3IEQA

Crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with cytidine
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
b'MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
molecule tags Lyase
source organism Burkholderia pseudomallei
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
total genus 50
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2009-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3ieqA00
3GHZA 1W55A 1U40A 1JY8A 1W57A 1IV1A 3ERNA 4C82A 1IV2A 3MBMA 5B8FA 2PMPA 1T0AA 3EORA 3K14A 3F0EA 3JVHA 1IV3A 3Q8HA 3IKEA 3IKFA 1GX1A 3ELCA 3FBAA 3P0ZA 1H47A 1IV4A 3RE3A 3IEQA 3IEWA 1H48A 3F0GA 3QHDA 1U3LA 3T80A 1VHAA 3F0FA 3K2XA 1VH8A 1YQNA 2UZHA 2GZLA 3B6NA 4C8GA 2AMTA 3FPIA 3P10A 3F6MA 4C8EA 1KNJA 1U43A 4C8IA 4C81A 1U3PA 3F0DA 1JN1A 1KNKA 3ESJA 3KE1A
chains in the Genus database with same CATH superfamily
4TUYA 3S03A 1IV2A 3LDTA 1W42A 1DBFA 4O4HB 4G4WA 3EORA 3WGLA 3LWQC 4X20B 2EWCA 5J2TA 1JD1A 3S0WA 5C8YB 5ITZB 4ZOLB 3WJRA 1OFUA 2Q1YA 3L7QA 3QTYA 4DRXA 1K73H 2QTPA 1CN7A 1GZ0A 1QVGF 1FNKA 1RA4A 1TUBB 2RB9A 4ZOLA 4X3LA 4F6RB 3J81M 3NK7A 3J7AR 1CLIA 5JH7A 3N2KB 3VOBA 1QVFF 3AGKA 3P4EA 4TV8A 3CCSF 2HP0A 2KTVA 1YJNF 3CC7F 3M1XA 3FD6A 4ZHWA 2B33A 3HKEA 2GVIA 3I3FA 2K1SA 5CB4B 3F6MA 4C8EA 4ZHQB 5JVDB 2Q1XA 3SIUA 5LP6A 2CHTA 2OHWA 5FNVA 1NQ3A 3VCZA 3CCRF 1YIJF 1VQ5F 2GLZA 1IPAA 4U39A 2LBWA 5LXTA 5HY0A 3KIZA 3CCEF 5EYPA 3P0ZA 4ERHA 1VQVA 2P6YA 2BTUA 4FFBA 1SA0B 2YYEA 1VQKF 3IMPA 3CCQF 4O4JA 3VO8A 4IIJA 4PWTA 3S02A 5J2UA 1YI2F 3M4SA 1R1MA 3MCAB 3P10A 5HP8A 4RQOA 3RYHB 3VYSC 4M8IA 2RHHA 3LWVC 2VAPA 5GIOC 3E1YA 3QUWA 4DRXB 5CA0B 4C82A 2LCAA 3CC4F 2HP3A 1RLUA 3WJQA 1T0AA 4HNAB 1GO1A 5CA1A 5GANK 3IKEA 1YJWF 2NMUA 4WBNB 1H47A 5IT9M 3VMFB 2DYYA 5KX5B 2UYKA 1VHAA 1FFXB 4EB6B 2ZVZA 1RQ7A 3B6NA 5MN5A 3JAKB 3D00A 5CA0A 4BT2A 3D54A 2UYPA 3GHZA 5LXTB 3CMEF 2DT4A 3ZO8A 4X1YB 2UYJA 2UYNB 4BVRA 2IQQA 1XHOA 2CSLA 5BMVA 1JFFB 5LOVB 3N4ZA 3C8LA 3K14A 3JCMM 2WALA 1NMUB 3V7QA 1IV3A 1X7OA 4ZI7A 3RYCB 3LWOC 3IKFA 2HRUA 3CCVF 3WGMA 4KWEA 4B5CA 5MN6A 1IV4A 5IYZB 3IEWA 4YJ2A 5GINC 1FSZA 1JFFA 4XCQA 2RHJA 3HWUA 2L26A 