3IEQA

Crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with cytidine
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
b'MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
source organism Burkholderia pseudomallei
molecule tags Lyase
total genus 50
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2009-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3ieqA00
3F0EA 3F0GA 3MBMA 4C81A 1U3PA 1T0AA 1JY8A 1H48A 3FBAA 3ERNA 2UZHA 3IEQA 1U3LA 4C8IA 3ELCA 5B8FA 1IV2A 3F0FA 3EORA 3KE1A 3B6NA 3FPIA 1IV1A 1H47A 3T80A 3JVHA 1YQNA 3IEWA 1KNKA 1W55A 3F6MA 1JN1A 2AMTA 2GZLA 3K14A 1IV3A 1VHAA 3Q8HA 3RE3A 3P10A 4C82A 4C8GA 2PMPA 4C8EA 1KNJA 1U40A 1U43A 3K2XA 3IKFA 3F0DA 1W57A 3QHDA 3IKEA 3ESJA 3GHZA 1IV4A 1GX1A 1VH8A 3P0ZA
chains in the Genus database with same CATH superfamily
5EB1B 3D00A 2I6RA 5EYPA 2LBWA 1J7HA 3JAWB 2EWCA 4NUTA 2KGWA 4C8IA 1VQ8F 3PLAC 1JFFA 2Z1UA 5LA6A 1SA0B 3LWPC 4WBNA 5IJ0A 3CCVF 3C9UA 3JVHA 3RYHB 3G6EF 3JASB 3WGLA 1IV3A 3N4YA 3RYIB 3E22B 1SDSA 2OTMA 5FNVA 3WPXA 1N8RH 3SIVA 5ITZB 5G4UC 1X25A 3VMFB 1VQ6F 1VQ5F 3HKCA 3P0ZA 3JALA 3F0EA 4LNUB 1U3PA 5EZYB 1VQLF 2FC3A 2AIZP 3HJWC 5CA0A 2ZODA 3F0FA 3EORA 2CVLA 5BMVB 2Q1YA 2K1SA 1IV1A 2UYNA 2UYPA 1TUBB 5HP8A 1JN1A 5J2TA 3RYCB 4I50A 4O2BB 1CN7A 5IJ9A 1QAHA 5J2UA 5GANK 5EWRA 1JY8A 3VYTC 2UZHA 1COMA 2P6YA 1PF5A 1VQ4F 3JAKA 2G9IA 2I6DA 3U0OA 4TV9A 1X7OA 4B5CA 4X1YA 2UYKA 3ON1A 5EIBD 1W41A 1YI2F 3VOBA 3VCZA 3E20B 4O4HB 3K2XA 3CCLF 5A2QM 3WJRA 5HXZA 3FD6A 1CK2A 3N2KB 4F6RB 4BVQA 1W2BF 2GLZA 1OFUA 2VAMA 2BTQB 5JQGA 2VGNA 2F9ZC 1UFYA 5LXTA 2HP0A 2HRUA 5GIOC 4O2AA 2BO1A 3WGMA 1GO0A 2IQQA 4C8GA 3CC2F 4IIJA 5KMGA 4G4WA 3WJPA 3QHDA 4ZI7A 1W42A 1W59A 2CWJA 3TD5A 3GHZA 3IKFA 3TD3A 3GTZA 3CCUF 1VQKF 2LBXA 4ZOLA 4X20A 3M4SA 5FJ4C 5GONA 4BVSA 5LYJB 3CCMF 3E1YA 3D54A 2VGMA 3CPWF 3HKDB 2Z1TA 3JATA 4BVRA 3C9TA 4FFBB 3VTIC 4TV8B 3G4SF 1KNKA 1W55A 4O4JA 3CC7F 1T0KB 1VHAA 2Z1EA 1S72F 5LP6B 5GAPK 2DT4A 3N4ZA 1VK3A 1U40A 3HKEB 1QU9A 2ZVZA 1R1MA 4TZZA 5IYZA 3DDNA 1FNKA 2YYEA 4TUYA 3MCQA 4I4TA 3TD4A 1FSZA 2KTUA 3ZOPA 3M84A 1QVFF 3LMEA 5JH7B 3VI6A 4NWOB 3WGNA 1JFFB 