3IEDA

Crystal structure of n-terminal domain of plasmodium falciparum hsp90 (pf14_0417) in complex with amppn
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
258
structure length
224
Chain Sequence
b'RENLYFQGSPVEKYNFKAEVNKVMDIIVNSLYTDKDVFLRELISNASDACDKKRIILENNKLIKDAEVNDIKKLIIKIKPDKEKKTLTITDNGIGMDKSELINNLGTIAQSGTAKFLKQIEEGKADSNLIGQFGVGFYSSFLVSNRVEVYTKKEDQIYRWSSDLKGSFSVNEIKKYDQEYIKGSGTKIILHLKEECDEYLEDYKLKELIKKYSEFIKFPIEIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat shock protein
publication title Crystal structure of N-terminal domain of Plasmodium falciparum Hsp90 (PF14_0417) in complex with AMPPN
rcsb
source organism Plasmodium falciparum
molecule tags Chaperone
total genus 66
structure length 224
sequence length 258
ec nomenclature
pdb deposition date 2009-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3iedA00
2CCSA 3GIGA 2BU7A 4B6CA 4MPNA 1EA6A 4R1FA 5F3KA 2GFDA 3K99A 5L3JA 2JJCA 1ID0A 3CRKA 2WI2A 4U7NA 3DGEA 4XE2A 3GIGB 3WHAA 3TZ0A 4GEEA 3GIFA 2CG9A 3C11A 2YE6A 2BZ5A 2VCIA 2XJJA 1I59A 1US7A 3HEKA 3WQ9A 4H81A 4U93A 1BGQA 1ZWHA 2YGEA 4B7PA 3D36A 3A0ZA 3FT5A 4XKAA 3O0IA 5D7RA 3IEDA 2AKPA 3A0RA 4E00A 3QDDA 5CTXA 1ZXMA 4FCQA 4LWIA 4KFGA 1UYKA 2Q8IA 5BODA 5FNCA 3CGZA 1YT2A 1GJVA 1UYLA 1NHHA 5D7DA 2CCUA 5CTWA 1UYIA 4XC0A 3EKRA 2YJXA 3K60A 4I5SA 1YSRA 4ASBA 4ASFA 2ZDYA 4V26A 1H7SA 4O05A 1MX0A 3T0ZA 1S16A 2CGFA 1U0ZA 1BYQA 2XD6A 2WI7A 1I5BA 4URLA 2YE3A 1JM6A 4P8OA 4CE2A 5J6AA 3OWBA 4PL9A 2O1VA 4JAUA 1Y4UA 2VCJA 3HZ5A 3B25A 2YI0A 3INWA 2XHTA 3EKOA 3EHGA 2YI6A 3R4MA 3EHJA 2H8MA 4EGHA 2FYPA 4XIPA 1UYGA 4XCLA 1BKNA 4O0BA 4JASA 2IWXA 1S14A 3Q5JA 3RLRA 5IDMA 2BU8A 2XHXA 4MP7A 3SL2A 1I5DA 3ZXOA 4V25A 2IOPA 5CF0A 2XK2A 4DZYA 4CWFA 5CTUA 4YKYA 2YE7A 4LPBA 1Z5CA 4XD8A 4MP2A 1GKZA 2QFOA 2WI3A 4FMTA 4PRXA 1Z59A 2WI1A 3G75A 2BU5A 4KQVA 3ZKBA 5M4PA 4BQGA 2XX4A 4W7TA 3A0WA 5D6QA 4AWPA 1B63A 2O1UA 3JZ3A 3OW6A 5FNDA 2YEAA 2E0AA 2ZBKB 4O09A 4URMA 3T10A 1L0OA 3A0YA 4MPCA 1YT0A 4U7OA 4PRVA 1YSZA 3Q5KA 4KTNA 4EMVA 1TC6A 4L8ZA 3G7BA 1YT1A 1Z5BA 4H7QA 2IOQA 4LWEA 2XHRA 4MBCA 2O1WA 4KSGA 2XDUA 1YETA 1AJ6A 4HXWA 1Y8PA 3EHHA 5M4MA 2XDXA 4L94A 4KSHA 2BYIA 3BMYA 4L93A 4GGLA 1U2OA 2YEIA 4LWHA 4YKUA 2YEHA 2YECA 4NH7A 3GIEA 4WUCA 3T0HA 3B27A 4R3AA 2YEFA 3OWDA 1UY7A 3PEHA 2FWYA 3T2SA 3Q5LA 2ZKJA 4BAEA 1KZNA 1Z5AA 3B26A 1YESA 1A4HA 2XDSA 3RKZA 4HYPA 4EM7A 3R92A 3INXA 4X9LA 3O2FA 2IWUA 4FCRA 2Q8FA 3RLPA 2WI6A 2YKEA 1EI1A 2HCHA 4H85A 3HHUA 4JAVA 2GQPA 1ZXNA 4FPPA 4CWOA 2XDLA 4KP4A 4EGKA 2JKIA 3C0EA 3VHDA 4QPKA 3HZ1A 3T1KA 4CWPA 3B24A 1Y8OA 2YEBA 1QYEA 1UYMA 4MPEA 1UY6A 2CH4A 4HZ5A 4EFTA 4GCZA 4CE1A 3EHFA 4XKKA 4AS9A 3D2RA 4BQJA 3ZKDA 2WEPA 2BU6A 2BREA 4AWQA 3VHAA 5CTYA 1QZRA 4JQLA 1I5AA 2VW5A 2YK9A 4L91A 3HYZA 4CE3A 4GQTA 2YKBA 3R4PA 1PVGA 2XJGA 3CRLA 4O07A 4QPJA 2YEJA 3TTZA 4NH9A 4BXIA 2PNRA 4NH8A 4CWTA 1TBWA 1I5CA 2UWDA 2BRCA 3KE6A 4CWNA 2BTZA 2ESAA 1NHIA 2IORA 2BSMA 2YE9A 2WEQA 3D0BA 4CWQA 1B3QA 4E02A 1UYEA 5M4EA 3OMUA 3TZ2A 2C2AA 4ASGA 2XCMA 3MNRP 1Y4SA 4YKQA 3G7EA 4XITA 2YGAA 4XKOA 5IN9A 4HY1A 1KIJA 3R4NA 4YKTA 3VHCA 2XX5A 4GT8A 5M4HA 4BIZA 4HZ0A 5D7CA 1UY8A 2ZDXA 1ZW9A 4ASAA 1YC1A 3B28A 4LWGA 2IWSA 5IDJA 4XIRA 3BM9A 2YE5A 3OPDA 2WI5A 3CGYA 