4BVQA 2CWJA 3OW2F 3PLAC 4G4YA 4C8IA 3JASB 3LYBA 4TZZA 3ESJA 4ZHYB 1CK2A 2VAMA 4ZK7A 3UT5A 2QI2A 3RYCA 3N4YA 2OZBA 5JH7B 3WGNA 3K12A 4G4XA 5FNVB 1N8RH 5HWEA 3I56F 5HXUA 1Q81H 3E22B 3CPQA 4DXDA 1J7HA 5EWRA 5KX5A 5DCVA 3HKBA 1U3PA 1GO0A 1KNKA 5J2TB 2BO1A 4X1YA 4TV9A 1JY8A 1W57A 5FLXM 2OTMA 1TVKB 2CZWA 3E20B 1ODEA 4I55A 4NWOB 3TD5A 4BT5A 3RYFB 2HVYD 3HKCB 2H6LA 5C8YA 5ITZA 3NVIB 5IJ0A 1U3LA 3CXCF 3T80A 1Q8RA 4EI8A 3N2GB 4O2AB 2OTLF 5MN4A 5IYZA 3KJKA 4FFBB 4TUYB 3R0PA 2LBTA 4LCKA 1W5EA 1RLGA 3JARA 4I4TA 2PHNA 1VQNF 2KG4A 1OAPA 1ZWZA 2BTQB 4YJ3A 2HQSC 4IHJA 2ZOVA 2Z1EA 3CYPB 3OONA 2HP0B 5IJ9A 3CPWF 1VQMF 3RE3A 2HRYA 2QEXF 5A2QM 1COMA 4O4IB 3I55F 2FC3A 4G4VA 4BW0B 2IAFA 4X1KA 4C8GA 1VQ4F 4F6RA 4E6EA 1W59A 4WBNA 3JARB 1Q86H 5LP6C 1Z5VA 5GONB 1NJIH 3PAFA 4EB6A 1TVKA 3NMUC 4O2BA 2HS4A 4BT3A 2KTUA 4EI7A 5EZYA 1GX1A 4X20A 3JAWA 2V9YA 3C9TA 3MDOA 4BVTA 3G4SF 4EI9A 1W41A 4I55B 3NK6A 1QD9A 3TD3A 3HKCA 1Q82H 2HS3A 3OBYA 3E22A 1QAHA 5GONA 3HKDA 3CMAF 3N2KA 3RYIB 5HY2A 4TV9B 3GYQA 2LBXA 5EB0A 3K0TA 5AVMA 3WXMB 3DDNA 5EIBC 1K9MH 4BT4A 4HNAA 5HY1A 3KHNA 2ZVYA 4I50B 5LYJA 3ELCA 1VQ6F 5EO3A 5LA6B 1H48A 1W5AA 1W5BA 4G88A 3CC2F 1SDSA 4U3JB 2KGWA 2GZLA 1Q7YH 4BY9D 3KJJA 1VQLF 4O4HA 1Z5WA 4B45A 1DT9A 1XRGA 4O4IA 5KMGA 2Z01A 5JVDA 3C9RA 2Z1FA 1VQOF 2H8EA 5CB4A 1FFXA 3GTZA 1VQ8F 4O4LB 1S72F 2ALEA 3RYFA 3S0YA 3VYUC 2CW4A 4YJ2B 3WPXA 3CG6A 2VGNA 3RA6A 5IJ9B 1W581 3ON1A 1UI9A 4G4ZA 1VQ7F 3JAMM 1YQNA 2UZHA 3N2GA 3CCMF 2I6RA 3VYTC 3C9UA 2UYNA 3F0DA 3WGJA 1TUBA 5IJ0B 4X1IA 2Z1TA 1W5FA 5CA1B 1PF5A 4IIJB 2R751 5EIBD 1IV1A 2AIZP 5LA6A 4B46A 1KC8H 2OTJF 2AIFA 3VTIC 3CYQA 3JATA 1FNJA 1H7MA 1M90H 3ZP4A 1SZQA 3CD6F 3SIVA 3IEQA 5EZYB 3V3TA 4RHAA 3HKDB 1VH8A 3DC2A 3RYIA 1VK3A 3G6EF 1YJ9F 2IG8A 3O85A 2ZODA 2W8BC 1KNJA 1U43A 2BTOA 2JNBA 3FFMA 5HY4A 1VQ9F 3KE1A 5EYPB 5GAPK 3VI6A 1W55A 1PXWA 1U40A 3WJPA 3ZP7A 2HX0A 3ERNA 5GIPC 3MBMA 3WGKA 1QU9A 2PMPA 2RHLA 4O4JB 2ZF8A 4O2BB 5J2UB 2H8CA 3Q8HA 4ZI7B 2VXYA 4X3MA 1XBIA 5JQGA 3VOAA 3FD5A 1JJ2F 4O2AA 3F0FA 2ZAUA 3LWPC 4NUTA 4LNUB 5G4VC 3D01A 3LFOA 3MQWA 1JN1A 2CVLA 5B8FA 3RA5A 1YITF 1SA0A 1W40A 1RQ2A 5KMGB 1XV2A 2R6R1 