3IEQA

Crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with cytidine
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
total genus 50
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2009-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3ieqA00
3K14A 4C8IA 2AMTA 1U3PA 3EORA 3IEQA 1KNJA 3K2XA 3T80A 4C82A 2PMPA 3ERNA 1VH8A 1IV2A 4C8EA 4C81A 1KNKA 1IV1A 4C8GA 1IV4A 1H48A 3F0FA 3GHZA 3IKEA 1U43A 3P0ZA 1IV3A 1W57A 3QHDA 1U3LA 3F0GA 3MBMA 3B6NA 1YQNA 1JY8A 2GZLA 3JVHA 1T0AA 3KE1A 1H47A 5B8FA 3IEWA 1JN1A 3FPIA 3F0DA 1W55A 3ELCA 3ESJA 3RE3A 3Q8HA 3IKFA 3P10A 3F6MA 3FBAA 1GX1A 1VHAA 2UZHA 1U40A 3F0EA
chains in the Genus database with same CATH superfamily
3K14A 4LNUA 2BTUA 2RHOA 1E7KA 2ZAUA 1VQNF 5EZYB 2KGWA 3RYHB 4DXDA 3UT5B 1JJ2F 1M1KH 1RQ7A 1SDSA 2CZWA 1Q81H 1IV4A 1TUBA 5J2TB 1IV3A 5IJ9A 1K8AH 5LOVB 3OBYA 3HKBB 3JCMM 2L26A 1VQLF 1KC8H 1JD1A 2ALEA 3C9RA 1W55A 5LYJA 2Z1TA 2V9YA 4DRXB 4ZK7A 3CCMF 1K9MH 4YJ3A 5LA6A 2N48A 2CVLA 2I6RA 2HP3A 5EB1B 3VYUC 3JAMM 2AMTA 3LYBA 3S02A 4O2AA 3D54A 3N2KA 3HKEB 3FFMA 3ON1A 5EIBD 1Q7YH 3OONA 1IV1A 3KHNA 5CA0B 3HTNA 3U0OA 1YJ9F 3B6NA 2F9ZC 1W41A 5AVMA 4HNAB 3HJWC 4BT5A 5EZYA 3JAWB 3N2GB 3MCAB 3S06A 1TVKB 3UT5A 4IHJA 4I4TB 4BT6A 1U40A 3N4ZA 5J2TA 4E6EA 3LWVC 1VQVA 3VO8A 4BT2A 4F6RA 3ZOPA 3WJRA 1W3EX 1X25A 4C8GA 3PLAC 2UYKA 4O4JA 3MBMA 5KMGB 3OW2F 3WJPA 5HP8A 3RYFB 5KX5A 1KD1H 3HKEA 5LXTA 5EB0A 1W2BF 4B45A 4G4XA 5A2QM 4O4LB 3KIZA 4TV8A 5FLXM 2HRYA 3GYQA 3PAFA 5CA0A 3K2XA 3C9TA 2B33A 1VQ5F 1W42A 3JARA 2H8EA 1QAHA 4HNAA 4G4YA 4X3MA 3MCQA 3GHZA 5FNVB 4BT3A 4EB6B 3JAWA 2HX0A 4ERHA 1YQNA 3M84A 1JY8A 2CHTA 2GZLA 2QTPA 3M4SA 3CCEF 3WPXA 3V3TA 5IJ0A 3NVKE 4G4WA 2Q1YA 3WJQA 3FBAA 1FFXB 3JAKB 5HXUA 1YJNF 5J2UB 4FFBA 4ZOLA 1K73H 4RQOA 4C82A 1X52A 3WGJA 2CHSA 5KMGA 2BTQB 1KNKA 3JATB 4RHAA 1W5FA 3F0FA 4BW0B 2Z1UA 3RYFA 1U3LA 2OHWA 2VAPA 5HWEA 3M1XA 5EYPB 5JCOA 2IAFA 2DT4A 2UYJA 5GANK 4NQ3A 3CCQF 2HS0A 3E22B 4ZHVA 3G71F 3VOAA 3VYTC 3I3FA 4U3JB 3VIUA 4B62A 3G6EF 1VQOF 1YIJF 4BY9D 4YJ2B 3VMFB 5HXZA 2Z01A 5LP6A 3C9UA 3S0YA 3FD5A 4XCQA 1PXWA 2RHLA 3ERNA 2IQQA 