2EXLA 2FWZA 3ZXQA 4HY6A 2YEGA 2QF6A 4R3MA 3R4OA 4K4OA 4ZKIA 3LNUA 4XDMA 5M4NA 1BXDA 5FNFA 3H80A 1UYFA 3TZ5A 1AH6A 1TILA 2YE4A 4WUDA 1UYCA 5F5RA 1H7UA 4YKWA 4MOTA 1R62A 3CWVA 3ZM7A 4CWSA 4WUBA 2HKJA 2YKJA 2CCTA 4YKXA 3TZ4A 4Q20A 1GKXA 2Q8GA 1AM1A 2QG0A 2QG2A 3FV5A 1AH8A 2Q2EB 4EFUA 3VADA 2VWCA 1THNA 2YKIA 2XX2A 3NMQA 2BYHA 2YE8A 4HXZA 4ZVIA 4EEHA 2XDKA 2YKCA 3HYYA 1B62A 3K97A 4FCPA 1Y8NA 3U2DA 1YERA 2HG1A 2XABA 2FXSA 3FT8A 5BOCA 1UYDA 4I3HA 1I58A 1QY8A 1OSFA 4GFNA 2YI5A 4MB9A 4E01A 1TC0A 5C93A 4BIUA 4LWFA 3U2KA 2WERA 5CPHA 5M4KA 2YI7A 2XJXA 4DUHA 3LPSA 1MU5A 4EGIA 3A0XA 4PU9A 1TH8A 4YKZA 4URNA 4AWOA 3QTFA 4UROA 3K98A 3TUHA 2YK2A 1TIDA 1UY9A 3A0TA 4YKRA 5D6PA 2YJWA 5J71A 3R91A 2YGFA 4P7AA 1YC4A 3O6OA 2YEEA 2K5BA 3U67A 4HYMA 4XCJA 4XIQA 2YE2A 2BU2A 5FWKA 3PEJA 2WI4A 4XTJA 1YS3A 2Q8HA 1UYHA 1NHJA 2BT0A 5GGZA 3H4LA 1YC3A 4O04A 2H55A 4L90A 1AMWA 3RLQA 4LP0A 2YEDA 4CWRA
chains in the Genus database with same CATH superfamily
2CCSA 3GIGA 2BU7A 4B6CA 4MPNA 1EA6A 4R1FA 5F3KA 2GFDA 3K99A 5L3JA 2JJCA 1ID0A 3CRKA 2WI2A 4U7NA 3DGEA 4XE2A 3GIGB 3WHAA 1IXMA 3TZ0A 4GEEA 1F51A 3GIFA 2CG9A 3C11A 2YE6A 2BZ5A 2VCIA 2XJJA 1I59A 1US7A 3HEKA 3WQ9A 4H81A 4U93A 1BGQA 1ZWHA 2YGEA 4B7PA 3D36A 3A0ZA 3FT5A 4XKAA 3O0IA 5D7RA 3IEDA 2AKPA 3A0RA 4E00A 3QDDA 5CTXA 5JENA 1ZXMA 4FCQA 4LWIA 4KFGA 1UYKA 2Q8IA 5BODA 5FNCA 3CGZA 1YT2A 1GJVA 1UYLA 1NHHA 5D7DA 2CCUA 5CTWA 1UYIA 4XC0A 3EKRA 2YJXA 3K60A 4I5SA 1YSRA 3LMMA 4ASBA 4ASFA 2ZDYA 4V26A 1H7SA 2FTKA 1MX0A 4O05A 3T0ZA 1S16A 2CGFA 1U0ZA 1BYQA 2XD6A 2WI7A 1I5BA 4URLA 2YE3A 1JM6A 4P8OA 4CE2A 5J6AA 3OWBA 4PL9A 2O1VA 4JAUA 1Y4UA 2VCJA 3HZ5A 3B25A 2YI0A 3INWA 2XHTA 3EKOA 3EHGA 2YI6A 3CYGA 3R4MA 3EHJA 2H8MA 4EGHA 2FYPA 4XIPA 1UYGA 4XCLA 1BKNA 4O0BA 4JASA 2IWXA 1S14A 3Q5JA 3RLRA 5IDMA 2BU8A 2XHXA 4MP7A 3SL2A 1I5DA 3ZXOA 4V25A 2IOPA 5CF0A 2XK2A 4DZYA 4CWFA 5CTUA 4YKYA 2YE7A 4LPBA 1Z5CA 4XD8A 4MP2A 1GKZA 2QFOA 2WI3A 4FMTA 4PRXA 1Z59A 2WI1A 3G75A 2BU5A 4KQVA 3ZKBA 5M4PA 4BQGA 2XX4A 4W7TA 3A0WA 5D6QA 4AWPA 1B63A 2O1UA 3JZ3A 3OW6A 5FNDA 2YEAA 2E0AA 2ZBKB 4O09A 4URMA 3T10A 1L0OA 3A0YA 4MPCA 1YT0A 4U7OA 4PRVA 1YSZA 3Q5KA 4KTNA 4EMVA 1TC6A 4L8ZA 3G7BA 1YT1A 1Z5BA 4H7QA 2IOQA 4LWEA 2XHRA 4MBCA 2O1WA 4KSGA 2XDUA 1YETA 1AJ6A 4HXWA 1Y8PA 3EHHA 5M4MA 2XDXA 4L94A 4KSHA 2BYIA 3BMYA 4L93A 4GGLA 1U2OA 2YEIA 4LWHA 4YKUA 2YEHA 2YECA 4NH7A 3GIEA 4WUCA 3T0HA 3B27A 4R3AA 2YEFA 3OWDA 1UY7A 3PEHA 2FWYA 3T2SA 3Q5LA 2ZKJA 4BAEA 1KZNA 1Z5AA 3B26A 1YESA 1A4HA 2XDSA 3RKZA 4HYPA 4EM7A 3R92A 3INXA 4X9LA 3O2FA 2IWUA 4FCRA 2Q8FA 3RLPA 2WI6A 2YKEA 1EI1A 2HCHA 4H85A 3HHUA 4JAVA 2GQPA 1ZXNA 4FPPA 4CWOA 2XDLA 4KP4A 4EGKA 2JKIA 3C0EA 3VHDA 4QPKA 3HZ1A 3T1KA 4CWPA 3B24A 1Y8OA 2YEBA 1QYEA 1UYMA 4MPEA 1UY6A 2CH4A 4HZ5A 4EFTA 4GCZA 4CE1A 3EHFA 4XKKA 4AS9A 3D2RA 4BQJA 3ZKDA 2WEPA 2BU6A 2BREA 4AWQA 3VHAA 5CTYA 1QZRA 4JQLA 1I5AA 2VW5A 2YK9A 4L91A 3HYZA 4CE3A 4E72A 4GQTA 2YKBA 3R4PA 1PVGA 2XJGA 3CRLA 4O07A 4QPJA 2YEJA 3TTZA 4NH9A 4BXIA 2PNRA 4NH8A 4CWTA 1TBWA 1I5CA 2UWDA 2BRCA 3KE6A 4CWNA 2BTZA 2ESAA 1NHIA 2IORA 2BSMA 2YE9A 2WEQA 3D0BA 4CWQA 1B3QA 4E02A 1UYEA 5M4EA 3OMUA 3TZ2A 2HHIA 2C2AA 4ASGA 2XCMA 3MNRP 1Y4SA 4YKQA 3G7EA 4XITA 3S5TA 2YGAA 4XKOA 5IN9A 4HY1A 1KIJA 3R4NA 