3IEQA

Crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with cytidine
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
total genus 50
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2009-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3ieqA00
1IV4A 1U40A 1IV1A 3IEWA 3T80A 1IV2A 3F0GA 3QHDA 1T0AA 1W55A 3EORA 1IV3A 2GZLA 2PMPA 3B6NA 3Q8HA 3IEQA 1W57A 3IKFA 1JY8A 3F0EA 3ELCA 4C8EA 4C81A 3IKEA 3K2XA 1U3LA 1H47A 3ESJA 1KNJA 3F0DA 3FPIA 3RE3A 4C8IA 1VH8A 1KNKA 1JN1A 1H48A 4C82A 1U3PA 3KE1A 3GHZA 1GX1A 3ERNA 3F6MA 3FBAA 3F0FA 1VHAA 3K14A 3JVHA 3P10A 5B8FA 3MBMA 1YQNA 3P0ZA 1U43A 4C8GA 2AMTA 2UZHA
chains in the Genus database with same CATH superfamily
5FNVB 2R751 3HAXD 3C9UA 3CCVF 3ZO8A 2IG8A 3EORA 4YJ2B 3N4YA 3HKDA 4BT6A 1S72F 1K73H 2JNBA 1SA0B 3CCLF 3UT5B 3LDTA 4X3LA 4I4TA 4G4XA 3J81M 3WPXA 2HX0A 1VQ5F 2KTUA 4C8IA 3M4SA 3WJRA 1RQ2A 2Z1UA 1VQ9F 5HY0A 1K8AH 3K14A 5EB1B 3C9TA 4BT7A 5JCOC 3HJWC 4R40B 3WJPA 2UZHA 1QU9A 4ZI7B 1VQ7F 3IEWA 3I55F 3JCMM 3RA5A 1IV3A 2H8CA 1RLGA 1NMUB 2LBWA 1SDSA 4B46A 2RHLA 2WALA 4TUYB 2CSLA 5IJ9B 1W3EX 4TV9A 3L7QA 1XHOA 5JQGA 1ZWZA 5HY2A 4BT4A 4U3JA 3LWOC 3SIUA 5FLXM 3FPIA 5LOVA 5J2TA 5EB0A 3WGMA 4C82A 4YJ3B 3JVHA 3D54A 4F6RA 3V3TA 5LYJB 2VGNA 3I3FA 2AMTA 3LWPC 3VMFB 3QTYA 1M1KH 3T80A 1W59A 1K9MH 2Z1TA 3VO8A 3N2GA 5LXTB 2MQEA 3JASA 3FD6A 3IKFA 5HP8A 3VYSC 1E7KA 2HS3A 3CYQA 5EYPA 1U3LA 1H47A 2QA4F 3I7TA 1KNJA 4FFBB 1RLUA 3S06A 3D01A 3NVIB 3M1XA 1X7OA 5ITZB 2QEXF 5EIBC 1YIJF 2IQQA 1U43A 3HKCA 2KGWA 2OTLF 3CCMF 1TVKA 3S03A 1IV4A 3E22A 3K0TA 1W581 3HKBB 3CCRF 2KTVA 1VQLF 1YJNF 4O4JB 3LFOA 4PWTA 3RYCA 1W5FA 4X1YA 1KQSF 2H8EA 3IKEA 2AIZP 2NMUA 4RQOA 5KX5A 1PF5A 5HXZA 4G4ZA 1JN1A 2BTQB 4C4WC 3ZP4A 5CB4A 2Q1XA 5JVDA 2HP3A 4U39A 1IV1A 3GTZA 4O4IB 1Z5WA 3JAKA 4BT3A 3NVKE 4ZHYB 1W2BF 1VQ8F 1W57A 4IHJA 1VQVA 1YI2F 3V7EA 2F9ZC 2BTUA 3K2XA 3HKEA 1YGYA 5JH7B 1W40A 5LA6B 2H6LA 1KNKA 2UYNB 4I55B 1VQ6F 5GAPK 2UYKA 3WGLA 3KJKA 2DT4A 3FFMA 1OFUA 2YXZA 3N4ZA 4G4WA 4BVSA 4O2AA 2HQSC 5EAZA 1QAHA 5LP6B 3VIUA 3F0GA 3QHDA 2LCAA 3S0YA 5JCOA 3BYQA 3Q8HA 5AVMA 3OW2F 1COMA 