4O4LB 4DRXA 2AMTA 3Q8HA 5CB4A 5IJ0B 3L7QA 3V3TA 4YJ2A 3UT5B 3ZP4A 3CMEF 4X1KA 1RQ2A 1W57A 2H6LA 3IKEA 1GX1A 3JAWA 3C9RA 2QTPA 1RQ7A 3MCAB 3NMUC 3C9SA 1SA0A 1U3LA 3VOAA 3IMPA 2DYYA 5B8FA 3I55F 1K8AH 3RYHA 3V7EA 1W5EA 1Z5WA 3JASA 2Z01A 4RQOA 3RYFB 2ZAUA 3RYIA 5C8YB 3E22A 1DBFA 2W8BC 4BY9D 5DCVA 4B62A 5ITZA 1X52A 3G71F 3CPQA 1RLUA 1U43A 4X3MA 5JCOA 5J2TB 1Q81H 1YITF 3KHNA 3C8LA 3F0DA 4LNUA 5EZYA 2YXZA 3NK7A 3DC2A 4G4YA 4C4WC 3OBYA 4ERHA 1W3EX 3KJKA 4EB6B 1DT9A 4G88A 2R6R1 1VQ7F 3HKBB 3I7TA 3GYQA 5BMVA 4X1IB 4ZK7A 1TUBA 2JNBA 3QTYA 2PHNA 4U3JB 3RYCA 5LOVB 2OTLF 4BT3A 1E7KA 2FGYA 1XV2A 1Q8RA 3LWVC 3CD6F 4HNAB 5KX5B 3HWUA 3CYQA 4G4XA 3CC4F 3CYPB 4X3LA 1PXWA 2R751 3N2GA 3BYQA 5JVDB 3V7QA 4ZHYB 3OBWA 4BT5A 1W40A 2MQEA 2Z1FA 3I3FA 4BT2A 4E6EA 3RA6A 1XBIA 1FFXB 5MN4A 2QA4F 4I55B 3VO8A 2L26A 5HY0A 4EI9A 3FBAA 2RHOA 2HVYD 5IT9M 1VQOF 1TVKB 3ELCA 1OAPA 1JD1A 1XHOA 4G4ZA 2CHSA 3MQWA 1Q7YH 4O4HA 3PAFA 3VIUA 1XRGA 2CW4A 2HS4A 2WALA 2RB9A 3N2KA 1W5FA 4YJ3B 3ESJA 1VH8A 1W581 4G4VA 4ZI7B 3NVKE 3WGKA 1YJWF 3MDOA 2H8EA 3JAMM 3IEQA 1K9MH 5CA1B 2CZWA 3WXMB 3D01A 4IHJB 4O4IB 2QEXF 5GIPC 3SIUA 3JARB 1VQVA 2IG8A 3FFMA 3M1XA 4ZHVA 3CMAF 2N48A 3I56F 4ZHQB 1VQNF 4BT7A 2VXYA 3NVIB 4EI8A 1IV4A 1KD1H 1QD9A 2HS0A 4R40B 3CG6A 3OONA 1H7MA 4C81A 2IAFA 3CCSF 3R0PA 3HKDA 3S06A 3J80M 4I4TB 3VYUC 3J81M 5MN6A 4ZHWA 4TV8A 1ONIA 1UI9A 5EYPB 1GZ0A 3LYBA 2ZOVA 2ALEA 1SZQA 3HKEA 3HTNA 2GZLA 5LA6B 4WBNB 2PMPA 2QI2A 3WGJA 3CCEF 1ODEA 4X1KB 4BVTA 5FNVB 4B45A 2OTJF 1YJ9F 2KTVA 4KWEA 2LCAA 5JH7A 3ERNA 3HKCB 4LCKA 3JALB 2GVIA 2H8CA 3K12A 3VYSC 4O4LA 5JCOC 3S0YA 1KQSF 5G4VC 3KJJA 5CA0B 5HY1A 3JCMM 3UT5A 2ZF8A 1YQNA 1CLIA 3CCQF 5GINC 2UYNB 1W5AA 1W5BA 1M90H 3S02A 1VQ9F 2AIFA 1YIJF 2OHWA 1Q86H 4I50B 1JJ2F 3ZO8A 5IJ9B 2RHJA 3MBMA 5J2UB 1YJNF 1Z5VA 1X7PA 5FLXM 4BT6A 3RYFA 5C8YA 3CB2A 3CCRF 5AVMA 2LBTA 5EAZA 1YHQF 3P4EA 3KE1A 3KIZA 3B6NA 4PWTA 3QUWA 4O2BA 2OZBA 1KC8H 3JAKB 4C82A 3P10A 4TV9B 4X1YB 3LWRC 3IR9A 5HY4A 4EB6A 3RA5A 2RHLA 3HKBA 3N2GB 2BTOA 2CSLA 1NMUB 4X1IA 2V9YA 4EI7A 2B33A 2UYJA 4U3JA 5LOVA 1K73H 3CCJF 1RLGA 4HNAA 5KX5A 2HQSC 1YGYA 3O85A 5JQGB 4XCQA 