4B6CA 4XIRA 1AM1A 2YK9A 3BMYA 4BQGA 3NMQA 4L93A 2EXLA 1UYGA 3U2KA 2GFDA 2Q8GA 2GQPA 3HHUA 3K99A 2FWZA 2YI0A 2YEEA 3G7BA 4CWNA 1TC6A 4O09A 1GKZA 4UROA 4XC0A 2WEQA 2K5BA 3TTZA 1Z5BA 5FNCA 3OWBA 1S16A 3C11A 4HYPA 4L90A 4O07A 4CE3A 4BQJA 3K97A 3B28A 2XABA 2IOPA 2WI2A 1Y4UA 4I5SA 2O1WA 1UYKA 3OPDA 1UYLA 3D36A 2BSMA 4X9LA 4XDMA 4CWSA 4P7AA 4LWEA 1B3QA 4FCPA 3TZ0A 5CF0A 2XHTA 1EI1A 4EFUA 2WI7A 2VCJA 2FWYA 1UYFA 4B7PA 2YEJA 2XJJA 3EHGA 4CWRA 3EHHA 5BOCA 1YC4A 1BKNA 4R1FA 2QFOA 2YKCA 4XKKA 3EHJA 2IORA 2XDKA 1MU5A 5M4MA 5CTXA 3Q5JA 4KQVA 3D2RA 5IDMA 4MOTA 3LMMA 4FCQA 1QY8A 3S5TA 4XIQA 1I59A 3CWVA 3PEHA 2XDSA 3HZ1A 3K60A 4HZ5A 3HYYA 4LWHA 2BT0A 3ZXOA 1AH8A 4BXIA 4XE2A 2FXSA 2XX4A 3B25A 3R4OA 3RLPA 4ASFA 2WI1A 2IWUA 2BZ5A 4E02A 3QTFA 2YKJA 5J71A 1H7UA 4MBCA 1KZNA 3T1KA 4O0BA 1MX0A 3ZKDA 2XJXA 3A0ZA 4MPCA 1Z59A 2C2AA 1UYIA 4R3MA 1YC1A 1Z5CA 4MB9A 4HZ0A 4HY1A 2FYPA 3R91A 4EGIA 2Q2EB 4PRXA 2UWDA 2Q8HA 4L91A 1ZXNA 4WUBA 2VWCA 4URMA 3C0EA 3TZ5A 2WI4A 3LPSA 1YSZA 5FNDA 2YE7A 2YGEA 3D0BA 4ASGA 4XIPA 4NH8A 3TZ2A 5GGZA 5CTUA 4XCJA 2BU8A 3CRLA 2XDLA 1JM6A 3OWDA 2YE5A 1YSRA 3B26A 4GGLA 3ZXQA 4AWOA 1UYCA 3JZ3A 2ZDXA 4NH9A 3H4LA 3ZM7A 2CG9A 1Y8OA 2IWXA 2WI6A 1UYEA 3KE6A 2YJXA 4KSGA 2YGAA 2QF6A 2WERA 2C1GA 4WUCA 1U2OA 5D6QA 3EKOA 5CTWA 1UYMA 1NHJA 4JAUA 4O05A 2HHIA 3A0XA 2YKEA 1UYHA 4AWPA 1THNA 1ZWHA 2YEDA 3O2FA 5D7DA 4U7OA 4GT8A 3G75A 4FCRA 2BRCA 2WI3A 2XHRA 4URLA 3IEDA 2XX2A 1BXDA 2YK2A 2YI7A 4ZKIA 3VADA 1UY6A 5FNFA 3GIGA 5CTYA 1IXMA 2JJCA 1UY9A 4LWFA 3GIFA 1TC0A 3CRKA 4XKAA 1YESA 2YGFA 3VHAA 2XJGA 4EM7A 5F5RA 4KP4A 3K98A 4KFGA 2HKJA 2VW5A 2FTKA 1AMWA 2IOQA 4YKQA 3BM9A 5D7RA 3G7EA 4JQLA 2BU7A 2O1VA 3A0TA 2XD6A 3H80A 4HYMA 4MPNA 2CH4A 4HY6A 2O1UA 3B27A 3PEJA 2CGFA 1YETA 3LNUA 2BU6A 4MPEA 2BYHA 3T0HA 2YE4A 1I5DA 3FV5A 4XD8A 4R3AA 4BIUA 4EGKA 3HYZA 4XTJA 3RLQA 2XDXA 3A0WA 2XDUA 3EKRA 5IN9A 4EEHA 3HZ5A 4H81A 1L0OA 4YKUA 1EA6A 3VHCA 1I5BA 1A4HA 5D6PA 2HCHA 3O6OA 3R4PA 4YKZA 4DZYA 1Z5AA 2BTZA 2QG2A 2JKIA 1AH6A 1QYEA 4MP2A 4JAVA 2YI5A 1Y8NA 2YKIA 2XK2A 5F3KA 3VHDA 3EHFA 1KIJA 4GEEA 4NH7A 4ZVIA 5M4HA 1Y8PA 4QPJA 2YE2A 4P8OA 1YT2A 1I5CA 2XCMA 4L94A 4JASA 4ASBA 4CWOA 3T2SA 2AKPA 3RKZA 3FT5A 3A0YA 2CCTA 4LWIA
chains in the Genus database with same CATH topology