5HWEA 5C8YA 4X1KB 2ZVZA 3VI6A 1Q8RA 1UI9A 5J2UB 1SA0A 4HNAB 4X1IB 3ZOPA 1VQNF 3R0PA 1Z5VA 2HP0A 4XCQA 3RYHA 3G4SF 4E6EA 3ERNA 5B8FA 1W5AA 3P0ZA 4X20A 3HKDB 4ERHA 1RA4A 1XV2A 4O4LB 5HY1A 4LCKA 2GZLA 4I50A 4I4TB 3LWVC 2ZF8A 1J7HA 5EWRA 5IT9M 1FFXA 5MN4A 2VAMA 3U0OA 2R6R1 4EI8A 2W8BC 4O2BA 4BW0B 3JALA 3VOBA 3KHNA 3OONA 1RQ7A 4BVTA 5EIBD 2FGYA 3G71F 2Z01A 4ZHQA 3C9RA 1X7PA 4WBNA 1X52A 2OTMA 4M8IA 4NQ3A 1U40A 2BTOA 3TD4A 4TV9B 4O4HA 5JQGB 5CA0A 1FNKA 4U3JB 2RHHA 1M90H 4ZHVA 5HP7A 2VAWA 3JAWA 1YJWF 1UFYA 5J2TB 4G4YA 3V4DA 1GZ0A 5IYZA 3CC4F 4F6RB 3FD5A 3RE3A 1XBIA 1GX1A 3CCQF 4X3MA 4G4VA 3CCJF 4FFBA 1JJ2F 5FJ4C 2RB9A 3N2GB 5GIOC 3JASB 5ITZA 5CA1A 4ZK7A 2DYYA 4B45A 2ZODA 1TUBA 2PMPA 5EYPB 1Q82H 4EB6A 5GINC 3RYFB 2HRUA 4TV8A 1GO1A 3CB2A 5GONA 2LBXA 1W42A 3CCSF 3HKCB 3LWQC 1TVKB 5IJ0A 3E22B 3KJJA 5BMVA 3KIZA 3F0FA 4ZOLA 2BO1A 5MN5A 2OTJF 1JFFB 5KMGA 2HS0A 2QI2A 3CC2F 4LNUA 1T0AA 5HY4A 4X1YB 3RA6A 3K12A 3RYCB 2KG4A 1CN7A 3NK7A 3WXMB 3E20B 3LMEA 3LYBA 3S0WA 5GIPC 1W5BA 5KX5B 1QVFF 2LBTA 3JARA 2OHWA 3JATA 3VTIC 1QVGF 1NJIH 4TZZA 3MCAB 3M84A 2G9IA 1Q86H 2I6RA 5CB4B 3N2KA 3C9SA 3ESJA 5JVDB 2K1SA 1VQKF 4DRXA 3O85A 3JAKB 4BT5A 2HS4A 3MBMA 2VGMA 2GLZA 4IIJA 3ON1A 4IHJB 3RYIA 2CWJA 3C8LA 2PHNA 3HKEB 3CPQA 5FNVA 3TD3A 5LP6A 1YJ9F 3CYPB 3ZP7A 2HVYD 3NK6A 2ZVYA 3LWRC 4YJ2A 1T0KB 3CMEF 1VK3A 4KWEA 1VH8A 3OBWA 5EZYB 4O2AB 3UT5A 3J80M 1U3PA 2VXYA 3QUWA 1IPAA 1VQMF 4NWOB 2OZBA 3S0HA 5LP6C 4EI9A 5C8YB 3CD6F 1W55A 5A2QM 3PLAC 3J7AR 3B6NA 2EWCA 4O4LA 3IEQA 4ZI7A 1R1MA 3DC2A 1VQ4F 2HP0B 2AIFA 3RYHB 4C81A 4B62A 1KC8H 1FNJA 3SIVA 2HRYA 3AGKA 2CW4A 1VQPF 2CHSA 4TUYA 4X20B 5IJ9A 3S02A 2CZWA 3WPWA 3IR9A 3OBYA 2CHTA 3P10A 1CK2A 4I50B 4DXDA 3WGJA 2YYEA 1FFXB 1XRGA 3TD5A 4YJ3A 1YITF 1GO0A 3G6EF 3VYTC 4EI7A 1ODEA 4O2BB 2V9YA 3JALB 5LYJA 3CCUF 4G88A 2L26A 2QTPA 3JAMM 2FC3A 3CPWF 3ELCA 3VCZA 4BVRA 5LOVB 1VQOF 3NMUC 4ZHQB 1X25A 5LXTA 4WBNB 3F0DA 2Z1EA 1FSZA 1VHAA 4O4HB 2I6DA 5CA0B 1W5EA 1YQNA 5EO3A 1NQ3A 1W41A 2VAPA 3JAWB 4B5CA 1IV2A 3P4EA 5IYZB 5DCVA 1SZQA 3CXCF 5G4UC 3F0EA 3WJQA 4RHAA 3HKBA 3CMAF 1DT9A 5HXUA 3RYFA 4O4JA 2IAFA 