4YKTA 3VHCA 2XX5A 4GT8A 5M4HA 4BIZA 4HZ0A 5D7CA 1UY8A 2ZDXA 1ZW9A 4ASAA 1YC1A 3B28A 4LWGA 2IWSA 5IDJA 4XIRA 3BM9A 2YE5A 3OPDA 2WI5A 3CGYA 2EXLA 2FWZA 3ZXQA 4HY6A 2YEGA 2QF6A 4R3MA 3R4OA 4K4OA 4ZKIA 3LNUA 4XDMA 5M4NA 1BXDA 5FNFA 3H80A 1UYFA 3TZ5A 1AH6A 1TILA 2YE4A 4WUDA 1UYCA 5F5RA 1H7UA 4YKWA 4MOTA 1R62A 3CWVA 3ZM7A 4CWSA 4WUBA 2HKJA 2YKJA 2CCTA 4YKXA 3TZ4A 4Q20A 1GKXA 2Q8GA 1AM1A 2QG0A 2QG2A 3FV5A 1AH8A 2Q2EB 4EFUA 3VADA 2VWCA 1THNA 2YKIA 2XX2A 3NMQA 2BYHA 2YE8A 4HXZA 4ZVIA 4EEHA 2XDKA 2YKCA 3HYYA 1B62A 3K97A 4FCPA 1Y8NA 3U2DA 1YERA 2HG1A 2XABA 2FXSA 3FT8A 5BOCA 1UYDA 4I3HA 1I58A 1QY8A 1OSFA 4GFNA 2YI5A 4MB9A 4E01A 1TC0A 5C93A 4BIUA 4LWFA 3U2KA 2WERA 5CPHA 5M4KA 2YI7A 2XJXA 4DUHA 3LPSA 1MU5A 4EGIA 3A0XA 4PU9A 1TH8A 4YKZA 4URNA 4AWOA 3QTFA 4UROA 3K98A 3TUHA 2YK2A 1TIDA 1UY9A 2C1IA 3A0TA 4YKRA 5D6PA 2YJWA 5J71A 3R91A 2YGFA 4P7AA 1YC4A 3O6OA 2YEEA 2K5BA 3U67A 4HYMA 4XCJA 4XIQA 2YE2A 2BU2A 5FWKA 3PEJA 2WI4A 4XTJA 1YS3A 2Q8HA 1UYHA 1NHJA 2BT0A 5GGZA 2C1GA 3H4LA 1YC3A 4O04A 2H55A 4L90A 1AMWA 3RLQA 4LP0A 2YEDA 4CWRA
chains in the Genus database with same CATH topology
2CCSA 3GIGA 2BU7A 4B6CA 4MPNA 1EA6A 4R1FA 5F3KA 2GFDA 3K99A 5L3JA 2JJCA 1ID0A 3CRKA 2WI2A 4U7NA 3DGEA 4XE2A 3GIGB 3WHAA 3TZ0A 4GEEA 3GIFA 2CG9A 3C11A 2YE6A 2BZ5A 2VCIA 2XJJA 1I59A 1US7A 3HEKA 3WQ9A 4H81A 4U93A 1BGQA 1ZWHA 2YGEA 4B7PA 3D36A 3A0ZA 3FT5A 4XKAA 3O0IA 5D7RA 3IEDA 2AKPA 3A0RA 4E00A 3QDDA 5CTXA 1ZXMA 4FCQA 4LWIA 4KFGA 1UYKA 2Q8IA 5BODA 5FNCA 3CGZA 1YT2A 1GJVA 1UYLA 1NHHA 5D7DA 2CCUA 5CTWA 1UYIA 4XC0A 3EKRA 2YJXA 3K60A 4I5SA 1YSRA 4ASBA 4ASFA 2ZDYA 4V26A 1H7SA 4O05A 1MX0A 3T0ZA 1S16A 2CGFA 1U0ZA 1BYQA 2XD6A 2WI7A 1I5BA 4URLA 2YE3A 1JM6A 4P8OA 4CE2A 5J6AA 3OWBA 4PL9A 2O1VA 4JAUA 1Y4UA 2VCJA 3HZ5A 3B25A 2YI0A 3INWA 2XHTA 3EKOA 3EHGA 2YI6A 3R4MA 3EHJA 2H8MA 4EGHA 2FYPA 4XIPA 1UYGA 4XCLA 1BKNA 4O0BA 4JASA 2IWXA 1S14A 3Q5JA 3RLRA 5IDMA 2BU8A 2XHXA 4MP7A 3SL2A 1I5DA 3ZXOA 4V25A 2IOPA 5CF0A 2XK2A 4DZYA 4CWFA 5CTUA 4YKYA 2YE7A 4LPBA 1Z5CA 4XD8A 4MP2A 1GKZA 2QFOA 2WI3A 4FMTA 4PRXA 1Z59A 2WI1A 3G75A 2BU5A 4KQVA 3ZKBA 5M4PA 4BQGA 2XX4A 4W7TA 3A0WA 5D6QA 4AWPA 1B63A 2O1UA 3JZ3A 3OW6A 5FNDA 2YEAA 2E0AA 2ZBKB 4O09A 4URMA 3T10A 1L0OA 3A0YA 4MPCA 1YT0A 4U7OA 4PRVA 1YSZA 3Q5KA 4KTNA 4EMVA 1TC6A 4L8ZA 3G7BA 1YT1A 1Z5BA 4H7QA 2IOQA 4LWEA 2XHRA 4MBCA 2O1WA 4KSGA 2XDUA 1YETA 1AJ6A 4HXWA 1Y8PA 3EHHA 5M4MA 2XDXA 4L94A 4KSHA 2BYIA 3BMYA 4L93A 4GGLA 1U2OA 2YEIA 4LWHA 4YKUA 2YEHA 2YECA 4NH7A 3GIEA 4WUCA 3T0HA 3B27A 4R3AA 2YEFA 3OWDA 1UY7A 3PEHA 2FWYA 3T2SA 3Q5LA 2ZKJA 4BAEA 1KZNA 1Z5AA 3B26A 1YESA 1A4HA 2XDSA 3RKZA 4HYPA 4EM7A 3R92A 3INXA 4X9LA 3O2FA 2IWUA 4FCRA 2Q8FA 3RLPA 2WI6A 2YKEA 1EI1A 2HCHA 4H85A 3HHUA 4JAVA 2GQPA 1ZXNA 4FPPA 4CWOA 2XDLA 4KP4A 4EGKA 2JKIA 3C0EA 3VHDA 4QPKA 3HZ1A 3T1KA 4CWPA 3B24A 1Y8OA 2YEBA 1QYEA 1UYMA 4MPEA 1UY6A 2CH4A 4HZ5A 4EFTA 4GCZA 4CE1A 3EHFA 4XKKA 4AS9A 3D2RA 4BQJA 3ZKDA 2WEPA 2BU6A 2BREA 4AWQA 3VHAA 5CTYA 1QZRA 4JQLA 1I5AA 2VW5A 2YK9A 4L91A 3HYZA 4CE3A 4GQTA 2YKBA 3R4PA 1PVGA 2XJGA 3CRLA 4O07A 4QPJA 2YEJA 3TTZA 4NH9A 4BXIA 2PNRA 4NH8A 4CWTA 1TBWA 1I5CA 2UWDA 2BRCA 3KE6A 4CWNA 2BTZA 2ESAA 1NHIA 2IORA 2BSMA 2YE9A 2WEQA 3D0BA 4CWQA 1B3QA 4E02A 1UYEA 5M4EA 3OMUA 