4YJ3B 4IHJB 3I7TA 3HJWC 3F0EA 3JVHA 4BT6A 5LOVA 1T0KB 5EAZA 3FBAA 1KQSF 3QHDA 3K2XA 4I50A 5LYJB 3IR9A 3TD4A 4X1IB 5HP7A 1ONIA 3S0HA 1M1KH 4U3JA 3HKBB 3C9SA 2MQEA 3HTNA 2YXZA 4R40B 3JATB 4BVSA 1YGYA 3JAKA 3UT5B 1W2BF 2QA4F 2Z1UA 3OBWA 3NVKE 3JAWB 2F9ZC 3JALA 5JCOC 2HS0A 3VIUA 4X1KB 4BT7A 1X25A 3RYHA 2VAWA 5HXZA 3M84A 3J80M 2AMTA 2N48A 5JCOA 5EB1B 2RHOA 3CCUF 3LMEA 3U0OA 3JASA 1K8AH 3G71F 3MCQA 3V7EA 2I6DA 3WPWA 4LNUA 3S06A 3LWRC 4I4TB 2VGMA 3HAXD 3JALB 5LP6B 4C4WC 1X52A 5JQGB 3BYQA 4ZHVA 1E7KA 3CCJF 4TV8B 1X7PA 2G9IA 3V4DA 4ZHQA 3F0GA 3ZOPA 1YHQF 5FJ4C 1KD1H 2FGYA 5BMVB 1VQPF 5G4UC 1UFYA 4NQ3A 3CB2A 3HKEB 2CHSA 4O4LA 3FPIA 4B62A 3CCLF 4C81A 1W3EX
chains in the Genus database with same CATH topology
3GHZA 1W55A 1U40A 1JY8A 1W57A 1IV1A 3ERNA 4C82A 1IV2A 3MBMA 5B8FA 2PMPA 1T0AA 3EORA 3K14A 3F0EA 3JVHA 1IV3A 3Q8HA 3IKEA 3IKFA 1GX1A 3ELCA 3FBAA 3P0ZA 1H47A 1IV4A 3RE3A 3IEQA 3IEWA 1H48A 3F0GA 3QHDA 1U3LA 3T80A 1VHAA 3F0FA 3K2XA 1VH8A 1YQNA 2UZHA 2GZLA 3B6NA 4C8GA 2AMTA 3FPIA 3P10A 3F6MA 4C8EA 1KNJA 1U43A 4C8IA 4C81A 1U3PA 3F0DA 1JN1A 1KNKA 3ESJA 3KE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GHZ A;  1W55 A;  1U40 A;  1JY8 A;  1W57 A;  1IV1 A;  3ERN A;  4C82 A;  1IV2 A;  3MBM A;  5B8F A;  2PMP A;  1T0A A;  3EOR A;  3K14 A;  3F0E A;  3JVH A;  1IV3 A;  3Q8H A;  3IKE A;  3IKF A;  1GX1 A;  3ELC A;  3FBA A;  3P0Z A;  1H47 A;  1IV4 A;  3RE3 A;  3IEQ A;  3IEW A;  1H48 A;  3F0G A;  3QHD A;  1U3L A;  3T80 A;  1VHA A;  3F0F A;  3K2X A;  1VH8 A;  1YQN A;  2UZH A;  2GZL A;  3B6N A;  4C8G A;  2AMT A;  3FPI A;  3P10 A;  3F6M A;  4C8E A;  1KNJ A;  1U43 A;  4C8I A;  4C81 A;  1U3P A;  3F0D A;  1JN1 A;  1KNK A;  3ESJ A;  3KE1 A; 
#chains in the Genus database with same CATH topology
 4TUY A;  3S03 A;  1IV2 A;  3LDT A;  1W42 A;  1DBF A;  4O4H B;  4G4W A;  3EOR A;  3WGL A;  3LWQ C;  4X20 B;  2EWC A;  5J2T A;  1JD1 A;  3S0W A;  5C8Y B;  5ITZ B;  4ZOL B;  3WJR A;  1OFU A;  2Q1Y A;  3L7Q A;  3QTY A;  4DRX A;  1K73 H;  2QTP A;  1CN7 A;  1GZ0 A;  1QVG F;  1FNK A;  1RA4 A;  1TUB B;  2RB9 A;  4ZOL A;  4X3L A;  4F6R B;  3J81 M;  3NK7 A;  