2GVIA 2ZAUA 2UYPA 2Q1YA 3GYQA 5CA1B 3GHZA 3F6MA 3FBAA 5GANK 1TUBB 1Q81H 4EB6B 3V7QA 3WGNA 1JFFA 5G4VC 2Z1FA 2RHOA 4TV8B 1DBFA 3CC7F 3VYUC 5GONB 4O4IA 1JY8A 4NUTA 1PXWA 5IJ0B 1ONIA 5BMVB 3E1YA 4ZOLB 1QD9A 3HWUA 2B33A 2RHJA 5KMGB 1OAPA 3MDOA 1Q7YH 3KE1A 4BVQA 4LNUB 3CG6A 5JH7A 3MQWA 5LA6A 3MCQA 2P6YA 1KD1H 4C8GA 3I56F 4BT2A 2UYNA 4I55A 1CLIA 2CVLA 3JARB 3PAFA 3JATB 2ZOVA 4ZHWA 3HTNA 3N2KB 5MN6A 1N8RH 3VOAA 4C8EA 4DRXB 3IMPA 2N48A 1JD1A 2UYJA 3CCEF 4BY9D 4X1KA 1H48A 3DDNA 4IIJB 1H7MA 3WGKA 5J2UA 3RYIB 4HNAA 2ALEA 4X1IA 3D00A 5EZYA 1YHQF
chains in the Genus database with same CATH topology
1IV4A 1U40A 1IV1A 3IEWA 3T80A 1IV2A 3F0GA 3QHDA 1T0AA 1W55A 3EORA 1IV3A 2GZLA 2PMPA 3B6NA 3Q8HA 3IEQA 1W57A 3IKFA 1JY8A 3F0EA 3ELCA 4C8EA 4C81A 3IKEA 3K2XA 1U3LA 1H47A 3ESJA 1KNJA 3F0DA 3FPIA 3RE3A 4C8IA 1VH8A 1KNKA 1JN1A 1H48A 4C82A 1U3PA 3KE1A 3GHZA 1GX1A 3ERNA 3F6MA 3FBAA 3F0FA 1VHAA 3K14A 3JVHA 3P10A 5B8FA 3MBMA 1YQNA 3P0ZA 1U43A 4C8GA 2AMTA 2UZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IV4 A;  1U40 A;  1IV1 A;  3IEW A;  3T80 A;  1IV2 A;  3F0G A;  3QHD A;  1T0A A;  1W55 A;  3EOR A;  1IV3 A;  2GZL A;  2PMP A;  3B6N A;  3Q8H A;  3IEQ A;  1W57 A;  3IKF A;  1JY8 A;  3F0E A;  3ELC A;  4C8E A;  4C81 A;  3IKE A;  3K2X A;  1U3L A;  1H47 A;  3ESJ A;  1KNJ A;  3F0D A;  3FPI A;  3RE3 A;  4C8I A;  1VH8 A;  1KNK A;  1JN1 A;  1H48 A;  4C82 A;  1U3P A;  3KE1 A;  3GHZ A;  1GX1 A;  3ERN A;  3F6M A;  3FBA A;  3F0F A;  1VHA A;  3K14 A;  3JVH A;  3P10 A;  5B8F A;  3MBM A;  1YQN A;  3P0Z A;  1U43 A;  4C8G A;  2AMT A;  2UZH A; 
#chains in the Genus database with same CATH topology
 5FNV B;  2R75 1;  3HAX D;  3C9U A;  3CCV F;  3ZO8 A;  2IG8 A;  3EOR A;  4YJ2 B;  3N4Y A;  3HKD A;  4BT6 A;  1S72 F;  1K73 H;  2JNB A;  1SA0 B;  3CCL F;  3UT5 B;  3LDT A;  4X3L A;  4I4T A;  4G4X A;  3J81 M;  3WPX A;  2HX0 A;  1VQ5 F;  2KTU A;  4C8I A;  3M4S A;  3WJR A;  1RQ2 A;  2Z1U A;  1VQ9 F;  5HY0 A;  1K8A H;  3K14 A;  5EB1 B;  3C9T A;  4BT7 A;  5JCO C;  3HJW C;  4R40 B;  3WJP A;  2UZH A;  1QU9 A;  4ZI7 B;  1VQ7 F;  3IEW A;  3I55 