3TZ2A 2C2AA 4ASGA 2XCMA 3MNRP 1Y4SA 4YKQA 3G7EA 4XITA 2YGAA 4XKOA 5IN9A 4HY1A 1KIJA 3R4NA 4YKTA 3VHCA 2XX5A 4GT8A 5M4HA 4BIZA 4HZ0A 5D7CA 1UY8A 2ZDXA 1ZW9A 4ASAA 1YC1A 3B28A 4LWGA 2IWSA 5IDJA 4XIRA 3BM9A 2YE5A 3OPDA 2WI5A 3CGYA 2EXLA 2FWZA 3ZXQA 4HY6A 2YEGA 2QF6A 4R3MA 3R4OA 4K4OA 4ZKIA 3LNUA 4XDMA 5M4NA 1BXDA 5FNFA 3H80A 1UYFA 3TZ5A 1AH6A 1TILA 2YE4A 4WUDA 1UYCA 5F5RA 1H7UA 4YKWA 4MOTA 1R62A 3CWVA 3ZM7A 4CWSA 4WUBA 2HKJA 2YKJA 2CCTA 4YKXA 3TZ4A 4Q20A 1GKXA 2Q8GA 1AM1A 2QG0A 2QG2A 3FV5A 1AH8A 2Q2EB 4EFUA 3VADA 2VWCA 1THNA 2YKIA 2XX2A 3NMQA 2BYHA 2YE8A 4HXZA 4ZVIA 4EEHA 2XDKA 2YKCA 3HYYA 1B62A 3K97A 4FCPA 1Y8NA 3U2DA 1YERA 2HG1A 2XABA 2FXSA 3FT8A 5BOCA 1UYDA 4I3HA 1I58A 1QY8A 1OSFA 4GFNA 2YI5A 4MB9A 4E01A 1TC0A 5C93A 4BIUA 4LWFA 3U2KA 2WERA 5CPHA 5M4KA 2YI7A 2XJXA 4DUHA 3LPSA 1MU5A 4EGIA 3A0XA 4PU9A 1TH8A 4YKZA 4URNA 4AWOA 3QTFA 4UROA 3K98A 3TUHA 2YK2A 1TIDA 1UY9A 3A0TA 4YKRA 5D6PA 2YJWA 5J71A 3R91A 2YGFA 4P7AA 1YC4A 3O6OA 2YEEA 2K5BA 3U67A 4HYMA 4XCJA 4XIQA 2YE2A 2BU2A 5FWKA 3PEJA 2WI4A 4XTJA 1YS3A 2Q8HA 1UYHA 1NHJA 2BT0A 5GGZA 3H4LA 1YC3A 4O04A 2H55A 4L90A 1AMWA 3RLQA 4LP0A 2YEDA 4CWRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CCS A;  3GIG A;  2BU7 A;  4B6C A;  4MPN A;  1EA6 A;  4R1F A;  5F3K A;  2GFD A;  3K99 A;  5L3J A;  2JJC A;  1ID0 A;  3CRK A;  2WI2 A;  4U7N A;  3DGE A;  4XE2 A;  3GIG B;  3WHA A;  3TZ0 A;  4GEE A;  3GIF A;  2CG9 A;  3C11 A;  2YE6 A;  2BZ5 A;  2VCI A;  2XJJ A;  1I59 A;  1US7 A;  3HEK A;  3WQ9 A;  4H81 A;  4U93 A;  1BGQ A;  1ZWH A;  2YGE A;  4B7P A;  3D36 A;  3A0Z A;  3FT5 A;  4XKA A;  3O0I A;  5D7R A;  3IED A;  2AKP A;  3A0R A;  4E00 A;  3QDD A;  5CTX A;  1ZXM A;  4FCQ A;  4LWI A;  4KFG A;  1UYK A;  2Q8I A;  5BOD A;  5FNC A;  3CGZ A;  1YT2 A;  1GJV A;  1UYL A;  1NHH A;  5D7D A;  2CCU A;  5CTW A;  1UYI A;  4XC0 A;  3EKR A;  2YJX A;  3K60 A;  4I5S A;  1YSR A;  4ASB A;  4ASF A;  2ZDY A;  4V26 A;  1H7S A;  4O05 A;  1MX0 A;  3T0Z A;  1S16 A;  2CGF A;  1U0Z A;  1BYQ A;  2XD6 A;  2WI7 A;  1I5B A;  4URL A;  2YE3 A;  1JM6 A;  4P8O A;  4CE2 A;  5J6A A;  3OWB A;  4PL9 A;  2O1V A;  4JAU A;  1Y4U A;  2VCJ A;  3HZ5 A;  3B25 A;  2YI0 A;  3INW A;  2XHT A;  3EKO A;  3EHG A;  2YI6 A;  3R4M A;  3EHJ A;  2H8M A;  4EGH A;  2FYP A;  4XIP A;  1UYG A;  4XCL A;  1BKN A;  4O0B A;  4JAS A;  2IWX A;  1S14 A;  3Q5J A;  3RLR A;  5IDM A;  2BU8 A;  2XHX A;  4MP7 A;  3SL2 A;  1I5D A;  3ZXO A;  4V25 A;  2IOP A;  5CF0 A;  2XK2 A;  4DZY A;  4CWF A;  5CTU A;  4YKY A;  2YE7 A;  4LPB A;  1Z5C A;  4XD8 A;  4MP2 A;  1GKZ A;  2QFO A;  2WI3 A;  4FMT A;  4PRX A;  1Z59 A;  2WI1 A;  3G75 A;  2BU5 A;  4KQV A;  3ZKB A;  5M4P A;  4BQG A;  2XX4 A;  4W7T A;  3A0W A;  5D6Q A;  4AWP A;  1B63 A;  2O1U A;  3JZ3 A;  3OW6 A;  5FND A;  2YEA A;  2E0A A;  2ZBK B;  4O09 A;  4URM A;  3T10 A;  1L0O A;  3A0Y A;  4MPC A;  1YT0 A;  4U7O A;  4PRV A;  1YSZ A;  3Q5K A;  4KTN A;  4EMV A;  1TC6 A;  4L8Z A;  3G7B A;  1YT1 A;  1Z5B A;  4H7Q A;  2IOQ A;  4LWE A;  2XHR A;  4MBC A;  2O1W A;  4KSG A;  2XDU A;  1YET A;  1AJ6 A;  4HXW A;  1Y8P A;  3EHH A;  5M4M A;  2XDX A;  4L94 A;  4KSH A;  2BYI A;  3BMY A;  4L93 A;  4GGL A;  1U2O A;  2YEI A;  4LWH A;  4YKU A;  2YEH A;  2YEC