1I5AA 4U93A 4K4OA 3WHAA 3QDDA 1YS3A 1BYQA 4DUHA 3T10A 1US7A 2YJWA 2XX5A 3B24A 3T0ZA 1YT1A 2WI5A 5M4KA 5C93A 4ASAA 4E00A 4I3HA 4W7TA 2YEIA 1QZRA 1YT0A 3HEKA 4HXWA 2YEHA 3FT8A 2PNRA 3GIEA 3OW6A 3SL2A 5BODA 3OMUA 4V25A 1TILA 1Y4SA 1PVGA 2BYIA 4CWFA 4CE2A 2ZDYA 2HG1A 2VCIA 4L8ZA 5D7CA 2BREA 2YEBA 4XITA 5M4PA 4AWQA 3U67A 4CWPA 1B63A 4MP7A 5IDJA 1UY8A 3TZ4A 4H7QA 2E0AA 4CWQA 2YEGA 2YI6A 4EFTA 4FMTA 4H85A 3R4NA 2IWSA 3RLRA 4O04A 4KTNA 1S14A 4CWTA 3O0IA 5J6AA 4PL9A 4GFNA 5M4EA 1NHHA 4FPPA 1TH8A 1NHIA 4PU9A 4LPBA 3U2DA 2Q8IA 5L3JA 3Q5LA 2H8MA 4YKRA 3CGYA 4LP0A 3R92A 3INWA 1ZXMA 3ZKBA 4YKXA 1AJ6A 4E01A 1GJVA 2XHXA 2QG0A 2YKBA 4XKOA 4V26A 3WQ9A 2H55A 1ZW9A 3CGZA 4KSHA 1YC3A 2BU2A 1H7SA 1U0ZA 2ESAA 3TUHA 2YECA 4HXZA 5FWKA 1TBWA 1TIDA 4EGHA 4AS9A 4CE1A 3A0RA 1R62A 2ZKJA 2YEAA 4LWGA 1OSFA 1I58A 4U7NA 2Q8FA 4GCZA 2YE8A 3MNRP 4EMVA 1ID0A 4PRVA 1BGQA 2BU5A 2CCUA 4QPKA 1YERA 3DGEA 4BIZA 4WUDA 2YEFA 4GQTA 2WEPA 5M4NA 3GIGB 4YKTA 3R4MA 2ZBKB 1GKXA 1UY7A 4Q20A 4YKYA 5CPHA 2YE3A 3INXA 4YKWA 3Q5KA 2YE6A 4XCLA 1B62A 2YE9A 4URNA 2CCSA 4BAEA 1UYDA 4B6CA 4XIRA 1AM1A 2YK9A 3BMYA 4BQGA 3NMQA 4L93A 2EXLA 1UYGA 3U2KA 2GFDA 2Q8GA 2GQPA 3HHUA 3K99A 2FWZA 2YI0A 2YEEA 3G7BA 4CWNA 1TC6A 4O09A 1GKZA 4UROA 4XC0A 2WEQA 2K5BA 3TTZA 1Z5BA 5FNCA 3OWBA 1S16A 3C11A 4HYPA 4L90A 4O07A 4CE3A 4BQJA 3K97A 3B28A 2XABA 2IOPA 2WI2A 1Y4UA 4I5SA 2O1WA 1UYKA 3OPDA 1UYLA 3D36A 2BSMA 4X9LA 4XDMA 4CWSA 4P7AA 4LWEA 1B3QA 4FCPA 3TZ0A 5CF0A 2XHTA 1EI1A 4EFUA 2WI7A 2VCJA 2FWYA 1UYFA 4B7PA 2YEJA 2XJJA 3EHGA 4CWRA 3EHHA 5BOCA 1YC4A 1BKNA 4R1FA 2QFOA 2YKCA 4XKKA 3EHJA 2IORA 2XDKA 1MU5A 5M4MA 5CTXA 3Q5JA 4KQVA 3D2RA 5IDMA 4MOTA 4FCQA 1QY8A 4XIQA 1I59A 3CWVA 3PEHA 2XDSA 3HZ1A 3K60A 4HZ5A 3HYYA 4LWHA 2BT0A 3ZXOA 1AH8A 4BXIA 4XE2A 2FXSA 2XX4A 3B25A 3R4OA 3RLPA 4ASFA 2WI1A 2IWUA 2BZ5A 4E02A 3QTFA 2YKJA 5J71A 1H7UA 4MBCA 1KZNA 3T1KA 4O0BA 1MX0A 3ZKDA 2XJXA 3A0ZA 4MPCA 1Z59A 2C2AA 1UYIA 4R3MA 1YC1A 1Z5CA 4MB9A 4HZ0A 4HY1A 2FYPA 3R91A 4EGIA 2Q2EB 4PRXA 2UWDA 2Q8HA 4L91A 1ZXNA 4WUBA 2VWCA 4URMA 3C0EA 3TZ5A 2WI4A 3LPSA 1YSZA 5FNDA 2YE7A 2YGEA 3D0BA 4ASGA 4XIPA 4NH8A 3TZ2A 5GGZA 5CTUA 4XCJA 2BU8A 3CRLA 2XDLA 1JM6A 3OWDA 2YE5A 1YSRA 3B26A 4GGLA 3ZXQA 4AWOA 1UYCA 3JZ3A 2ZDXA 4NH9A 3H4LA 3ZM7A 2CG9A 1Y8OA 2IWXA 2WI6A 1UYEA 3KE6A 2YJXA 4KSGA 2YGAA 2QF6A 2WERA 4WUCA 1U2OA 5D6QA 3EKOA 5CTWA 1UYMA 1NHJA 4JAUA 4O05A 3A0XA 2YKEA 1UYHA 4AWPA 1THNA 1ZWHA 2YEDA 3O2FA 5D7DA 4U7OA 4GT8A 3G75A 4FCRA 2BRCA 2WI3A 2XHRA 4URLA 3IEDA 2XX2A 1BXDA 2YK2A 2YI7A 4ZKIA 3VADA 1UY6A 5FNFA 3GIGA 5CTYA 2JJCA 1UY9A 4LWFA 3GIFA 1TC0A 3CRKA 4XKAA 1YESA 2YGFA 3VHAA 2XJGA 4EM7A 5F5RA 4KP4A 3K98A 4KFGA 2HKJA 2VW5A 1AMWA 2IOQA 4YKQA 3BM9A 5D7RA 3G7EA 4JQLA 2BU7A 2O1VA 3A0TA 2XD6A 3H80A 4HYMA 4MPNA 2CH4A 4HY6A 2O1UA 3B27A 3PEJA 2CGFA 1YETA 3LNUA 2BU6A 4MPEA 2BYHA 3T0HA 2YE4A 1I5DA 3FV5A 4XD8A 4R3AA 