2BO1A 2KTVA 5GIOC 1YJWF 3S03A 1YGYA 4BVSA 2QA4F 2HVYD 1RA4A 3KE1A 5EWRA 4O4IA 3JAKA 2ZVZA 4X20A 3F0DA 3RYCA 3ELCA 4X1YA 4BT4A 2VAMA 3CPWF 2FGYA 2HQSC 4BVQA 2DYYA 2FC3A 4X1KA 1GO0A 2LCAA 4O2BB 3WGKA 5ITZB 2OTLF 1VQ9F 4EI8A 5MN6A 3NK7A 1H47A 1JFFB 3ZP4A 2Z1FA 1VK3A 3RE3A 3D00A 4TV9B 2I6DA 5IYZB 1CK2A 3RYHA 2ZVYA 2LBWA 2RHHA 1VQMF 1Q86H 3O85A 1DT9A 3IEQA 4BVRA 3DC2A 3D01A 5LOVA 2H6LA 3ZP7A 1PF5A 3HKBA 4IIJB 3JALB 3LWQC 3CCRF 2MQEA 4ZI7B 3IR9A 3LWRC 4DRXA 3G4SF 4NUTA 3JVHA 3TD4A 3ZO8A 5DCVA 1H7MA 2ZOVA 1JN1A 2R6R1 3FPIA 4ZHQB 3RYIB 1Q8RA 2EWCA 3ESJA 1OAPA 3IKFA 3C9SA 2LBXA 3S0WA 1RLGA 3VYSC 5ITZA 2UZHA 1VHAA 4NWOB 3CCVF 2ZF8A 5BMVB 1W5BA 4TUYB 2HP0B 3GTZA 1CN7A 5HY2A 1QVGF 1VH8A 3HKDB 3IMPA 3AGKA 1H48A 4EI9A 3P4EA 3I7TA 3P0ZA 5HY4A 4O4HB 1VQ8F 5IYZA 3N2GA 3WPWA 3CPQA 1TVKA 4I4TA 4R40B 4X1IB 5JVDB 5CB4B 4PWTA 2K1SA 2VAWA 3TD5A 2JNBA 3DDNA 2W8BC 1NMUB 5MN4A 2R751 3JALA 2HRUA 4WBNB 3RA5A 4ZI7A 5CA1B 4B5CA 2PMPA 4C81A 4C8EA 4LNUB 1X7OA 4I50B 4ZHQA 1NQ3A 3KJKA 1COMA 3RYIA 3RA6A 2PHNA 5JH7B 1VQPF 3QHDA 1M90H 3K0TA 2G9IA 4O4LA 5BMVA 1TUBB 4M8IA 4TUYA 2RHJA 3Q8HA 4G4ZA 5MN5A 1W5EA 2ZODA 1YITF 2KG4A 5LYJB 4O4HA 4BVTA 5FNVA 4EB6A 4YJ3B 3T80A 5LA6B 3VOBA 1Z5VA 1ODEA 4KWEA 5JVDA 5CB4A 3CB2A 2AIZP 3IKEA 2AIFA 1GZ0A 3FD6A 1W57A 3J81M 2UYNB 1KQSF 4X3LA 3V7EA 1FFXA 4WBNA 5J2UA 5CA1A 3CXCF 2UYPA 2GVIA 3S0HA 1ONIA 3F0EA 4I50A 4C8IA 5C8YB 3EORA 2Z1EA 3JATA 3CYQA 5GONB 5JH7A 1KNJA 4IHJB 3JASB 3J80M 5EYPA 1DBFA 1W59A 2HS3A 1SA0B 1U43A 2QI2A 3BYQA 3E22A 3F0GA 3LWOC 1UI9A 1X7PA 4F6RB 1FNJA 1QD9A 3CYPB 1R1MA 4G88A 4U3JA 5HY0A 3VCZA 4YJ2A 2LBTA 1VQ4F 2OZBA 2P6YA 4O4JB 3MQWA 4C4WC 1GX1A 3N4YA 2RB9A 1T0KB 4TZZA 1CLIA 5KX5B 5EIBC 2HS4A 1QU9A 3LDTA 5LXTB 1NJIH 2UYNA 4U39A 4TV8B 5GIPC 3WXMB 3WGMA 1RLUA 1W40A 3WGLA 3CC7F 3I56F 3CD6F 3JARB 4ZHYB 3LWPC 1VQ6F 5C8YA 5GONA 5GAPK 3R0PA 3HKCB 3VI6A 4O2BA 3JASA 5HY1A 2NMUA 5IJ0B 1SA0A 1U3PA 2VGNA 3NVIB 2IG8A 1XV2A 1SZQA 3L7QA 4FFBB 4I55B 1JFFA 4ZOLB 2GLZA 1ZWZA 5GINC 3WGNA 3V4DA 1YHQF 5FJ4C 4TV9A 1S72F 1VQ7F 3E20B 3SIVA 2OTMA 5IT9M 1VQKF 1Z5WA 2CSLA 3F6MA 3QTYA 5JQGB 1FNKA 2CW4A 