A;  4NH7 A;  3GIE A;  4WUC A;  3T0H A;  3B27 A;  4R3A A;  2YEF A;  3OWD A;  1UY7 A;  3PEH A;  2FWY A;  3T2S A;  3Q5L A;  2ZKJ A;  4BAE A;  1KZN A;  1Z5A A;  3B26 A;  1YES A;  1A4H A;  2XDS A;  3RKZ A;  4HYP A;  4EM7 A;  3R92 A;  3INX A;  4X9L A;  3O2F A;  2IWU A;  4FCR A;  2Q8F A;  3RLP A;  2WI6 A;  2YKE A;  1EI1 A;  2HCH A;  4H85 A;  3HHU A;  4JAV A;  2GQP A;  1ZXN A;  4FPP A;  4CWO A;  2XDL A;  4KP4 A;  4EGK A;  2JKI A;  3C0E A;  3VHD A;  4QPK A;  3HZ1 A;  3T1K A;  4CWP A;  3B24 A;  1Y8O A;  2YEB A;  1QYE A;  1UYM A;  4MPE A;  1UY6 A;  2CH4 A;  4HZ5 A;  4EFT A;  4GCZ A;  4CE1 A;  3EHF A;  4XKK A;  4AS9 A;  3D2R A;  4BQJ A;  3ZKD A;  2WEP A;  2BU6 A;  2BRE A;  4AWQ A;  3VHA A;  5CTY A;  1QZR A;  4JQL A;  1I5A A;  2VW5 A;  2YK9 A;  4L91 A;  3HYZ A;  4CE3 A;  4GQT A;  2YKB A;  3R4P A;  1PVG A;  2XJG A;  3CRL A;  4O07 A;  4QPJ A;  2YEJ A;  3TTZ A;  4NH9 A;  4BXI A;  2PNR A;  4NH8 A;  4CWT A;  1TBW A;  1I5C A;  2UWD A;  2BRC A;  3KE6 A;  4CWN A;  2BTZ A;  2ESA A;  1NHI A;  2IOR A;  2BSM A;  2YE9 A;  2WEQ A;  3D0B A;  4CWQ A;  1B3Q A;  4E02 A;  1UYE A;  5M4E A;  3OMU A;  3TZ2 A;  2C2A A;  4ASG A;  2XCM A;  3MNR P;  1Y4S A;  4YKQ A;  3G7E A;  4XIT A;  2YGA A;  4XKO A;  5IN9 A;  4HY1 A;  1KIJ A;  3R4N A;  4YKT A;  3VHC A;  2XX5 A;  4GT8 A;  5M4H A;  4BIZ A;  4HZ0 A;  5D7C A;  1UY8 A;  2ZDX A;  1ZW9 A;  4ASA A;  1YC1 A;  3B28 A;  4LWG A;  2IWS A;  5IDJ A;  4XIR A;  3BM9 A;  2YE5 A;  3OPD A;  2WI5 A;  3CGY A;  2EXL A;  2FWZ A;  3ZXQ A;  4HY6 A;  2YEG A;  2QF6 A;  4R3M A;  3R4O A;  4K4O A;  4ZKI A;  3LNU A;  4XDM A;  5M4N A;  1BXD A;  5FNF A;  3H80 A;  1UYF A;  3TZ5 A;  1AH6 A;  1TIL A;  2YE4 A;  4WUD A;  1UYC A;  5F5R A;  1H7U A;  4YKW A;  4MOT A;  1R62 A;  3CWV A;  3ZM7 A;  4CWS A;  4WUB A;  2HKJ A;  2YKJ A;  2CCT A;  4YKX A;  3TZ4 A;  4Q20 A;  1GKX A;  2Q8G A;  1AM1 A;  2QG0 A;  2QG2 A;  3FV5 A;  1AH8 A;  2Q2E B;  4EFU A;  3VAD A;  2VWC A;  1THN A;  2YKI A;  2XX2 A;  3NMQ A;  2BYH A;  2YE8 A;  4HXZ A;  4ZVI A;  4EEH A;  2XDK A;  2YKC A;  3HYY A;  1B62 A;  3K97 A;  4FCP A;  1Y8N A;  3U2D A;  1YER A;  2HG1 A;  2XAB A;  2FXS A;  3FT8 A;  5BOC A;  1UYD A;  4I3H A;  1I58 A;  1QY8 A;  1OSF A;  4GFN A;  2YI5 A;  4MB9 A;  4E01 A;  1TC0 A;  5C93 A;  4BIU A;  4LWF A;  3U2K A;  2WER A;  5CPH A;  5M4K A;  2YI7 A;  2XJX A;  4DUH A;  3LPS A;  1MU5 A;  4EGI A;  3A0X A;  4PU9 A;  1TH8 A;  4YKZ A;  4URN A;  4AWO A;  3QTF A;  4URO A;  3K98 A;  3TUH A;  2YK2 A;  1TID A;  1UY9 A;  3A0T A;  4YKR A;  5D6P A;  2YJW A;  5J71 A;  3R91 A;  2YGF A;  4P7A A;  1YC4 A;  3O6O A;  2YEE A;  2K5B A;  3U67 A;  4HYM A;  4XCJ A;  4XIQ A;  2YE2 A;  2BU2 A;  5FWK A;  3PEJ A;  2WI4 A;  4XTJ A;  1YS3 A;  2Q8H A;  1UYH A;  1NHJ A;  2BT0 A;  5GGZ A;  3H4L A;  1YC3 A;  4O04 A;  2H55 A;  4L90 A;  1AMW A;  3RLQ A;  4LP0 A;  2YED A;  4CWR A; 
#chains in the Genus database with same CATH topology