4BIUA 4EGKA 3HYZA 4XTJA 3RLQA 2XDXA 3A0WA 2XDUA 3EKRA 5IN9A 4EEHA 3HZ5A 4H81A 1L0OA 4YKUA 1EA6A 3VHCA 1I5BA 1A4HA 5D6PA 2HCHA 3O6OA 3R4PA 4YKZA 4DZYA 1Z5AA 2BTZA 2QG2A 2JKIA 1AH6A 1QYEA 4MP2A 4JAVA 2YI5A 1Y8NA 2YKIA 2XK2A 5F3KA 3VHDA 3EHFA 1KIJA 4GEEA 4NH7A 4ZVIA 5M4HA 1Y8PA 4QPJA 2YE2A 4P8OA 1YT2A 1I5CA 2XCMA 4L94A 4JASA 4ASBA 4CWOA 3T2SA 2AKPA 3RKZA 3FT5A 3A0YA 2CCTA 4LWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I5A A;  4U93 A;  4K4O A;  3WHA A;  3QDD A;  1YS3 A;  1BYQ A;  4DUH A;  3T10 A;  1US7 A;  2YJW A;  2XX5 A;  3B24 A;  3T0Z A;  1YT1 A;  2WI5 A;  5M4K A;  5C93 A;  4ASA A;  4E00 A;  4I3H A;  4W7T A;  2YEI A;  1QZR A;  1YT0 A;  3HEK A;  4HXW A;  2YEH A;  3FT8 A;  2PNR A;  3GIE A;  3OW6 A;  3SL2 A;  5BOD A;  3OMU A;  4V25 A;  1TIL A;  1Y4S A;  1PVG A;  2BYI A;  4CWF A;  4CE2 A;  2ZDY A;  2HG1 A;  2VCI A;  4L8Z A;  5D7C A;  2BRE A;  2YEB A;  4XIT A;  5M4P A;  4AWQ A;  3U67 A;  4CWP A;  1B63 A;  4MP7 A;  5IDJ A;  1UY8 A;  3TZ4 A;  4H7Q A;  2E0A A;  4CWQ A;  2YEG A;  2YI6 A;  4EFT A;  4FMT A;  4H85 A;  3R4N A;  2IWS A;  3RLR A;  4O04 A;  4KTN A;  1S14 A;  4CWT A;  3O0I A;  5J6A A;  4PL9 A;  4GFN A;  5M4E A;  1NHH A;  4FPP A;  1TH8 A;  1NHI A;  4PU9 A;  4LPB A;  3U2D A;  2Q8I A;  5L3J A;  3Q5L A;  2H8M A;  4YKR A;  3CGY A;  4LP0 A;  3R92 A;  3INW A;  1ZXM A;  3ZKB A;  4YKX A;  1AJ6 A;  4E01 A;  1GJV A;  2XHX A;  2QG0 A;  2YKB A;  4XKO A;  4V26 A;  3WQ9 A;  2H55 A;  1ZW9 A;  3CGZ A;  4KSH A;  1YC3 A;  2BU2 A;  1H7S A;  1U0Z A;  2ESA A;  3TUH A;  2YEC A;  4HXZ A;  5FWK A;  1TBW A;  1TID A;  4EGH A;  4AS9 A;  4CE1 A;  3A0R A;  1R62 A;  2ZKJ A;  2YEA A;  4LWG A;  1OSF A;  1I58 A;  4U7N A;  2Q8F A;  4GCZ A;  2YE8 A;  3MNR P;  4EMV A;  1ID0 A;  4PRV A;  1BGQ A;  2BU5 A;  2CCU A;  4QPK A;  1YER A;  3DGE A;  4BIZ A;  4WUD A;  2YEF A;  4GQT A;  2WEP A;  5M4N A;  3GIG B;  4YKT A;  3R4M A;  2ZBK B;  1GKX A;  1UY7 A;  4Q20 A;  4YKY A;  5CPH A;  2YE3 A;  3INX A;  4YKW A;  3Q5K A;  2YE6 A;  4XCL A;  1B62 A;  2YE9 A;  4URN A;  2CCS A;  4BAE A;  1UYD A;  4B6C A;  4XIR A;  1AM1 A;  2YK9 A;  3BMY A;  4BQG A;  3NMQ A;  4L93 A;  2EXL A;  1UYG A;  3U2K A;  2GFD A;  2Q8G A;  2GQP A;  3HHU A;  3K99 A;  2FWZ A;  2YI0 A;  2YEE A;  3G7B A;  4CWN A;  1TC6 A;  4O09 A;  1GKZ A;  4URO A;  4XC0 A;  2WEQ A;  2K5B A;  3TTZ A;  1Z5B A;  5FNC A;  3OWB A;  1S16 A;  3C11 A;  4HYP A;  4L90 A;  4O07 A;  4CE3 A;  4BQJ A;  3K97 A;  3B28 A;  2XAB A;  2IOP A;  2WI2 A;  1Y4U A;  4I5S A;  2O1W A;  1UYK A;  3OPD A;  1UYL A;  3D36 A;  2BSM