2QEXF 4EI7A 4IIJA 1IPAA 3KJJA 3VTIC 1QVFF 3C8LA 3E1YA 3CMEF 5EAZA 3K12A 3QUWA 3HWUA 5LP6B 1Q82H 2OTJF 5HP7A 1GO1A 2CWJA 3V7QA 2VGMA 3HKCA 2Q1XA 5JCOC 1T0AA 5B8FA 3HAXD 1RQ2A 2BTOA 2WALA 3IEWA 4BT7A 1XHOA 3CMAF 3SIUA 3MDOA 5G4VC 1UFYA 5IJ9B 2HP0A 2YYEA 3NMUC 4O4IB 3I55F 2H8CA 4X20B 4I55A 3RYCB 3CC4F 4X1YB 3HKDA 5LP6C 3CCJF 3NK6A 4ZHWA 1N8RH 1IV2A 1XRGA 5EO3A 4B46A 1W5AA 4X1KB 1OFUA 4X1IA 3CCSF 3CCLF 1W581 1XBIA 2KTUA 4O2AB 4LCKA 3N2KB 3TD3A 4G4VA 3CC2F 5JQGA 3LMEA 2VXYA 5G4UC 1J7HA 1YI2F 3J7AR 1FSZA 3OBWA 3CCUF 3CG6A 3P10A 3LFOA 2YXZA
chains in the Genus database with same CATH topology
3K14A 4C8IA 2AMTA 1U3PA 3EORA 3IEQA 1KNJA 3K2XA 3T80A 4C82A 2PMPA 3ERNA 1VH8A 1IV2A 4C8EA 4C81A 1KNKA 1IV1A 4C8GA 1IV4A 1H48A 3F0FA 3GHZA 3IKEA 1U43A 3P0ZA 1IV3A 1W57A 3QHDA 1U3LA 3F0GA 3MBMA 3B6NA 1YQNA 1JY8A 2GZLA 3JVHA 1T0AA 3KE1A 1H47A 5B8FA 3IEWA 1JN1A 3FPIA 3F0DA 1W55A 3ELCA 3ESJA 3RE3A 3Q8HA 3IKFA 3P10A 3F6MA 3FBAA 1GX1A 1VHAA 2UZHA 1U40A 3F0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K14 A;  4C8I A;  2AMT A;  1U3P A;  3EOR A;  3IEQ A;  1KNJ A;  3K2X A;  3T80 A;  4C82 A;  2PMP A;  3ERN A;  1VH8 A;  1IV2 A;  4C8E A;  4C81 A;  1KNK A;  1IV1 A;  4C8G A;  1IV4 A;  1H48 A;  3F0F A;  3GHZ A;  3IKE A;  1U43 A;  3P0Z A;  1IV3 A;  1W57 A;  3QHD A;  1U3L A;  3F0G A;  3MBM A;  3B6N A;  1YQN A;  1JY8 A;  2GZL A;  3JVH A;  1T0A A;  3KE1 A;  1H47 A;  5B8F A;  3IEW A;  1JN1 A;  3FPI A;  3F0D A;  1W55 A;  3ELC A;  3ESJ A;  3RE3 A;  3Q8H A;  3IKF A;  3P10 A;  3F6M A;  3FBA A;  1GX1 A;  1VHA A;  2UZH A;  1U40 A;  3F0E A; 
#chains in the Genus database with same CATH topology
 3K14 A;  4LNU A;  2BTU A;  2RHO A;  1E7K A;  2ZAU A;  1VQN F;  5EZY B;  2KGW A;  3RYH B;  4DXD A;  3UT5 B;  1JJ2 F;  1M1K H;  1RQ7 A;  1SDS A;  2CZW A;  1Q81 H;  1IV4 A;  1TUB A;  5J2T B;  1IV3 A;  5IJ9 A;  1K8A H;  5LOV B;  3OBY A;  3HKB B;  3JCM M;  2L26 A;  1VQL F;  1KC8 H;  1JD1 A;  2ALE A;  3C9R A;  1W55 A;  5LYJ A;  2Z1T A;  2V9Y A;  4DRX B;  4ZK7 A;  3CCM F;  1K9M H;  4YJ3 A;  5LA6 A;  2N48 A;  2CVL A;  2I6R A;  2HP3 A;  5EB1 