 2CCS A;  3GIG A;  2BU7 A;  4B6C A;  4MPN A;  1EA6 A;  4R1F A;  5F3K A;  2GFD A;  3K99 A;  5L3J A;  2JJC A;  1ID0 A;  3CRK A;  2WI2 A;  4U7N A;  3DGE A;  4XE2 A;  3GIG B;  3WHA A;  1IXM A;  3TZ0 A;  4GEE A;  1F51 A;  3GIF A;  2CG9 A;  3C11 A;  2YE6 A;  2BZ5 A;  2VCI A;  2XJJ A;  1I59 A;  1US7 A;  3HEK A;  3WQ9 A;  4H81 A;  4U93 A;  1BGQ A;  1ZWH A;  2YGE A;  4B7P A;  3D36 A;  3A0Z A;  3FT5 A;  4XKA A;  3O0I A;  5D7R A;  3IED A;  2AKP A;  3A0R A;  4E00 A;  3QDD A;  5CTX A;  5JEN A;  1ZXM A;  4FCQ A;  4LWI A;  4KFG A;  1UYK A;  2Q8I A;  5BOD A;  5FNC A;  3CGZ A;  1YT2 A;  1GJV A;  1UYL A;  1NHH A;  5D7D A;  2CCU A;  5CTW A;  1UYI A;  4XC0 A;  3EKR A;  2YJX A;  3K60 A;  4I5S A;  1YSR A;  3LMM A;  4ASB A;  4ASF A;  2ZDY A;  4V26 A;  1H7S A;  2FTK A;  1MX0 A;  4O05 A;  3T0Z A;  1S16 A;  2CGF A;  1U0Z A;  1BYQ A;  2XD6 A;  2WI7 A;  1I5B A;  4URL A;  2YE3 A;  1JM6 A;  4P8O A;  4CE2 A;  5J6A A;  3OWB A;  4PL9 A;  2O1V A;  4JAU A;  1Y4U A;  2VCJ A;  3HZ5 A;  3B25 A;  2YI0 A;  3INW A;  2XHT A;  3EKO A;  3EHG A;  2YI6 A;  3CYG A;  3R4M A;  3EHJ A;  2H8M A;  4EGH A;  2FYP A;  4XIP A;  1UYG A;  4XCL A;  1BKN A;  4O0B A;  4JAS A;  2IWX A;  1S14 A;  3Q5J A;  3RLR A;  5IDM A;  2BU8 A;  2XHX A;  4MP7 A;  3SL2 A;  1I5D A;  3ZXO A;  4V25 A;  2IOP A;  5CF0 A;  2XK2 A;  4DZY A;  4CWF A;  5CTU A;  4YKY A;  2YE7 A;  4LPB A;  1Z5C A;  4XD8 A;  4MP2 A;  1GKZ A;  2QFO A;  2WI3 A;  4FMT A;  4PRX A;  1Z59 A;  2WI1 A;  3G75 A;  2BU5 A;  4KQV A;  3ZKB A;  5M4P A;  4BQG A;  2XX4 A;  4W7T A;  3A0W A;  5D6Q A;  4AWP A;  1B63 A;  2O1U A;  3JZ3 A;  3OW6 A;  5FND A;  2YEA A;  2E0A A;  2ZBK B;  4O09 A;  4URM A;  3T10 A;  1L0O A;  3A0Y A;  4MPC A;  1YT0 A;  4U7O A;  4PRV A;  1YSZ A;  3Q5K A;  4KTN A;  4EMV A;  1TC6 A;  4L8Z A;  3G7B A;  1YT1 A;  1Z5B A;  4H7Q A;  2IOQ A;  4LWE A;  2XHR A;  4MBC A;  2O1W A;  4KSG A;  2XDU A;  1YET A;  1AJ6 A;  4HXW A;  1Y8P A;  3EHH A;  5M4M A;  2XDX A;  4L94 A;  4KSH A;  2BYI A;  3BMY A;  4L93 A;  4GGL A;  1U2O A;  2YEI A;  4LWH A;  4YKU A;  2YEH A;  2YEC A;  4NH7 A;  3GIE A;  4WUC A;  3T0H A;  3B27 A;  4R3A A;  2YEF A;  3OWD A;  1UY7 A;  3PEH A;  2FWY A;  3T2S A;  3Q5L A;  2ZKJ A;  4BAE A;  1KZN A;  1Z5A A;  3B26 A;  1YES A;  1A4H A;  2XDS A;  3RKZ A;  4HYP A;  4EM7 A;  3R92 A;  3INX A;  4X9L A;  3O2F A;  2IWU A;  4FCR A;  2Q8F A;  3RLP A;  2WI6 A;  2YKE A;  1EI1 A;  2HCH A;  4H85 A;  3HHU A;  4JAV A;  2GQP A;  1ZXN A;  4FPP A;  4CWO A;  2XDL A;  4KP4 A;  4EGK A;  2JKI A;  3C0E A;  3VHD A;  4QPK A;  3HZ1 A;  3T1K A;  4CWP A;  3B24 A;  1Y8O A;  2YEB A;  1QYE A;  1UYM A;  4MPE A;  1UY6 A;  2CH4 A;  4HZ5 A;  4EFT A;  4GCZ A;  4CE1 A;  3EHF A;  4XKK A;  4AS9 A;  3D2R A;  4BQJ A;  3ZKD A;  2WEP A;  2BU6 A;  2BRE A;  4AWQ A;  3VHA A;  5CTY A;  1QZR A;  4JQL A;  1I5A A;  2VW5 A;  2YK9 A;  4L91 A;  3HYZ A;  4CE3 A;  4E72 A;  4GQT A;  2YKB A;  3R4P A;  1PVG A;  2XJG A;  3CRL A;  4O07 A;  4QPJ A;  2YEJ A;  3TTZ A;  4NH9 A;  4BXI A;  2PNR A;  4NH8 A;  4CWT A;  1TBW A;  1I5C A;  2UWD A;  2BRC A;  3KE6 A;  4CWN A;  2BTZ A;  2ESA A;  1NHI A;  2IOR A;  2BSM A;  2YE9 A;  2WEQ A;  3D0B A;  4CWQ A;  1B3Q A;  4E02 A;  1UYE A;  5M4E A;  3OMU A;  3TZ2 A;  2HHI A;  2C2A A;  4ASG A;  2XCM A;  3MNR P;  1Y4S A;  4YKQ A;  3G7E A;  4XIT A;  3S5T A;  2YGA A;  4XKO A;  5IN9 A;  4HY1 A;  1KIJ A;  3R4N A;  4YKT A;  3VHC A;  2XX5 A;  4GT8 A;  5M4H A;  4BIZ A;  4HZ0 A;  5D7C A;  1UY8 A;  2ZDX A;  1ZW9 A;  4ASA A;  1YC1 A;  3B28 A;  4LWG A;  2IWS A;  