F;  3JCM M;  3RA5 A;  1IV3 A;  2H8C A;  1RLG A;  1NMU B;  2LBW A;  1SDS A;  4B46 A;  2RHL A;  2WAL A;  4TUY B;  2CSL A;  5IJ9 B;  1W3E X;  4TV9 A;  3L7Q A;  1XHO A;  5JQG A;  1ZWZ A;  5HY2 A;  4BT4 A;  4U3J A;  3LWO C;  3SIU A;  5FLX M;  3FPI A;  5LOV A;  5J2T A;  5EB0 A;  3WGM A;  4C82 A;  4YJ3 B;  3JVH A;  3D54 A;  4F6R A;  3V3T A;  5LYJ B;  2VGN A;  3I3F A;  2AMT A;  3LWP C;  3VMF B;  3QTY A;  1M1K H;  3T80 A;  1W59 A;  1K9M H;  2Z1T A;  3VO8 A;  3N2G A;  5LXT B;  2MQE A;  3JAS A;  3FD6 A;  3IKF A;  5HP8 A;  3VYS C;  1E7K A;  2HS3 A;  3CYQ A;  5EYP A;  1U3L A;  1H47 A;  2QA4 F;  3I7T A;  1KNJ A;  4FFB B;  1RLU A;  3S06 A;  3D01 A;  3NVI B;  3M1X A;  1X7O A;  5ITZ B;  2QEX F;  5EIB C;  1YIJ F;  2IQQ A;  1U43 A;  3HKC A;  2KGW A;  2OTL F;  3CCM F;  1TVK A;  3S03 A;  1IV4 A;  3E22 A;  3K0T A;  1W58 1;  3HKB B;  3CCR F;  2KTV A;  1VQL F;  1YJN F;  4O4J B;  3LFO A;  4PWT A;  3RYC A;  1W5F A;  4X1Y A;  1KQS F;  2H8E A;  3IKE A;  2AIZ P;  2NMU A;  4RQO A;  5KX5 A;  1PF5 A;  5HXZ A;  4G4Z A;  1JN1 A;  2BTQ B;  4C4W C;  3ZP4 A;  5CB4 A;  2Q1X A;  5JVD A;  2HP3 A;  4U39 A;  1IV1 A;  3GTZ A;  4O4I B;  1Z5W A;  3JAK A;  4BT3 A;  3NVK E;  4ZHY B;  1W2B F;  1VQ8 F;  1W57 A;  4IHJ A;  1VQV A;  1YI2 F;  3V7E A;  2F9Z C;  2BTU A;  3K2X A;  3HKE A;  1YGY A;  5JH7 B;  1W40 A;  5LA6 B;  2H6L A;  1KNK A;  2UYN B;  4I55 B;  1VQ6 F;  5GAP K;  2UYK A;  3WGL A;  3KJK A;  2DT4 A;  3FFM A;  1OFU A;  2YXZ A;  3N4Z A;  4G4W A;  4BVS A;  4O2A A;  2HQS C;  5EAZ A;  1QAH A;  5LP6 B;  3VIU A;  3F0G A;  3QHD A;  2LCA A;  3S0Y A;  5JCO A;  3BYQ A;  3Q8H A;  5AVM A;  3OW2 F;  1COM A;  5HWE A;  5C8Y A;  4X1K B;  2ZVZ A;  3VI6 A;  1Q8R A;  1UI9 A;  5J2U B;  1SA0 A;  4HNA B;  4X1I B;  3ZOP A;  1VQN F;  3R0P A;  1Z5V A;  2HP0 A;  4XCQ A;  3RYH A;  3G4S F;  4E6E A;  3ERN A;  5B8F A;  1W5A A;  3P0Z A;  4X20 A;  3HKD B;  4ERH A;  1RA4 A;  1XV2 A;  4O4L B;  5HY1 A;  4LCK A;  2GZL A;  4I50 A;  4I4T B;  3LWV C;  2ZF8 A;  1J7H A;  5EWR A;  5IT9 M;  1FFX A;  5MN4 A;  2VAM A;  3U0O A;  2R6R 1;  4EI8 A;  2W8B C;  4O2B A;  4BW0 B;  