A;  4X9L A;  4XDM A;  4CWS A;  4P7A A;  4LWE A;  1B3Q A;  4FCP A;  3TZ0 A;  5CF0 A;  2XHT A;  1EI1 A;  4EFU A;  2WI7 A;  2VCJ A;  2FWY A;  1UYF A;  4B7P A;  2YEJ A;  2XJJ A;  3EHG A;  4CWR A;  3EHH A;  5BOC A;  1YC4 A;  1BKN A;  4R1F A;  2QFO A;  2YKC A;  4XKK A;  3EHJ A;  2IOR A;  2XDK A;  1MU5 A;  5M4M A;  5CTX A;  3Q5J A;  4KQV A;  3D2R A;  5IDM A;  4MOT A;  4FCQ A;  1QY8 A;  4XIQ A;  1I59 A;  3CWV A;  3PEH A;  2XDS A;  3HZ1 A;  3K60 A;  4HZ5 A;  3HYY A;  4LWH A;  2BT0 A;  3ZXO A;  1AH8 A;  4BXI A;  4XE2 A;  2FXS A;  2XX4 A;  3B25 A;  3R4O A;  3RLP A;  4ASF A;  2WI1 A;  2IWU A;  2BZ5 A;  4E02 A;  3QTF A;  2YKJ A;  5J71 A;  1H7U A;  4MBC A;  1KZN A;  3T1K A;  4O0B A;  1MX0 A;  3ZKD A;  2XJX A;  3A0Z A;  4MPC A;  1Z59 A;  2C2A A;  1UYI A;  4R3M A;  1YC1 A;  1Z5C A;  4MB9 A;  4HZ0 A;  4HY1 A;  2FYP A;  3R91 A;  4EGI A;  2Q2E B;  4PRX A;  2UWD A;  2Q8H A;  4L91 A;  1ZXN A;  4WUB A;  2VWC A;  4URM A;  3C0E A;  3TZ5 A;  2WI4 A;  3LPS A;  1YSZ A;  5FND A;  2YE7 A;  2YGE A;  3D0B A;  4ASG A;  4XIP A;  4NH8 A;  3TZ2 A;  5GGZ A;  5CTU A;  4XCJ A;  2BU8 A;  3CRL A;  2XDL A;  1JM6 A;  3OWD A;  2YE5 A;  1YSR A;  3B26 A;  4GGL A;  3ZXQ A;  4AWO A;  1UYC A;  3JZ3 A;  2ZDX A;  4NH9 A;  3H4L A;  3ZM7 A;  2CG9 A;  1Y8O A;  2IWX A;  2WI6 A;  1UYE A;  3KE6 A;  2YJX A;  4KSG A;  2YGA A;  2QF6 A;  2WER A;  4WUC A;  1U2O A;  5D6Q A;  3EKO A;  5CTW A;  1UYM A;  1NHJ A;  4JAU A;  4O05 A;  3A0X A;  2YKE A;  1UYH A;  4AWP A;  1THN A;  1ZWH A;  2YED A;  3O2F A;  5D7D A;  4U7O A;  4GT8 A;  3G75 A;  4FCR A;  2BRC A;  2WI3 A;  2XHR A;  4URL A;  3IED A;  2XX2 A;  1BXD A;  2YK2 A;  2YI7 A;  4ZKI A;  3VAD A;  1UY6 A;  5FNF A;  3GIG A;  5CTY A;  2JJC A;  1UY9 A;  4LWF A;  3GIF A;  1TC0 A;  3CRK A;  4XKA A;  1YES A;  2YGF A;  3VHA A;  2XJG A;  4EM7 A;  5F5R A;  4KP4 A;  3K98 A;  4KFG A;  2HKJ A;  2VW5 A;  1AMW A;  2IOQ A;  4YKQ A;  3BM9 A;  5D7R A;  3G7E A;  4JQL A;  2BU7 A;  2O1V A;  3A0T A;  2XD6 A;  3H80 A;  4HYM A;  4MPN A;  2CH4 A;  4HY6 A;  2O1U A;  3B27 A;  3PEJ A;  2CGF A;  1YET A;  3LNU A;  2BU6 A;  4MPE A;  2BYH A;  3T0H A;  2YE4 A;  1I5D A;  3FV5 A;  4XD8 A;  4R3A A;  4BIU A;  4EGK A;  3HYZ A;  4XTJ A;  3RLQ A;  2XDX A;  3A0W A;  2XDU A;  3EKR A;  5IN9 A;  4EEH A;  3HZ5 A;  4H81 A;  1L0O A;  4YKU A;  1EA6 A;  3VHC A;  1I5B A;  1A4H A;  5D6P A;  2HCH A;  3O6O A;  3R4P A;  4YKZ A;  4DZY A;  1Z5A A;  2BTZ A;  2QG2 A;  2JKI A;  1AH6 A;  1QYE A;  4MP2 A;  4JAV A;  2YI5 A;  1Y8N A;  2YKI A;  2XK2 A;  5F3K A;  3VHD A;  3EHF A;  1KIJ A;  4GEE A;  4NH7 A;  4ZVI A;  5M4H A;  1Y8P A;  4QPJ A;  2YE2 A;  4P8O A;  1YT2 A;  1I5C A;  2XCM A;  4L94 A;  4JAS A;  4ASB A;  4CWO A;  3T2S A;  2AKP A;  3RKZ A;  3FT5 A;  3A0Y A;  2CCT A;  4LWI A; 