5IDJ A;  4XIR A;  3BM9 A;  2YE5 A;  3OPD A;  2WI5 A;  3CGY A;  2EXL A;  2FWZ A;  3ZXQ A;  4HY6 A;  2YEG A;  2QF6 A;  4R3M A;  3R4O A;  4K4O A;  4ZKI A;  3LNU A;  4XDM A;  5M4N A;  1BXD A;  5FNF A;  3H80 A;  1UYF A;  3TZ5 A;  1AH6 A;  1TIL A;  2YE4 A;  4WUD A;  1UYC A;  5F5R A;  1H7U A;  4YKW A;  4MOT A;  1R62 A;  3CWV A;  3ZM7 A;  4CWS A;  4WUB A;  2HKJ A;  2YKJ A;  2CCT A;  4YKX A;  3TZ4 A;  4Q20 A;  1GKX A;  2Q8G A;  1AM1 A;  2QG0 A;  2QG2 A;  3FV5 A;  1AH8 A;  2Q2E B;  4EFU A;  3VAD A;  2VWC A;  1THN A;  2YKI A;  2XX2 A;  3NMQ A;  2BYH A;  2YE8 A;  4HXZ A;  4ZVI A;  4EEH A;  2XDK A;  2YKC A;  3HYY A;  1B62 A;  3K97 A;  4FCP A;  1Y8N A;  3U2D A;  1YER A;  2HG1 A;  2XAB A;  2FXS A;  3FT8 A;  5BOC A;  1UYD A;  4I3H A;  1I58 A;  1QY8 A;  1OSF A;  4GFN A;  2YI5 A;  4MB9 A;  4E01 A;  1TC0 A;  5C93 A;  4BIU A;  4LWF A;  3U2K A;  2WER A;  5CPH A;  5M4K A;  2YI7 A;  2XJX A;  4DUH A;  3LPS A;  1MU5 A;  4EGI A;  3A0X A;  4PU9 A;  1TH8 A;  4YKZ A;  4URN A;  4AWO A;  3QTF A;  4URO A;  3K98 A;  3TUH A;  2YK2 A;  1TID A;  1UY9 A;  2C1I A;  3A0T A;  4YKR A;  5D6P A;  2YJW A;  5J71 A;  3R91 A;  2YGF A;  4P7A A;  1YC4 A;  3O6O A;  2YEE A;  2K5B A;  3U67 A;  4HYM A;  4XCJ A;  4XIQ A;  2YE2 A;  2BU2 A;  5FWK A;  3PEJ A;  2WI4 A;  4XTJ A;  1YS3 A;  2Q8H A;  1UYH A;  1NHJ A;  2BT0 A;  5GGZ A;  2C1G A;  3H4L A;  1YC3 A;  4O04 A;  2H55 A;  4L90 A;  1AMW A;  3RLQ A;  4LP0 A;  2YED A;  4CWR A; 
#chains in the Genus database with same CATH homology
 2CCS A;  3GIG A;  2BU7 A;  4B6C A;  4MPN A;  1EA6 A;  4R1F A;  5F3K A;  2GFD A;  3K99 A;  5L3J A;  2JJC A;  1ID0 A;  3CRK A;  2WI2 A;  4U7N A;  3DGE A;  4XE2 A;  3GIG B;  3WHA A;  3TZ0 A;  4GEE A;  3GIF A;  2CG9 A;  3C11 A;  2YE6 A;  2BZ5 A;  2VCI A;  2XJJ A;  1I59 A;  1US7 A;  3HEK A;  3WQ9 A;  4H81 A;  4U93 A;  1BGQ A;  1ZWH A;  2YGE A;  4B7P A;  3D36 A;  3A0Z A;  3FT5 A;  4XKA A;  3O0I A;  5D7R A;  3IED A;  2AKP A;  3A0R A;  4E00 A;  3QDD A;  5CTX A;  1ZXM A;  4FCQ A;  4LWI A;  4KFG A;  1UYK A;  2Q8I A;  5BOD A;  5FNC A;  3CGZ A;  1YT2 A;  1GJV A;  1UYL A;  1NHH A;  5D7D A;  2CCU A;  5CTW A;  1UYI A;  4XC0 A;  3EKR A;  2YJX A;  3K60 A;  4I5S A;  1YSR A;  4ASB A;  4ASF A;  2ZDY A;  4V26 A;  1H7S A;  4O05 A;  1MX0 A;  3T0Z A;  1S16 A;  2CGF A;  1U0Z A;  1BYQ A;  2XD6 A;  2WI7 A;  1I5B A;  4URL A;  2YE3 A;  1JM6 A;  4P8O A;  4CE2 A;  5J6A A;  3OWB A;  4PL9 A;  2O1V A;  4JAU A;  1Y4U A;  2VCJ A;  3HZ5 A;  3B25 A;  2YI0 A;  3INW A;  2XHT A;  3EKO A;  3EHG A;  2YI6 A;  3R4M A;  3EHJ A;  2H8M A;  4EGH A;  2FYP A;  4XIP A;  1UYG A;  4XCL A;  1BKN A;  4O0B A;  4JAS A;  2IWX A;  1S14 A;  3Q5J A;  3RLR A;  5IDM A;  2BU8 A;  2XHX A;  4MP7 A;  3SL2 A;  1I5D A;  3ZXO A;  4V25 A;  2IOP A;  5CF0 A;  2XK2 A;  4DZY A;  4CWF A;  5CTU A;  4YKY A;  2YE7 A;  4LPB A;  1Z5C A;  4XD8 A;  4MP2 A;  1GKZ A;  2QFO A;  2WI3 A;  4FMT A;  4PRX A;  1Z59 A;  2WI1 A;  3G75 A;  2BU5 A;  4KQV A;  3ZKB A;  5M4P A;  4BQG A;  2XX4 A;  4W7T A;  3A0W A;  5D6Q A;  4AWP A;  1B63 A;  2O1U A;  3JZ3 A;  3OW6 A;  5FND A;  2YEA A;  2E0A A;  2ZBK B;  4O09 A;  4URM A;  3T10 A;  1L0O A;  3A0Y A;  4MPC A;  1YT0 A;  4U7O A;  4PRV A;  1YSZ A;  3Q5K A;  4KTN A;  