B;  3VYU C;  3JAM M;  2AMT A;  3LYB A;  3S02 A;  4O2A A;  3D54 A;  3N2K A;  3HKE B;  3FFM A;  3ON1 A;  5EIB D;  1Q7Y H;  3OON A;  1IV1 A;  3KHN A;  5CA0 B;  3HTN A;  3U0O A;  1YJ9 F;  3B6N A;  2F9Z C;  1W41 A;  5AVM A;  4HNA B;  3HJW C;  4BT5 A;  5EZY A;  3JAW B;  3N2G B;  3MCA B;  3S06 A;  1TVK B;  3UT5 A;  4IHJ A;  4I4T B;  4BT6 A;  1U40 A;  3N4Z A;  5J2T A;  4E6E A;  3LWV C;  1VQV A;  3VO8 A;  4BT2 A;  4F6R A;  3ZOP A;  3WJR A;  1W3E X;  1X25 A;  4C8G A;  3PLA C;  2UYK A;  4O4J A;  3MBM A;  5KMG B;  3OW2 F;  3WJP A;  5HP8 A;  3RYF B;  5KX5 A;  1KD1 H;  3HKE A;  5LXT A;  5EB0 A;  1W2B F;  4B45 A;  4G4X A;  5A2Q M;  4O4L B;  3KIZ A;  4TV8 A;  5FLX M;  2HRY A;  3GYQ A;  3PAF A;  5CA0 A;  3K2X A;  3C9T A;  2B33 A;  1VQ5 F;  1W42 A;  3JAR A;  2H8E A;  1QAH A;  4HNA A;  4G4Y A;  4X3M A;  3MCQ A;  3GHZ A;  5FNV B;  4BT3 A;  4EB6 B;  3JAW A;  2HX0 A;  4ERH A;  1YQN A;  3M84 A;  1JY8 A;  2CHT A;  2GZL A;  2QTP A;  3M4S A;  3CCE F;  3WPX A;  3V3T A;  5IJ0 A;  3NVK E;  4G4W A;  2Q1Y A;  3WJQ A;  3FBA A;  1FFX B;  3JAK B;  5HXU A;  1YJN F;  5J2U B;  4FFB A;  4ZOL A;  1K73 H;  4RQO A;  4C82 A;  1X52 A;  3WGJ A;  2CHS A;  5KMG A;  2BTQ B;  1KNK A;  3JAT B;  4RHA A;  1W5F A;  3F0F A;  4BW0 B;  2Z1U A;  3RYF A;  1U3L A;  2OHW A;  2VAP A;  5HWE A;  3M1X A;  5EYP B;  5JCO A;  2IAF A;  2DT4 A;  2UYJ A;  5GAN K;  4NQ3 A;  3CCQ F;  2HS0 A;  3E22 B;  4ZHV A;  3G71 F;  3VOA A;  3VYT C;  3I3F A;  4U3J B;  3VIU A;  4B62 A;  3G6E F;  1VQO F;  1YIJ F;  4BY9 D;  4YJ2 B;  3VMF B;  5HXZ A;  2Z01 A;  5LP6 A;  3C9U A;  3S0Y A;  3FD5 A;  4XCQ A;  1PXW A;  2RHL A;  3ERN A;  2IQQ A;  2BO1 A;  2KTV A;  5GIO C;  1YJW F;  3S03 A;  1YGY A;  4BVS A;  2QA4 F;  2HVY D;  1RA4 A;  3KE1 A;  5EWR A;  4O4I A;  3JAK A;  2ZVZ A;  4X20 A;  3F0D A;  3RYC A;  3ELC A;  4X1Y A;  4BT4 A;  2VAM A;  3CPW F;  2FGY A;  2HQS C;  4BVQ A;  2DYY A;  2FC3 A;  4X1K A;  1GO0 A;  2LCA A;  4O2B B;  3WGK A;  5ITZ B;  2OTL F;  1VQ9 F;  4EI8 A;  5MN6 A;  3NK7 A;  1H47 A;  1JFF B;  3ZP4 A;  2Z1F A;  1VK3 A;  3RE3 A;  3D00 A;  4TV9 B;  2I6D A;  5IYZ B;  