#chains in the Genus database with same CATH topology
 1I5A A;  4U93 A;  4K4O A;  3WHA A;  3QDD A;  4E72 A;  1YS3 A;  1BYQ A;  4DUH A;  3CYG A;  3T10 A;  1US7 A;  2YJW A;  2XX5 A;  3B24 A;  3T0Z A;  1YT1 A;  2WI5 A;  5M4K A;  5C93 A;  4ASA A;  4E00 A;  4I3H A;  4W7T A;  2YEI A;  1QZR A;  1YT0 A;  3HEK A;  4HXW A;  2YEH A;  3FT8 A;  2PNR A;  3GIE A;  3OW6 A;  3SL2 A;  5BOD A;  3OMU A;  4V25 A;  1TIL A;  1Y4S A;  1PVG A;  2BYI A;  4CWF A;  4CE2 A;  2ZDY A;  2HG1 A;  2VCI A;  4L8Z A;  5D7C A;  2BRE A;  2YEB A;  4XIT A;  5M4P A;  4AWQ A;  3U67 A;  1F51 A;  4CWP A;  1B63 A;  4MP7 A;  5IDJ A;  1UY8 A;  3TZ4 A;  4H7Q A;  2E0A A;  4CWQ A;  2YEG A;  2YI6 A;  4EFT A;  4FMT A;  4H85 A;  3R4N A;  2IWS A;  3RLR A;  4O04 A;  4KTN A;  1S14 A;  4CWT A;  3O0I A;  5J6A A;  4PL9 A;  4GFN A;  5M4E A;  1NHH A;  4FPP A;  1TH8 A;  1NHI A;  4PU9 A;  4LPB A;  3U2D A;  2Q8I A;  5L3J A;  3Q5L A;  2H8M A;  4YKR A;  5JEN A;  3CGY A;  4LP0 A;  3R92 A;  3INW A;  1ZXM A;  3ZKB A;  4YKX A;  1AJ6 A;  4E01 A;  1GJV A;  2XHX A;  2QG0 A;  2YKB A;  4XKO A;  4V26 A;  3WQ9 A;  2H55 A;  1ZW9 A;  3CGZ A;  4KSH A;  1YC3 A;  2BU2 A;  1H7S A;  1U0Z A;  2ESA A;  3TUH A;  2YEC A;  4HXZ A;  5FWK A;  1TBW A;  1TID A;  4EGH A;  4AS9 A;  4CE1 A;  3A0R A;  1R62 A;  2ZKJ A;  2YEA A;  4LWG A;  1OSF A;  1I58 A;  4U7N A;  2Q8F A;  4GCZ A;  2YE8 A;  3MNR P;  4EMV A;  1ID0 A;  4PRV A;  1BGQ A;  2BU5 A;  2CCU A;  4QPK A;  1YER A;  3DGE A;  4BIZ A;  4WUD A;  2YEF A;  4GQT A;  2WEP A;  5M4N A;  3GIG B;  4YKT A;  2C1I A;  3R4M A;  2ZBK B;  1GKX A;  1UY7 A;  4Q20 A;  4YKY A;  5CPH A;  2YE3 A;  3INX A;  4YKW A;  3Q5K A;  2YE6 A;  4XCL A;  1B62 A;  2YE9 A;  4URN A;  2CCS A;  4BAE A;  1UYD A;  4B6C A;  4XIR A;  1AM1 A;  2YK9 A;  3BMY A;  4BQG A;  3NMQ A;  4L93 A;  2EXL A;  1UYG A;  3U2K A;  2GFD A;  2Q8G A;  2GQP A;  3HHU A;  3K99 A;  2FWZ A;  2YI0 A;  2YEE A;  3G7B A;  4CWN A;  1TC6 A;  4O09 A;  1GKZ A;  4URO A;  4XC0 A;  2WEQ A;  2K5B A;  3TTZ A;  1Z5B A;  5FNC A;  3OWB A;  1S16 A;  3C11 A;  4HYP A;  4L90 A;  4O07 A;  4CE3 A;  4BQJ A;  3K97 A;  3B28 A;  2XAB A;  2IOP A;  2WI2 A;  1Y4U A;  4I5S A;  2O1W A;  1UYK A;  3OPD A;  1UYL A;  3D36 A;  2BSM A;  4X9L A;  4XDM A;  4CWS A;  4P7A A;  4LWE A;  1B3Q A;  4FCP A;  3TZ0 A;  5CF0 A;  2XHT A;  1EI1 A;  4EFU A;  2WI7 A;  2VCJ A;  