3JAL A;  3VOB A;  3KHN A;  3OON A;  1RQ7 A;  4BVT A;  5EIB D;  2FGY A;  3G71 F;  2Z01 A;  4ZHQ A;  3C9R A;  1X7P A;  4WBN A;  1X52 A;  2OTM A;  4M8I A;  4NQ3 A;  1U40 A;  2BTO A;  3TD4 A;  4TV9 B;  4O4H A;  5JQG B;  5CA0 A;  1FNK A;  4U3J B;  2RHH A;  1M90 H;  4ZHV A;  5HP7 A;  2VAW A;  3JAW A;  1YJW F;  1UFY A;  5J2T B;  4G4Y A;  3V4D A;  1GZ0 A;  5IYZ A;  3CC4 F;  4F6R B;  3FD5 A;  3RE3 A;  1XBI A;  1GX1 A;  3CCQ F;  4X3M A;  4G4V A;  3CCJ F;  4FFB A;  1JJ2 F;  5FJ4 C;  2RB9 A;  3N2G B;  5GIO C;  3JAS B;  5ITZ A;  5CA1 A;  4ZK7 A;  2DYY A;  4B45 A;  2ZOD A;  1TUB A;  2PMP A;  5EYP B;  1Q82 H;  4EB6 A;  5GIN C;  3RYF B;  2HRU A;  4TV8 A;  1GO1 A;  3CB2 A;  5GON A;  2LBX A;  1W42 A;  3CCS F;  3HKC B;  3LWQ C;  1TVK B;  5IJ0 A;  3E22 B;  3KJJ A;  5BMV A;  3KIZ A;  3F0F A;  4ZOL A;  2BO1 A;  5MN5 A;  2OTJ F;  1JFF B;  5KMG A;  2HS0 A;  2QI2 A;  3CC2 F;  4LNU A;  1T0A A;  5HY4 A;  4X1Y B;  3RA6 A;  3K12 A;  3RYC B;  2KG4 A;  1CN7 A;  3NK7 A;  3WXM B;  3E20 B;  3LME A;  3LYB A;  3S0W A;  5GIP C;  1W5B A;  5KX5 B;  1QVF F;  2LBT A;  3JAR A;  2OHW A;  3JAT A;  3VTI C;  1QVG F;  1NJI H;  4TZZ A;  3MCA B;  3M84 A;  2G9I A;  1Q86 H;  2I6R A;  5CB4 B;  3N2K A;  3C9S A;  3ESJ A;  5JVD B;  2K1S A;  1VQK F;  4DRX A;  3O85 A;  3JAK B;  4BT5 A;  2HS4 A;  3MBM A;  2VGM A;  2GLZ A;  4IIJ A;  3ON1 A;  4IHJ B;  3RYI A;  2CWJ A;  3C8L A;  2PHN A;  3HKE B;  3CPQ A;  5FNV A;  3TD3 A;  5LP6 A;  1YJ9 F;  3CYP B;  3ZP7 A;  2HVY D;  3NK6 A;  2ZVY A;  3LWR C;  4YJ2 A;  1T0K B;  3CME F;  1VK3 A;  4KWE A;  1VH8 A;  3OBW A;  5EZY B;  4O2A B;  3UT5 A;  3J80 M;  1U3P A;  2VXY A;  3QUW A;  1IPA A;  1VQM F;  4NWO B;  2OZB A;  3S0H A;  5LP6 C;  4EI9 A;  5C8Y B;  3CD6 F;  1W55 A;  5A2Q M;  3PLA C;  3J7A R;  3B6N A;  2EWC A;  4O4L A;  3IEQ A;  4ZI7 A;  1R1M A;  3DC2 A;  1VQ4 F;  2HP0 B;  2AIF A;  3RYH B;  4C81 A;  4B62 A;  1KC8 H;  1FNJ A;  3SIV A;  2HRY A;  3AGK A;  2CW4 A;  1VQP F;  2CHS A;  4TUY A;  4X20 B;  5IJ9 A;  3S02 A;  2CZW A;  3WPW A;  3IR9 A;  3OBY A;  2CHT A;  3P10 A;  1CK2 A;  4I50 B;  4DXD A;  3WGJ A;  