1CK2 A;  3RYH A;  2ZVY A;  2LBW A;  2RHH A;  1VQM F;  1Q86 H;  3O85 A;  1DT9 A;  3IEQ A;  4BVR A;  3DC2 A;  3D01 A;  5LOV A;  2H6L A;  3ZP7 A;  1PF5 A;  3HKB A;  4IIJ B;  3JAL B;  3LWQ C;  3CCR F;  2MQE A;  4ZI7 B;  3IR9 A;  3LWR C;  4DRX A;  3G4S F;  4NUT A;  3JVH A;  3TD4 A;  3ZO8 A;  5DCV A;  1H7M A;  2ZOV A;  1JN1 A;  2R6R 1;  3FPI A;  4ZHQ B;  3RYI B;  1Q8R A;  2EWC A;  3ESJ A;  1OAP A;  3IKF A;  3C9S A;  2LBX A;  3S0W A;  1RLG A;  3VYS C;  5ITZ A;  2UZH A;  1VHA A;  4NWO B;  3CCV F;  2ZF8 A;  5BMV B;  1W5B A;  4TUY B;  2HP0 B;  3GTZ A;  1CN7 A;  5HY2 A;  1QVG F;  1VH8 A;  3HKD B;  3IMP A;  3AGK A;  1H48 A;  4EI9 A;  3P4E A;  3I7T A;  3P0Z A;  5HY4 A;  4O4H B;  1VQ8 F;  5IYZ A;  3N2G A;  3WPW A;  3CPQ A;  1TVK A;  4I4T A;  4R40 B;  4X1I B;  5JVD B;  5CB4 B;  4PWT A;  2K1S A;  2VAW A;  3TD5 A;  2JNB A;  3DDN A;  2W8B C;  1NMU B;  5MN4 A;  2R75 1;  3JAL A;  2HRU A;  4WBN B;  3RA5 A;  4ZI7 A;  5CA1 B;  4B5C A;  2PMP A;  4C81 A;  4C8E A;  4LNU B;  1X7O A;  4I50 B;  4ZHQ A;  1NQ3 A;  3KJK A;  1COM A;  3RYI A;  3RA6 A;  2PHN A;  5JH7 B;  1VQP F;  3QHD A;  1M90 H;  3K0T A;  2G9I A;  4O4L A;  5BMV A;  1TUB B;  4M8I A;  4TUY A;  2RHJ A;  3Q8H A;  4G4Z A;  5MN5 A;  1W5E A;  2ZOD A;  1YIT F;  2KG4 A;  5LYJ B;  4O4H A;  4BVT A;  5FNV A;  4EB6 A;  4YJ3 B;  3T80 A;  5LA6 B;  3VOB A;  1Z5V A;  1ODE A;  4KWE A;  5JVD A;  5CB4 A;  3CB2 A;  2AIZ P;  3IKE A;  2AIF A;  1GZ0 A;  3FD6 A;  1W57 A;  3J81 M;  2UYN B;  1KQS F;  4X3L A;  3V7E A;  1FFX A;  4WBN A;  5J2U A;  5CA1 A;  3CXC F;  2UYP A;  2GVI A;  3S0H A;  1ONI A;  3F0E A;  4I50 A;  4C8I A;  5C8Y B;  3EOR A;  2Z1E A;  3JAT A;  3CYQ A;  5GON B;  5JH7 A;  1KNJ A;  4IHJ B;  3JAS B;  3J80 M;  5EYP A;  1DBF A;  1W59 A;  2HS3 A;  1SA0 B;  1U43 A;  2QI2 A;  3BYQ A;  3E22 A;  3F0G A;  3LWO C;  1UI9 A;  1X7P A;  4F6R B;  1FNJ A;  1QD9 A;  3CYP B;  1R1M A;  4G88 A;  4U3J A;  5HY0 A;  3VCZ A;  4YJ2 A;  2LBT A;  1VQ4 F;  2OZB A;  2P6Y A;  4O4J B;  3MQW A;  4C4W C;  1GX1 A;  3N4Y A;  2RB9 A;  1T0K B;  4TZZ A;  1CLI A;  5KX5 B;  5EIB C;  2HS4 A;  1QU9 A;  