1M1KH 1QVGF 5LXTB 5JVDA 3F6MA 5MN5A 2HP0B 4O2AB 3FD5A 1IPAA 1KNJA 1FFXA 4I55A 5EIBC 3S03A 4F6RA 2CHTA 3CXCF 3LWQC 3F0GA 1TVKA 4IIJB 3HAXD 5KMGB 1GO1A 1T0AA 3LFOA 3OW2F 4BT4A 3LDTA 1NQ3A 3S0WA 4B46A 3LWOC 1IV2A 4M8IA 2Q1XA 2VAWA 4ZOLB 4X20B 2RHHA 2HX0A 5GONB 3WPWA 4NQ3A 1NJIH 3AGKA 3JATB 3J7AR 4YJ3A 1FNJA 4BW0B 4DXDA 4O4JB 3RE3A 5HWEA 3V4DA 5HXUA 5LP6C 5LYJA 5CA1A 5HY2A 2VAPA 2HP3A 5IYZB 1H48A 2BTUA 3K0TA 2HRYA 4IHJA 4TUYB 2KG4A 4O4IA 3JARA 4FFBA 1VQMF 4U39A 1Q82H 2ZVYA 3FPIA 1ZWZA 3S0HA 1H47A 3T80A 5LP6A 4ZHQA 3IEWA 3K14A 3WJQA 5HP7A 4C8EA 1VQPF 2HS3A 5EO3A 3ZP7A 4DRXB 5CB4B 4RHAA 5EB0A 4YJ2B 1RA4A 3NK6A 2NMUA
chains in the Genus database with same CATH topology
3F0EA 3F0GA 3MBMA 4C81A 1U3PA 1T0AA 1JY8A 1H48A 3FBAA 3ERNA 2UZHA 3IEQA 1U3LA 4C8IA 3ELCA 5B8FA 1IV2A 3F0FA 3EORA 3KE1A 3B6NA 3FPIA 1IV1A 1H47A 3T80A 3JVHA 1YQNA 3IEWA 1KNKA 1W55A 3F6MA 1JN1A 2AMTA 2GZLA 3K14A 1IV3A 1VHAA 3Q8HA 3RE3A 3P10A 4C82A 4C8GA 2PMPA 4C8EA 1KNJA 1U40A 1U43A 3K2XA 3IKFA 3F0DA 1W57A 3QHDA 3IKEA 3ESJA 3GHZA 1IV4A 1GX1A 1VH8A 3P0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F0E A;  3F0G A;  3MBM A;  4C81 A;  1U3P A;  1T0A A;  1JY8 A;  1H48 A;  3FBA A;  3ERN A;  2UZH A;  3IEQ A;  1U3L A;  4C8I A;  3ELC A;  5B8F A;  1IV2 A;  3F0F A;  3EOR A;  3KE1 A;  3B6N A;  3FPI A;  1IV1 A;  1H47 A;  3T80 A;  3JVH A;  1YQN A;  3IEW A;  1KNK A;  1W55 A;  3F6M A;  1JN1 A;  2AMT A;  2GZL A;  3K14 A;  1IV3 A;  1VHA A;  3Q8H A;  3RE3 A;  3P10 A;  4C82 A;  4C8G A;  2PMP A;  4C8E A;  1KNJ A;  1U40 A;  1U43 A;  3K2X A;  3IKF A;  3F0D A;  1W57 A;  3QHD A;  3IKE A;  3ESJ A;  3GHZ A;  1IV4 A;  1GX1 A;  1VH8 A;  3P0Z A; 
#chains in the Genus database with same CATH topology
 5EB1 B;  3D00 A;  2I6R A;  5EYP A;  2LBW A;  1J7H A;  3JAW B;  2EWC A;  4NUT A;  2KGW A;  4C8I A;  1VQ8 F;  3PLA C;  1JFF A;  2Z1U A;  5LA6 A;  1SA0 B;  3LWP C;  4WBN A;  5IJ0 A;  3CCV F;  3C9U A;  3JVH A;  3RYH B;  3G6E F;  3JAS B;  3WGL A;  1IV3 A;  3N4Y A;  3RYI B;  3E22 B;  1SDS A;  2OTM A;  5FNV A;  3WPX A;  1N8R H;  3SIV A;  5ITZ B;  5G4U C;  1X25 A;  3VMF B;  1VQ6 F;  