2FWY A;  1UYF A;  4B7P A;  2YEJ A;  2XJJ A;  3EHG A;  4CWR A;  3EHH A;  5BOC A;  1YC4 A;  1BKN A;  4R1F A;  2QFO A;  2YKC A;  4XKK A;  3EHJ A;  2IOR A;  2XDK A;  1MU5 A;  5M4M A;  5CTX A;  3Q5J A;  4KQV A;  3D2R A;  5IDM A;  4MOT A;  3LMM A;  4FCQ A;  1QY8 A;  3S5T A;  4XIQ A;  1I59 A;  3CWV A;  3PEH A;  2XDS A;  3HZ1 A;  3K60 A;  4HZ5 A;  3HYY A;  4LWH A;  2BT0 A;  3ZXO A;  1AH8 A;  4BXI A;  4XE2 A;  2FXS A;  2XX4 A;  3B25 A;  3R4O A;  3RLP A;  4ASF A;  2WI1 A;  2IWU A;  2BZ5 A;  4E02 A;  3QTF A;  2YKJ A;  5J71 A;  1H7U A;  4MBC A;  1KZN A;  3T1K A;  4O0B A;  1MX0 A;  3ZKD A;  2XJX A;  3A0Z A;  4MPC A;  1Z59 A;  2C2A A;  1UYI A;  4R3M A;  1YC1 A;  1Z5C A;  4MB9 A;  4HZ0 A;  4HY1 A;  2FYP A;  3R91 A;  4EGI A;  2Q2E B;  4PRX A;  2UWD A;  2Q8H A;  4L91 A;  1ZXN A;  4WUB A;  2VWC A;  4URM A;  3C0E A;  3TZ5 A;  2WI4 A;  3LPS A;  1YSZ A;  5FND A;  2YE7 A;  2YGE A;  3D0B A;  4ASG A;  4XIP A;  4NH8 A;  3TZ2 A;  5GGZ A;  5CTU A;  4XCJ A;  2BU8 A;  3CRL A;  2XDL A;  1JM6 A;  3OWD A;  2YE5 A;  1YSR A;  3B26 A;  4GGL A;  3ZXQ A;  4AWO A;  1UYC A;  3JZ3 A;  2ZDX A;  4NH9 A;  3H4L A;  3ZM7 A;  2CG9 A;  1Y8O A;  2IWX A;  2WI6 A;  1UYE A;  3KE6 A;  2YJX A;  4KSG A;  2YGA A;  2QF6 A;  2WER A;  2C1G A;  4WUC A;  1U2O A;  5D6Q A;  3EKO A;  5CTW A;  1UYM A;  1NHJ A;  4JAU A;  4O05 A;  2HHI A;  3A0X A;  2YKE A;  1UYH A;  4AWP A;  1THN A;  1ZWH A;  2YED A;  3O2F A;  5D7D A;  4U7O A;  4GT8 A;  3G75 A;  4FCR A;  2BRC A;  2WI3 A;  2XHR A;  4URL A;  3IED A;  2XX2 A;  1BXD A;  2YK2 A;  2YI7 A;  4ZKI A;  3VAD A;  1UY6 A;  5FNF A;  3GIG A;  5CTY A;  1IXM A;  2JJC A;  1UY9 A;  4LWF A;  3GIF A;  1TC0 A;  3CRK A;  4XKA A;  1YES A;  2YGF A;  3VHA A;  2XJG A;  4EM7 A;  5F5R A;  4KP4 A;  3K98 A;  4KFG A;  2HKJ A;  2VW5 A;  2FTK A;  1AMW A;  2IOQ A;  4YKQ A;  3BM9 A;  5D7R A;  3G7E A;  4JQL A;  2BU7 A;  2O1V A;  3A0T A;  2XD6 A;  3H80 A;  4HYM A;  4MPN A;  2CH4 A;  4HY6 A;  2O1U A;  3B27 A;  3PEJ A;  2CGF A;  1YET A;  3LNU A;  2BU6 A;  4MPE A;  2BYH A;  3T0H A;  2YE4 A;  1I5D A;  3FV5 A;  4XD8 A;  4R3A A;  4BIU A;  4EGK A;  3HYZ A;  4XTJ A;  3RLQ A;  2XDX A;  3A0W A;  2XDU A;  3EKR A;  5IN9 A;  4EEH A;  3HZ5 A;  4H81 A;  1L0O A;  4YKU A;  1EA6 A;  3VHC A;  1I5B A;  1A4H A;  5D6P A;  2HCH A;  3O6O A;  3R4P A;  4YKZ A;  4DZY A;  1Z5A A;  2BTZ A;  2QG2 A;  2JKI A;  1AH6 A;  1QYE A;  4MP2 A;  4JAV A;  2YI5 A;  1Y8N A;  2YKI A;  2XK2 A;  5F3K A;  3VHD A;  3EHF A;  1KIJ A;  4GEE A;  4NH7 A;  4ZVI A;  5M4H A;  1Y8P A;  4QPJ A;  2YE2 A;  4P8O A;  1YT2 A;  1I5C A;  2XCM A;  4L94 A;  4JAS A;  4ASB A;  4CWO A;  3T2S A;  2AKP A;  3RKZ A;  3FT5 A;  3A0Y A;  2CCT A;  4LWI A; 