2YYE A;  1FFX B;  1XRG A;  3TD5 A;  4YJ3 A;  1YIT F;  1GO0 A;  3G6E F;  3VYT C;  4EI7 A;  1ODE A;  4O2B B;  2V9Y A;  3JAL B;  5LYJ A;  3CCU F;  4G88 A;  2L26 A;  2QTP A;  3JAM M;  2FC3 A;  3CPW F;  3ELC A;  3VCZ A;  4BVR A;  5LOV B;  1VQO F;  3NMU C;  4ZHQ B;  1X25 A;  5LXT A;  4WBN B;  3F0D A;  2Z1E A;  1FSZ A;  1VHA A;  4O4H B;  2I6D A;  5CA0 B;  1W5E A;  1YQN A;  5EO3 A;  1NQ3 A;  1W41 A;  2VAP A;  3JAW B;  4B5C A;  1IV2 A;  3P4E A;  5IYZ B;  5DCV A;  1SZQ A;  3CXC F;  5G4U C;  3F0E A;  3WJQ A;  4RHA A;  3HKB A;  3CMA F;  1DT9 A;  5HXU A;  3RYF A;  4O4J A;  2IAF A;  2GVI A;  2ZAU A;  2UYP A;  2Q1Y A;  3GYQ A;  5CA1 B;  3GHZ A;  3F6M A;  3FBA A;  5GAN K;  1TUB B;  1Q81 H;  4EB6 B;  3V7Q A;  3WGN A;  1JFF A;  5G4V C;  2Z1F A;  2RHO A;  4TV8 B;  1DBF A;  3CC7 F;  3VYU C;  5GON B;  4O4I A;  1JY8 A;  4NUT A;  1PXW A;  5IJ0 B;  1ONI A;  5BMV B;  3E1Y A;  4ZOL B;  1QD9 A;  3HWU A;  2B33 A;  2RHJ A;  5KMG B;  1OAP A;  3MDO A;  1Q7Y H;  3KE1 A;  4BVQ A;  4LNU B;  3CG6 A;  5JH7 A;  3MQW A;  5LA6 A;  3MCQ A;  2P6Y A;  1KD1 H;  4C8G A;  3I56 F;  4BT2 A;  2UYN A;  4I55 A;  1CLI A;  2CVL A;  3JAR B;  3PAF A;  3JAT B;  2ZOV A;  4ZHW A;  3HTN A;  3N2K B;  5MN6 A;  1N8R H;  3VOA A;  4C8E A;  4DRX B;  3IMP A;  2N48 A;  1JD1 A;  2UYJ A;  3CCE F;  4BY9 D;  4X1K A;  1H48 A;  3DDN A;  4IIJ B;  1H7M A;  3WGK A;  5J2U A;  3RYI B;  4HNA A;  2ALE A;  4X1I A;  3D00 A;  5EZY A;  1YHQ F; 
#chains in the Genus database with same CATH homology
 1IV4 A;  1U40 A;  1IV1 A;  3IEW A;  3T80 A;  1IV2 A;  3F0G A;  3QHD A;  1T0A A;  1W55 A;  3EOR A;  1IV3 A;  2GZL A;  2PMP A;  3B6N A;  3Q8H A;  3IEQ A;  1W57 A;  3IKF A;  1JY8 A;  3F0E A;  3ELC A;  4C8E A;  4C81 A;  3IKE A;  3K2X A;  1U3L A;  1H47 A;  3ESJ A;  1KNJ A;  3F0D A;  3FPI A;  3RE3 A;  4C8I A;  1VH8 A;  1KNK A;  1JN1 A;  1H48 A;  4C82 A;  1U3P A;  3KE1 A;  3GHZ A;  1GX1 A;  3ERN A;  3F6M A;  3FBA A;  3F0F A;  1VHA A;  3K14 A;  3JVH A;  3P10 A;  5B8F A;  3MBM A;  1YQN A;  3P0Z A;  1U43 A;  4C8G A;  2AMT A;  2UZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...