1VQ5 F;  3HKC A;  3P0Z A;  3JAL A;  3F0E A;  4LNU B;  1U3P A;  5EZY B;  1VQL F;  2FC3 A;  2AIZ P;  3HJW C;  5CA0 A;  2ZOD A;  3F0F A;  3EOR A;  2CVL A;  5BMV B;  2Q1Y A;  2K1S A;  1IV1 A;  2UYN A;  2UYP A;  1TUB B;  5HP8 A;  1JN1 A;  5J2T A;  3RYC B;  4I50 A;  4O2B B;  1CN7 A;  5IJ9 A;  1QAH A;  5J2U A;  5GAN K;  5EWR A;  1JY8 A;  3VYT C;  2UZH A;  1COM A;  2P6Y A;  1PF5 A;  1VQ4 F;  3JAK A;  2G9I A;  2I6D A;  3U0O A;  4TV9 A;  1X7O A;  4B5C A;  4X1Y A;  2UYK A;  3ON1 A;  5EIB D;  1W41 A;  1YI2 F;  3VOB A;  3VCZ A;  3E20 B;  4O4H B;  3K2X A;  3CCL F;  5A2Q M;  3WJR A;  5HXZ A;  3FD6 A;  1CK2 A;  3N2K B;  4F6R B;  4BVQ A;  1W2B F;  2GLZ A;  1OFU A;  2VAM A;  2BTQ B;  5JQG A;  2VGN A;  2F9Z C;  1UFY A;  5LXT A;  2HP0 A;  2HRU A;  5GIO C;  4O2A A;  2BO1 A;  3WGM A;  1GO0 A;  2IQQ A;  4C8G A;  3CC2 F;  4IIJ A;  5KMG A;  4G4W A;  3WJP A;  3QHD A;  4ZI7 A;  1W42 A;  1W59 A;  2CWJ A;  3TD5 A;  3GHZ A;  3IKF A;  3TD3 A;  3GTZ A;  3CCU F;  1VQK F;  2LBX A;  4ZOL A;  4X20 A;  3M4S A;  5FJ4 C;  5GON A;  4BVS A;  5LYJ B;  3CCM F;  3E1Y A;  3D54 A;  2VGM A;  3CPW F;  3HKD B;  2Z1T A;  3JAT A;  4BVR A;  3C9T A;  4FFB B;  3VTI C;  4TV8 B;  3G4S F;  1KNK A;  1W55 A;  4O4J A;  3CC7 F;  1T0K B;  1VHA A;  2Z1E A;  1S72 F;  5LP6 B;  5GAP K;  2DT4 A;  3N4Z A;  1VK3 A;  1U40 A;  3HKE B;  1QU9 A;  2ZVZ A;  1R1M A;  4TZZ A;  5IYZ A;  3DDN A;  1FNK A;  2YYE A;  4TUY A;  3MCQ A;  4I4T A;  3TD4 A;  1FSZ A;  2KTU A;  3ZOP A;  3M84 A;  1QVF F;  3LME A;  5JH7 B;  3VI6 A;  4NWO B;  3WGN A;  1JFF B;  4O4L B;  4DRX A;  2AMT A;  3Q8H A;  5CB4 A;  5IJ0 B;  3L7Q A;  3V3T A;  4YJ2 A;  3UT5 B;  3ZP4 A;  3CME F;  4X1K A;  1RQ2 A;  1W57 A;  2H6L A;  3IKE A;  1GX1 A;  3JAW A;  3C9R A;  2QTP A;  1RQ7 A;  3MCA B;  3NMU C;  3C9S A;  1SA0 A;  1U3L A;  3VOA A;  3IMP A;  2DYY A;  5B8F A;  3I55 F;  1K8A H;  3RYH A;  3V7E A;  1W5E A;  1Z5W A;  3JAS A;  2Z01 A;  4RQO A;  3RYF B;  2ZAU A;  3RYI A;  5C8Y B;  3E22 A;  1DBF A;  2W8B C;  4BY9 D;  5DCV A;  4B62 A;  5ITZ A;  1X52 A;  3G71 F;  3CPQ A;  1RLU A;  1U43 A;  4X3M A;  5JCO A;  5J2T B;  1Q81 H;  1YIT