3J7A R;  1CLI A;  5JH7 A;  3N2K B;  3VOB A;  1QVF F;  3AGK A;  3P4E A;  4TV8 A;  3CCS F;  2HP0 A;  2KTV A;  1YJN F;  3CC7 F;  3M1X A;  3FD6 A;  4ZHW A;  2B33 A;  3HKE A;  2GVI A;  3I3F A;  2K1S A;  5CB4 B;  3F6M A;  4C8E A;  4ZHQ B;  5JVD B;  2Q1X A;  3SIU A;  5LP6 A;  2CHT A;  2OHW A;  5FNV A;  1NQ3 A;  3VCZ A;  3CCR F;  1YIJ F;  1VQ5 F;  2GLZ A;  1IPA A;  4U39 A;  2LBW A;  5LXT A;  5HY0 A;  3KIZ A;  3CCE F;  5EYP A;  3P0Z A;  4ERH A;  1VQV A;  2P6Y A;  2BTU A;  4FFB A;  1SA0 B;  2YYE A;  1VQK F;  3IMP A;  3CCQ F;  4O4J A;  3VO8 A;  4IIJ A;  4PWT A;  3S02 A;  5J2U A;  1YI2 F;  3M4S A;  1R1M A;  3MCA B;  3P10 A;  5HP8 A;  4RQO A;  3RYH B;  3VYS C;  4M8I A;  2RHH A;  3LWV C;  2VAP A;  5GIO C;  3E1Y A;  3QUW A;  4DRX B;  5CA0 B;  4C82 A;  2LCA A;  3CC4 F;  2HP3 A;  1RLU A;  3WJQ A;  1T0A A;  4HNA B;  1GO1 A;  5CA1 A;  5GAN K;  3IKE A;  1YJW F;  2NMU A;  4WBN B;  1H47 A;  5IT9 M;  3VMF B;  2DYY A;  5KX5 B;  2UYK A;  1VHA A;  1FFX B;  4EB6 B;  2ZVZ A;  1RQ7 A;  3B6N A;  5MN5 A;  3JAK B;  3D00 A;  5CA0 A;  4BT2 A;  3D54 A;  2UYP A;  3GHZ A;  5LXT B;  3CME F;  2DT4 A;  3ZO8 A;  4X1Y B;  2UYJ A;  2UYN B;  4BVR A;  2IQQ A;  1XHO A;  2CSL A;  5BMV A;  1JFF B;  5LOV B;  3N4Z A;  3C8L A;  3K14 A;  3JCM M;  2WAL A;  1NMU B;  3V7Q A;  1IV3 A;  1X7O A;  4ZI7 A;  3RYC B;  3LWO C;  3IKF A;  2HRU A;  3CCV F;  3WGM A;  4KWE A;  4B5C A;  5MN6 A;  1IV4 A;  5IYZ B;  3IEW A;  4YJ2 A;  5GIN C;  1FSZ A;  1JFF A;  4XCQ A;  2RHJ A;  3HWU A;  2L26 A;  4BVQ A;  2CWJ A;  3OW2 F;  3PLA C;  4G4Y A;  4C8I A;  3JAS B;  3LYB A;  4TZZ A;  3ESJ A;  4ZHY B;  1CK2 A;  2VAM A;  4ZK7 A;  3UT5 A;  2QI2 A;  3RYC A;  3N4Y A;  2OZB A;  5JH7 B;  3WGN A;  3K12 A;  4G4X A;  5FNV B;  1N8R H;  5HWE A;  3I56 F;  5HXU A;  1Q81 H;  3E22 B;  3CPQ A;  4DXD A;  1J7H A;  5EWR A;  5KX5 A;  5DCV A;  3HKB A;  1U3P A;  1GO0 A;  1KNK A;  5J2T B;  2BO1 A;  4X1Y A;  4TV9 A;  1JY8 A;  1W57 A;  5FLX M;  2OTM A;  1TVK B;  2CZW A;  3E20 B;  1ODE A;  4I55 A;  4NWO B;  3TD5 A;  4BT5 A;  3RYF B;  2HVY D;  3HKC B;  2H6L A;  5C8Y A;  5ITZ A;  3NVI B;  5IJ0 A;  1U3L A;  3CXC F;  3T80 