#chains in the Genus database with same CATH homology
 1I5A A;  4U93 A;  4K4O A;  3WHA A;  3QDD A;  1YS3 A;  1BYQ A;  4DUH A;  3T10 A;  1US7 A;  2YJW A;  2XX5 A;  3B24 A;  3T0Z A;  1YT1 A;  2WI5 A;  5M4K A;  5C93 A;  4ASA A;  4E00 A;  4I3H A;  4W7T A;  2YEI A;  1QZR A;  1YT0 A;  3HEK A;  4HXW A;  2YEH A;  3FT8 A;  2PNR A;  3GIE A;  3OW6 A;  3SL2 A;  5BOD A;  3OMU A;  4V25 A;  1TIL A;  1Y4S A;  1PVG A;  2BYI A;  4CWF A;  4CE2 A;  2ZDY A;  2HG1 A;  2VCI A;  4L8Z A;  5D7C A;  2BRE A;  2YEB A;  4XIT A;  5M4P A;  4AWQ A;  3U67 A;  4CWP A;  1B63 A;  4MP7 A;  5IDJ A;  1UY8 A;  3TZ4 A;  4H7Q A;  2E0A A;  4CWQ A;  2YEG A;  2YI6 A;  4EFT A;  4FMT A;  4H85 A;  3R4N A;  2IWS A;  3RLR A;  4O04 A;  4KTN A;  1S14 A;  4CWT A;  3O0I A;  5J6A A;  4PL9 A;  4GFN A;  5M4E A;  1NHH A;  4FPP A;  1TH8 A;  1NHI A;  4PU9 A;  4LPB A;  3U2D A;  2Q8I A;  5L3J A;  3Q5L A;  2H8M A;  4YKR A;  3CGY A;  4LP0 A;  3R92 A;  3INW A;  1ZXM A;  3ZKB A;  4YKX A;  1AJ6 A;  4E01 A;  1GJV A;  2XHX A;  2QG0 A;  2YKB A;  4XKO A;  4V26 A;  3WQ9 A;  2H55 A;  1ZW9 A;  3CGZ A;  4KSH A;  1YC3 A;  2BU2 A;  1H7S A;  1U0Z A;  2ESA A;  3TUH A;  2YEC A;  4HXZ A;  5FWK A;  1TBW A;  1TID A;  4EGH A;  4AS9 A;  4CE1 A;  3A0R A;  1R62 A;  2ZKJ A;  2YEA A;  4LWG A;  1OSF A;  1I58 A;  4U7N A;  2Q8F A;  4GCZ A;  2YE8 A;  3MNR P;  4EMV A;  1ID0 A;  4PRV A;  1BGQ A;  2BU5 A;  2CCU A;  4QPK A;  1YER A;  3DGE A;  4BIZ A;  4WUD A;  2YEF A;  4GQT A;  2WEP A;  5M4N A;  3GIG B;  4YKT A;  3R4M A;  2ZBK B;  1GKX A;  1UY7 A;  4Q20 A;  4YKY A;  5CPH A;  2YE3 A;  3INX A;  4YKW A;  3Q5K A;  2YE6 A;  4XCL A;  1B62 A;  2YE9 A;  4URN A;  2CCS A;  4BAE A;  1UYD A;  4B6C A;  4XIR A;  1AM1 A;  2YK9 A;  3BMY A;  4BQG A;  3NMQ A;  4L93 A;  2EXL A;  1UYG A;  3U2K A;  2GFD A;  2Q8G A;  2GQP A;  3HHU A;  3K99 A;  2FWZ A;  2YI0 A;  2YEE A;  3G7B A;  4CWN A;  1TC6 A;  4O09 A;  1GKZ A;  4URO A;  4XC0 A;  2WEQ A;  2K5B A;  3TTZ A;  1Z5B A;  5FNC A;  3OWB A;  1S16 A;  3C11 A;  4HYP A;  4L90 A;  4O07 A;  4CE3 A;  4BQJ A;  3K97 A;  3B28 A;  2XAB A;  2IOP A;  2WI2 A;  1Y4U A;  4I5S A;  2O1W A;  1UYK A;  3OPD A;  1UYL A;  3D36 A;  2BSM A;  4X9L A;  4XDM A;  4CWS A;  4P7A A;  4LWE A;  1B3Q A;  4FCP A;  3TZ0 A;  5CF0 A;  2XHT A;  1EI1 A;  4EFU A;  2WI7 A;  2VCJ A;  2FWY A;  1UYF A;  4B7P A;  2YEJ A;  2XJJ A;  3EHG A;  4CWR A;  3EHH A;  5BOC A;  1YC4 A;  1BKN A;  4R1F A;  2QFO A;  2YKC