F;  3KHN A;  3C8L A;  3F0D A;  4LNU A;  5EZY A;  2YXZ A;  3NK7 A;  3DC2 A;  4G4Y A;  4C4W C;  3OBY A;  4ERH A;  1W3E X;  3KJK A;  4EB6 B;  1DT9 A;  4G88 A;  2R6R 1;  1VQ7 F;  3HKB B;  3I7T A;  3GYQ A;  5BMV A;  4X1I B;  4ZK7 A;  1TUB A;  2JNB A;  3QTY A;  2PHN A;  4U3J B;  3RYC A;  5LOV B;  2OTL F;  4BT3 A;  1E7K A;  2FGY A;  1XV2 A;  1Q8R A;  3LWV C;  3CD6 F;  4HNA B;  5KX5 B;  3HWU A;  3CYQ A;  4G4X A;  3CC4 F;  3CYP B;  4X3L A;  1PXW A;  2R75 1;  3N2G A;  3BYQ A;  5JVD B;  3V7Q A;  4ZHY B;  3OBW A;  4BT5 A;  1W40 A;  2MQE A;  2Z1F A;  3I3F A;  4BT2 A;  4E6E A;  3RA6 A;  1XBI A;  1FFX B;  5MN4 A;  2QA4 F;  4I55 B;  3VO8 A;  2L26 A;  5HY0 A;  4EI9 A;  3FBA A;  2RHO A;  2HVY D;  5IT9 M;  1VQO F;  1TVK B;  3ELC A;  1OAP A;  1JD1 A;  1XHO A;  4G4Z A;  2CHS A;  3MQW A;  1Q7Y H;  4O4H A;  3PAF A;  3VIU A;  1XRG A;  2CW4 A;  2HS4 A;  2WAL A;  2RB9 A;  3N2K A;  1W5F A;  4YJ3 B;  3ESJ A;  1VH8 A;  1W58 1;  4G4V A;  4ZI7 B;  3NVK E;  3WGK A;  1YJW F;  3MDO A;  2H8E A;  3JAM M;  3IEQ A;  1K9M H;  5CA1 B;  2CZW A;  3WXM B;  3D01 A;  4IHJ B;  4O4I B;  2QEX F;  5GIP C;  3SIU A;  3JAR B;  1VQV A;  2IG8 A;  3FFM A;  3M1X A;  4ZHV A;  3CMA F;  2N48 A;  3I56 F;  4ZHQ B;  1VQN F;  4BT7 A;  2VXY A;  3NVI B;  4EI8 A;  1IV4 A;  1KD1 H;  1QD9 A;  2HS0 A;  4R40 B;  3CG6 A;  3OON A;  1H7M A;  4C81 A;  2IAF A;  3CCS F;  3R0P A;  3HKD A;  3S06 A;  3J80 M;  4I4T B;  3VYU C;  3J81 M;  5MN6 A;  4ZHW A;  4TV8 A;  1ONI A;  1UI9 A;  5EYP B;  1GZ0 A;  3LYB A;  2ZOV A;  2ALE A;  1SZQ A;  3HKE A;  3HTN A;  2GZL A;  5LA6 B;  4WBN B;  2PMP A;  2QI2 A;  3WGJ A;  3CCE F;  1ODE A;  4X1K B;  4BVT A;  5FNV B;  4B45 A;  2OTJ F;  1YJ9 F;  2KTV A;  4KWE A;  2LCA A;  5JH7 A;  3ERN A;  3HKC B;  4LCK A;  3JAL B;  2GVI A;  2H8C A;  3K12 A;  3VYS C;  4O4L A;  5JCO C;  3S0Y A;  1KQS F;  5G4V C;  3KJJ A;  5CA0 B;  5HY1 A;  3JCM M;  3UT5 A;  2ZF8 A;  1YQN A;  1CLI A;  3CCQ F;  5GIN C;  2UYN B;  1W5A A;  1W5B A;  1M90 H;  3S02 A;  1VQ9 F;  2AIF A;  1YIJ F;  2OHW A;  1Q86 H;  4I50 B;  1JJ2 F;  3ZO8 A;  5IJ9 B;  2RHJ A;  3MBM A;  5J2U B;  1YJN F;  1Z5V A;  