A;  1Q8R A;  4EI8 A;  3N2G B;  4O2A B;  2OTL F;  5MN4 A;  5IYZ A;  3KJK A;  4FFB B;  4TUY B;  3R0P A;  2LBT A;  4LCK A;  1W5E A;  1RLG A;  3JAR A;  4I4T A;  2PHN A;  1VQN F;  2KG4 A;  1OAP A;  1ZWZ A;  2BTQ B;  4YJ3 A;  2HQS C;  4IHJ A;  2ZOV A;  2Z1E A;  3CYP B;  3OON A;  2HP0 B;  5IJ9 A;  3CPW F;  1VQM F;  3RE3 A;  2HRY A;  2QEX F;  5A2Q M;  1COM A;  4O4I B;  3I55 F;  2FC3 A;  4G4V A;  4BW0 B;  2IAF A;  4X1K A;  4C8G A;  1VQ4 F;  4F6R A;  4E6E A;  1W59 A;  4WBN A;  3JAR B;  1Q86 H;  5LP6 C;  1Z5V A;  5GON B;  1NJI H;  3PAF A;  4EB6 A;  1TVK A;  3NMU C;  4O2B A;  2HS4 A;  4BT3 A;  2KTU A;  4EI7 A;  5EZY A;  1GX1 A;  4X20 A;  3JAW A;  2V9Y A;  3C9T A;  3MDO A;  4BVT A;  3G4S F;  4EI9 A;  1W41 A;  4I55 B;  3NK6 A;  1QD9 A;  3TD3 A;  3HKC A;  1Q82 H;  2HS3 A;  3OBY A;  3E22 A;  1QAH A;  5GON A;  3HKD A;  3CMA F;  3N2K A;  3RYI B;  5HY2 A;  4TV9 B;  3GYQ A;  2LBX A;  5EB0 A;  3K0T A;  5AVM A;  3WXM B;  3DDN A;  5EIB C;  1K9M H;  4BT4 A;  4HNA A;  5HY1 A;  3KHN A;  2ZVY A;  4I50 B;  5LYJ A;  3ELC A;  1VQ6 F;  5EO3 A;  5LA6 B;  1H48 A;  1W5A A;  1W5B A;  4G88 A;  3CC2 F;  1SDS A;  4U3J B;  2KGW A;  2GZL A;  1Q7Y H;  4BY9 D;  3KJJ A;  1VQL F;  4O4H A;  1Z5W A;  4B45 A;  1DT9 A;  1XRG A;  4O4I A;  5KMG A;  2Z01 A;  5JVD A;  3C9R A;  2Z1F A;  1VQO F;  2H8E A;  5CB4 A;  1FFX A;  3GTZ A;  1VQ8 F;  4O4L B;  1S72 F;  2ALE A;  3RYF A;  3S0Y A;  3VYU C;  2CW4 A;  4YJ2 B;  3WPX A;  3CG6 A;  2VGN A;  3RA6 A;  5IJ9 B;  1W58 1;  3ON1 A;  1UI9 A;  4G4Z A;  1VQ7 F;  3JAM M;  1YQN A;  2UZH A;  3N2G A;  3CCM F;  2I6R A;  3VYT C;  3C9U A;  2UYN A;  3F0D A;  3WGJ A;  1TUB A;  5IJ0 B;  4X1I A;  2Z1T A;  1W5F A;  5CA1 B;  1PF5 A;  4IIJ B;  2R75 1;  5EIB D;  1IV1 A;  2AIZ P;  5LA6 A;  4B46 A;  1KC8 H;  2OTJ F;  2AIF A;  3VTI C;  3CYQ A;  3JAT A;  1FNJ A;  1H7M A;  1M90 H;  3ZP4 A;  1SZQ A;  3CD6 F;  3SIV A;  3IEQ A;  5EZY B;  3V3T A;  4RHA A;  3HKD B;  1VH8 A;  3DC2 A;  3RYI A;  1VK3 A;  3G6E F;  1YJ9 F;  2IG8 A;  3O85 A;  2ZOD A;  2W8B C;  1KNJ A;  1U43 A;  2BTO A;  2JNB A;  3FFM A;  5HY4 A;  1VQ9 F;  3KE1 A;  5EYP B;  5GAP K;  3VI6 A;  