4EMV A;  1TC6 A;  4L8Z A;  3G7B A;  1YT1 A;  1Z5B A;  4H7Q A;  2IOQ A;  4LWE A;  2XHR A;  4MBC A;  2O1W A;  4KSG A;  2XDU A;  1YET A;  1AJ6 A;  4HXW A;  1Y8P A;  3EHH A;  5M4M A;  2XDX A;  4L94 A;  4KSH A;  2BYI A;  3BMY A;  4L93 A;  4GGL A;  1U2O A;  2YEI A;  4LWH A;  4YKU A;  2YEH A;  2YEC A;  4NH7 A;  3GIE A;  4WUC A;  3T0H A;  3B27 A;  4R3A A;  2YEF A;  3OWD A;  1UY7 A;  3PEH A;  2FWY A;  3T2S A;  3Q5L A;  2ZKJ A;  4BAE A;  1KZN A;  1Z5A A;  3B26 A;  1YES A;  1A4H A;  2XDS A;  3RKZ A;  4HYP A;  4EM7 A;  3R92 A;  3INX A;  4X9L A;  3O2F A;  2IWU A;  4FCR A;  2Q8F A;  3RLP A;  2WI6 A;  2YKE A;  1EI1 A;  2HCH A;  4H85 A;  3HHU A;  4JAV A;  2GQP A;  1ZXN A;  4FPP A;  4CWO A;  2XDL A;  4KP4 A;  4EGK A;  2JKI A;  3C0E A;  3VHD A;  4QPK A;  3HZ1 A;  3T1K A;  4CWP A;  3B24 A;  1Y8O A;  2YEB A;  1QYE A;  1UYM A;  4MPE A;  1UY6 A;  2CH4 A;  4HZ5 A;  4EFT A;  4GCZ A;  4CE1 A;  3EHF A;  4XKK A;  4AS9 A;  3D2R A;  4BQJ A;  3ZKD A;  2WEP A;  2BU6 A;  2BRE A;  4AWQ A;  3VHA A;  5CTY A;  1QZR A;  4JQL A;  1I5A A;  2VW5 A;  2YK9 A;  4L91 A;  3HYZ A;  4CE3 A;  4GQT A;  2YKB A;  3R4P A;  1PVG A;  2XJG A;  3CRL A;  4O07 A;  4QPJ A;  2YEJ A;  3TTZ A;  4NH9 A;  4BXI A;  2PNR A;  4NH8 A;  4CWT A;  1TBW A;  1I5C A;  2UWD A;  2BRC A;  3KE6 A;  4CWN A;  2BTZ A;  2ESA A;  1NHI A;  2IOR A;  2BSM A;  2YE9 A;  2WEQ A;  3D0B A;  4CWQ A;  1B3Q A;  4E02 A;  1UYE A;  5M4E A;  3OMU A;  3TZ2 A;  2C2A A;  4ASG A;  2XCM A;  3MNR P;  1Y4S A;  4YKQ A;  3G7E A;  4XIT A;  2YGA A;  4XKO A;  5IN9 A;  4HY1 A;  1KIJ A;  3R4N A;  4YKT A;  3VHC A;  2XX5 A;  4GT8 A;  5M4H A;  4BIZ A;  4HZ0 A;  5D7C A;  1UY8 A;  2ZDX A;  1ZW9 A;  4ASA A;  1YC1 A;  3B28 A;  4LWG A;  2IWS A;  5IDJ A;  4XIR A;  3BM9 A;  2YE5 A;  3OPD A;  2WI5 A;  3CGY A;  2EXL A;  2FWZ A;  3ZXQ A;  4HY6 A;  2YEG A;  2QF6 A;  4R3M A;  3R4O A;  4K4O A;  4ZKI A;  3LNU A;  4XDM A;  5M4N A;  1BXD A;  5FNF A;  3H80 A;  1UYF A;  3TZ5 A;  1AH6 A;  1TIL A;  2YE4 A;  4WUD A;  1UYC A;  5F5R A;  1H7U A;  4YKW A;  4MOT A;  1R62 A;  3CWV A;  3ZM7 A;  4CWS A;  4WUB A;  2HKJ A;  2YKJ A;  2CCT A;  4YKX A;  3TZ4 A;  4Q20 A;  1GKX A;  2Q8G A;  1AM1 A;  2QG0 A;  2QG2 A;  3FV5 A;  1AH8 A;  2Q2E B;  4EFU A;  3VAD A;  2VWC A;  1THN A;  2YKI A;  2XX2 A;  3NMQ A;  2BYH A;  2YE8 A;  4HXZ A;  4ZVI A;  4EEH A;  2XDK A;  2YKC A;  3HYY A;  1B62 A;  3K97 A;  4FCP A;  1Y8N A;  3U2D A;  1YER A;  2HG1 A;  2XAB A;  2FXS A;  3FT8 A;  5BOC A;  1UYD A;  4I3H A;  1I58 A;  1QY8 A;  1OSF A;  4GFN A;  2YI5 A;  4MB9 A;  4E01 A;  1TC0 A;  5C93 A;  4BIU A;  4LWF A;  3U2K A;  2WER A;  5CPH A;  5M4K A;  2YI7 A;  2XJX A;  4DUH A;  3LPS A;  1MU5 A;  4EGI A;  3A0X A;  4PU9 A;  1TH8 A;  4YKZ A;  4URN A;  4AWO A;  3QTF A;  4URO A;  3K98 A;  3TUH A;  2YK2 A;  1TID A;  1UY9 A;  3A0T A;  4YKR A;  5D6P A;  2YJW A;  5J71 A;  3R91 A;  2YGF A;  4P7A A;  1YC4 A;  3O6O A;  2YEE A;  2K5B A;  3U67 A;  4HYM A;  4XCJ A;  4XIQ A;  2YE2 A;  2BU2 A;  5FWK A;  3PEJ A;  2WI4 A;  4XTJ A;  1YS3 A;  2Q8H A;  1UYH A;  1NHJ A;  2BT0 A;  5GGZ A;  3H4L A;  1YC3 A;  4O04 A;  2H55 A;  4L90 A;  1AMW A;  3RLQ A;  4LP0 A;  2YED A;  4CWR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...