1X7P A;  5FLX M;  4BT6 A;  3RYF A;  5C8Y A;  3CB2 A;  3CCR F;  5AVM A;  2LBT A;  5EAZ A;  1YHQ F;  3P4E A;  3KE1 A;  3KIZ A;  3B6N A;  4PWT A;  3QUW A;  4O2B A;  2OZB A;  1KC8 H;  3JAK B;  4C82 A;  3P10 A;  4TV9 B;  4X1Y B;  3LWR C;  3IR9 A;  5HY4 A;  4EB6 A;  3RA5 A;  2RHL A;  3HKB A;  3N2G B;  2BTO A;  2CSL A;  1NMU B;  4X1I A;  2V9Y A;  4EI7 A;  2B33 A;  2UYJ A;  4U3J A;  5LOV A;  1K73 H;  3CCJ F;  1RLG A;  4HNA A;  5KX5 A;  2HQS C;  1YGY A;  3O85 A;  5JQG B;  4XCQ A;  1M1K H;  1QVG F;  5LXT B;  5JVD A;  3F6M A;  5MN5 A;  2HP0 B;  4O2A B;  3FD5 A;  1IPA A;  1KNJ A;  1FFX A;  4I55 A;  5EIB C;  3S03 A;  4F6R A;  2CHT A;  3CXC F;  3LWQ C;  3F0G A;  1TVK A;  4IIJ B;  3HAX D;  5KMG B;  1GO1 A;  1T0A A;  3LFO A;  3OW2 F;  4BT4 A;  3LDT A;  1NQ3 A;  3S0W A;  4B46 A;  3LWO C;  1IV2 A;  4M8I A;  2Q1X A;  2VAW A;  4ZOL B;  4X20 B;  2RHH A;  2HX0 A;  5GON B;  3WPW A;  4NQ3 A;  1NJI H;  3AGK A;  3JAT B;  3J7A R;  4YJ3 A;  1FNJ A;  4BW0 B;  4DXD A;  4O4J B;  3RE3 A;  5HWE A;  3V4D A;  5HXU A;  5LP6 C;  5LYJ A;  5CA1 A;  5HY2 A;  2VAP A;  2HP3 A;  5IYZ B;  1H48 A;  2BTU A;  3K0T A;  2HRY A;  4IHJ A;  4TUY B;  2KG4 A;  4O4I A;  3JAR A;  4FFB A;  1VQM F;  4U39 A;  1Q82 H;  2ZVY A;  3FPI A;  1ZWZ A;  3S0H A;  1H47 A;  3T80 A;  5LP6 A;  4ZHQ A;  3IEW A;  3K14 A;  3WJQ A;  5HP7 A;  4C8E A;  1VQP F;  2HS3 A;  5EO3 A;  3ZP7 A;  4DRX B;  5CB4 B;  4RHA A;  5EB0 A;  4YJ2 B;  1RA4 A;  3NK6 A;  2NMU A; 
#chains in the Genus database with same CATH homology
 3F0E A;  3F0G A;  3MBM A;  4C81 A;  1U3P A;  1T0A A;  1JY8 A;  1H48 A;  3FBA A;  3ERN A;  2UZH A;  3IEQ A;  1U3L A;  4C8I A;  3ELC A;  5B8F A;  1IV2 A;  3F0F A;  3EOR A;  3KE1 A;  3B6N A;  3FPI A;  1IV1 A;  1H47 A;  3T80 A;  3JVH A;  1YQN A;  3IEW A;  1KNK A;  1W55 A;  3F6M A;  1JN1 A;  2AMT A;  2GZL A;  3K14 A;  1IV3 A;  1VHA A;  3Q8H A;  3RE3 A;  3P10 A;  4C82 A;  4C8G A;  2PMP A;  4C8E A;  1KNJ A;  1U40 A;  1U43 A;  3K2X A;  3IKF A;  3F0D A;  1W57 A;  3QHD A;  3IKE A;  3ESJ A;  3GHZ A;  1IV4 A;  1GX1 A;  1VH8 A;  3P0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...