1W55 A;  1PXW A;  1U40 A;  3WJP A;  3ZP7 A;  2HX0 A;  3ERN A;  5GIP C;  3MBM A;  3WGK A;  1QU9 A;  2PMP A;  2RHL A;  4O4J B;  2ZF8 A;  4O2B B;  5J2U B;  2H8C A;  3Q8H A;  4ZI7 B;  2VXY A;  4X3M A;  1XBI A;  5JQG A;  3VOA A;  3FD5 A;  1JJ2 F;  4O2A A;  3F0F A;  2ZAU A;  3LWP C;  4NUT A;  4LNU B;  5G4V C;  3D01 A;  3LFO A;  3MQW A;  1JN1 A;  2CVL A;  5B8F A;  3RA5 A;  1YIT F;  1SA0 A;  1W40 A;  1RQ2 A;  5KMG B;  1XV2 A;  2R6R 1;  4YJ3 B;  4IHJ B;  3I7T A;  3HJW C;  3F0E A;  3JVH A;  4BT6 A;  5LOV A;  1T0K B;  5EAZ A;  3FBA A;  1KQS F;  3QHD A;  3K2X A;  4I50 A;  5LYJ B;  3IR9 A;  3TD4 A;  4X1I B;  5HP7 A;  1ONI A;  3S0H A;  1M1K H;  4U3J A;  3HKB B;  3C9S A;  2MQE A;  3HTN A;  2YXZ A;  4R40 B;  3JAT B;  4BVS A;  1YGY A;  3JAK A;  3UT5 B;  1W2B F;  2QA4 F;  2Z1U A;  3OBW A;  3NVK E;  3JAW B;  2F9Z C;  3JAL A;  5JCO C;  2HS0 A;  3VIU A;  4X1K B;  4BT7 A;  1X25 A;  3RYH A;  2VAW A;  5HXZ A;  3M84 A;  3J80 M;  2AMT A;  2N48 A;  5JCO A;  5EB1 B;  2RHO A;  3CCU F;  3LME A;  3U0O A;  3JAS A;  1K8A H;  3G71 F;  3MCQ A;  3V7E A;  2I6D A;  3WPW A;  4LNU A;  3S06 A;  3LWR C;  4I4T B;  2VGM A;  3HAX D;  3JAL B;  5LP6 B;  4C4W C;  1X52 A;  5JQG B;  3BYQ A;  4ZHV A;  1E7K A;  3CCJ F;  4TV8 B;  1X7P A;  2G9I A;  3V4D A;  4ZHQ A;  3F0G A;  3ZOP A;  1YHQ F;  5FJ4 C;  1KD1 H;  2FGY A;  5BMV B;  1VQP F;  5G4U C;  1UFY A;  4NQ3 A;  3CB2 A;  3HKE B;  2CHS A;  4O4L A;  3FPI A;  4B62 A;  3CCL F;  4C81 A;  1W3E X; 
#chains in the Genus database with same CATH homology
 3GHZ A;  1W55 A;  1U40 A;  1JY8 A;  1W57 A;  1IV1 A;  3ERN A;  4C82 A;  1IV2 A;  3MBM A;  5B8F A;  2PMP A;  1T0A A;  3EOR A;  3K14 A;  3F0E A;  3JVH A;  1IV3 A;  3Q8H A;  3IKE A;  3IKF A;  1GX1 A;  3ELC A;  3FBA A;  3P0Z A;  1H47 A;  1IV4 A;  3RE3 A;  3IEQ A;  3IEW A;  1H48 A;  3F0G A;  3QHD A;  1U3L A;  3T80 A;  1VHA A;  3F0F A;  3K2X A;  1VH8 A;  1YQN A;  2UZH A;  2GZL A;  3B6N A;  4C8G A;  2AMT A;  3FPI A;  3P10 A;  3F6M A;  4C8E A;  1KNJ A;  1U43 A;  4C8I A;  4C81 A;  1U3P A;  3F0D A;  1JN1 A;  1KNK A;  3ESJ A;  3KE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...