3LDT A;  5LXT B;  1NJI H;  2UYN A;  4U39 A;  4TV8 B;  5GIP C;  3WXM B;  3WGM A;  1RLU A;  1W40 A;  3WGL A;  3CC7 F;  3I56 F;  3CD6 F;  3JAR B;  4ZHY B;  3LWP C;  1VQ6 F;  5C8Y A;  5GON A;  5GAP K;  3R0P A;  3HKC B;  3VI6 A;  4O2B A;  3JAS A;  5HY1 A;  2NMU A;  5IJ0 B;  1SA0 A;  1U3P A;  2VGN A;  3NVI B;  2IG8 A;  1XV2 A;  1SZQ A;  3L7Q A;  4FFB B;  4I55 B;  1JFF A;  4ZOL B;  2GLZ A;  1ZWZ A;  5GIN C;  3WGN A;  3V4D A;  1YHQ F;  5FJ4 C;  4TV9 A;  1S72 F;  1VQ7 F;  3E20 B;  3SIV A;  2OTM A;  5IT9 M;  1VQK F;  1Z5W A;  2CSL A;  3F6M A;  3QTY A;  5JQG B;  1FNK A;  2CW4 A;  2QEX F;  4EI7 A;  4IIJ A;  1IPA A;  3KJJ A;  3VTI C;  1QVF F;  3C8L A;  3E1Y A;  3CME F;  5EAZ A;  3K12 A;  3QUW A;  3HWU A;  5LP6 B;  1Q82 H;  2OTJ F;  5HP7 A;  1GO1 A;  2CWJ A;  3V7Q A;  2VGM A;  3HKC A;  2Q1X A;  5JCO C;  1T0A A;  5B8F A;  3HAX D;  1RQ2 A;  2BTO A;  2WAL A;  3IEW A;  4BT7 A;  1XHO A;  3CMA F;  3SIU A;  3MDO A;  5G4V C;  1UFY A;  5IJ9 B;  2HP0 A;  2YYE A;  3NMU C;  4O4I B;  3I55 F;  2H8C A;  4X20 B;  4I55 A;  3RYC B;  3CC4 F;  4X1Y B;  3HKD A;  5LP6 C;  3CCJ F;  3NK6 A;  4ZHW A;  1N8R H;  1IV2 A;  1XRG A;  5EO3 A;  4B46 A;  1W5A A;  4X1K B;  1OFU A;  4X1I A;  3CCS F;  3CCL F;  1W58 1;  1XBI A;  2KTU A;  4O2A B;  4LCK A;  3N2K B;  3TD3 A;  4G4V A;  3CC2 F;  5JQG A;  3LME A;  2VXY A;  5G4U C;  1J7H A;  1YI2 F;  3J7A R;  1FSZ A;  3OBW A;  3CCU F;  3CG6 A;  3P10 A;  3LFO A;  2YXZ A; 
#chains in the Genus database with same CATH homology
 3K14 A;  4C8I A;  2AMT A;  1U3P A;  3EOR A;  3IEQ A;  1KNJ A;  3K2X A;  3T80 A;  4C82 A;  2PMP A;  3ERN A;  1VH8 A;  1IV2 A;  4C8E A;  4C81 A;  1KNK A;  1IV1 A;  4C8G A;  1IV4 A;  1H48 A;  3F0F A;  3GHZ A;  3IKE A;  1U43 A;  3P0Z A;  1IV3 A;  1W57 A;  3QHD A;  1U3L A;  3F0G A;  3MBM A;  3B6N A;  1YQN A;  1JY8 A;  2GZL A;  3JVH A;  1T0A A;  3KE1 A;  1H47 A;  5B8F A;  3IEW A;  1JN1 A;  3FPI A;  3F0D A;  1W55 A;  3ELC A;  3ESJ A;  3RE3 A;  3Q8H A;  3IKF A;  3P10 A;  3F6M A;  3FBA A;  1GX1 A;  1VHA A;  2UZH A;  1U40 A;  3F0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...