A;  4XKK A;  3EHJ A;  2IOR A;  2XDK A;  1MU5 A;  5M4M A;  5CTX A;  3Q5J A;  4KQV A;  3D2R A;  5IDM A;  4MOT A;  4FCQ A;  1QY8 A;  4XIQ A;  1I59 A;  3CWV A;  3PEH A;  2XDS A;  3HZ1 A;  3K60 A;  4HZ5 A;  3HYY A;  4LWH A;  2BT0 A;  3ZXO A;  1AH8 A;  4BXI A;  4XE2 A;  2FXS A;  2XX4 A;  3B25 A;  3R4O A;  3RLP A;  4ASF A;  2WI1 A;  2IWU A;  2BZ5 A;  4E02 A;  3QTF A;  2YKJ A;  5J71 A;  1H7U A;  4MBC A;  1KZN A;  3T1K A;  4O0B A;  1MX0 A;  3ZKD A;  2XJX A;  3A0Z A;  4MPC A;  1Z59 A;  2C2A A;  1UYI A;  4R3M A;  1YC1 A;  1Z5C A;  4MB9 A;  4HZ0 A;  4HY1 A;  2FYP A;  3R91 A;  4EGI A;  2Q2E B;  4PRX A;  2UWD A;  2Q8H A;  4L91 A;  1ZXN A;  4WUB A;  2VWC A;  4URM A;  3C0E A;  3TZ5 A;  2WI4 A;  3LPS A;  1YSZ A;  5FND A;  2YE7 A;  2YGE A;  3D0B A;  4ASG A;  4XIP A;  4NH8 A;  3TZ2 A;  5GGZ A;  5CTU A;  4XCJ A;  2BU8 A;  3CRL A;  2XDL A;  1JM6 A;  3OWD A;  2YE5 A;  1YSR A;  3B26 A;  4GGL A;  3ZXQ A;  4AWO A;  1UYC A;  3JZ3 A;  2ZDX A;  4NH9 A;  3H4L A;  3ZM7 A;  2CG9 A;  1Y8O A;  2IWX A;  2WI6 A;  1UYE A;  3KE6 A;  2YJX A;  4KSG A;  2YGA A;  2QF6 A;  2WER A;  4WUC A;  1U2O A;  5D6Q A;  3EKO A;  5CTW A;  1UYM A;  1NHJ A;  4JAU A;  4O05 A;  3A0X A;  2YKE A;  1UYH A;  4AWP A;  1THN A;  1ZWH A;  2YED A;  3O2F A;  5D7D A;  4U7O A;  4GT8 A;  3G75 A;  4FCR A;  2BRC A;  2WI3 A;  2XHR A;  4URL A;  3IED A;  2XX2 A;  1BXD A;  2YK2 A;  2YI7 A;  4ZKI A;  3VAD A;  1UY6 A;  5FNF A;  3GIG A;  5CTY A;  2JJC A;  1UY9 A;  4LWF A;  3GIF A;  1TC0 A;  3CRK A;  4XKA A;  1YES A;  2YGF A;  3VHA A;  2XJG A;  4EM7 A;  5F5R A;  4KP4 A;  3K98 A;  4KFG A;  2HKJ A;  2VW5 A;  1AMW A;  2IOQ A;  4YKQ A;  3BM9 A;  5D7R A;  3G7E A;  4JQL A;  2BU7 A;  2O1V A;  3A0T A;  2XD6 A;  3H80 A;  4HYM A;  4MPN A;  2CH4 A;  4HY6 A;  2O1U A;  3B27 A;  3PEJ A;  2CGF A;  1YET A;  3LNU A;  2BU6 A;  4MPE A;  2BYH A;  3T0H A;  2YE4 A;  1I5D A;  3FV5 A;  4XD8 A;  4R3A A;  4BIU A;  4EGK A;  3HYZ A;  4XTJ A;  3RLQ A;  2XDX A;  3A0W A;  2XDU A;  3EKR A;  5IN9 A;  4EEH A;  3HZ5 A;  4H81 A;  1L0O A;  4YKU A;  1EA6 A;  3VHC A;  1I5B A;  1A4H A;  5D6P A;  2HCH A;  3O6O A;  3R4P A;  4YKZ A;  4DZY A;  1Z5A A;  2BTZ A;  2QG2 A;  2JKI A;  1AH6 A;  1QYE A;  4MP2 A;  4JAV A;  2YI5 A;  1Y8N A;  2YKI A;  2XK2 A;  5F3K A;  3VHD A;  3EHF A;  1KIJ A;  4GEE A;  4NH7 A;  4ZVI A;  5M4H A;  1Y8P A;  4QPJ A;  2YE2 A;  4P8O A;  1YT2 A;  1I5C A;  2XCM A;  4L94 A;  4JAS A;  4ASB A;  4CWO A;  3T2S A;  2AKP A;  3RKZ A;  3FT5 A;  3A0Y A;  2CCT A;  4LWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...